2EXAA

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with farom
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
452
structure length
443
Chain Sequence
YITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYARIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 141
structure length 443
sequence length 452
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2exaA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2exaA02
4OPZA 5EVID 3PTEA 2OSUA 4GOGA 3JYIA 3WS1A 1NZUA 1YLJA 1L0GA 2IWBA 1KDSA 5CERA 1K56A 4FSFA 4S2PA 3S1YA 4PMAA 1DJBA 2WGWA 3ITBA 3UE3A 4R0QA 4LV0A 3AGEA 4C3QA 4E6XA 5FI2A 4KQOA 2X71A 3O86A 4JKTA 3ISGA 4KG6A 3HLCA 1ES3A 1TDGA 4QY5A 3GQZA 2PBYA 1BTLA 1MPLA 2ZLYA 1ALQA 4DE2A 3C4PA 1MBLA 3BLMA 3CMZA 1BLSA 4B4ZA 4LCMA 3SOIA 1KGEA 2Y59A 1BT5A 3PBNA 3UPPA 2Y2LA 3ZHHA 2XF3A 2ZQDA 4JBFA 1PWGA 3NIAA 1O7EA 2XH9A 5FSRA 3W8KA 1CEGA 5EPHA 3DWKA 4GKUA 2Z2LB 4KZAA 1SDEA 2XD5A 3LY4A 3OZHA 2H0TA 4MLLA 4IVIA 1K57A 1XKZA 5HFOA 3A3EA 4B4XA 1W8QA 4P87A 2XDMA 4N92A 4OOLA 4ZJ1A 4CPKA 3IF6A 4KZ7A 3FZCA 4UAAA 3VP3A 4B88A 3NI9A 3V50A 2C5WB 3BFGA 3G4PA 4BL2A 3BLSA 2VGJA 2WGIA 3S22A 2RCXA 1L0DA 4YFMA 3W4QA 3EQUA 4PM6A 3O3VA 3ZFZA 2ZC5B 4NETA 4OQGA 3W4OA 1TEMA 3MZDA 5AQ9A 4OOMA 1S0WA 2P9VB 5F82A 4WBGA 4RX2A 4JXGA 4E3JA 2V1ZA 3PAGA 2ZD8A 4JF6A 4ZBEA 4KZ8A 5FQQA 3FKWA 1L2SA 2H10A 2DNSA 5AQAA 1NJ4A 5FAPA 3MZEA 2QMIA 3G2YA 5EE8A 5GHYA 1MXOA 4LENA 1EI5A 1ZKJA 1WE4A 4WMCD 5JYOA 4JF5A 2B5RA 4RX3A 2XD1A 4DXBA 1DJCA 3FWLA 5DVAA 4ZJ2A 4DXCA 1RCJA 3FV7A 5CECA 3FKVA 4A5RA 3BFEA 5DF7A 4S2NA 5CGWA 3P09A 2V2FF 3A3JA 5FDHA 4GNUA 4FD8A 3OCLA 2IWDA 2JCHA 4KG2A 4LV3A 2XFTA 2G2UA 4P0MA 4XUXA 4QY6A 3N8RA 1SHVA 1HTZA 3GR2A 1N4OA 4WELA 5FQKA 3M2JA 2R9XA 3PBRA 1E25A 3SH9A 1I2SA 1CK3A 1LI9A 2PU2A 1K55A 2FFFB 3G31A 4OONA 3SS3A 1K38A 4WYYA 3HBRA 3MKEA 1U60A 1Z6FA 1ERMA 4MBKA 1KVLA 3BFCA 1MKIA 1IYOA 4ID4A 2PU4A 4FCFA 4DDYA 4FH2A 1KE3A 2HDRA 2ZM0A 3A3DA 4HBUA 1XPBA 3BM6A 4JXWA 1GHMA 3MKFA 2EX9A 1K6RA 1LL5A 5AQ7A 1GHIA 1W7FA 4E3MA 1QMEA 3C4OA 1BULA 4ZDXA 4WZ5A 3Q7VB 4Q8IA 1W8YA 5A92A 4MBHA 2EX8A 3IWQA 3VOZA 5KZHA 4N9KA 3HLEA 4S2MA 4BENA 3VP0A 4KZ3A 2OLUA 4LV1A 3IHAA 1PWCA 3MFDA 2I72A 5CRFA 3OCNA 1NYMA 4MEZA 4KENB 4HEFA 1FR6A 4S2OA 3C7VA 5A91A 3BRMA 4L0LA 5KSHA 1YT4A 3HLBA 3TSGA 1KE0A 3HUNA 5EVIA 3NDGA 1YMXA 2XQZA 5AQBA 5FQJA 3TG9A 1BLPA 3ZCZA 1KE4A 2DCFA 3MZFA 1FCNA 4EV4A 3TOIA 2QPNA 1K57C 3ZG5A 5G18A 5DTSA 1BUEA 1HZOA 3G32A 3G34A 4JLFA 1ZC2A 3Q81A 3ZGAB 4CJNA 3OPRA 3ITAA 3IF5A 1IYSA 3IF6C 4UA7A 4OP8A 2P9VA 5GLAA 3D4FA 5CTNA 1Y54A 2ZM8A 4R1GA 5DTKA 4QU3A 1ONGA 1YQSA 3UPNA 3HVFA 3HLDA 5FATA 3UO9A 3NBLA 3UNWA 4Y0OA 2ZC6B 2R9WA 1ES5A 2CC1A 2H0YA 2WKIA 4FH4A 2X01A 3MXSA 5M1AA 1W79A 1PYYA 2Y2PA 3E2KA 3VMAA 3O88A 1E3UD 3C5AA 3UE1A 3HUOA 1XX2A 1FCMA 3IWIA 3LEZA 3S4XA 1MWRA 3EQVA 3IXHA 3UDXA 2Y2KA 2Y2IA 4S2LA 4DF6A 3OPPA 5HX9A 1GHPA 3ZVTA 2OV5A 3VP2A 4D2OA 4S2IA 2EX6A 4E3NA 3QNCA 4KZ4A 1PI4A 1TVFA 1FOFA 4GDNA 3WWXA 3ZDJA 3NDEA 3AGDA 3G35A 3NC8A 2XLNA 4S2NC 4R4SA 1E4DA 1HVBA 3N6IA 4N1XA 1KVMA 1C3BA 1I5QA 1JVJA 2EXBA 1M6KA 2OLVA 3IXDA 4GB7A 4BD1A 5KMWA 2HP9A 3GTCA 3UPOA 4DRTA 4HESA 2WGWB 1FCOA 4OH0A 1CEFA 1YM1A 5CGSA 4E3OA 5A93A 3BFDA 4DE3A 5E2HA 4EBNA 2BLSA 1IKGA 4KG5A 3Q7VA 1JTDA 1ESUA 1H8YA 1K55C 5GL9A 1NRFA 1IEMA 4HBTA 4WMCA 4R3JA 4N9LA 2WK0A 1JTGA 1PW8A 1SCWA 2Y2MA 5KSCA 3UY6A 2Y2HA 4OLGA 4P6BA 5E2GA 5IHVA 5F1FA 2EX2A 4QJGA 5EOEA 1Q2QA 2X02A 3IWOA 2WGVA 4WM9A 4S2JA 4ZAMA 5FQIA 1EROA 4C6YA 3MBZA 1XA7A 2HDUA 2JE5A 3Q7ZA 2Y2QA 4OP5A 4Y0UA 3G2ZA 2HP6A 4O7DA 1GA9A 1ZG6A 3BEBA 2Q9MA 1JWVA 3CG5A 4WZ5C 1K4EA 4OPQA 3M2KA 3SH7A 5GLDA 1K25A 2WKHA 3ZG9B 1BSGA 3A3FA 5EVLA 1MY8A 1PZPA 5CHMA 3N8SA 2DRWA 3SH8A 4EBPA 2HDQA 4N1HA 4Y7PA 3ZG0A 3VSKA 1GCEA 3CZDA 3GRJA 4OLDA 3DWZA 3M6HA 2Y2OA 2ZC3B 2RL3A 4XUZA 1FSWA 4GN2A 3IF6B 3HLWA 5GLCA 1TDLA 3SS5A 3BECA 2HPBA 4BJPA 3GSGA 4GD6A 5HAPA 5FAOA 3C7UA 1SKFA 2IWCA 2Y91A 2ZC7A 5EVIC 4GZBA 3PBSA 2Y55A 1K54A 4X53A 4EWFA 4QD4A 5CXWA 3HLGA 3RJUA 5CGXA 1RP5A 4GD8A 1ES4A 3OPLA 1KGFA 2WYXA 3CJMA 4E3LA 3E2LA 3GMWA 1FR1A 2ZM2A 3FYZA 3G30A 1JWZA 4ZTKA 5J8XA 3UN7A 1DY6A 2HDSA 3GV9A 1PZOA 4PM7A 3Q1FA 3PBQA 4P85A 1NZOA 2WUQA 4C75A 3QHYA 1FQGA 1ONHA 2V20A 2ZQ7A 5DF9A 5FA7A 3GVBA 3HREA 5E43A 5DTTA 3N7WA 1ESIA 5EOOA 5TFQA 4OVDA 1L0FA 3OPHA 2EFXA 4WEJA 2ZC4B 1N9BA 1H8ZA 1WYCA 2ZJ9A 3VFFA 1XA1A 1CI8A 5FAQA 4LV2A 1LL9A 4R3BA 1NYYA 1O07A 4EQIA 2EFUA 3VOYA 3M6BA 1MWTA 2WZXA 3V5MA 1EWZA 3O87A 4X55A 4DE0A 3VSLA 2J9PA 1RGYA 2FFYA 4JPMA 4E3IA 1YLTA 1K56D 2ZQCA 3Q82A 3IH9A 3VP4A 4M3KA 1M40A 1XGIA 3MXRA 1NY0A 1MWUA 2P74A 5F1GA 5HAIA 2J9OA 1PI5A 4OPRA 2Y2NA 3QNBA 2G2WA 4U3TA 4EUZA 1IKIA 4QB8A 3VFHA 4NK3A 1PIOA 1PWDA 4OQ0A 2WKEA 4OKPA 1E3UA 3PAEA 4OOYA 1YLPA 4MBFA 3WRZA 5D3OA 1MWSA 1G6AA 3Q07A 3UDFA 4X56A 3VP1A 1IYPA 1BLHA 5GLBA 2ZQAA 4OPYA 1VQQA 5FQ9A 5DF8A 3IXBA 3AGFA 4KZ5A 5HARA 2H5SA 4BD0A 3OC2A 1KGGA 2WAEA 4ZJ3A 3W4PA 4WEKA 2WADA 1XP4A 4KZ6A 2Y2JA 4PPRA 4IBRA 4U0XA 5EVIB 4KQRA 4RVAA 3ZNYA 1J9MA 5BOHA 5A90A 5CHJA 4PM9A 5GHZA 2E8IA 3WS4A 4EBLA 1VM1A 4K91A 3N4IA 4JXVA 1HD8A 1I2WA 2BG1A 4R23A 3UDIA 3B3XA 4X6TA 4OQHA 4YINA 5FQMA 4S2KA 1S6RA 3WS5A 1K6SA 2J8YA 3PBOA 3WRTA 1LHYA 3V3RA 1XXMA 4DDSA 4JF4A 4F94A 5M18A 4GDBA 2Z2MB 5TGFA 1IYQA 1PW1A 5E2EA 2XGNA 3N8LA 3HLFA 1SDNA 1BLCA 1K54C 2UWXA 2WZZA 4Y0TA 1K4FA 1Q2PA 1IELA 2EXAA 5EUAA 1YMSA 1RGZA 2HP5A 2J7VA 3BFFA 3IT9A 3RXXA 4JXSA 4UA6A 2Y4AA 4BLMA 5L2FA 3RXWA 1YLWA 1KDWA 5TR7A 5I94A 3DTMA 2JBFA 5CHUA 2WAFA 1ES2A 1ZG4A 1LLBA 3IH8A 5EECA 1JWPA 4BQMA 4MNRA 2A3UA 2C6WB 5GHXA 2ZQ8A 2JC7A 3HL9A 2A49A 1QMFA 2ZMAA 4OQIA 3IHBA 4PM8A 2XK1A 4RA7A 5FI7A 4KQQA 1BZAA 4QHCA 2XFSA 3I7JA 4KZ9A 3PBTA 3ZG8B 4E6WA 5HAQA 1DJAA 1GA0A 3DW0A 3SS4A 2XEPA 3WS2A 4PM5A 5CEDA 1LI0A 3WS0A 3IQAA 3LY3A 4DE1A 1NXYA 3ZNTA 3P98A 4DKIA 1G68A 4LCLA 4U0TA 5F83A 1AXBA 4XXRA 2GDNA 5HL1A 2VGKA 4BL3A 3V39A 2QZ6A 4K0WA 5FASA 4Z9QA 4RYEA 4UHUA 3NY4A 4IBXA 5JYPA 4IVKA 5U47A 4WZ4A 2Q9NA 4K0XA 3LCEA 4H8RA 3BYDA 3NCKA 5E2FA 4IEDA 3ZG7B 4R4RA 3IXGA 1WYBA 3HUMA 1YLYA 4KZBA 5FI6A 3ZVWA 4X68A 5CTMA 4X69A 5M19A 3A3IA 5HW3A 1XGJA 1L0EA 1W5DA 3V3SA 1OMEA 1ERQA 4UA9A 1H5XA 1CI9A 1FSYA 4E3KA 5CEBA 2ZQ9A 1YLZA 3LO7A 2Y2GA 2XR0A 3UE0A
chains in the Genus database with same CATH superfamily
2OSUA 4RRRA 3WS1A 2BASA 3KSGA 4S2PA 3C38A 1HLUP 4E6XA 2X71A 4JKTA 2XSSA 4MMNA 5FL3A 1SKOA 1IFQA 4EEPA 3FPWA 1BTLA 3P7NA 1MBLA 1BLSA 4LCMA 2Y59A 2Y2LA 4JBFA 3EOIA 3NIAA 3MQQA 2XH9A 2M7VA 4NBIA 5DJUA 2Z2LB 2KDKA 1OT9A 2OWJA 1W8QA 4B93A 2HZ5A 4CPKA 3IF6A 1S1YA 2HL1A 3A0VA 5FDSA 3V50A 4PM6A 4EESA 3OOVA 4GS9A 5F82A 4HI4A 4E3JA 4F3LA 1W63M 5FAPA 3MZEA 1TD5A 5GHYA 4LENA 4WMCD 1WE4A 4NXEA 4DXBA 5DVAA 1RCJA 2CMNA 3CUEA 5CECA 3FKVA 4S2NA 5CGWA 3P09A 4GW9A 5FDHA 4GNUA 5EV0A 2KLIA 1P97A 4RR7A 1CJFA 4II7A 4HQAA 4QY6A 3N8RA 4NXBA 3PBRA 1LI9A 1SZVA 4RRFA 1K38A 3MKEA 1ERMA 4Y2FA 1IYOA 4ID4A 2PU4A 4FH2A 2ZM0A 4HBUA 1GHMA 3ULFA 4DJ2A 1YSPA 2EX9A 4HJ3A 1W7FA 3C4OA 1BULA 4ZDXA 4S0LA 1H3QA 3HJKA 3Q7VB 4RR6A 5A92A 3EEAA 1TS6A 3KO3A 4N9KA 4HHDA 4S2MA 3S7NA 4LV1A 4IUKA 2Y79A 3LFVA 4S2OA 3BRMA 3FPVA 3LIFA 1YSQA 2KX6A 4FOFA 3OBFA 1F98A 1YT4A 4M4XA 3PXPA 5EVIA 1XJ3A 2XQZA 2PYRA 4HNBA 1KE4A 3E4QA 2QPNA 1K57C 5DTSA 1HZOA 3G32A 3G34A 1X0OA 2A24B 3ZGAB 3OPRA 2QKPA 3FC7A 3IF5A 2L0WA 4OP8A 5CTNA 3E98A 2ZM8A 5DTKA 4I3JA 3UPNA 4R70A 4CLCE 5J7EA 3HLDA 5FATA 2ZC6B 2JKFA 4H6JA 2WKIA 3C30A 4FH4A 4RR8A 3BW6A 3O88A 1E3UD 3C5AA 1FCMA 3IXHA 2Y2IA 3LR5A 5HX9A 4K08A 2OV5A 4IHQA 3VP2A 3QNCA 4KZ4A 4ETXA 4L9EA 4GDNA 3AGDA 5LBRA 4R4SA 3JVVA 3N6IA 2PR5A 1C3BA 1I5QA 5L10A 4S0JA 2OLVA 3LEQA 2QWSA 3IXDA 1VEUB 3GTCA 5HWTA 4OH0A 4UQIS 2HV1A 4ETZA 1J7GA 1H8YA 5GL9A 4R3JA 3UY6A 5E2GA 5F1FA 2EX2A 2X02A 4WM9A 4ZAMA 3MBZA 3LMVA 2VV8A 3Q7ZA 4OP5A 3MFXA 3G2ZA 2HP6A 3UB8A 1JWVA 4OPQA 1UWPX 2VGLS 3M2KA 3IS2B 3A3FA 3SH8A 4EBPA 2W3DA 3KSHA 1VETA 3M6HA 2ZC3B 3HLWA 1TDLA 3GSGA 4ARZB 2Y55A 3VOLA 1OPXA 4HH2A 4ZTKA 5J8XA 3DTKA 3Q1FA 2ZQ7A 3B33A 5FA7A 5E43A 3N7WA 3K3CA 3LR3A 1N9BA 3KO7A 1XA1A 4B9OA 1CI8A 1LL9A 3M6BA 2PYPA 1EWZA 4DE0A 4RRGA 2FFYA 4E3IA 2ZMVA 2ZQCA 1G6OA 1XGIA 1NY0A 2PD7A 2P74A 5HAIA 2J9OA 4G3WA 4IJGA 4U3TA 4EUZA 1PIOA 2PBDP 4OQ0A 5MC7A 4OOYA 1YLPA 5HD3A 3WRZA 1MWSA 2J3WA 5FEFA 3QP2A 3LYXA 3VP1A 1IYPA 2PR6A 2HF6A 4GHIA 5FQ9A 2O9CA 3F1NB 1KGGA 1VHMA 2VGLM 4WEKA 2WADA 4PPRA 4IBRA 3ZNYA 1J9MA 5BOHA 5A90A 3CHWP 2BG1A 3UDIA 4WL9A 4S2KA 1K6SA 4Y17A 2J8YA 4F94A 4GDBA 1H8MA 2Z2MB 2VEAA 4Q0IA 2EXAA 2J7VA 5TBMA 1F2KA 4YOFA 2Y4AA 4BLMA 1YLWA 3A0RA 5TR7A 5J3WA 5DKKA 4RRJA 5CHUA 4EW7A 1LLBA 1JWPA 4MNRA 4PAUA 2ZQ8A 2O99A 3MSHA 4RA7A 5FI7A 4KQQA 1BZAA 4E6WA 5HAQA 2QJ7A 1GA0A 3WS2A 1LI0A 3LY3A 1NXYA 1G68A 4XXRA 1S4RA 4Z9QA 4RR9A 1XFQA 4RYEA 3NULA 5U47A 3KSIA 3LCEA 3NCKA 4R4RA 5CTMA 3T12B 3S7QA 1W5DA 3CLOA 4UEYA 2O0YA 5DFYA 5DTTA 2Y2GA 2XR0A 2ZBBA 4GOGA 1YLJA 1KDSA 5CERA 3LIBA 4FSFA 2WGWA 3ITBA 3AGEA 3O86A 3ISGA 3H7WB 4QY5A 3CMZA 4XT2B 3UPPA 3T4QA 2ZQDA 2HKZA 5FSRA 2OAQ1 4MLLA 4IVIA 2W3EA 3ZQ5A 3K2NA 2B95A 3A3EA 4B4XA 2XDMA 4N92A 3LMTA 3NHQA 3DAVA 3PHYA 4UAAA 3BQ8A 2W0NA 4B88A 2C5WB 3BY9A 4BL2A 3BLSA 2VGJA 4RRIA 2WGIA 3S22A 2UV0E 4NETA 2J3TD 4OOMA 5J61A 2P9VB 3CPTB 4JXGA 4NBJA 3PAGA 3UMEA 4KZ8A 2BTFP 1L2SA 5AQAA 2GZAA 3VV4A 5EE8A 3HCYA 1MXOA 4I38A 2HL2A 1ZKJA 4RX3A 2XD1A 1DJCA 3FWLA 4DXCA 3KYZA 4A5RA 1OTBA 2W3HA 2INWA 4QPRA 2V9AA 2Z6DA 5F68A 4P0MA 1ODVA 1SHVA 3GR2A 4WELA 1P0ZA 1CK3A 1K55A 3G31A 3SS3A 1T18A 3UE6A 1S4SA 3HBRA 4Q0HA 1U60A 1Z6FA 3BFCA 4DDYA 1KE3A 3A3DA 2ZOHA 4JXWA 2PRFA 1LL5A 1GHIA 1QMEA 1D06A 3UMDA 1H0MA 3VOZA 3HLEA 3VP0A 2W1TB 2OLUA 1PWCA 2I72A 3LR4A 3MR0A 4YWZA 2JKRM 4WLAA 3HLBA 3TSGA 3BQAA 5AQBA 3T4JA 3T4LA 3IX8A 3TG9A 2DCFA 3TOIA 3FG8A 4E04A 4HJ6A 4WN5A 3Q81A 3IF6C 3D4FA 1Y54A 2AVXA 4R1GA 4RRHA 2VX8A 1ONGA 4QU3A 1T19A 1GSXA 1YQSA 1FILA 3UO9A 2H0YA 5M1AA 2Y2PA 3T4SA 3VMAA 4HIAA 4JGQA 3HUOA 3KO9A 3IWIA 4RQ9A 2Y2KA 2HJEA 1GHPA 3T1RA 3EGDC 2EX6A 4S2IA 1PI4A 1G28A 4GJ4A 3CUEC 3NDEA 4I5SA 4S2NC 3T50A 1F5MA 4N1XA 3C2WA 4GB7A 4D60A 4BBUA 3E4PA 2HP9A 2WKRA 4JGRA 4HESA 1CF0A 5CGSA 5L09A 3Q7VA 1JTDA 4WMCA 3GDIA 4N9LA 2VZWA 1SKOB 2Y2MA 5KSCA 1T1BA 2GNXA 4OLGA 2E8JA 4P6BA 1Q2QA 2EWVA 2WGVA 5FQIA 1EROA 4C6YA 2XRNA 3LMUA 4WUJA 2Q9MA 3CG5A 3LICA 1K25A 3NJAA 3ZG9B 4KQDA 5EVLA 1PZPA 2VLGA 1TS0A 3VSKA 1GCEA 3CZDA 5KIZA 2LB5A 2Y2OA 3KNFA 1FSWA 4GN2A 3IF6B 2A24A 3SS5A 2ZC7A 4ME4A 4GCZA 5EVIC 1K54A 1T1AA 3RJUA 5CGXA 4HP4A 2WYXA 1JNUA 3E2LA 1JWZA 1DY6A 1OT6A 2V8FA 3CWFA 4F3LB 1ACFA 1MC0A 4C75A 4O01A 1FQGA 3HREA 3DTIA 5IT5A 4GLQA 2M1CA 3KOBA 3UB6A 1ESIA 2PDRA 2OKVA 1L0FA 5HD5A 2ZJ9A 1H8ZA 4EERA 1STZA 3V5MA 4X55A 1RGYA 1K56D 3IH9A 4MDZA 1NLZA 1BYWA 4M3KA 1VEUA 3MXRA 1J3WA 3HJIA 1LSXA 1TC5A 2Y2NA 2G2WA 4NK3A 2QJ5A 1E3UA 3PAEA 2G7UA 5D3OA 2IA2A 3MJQA 2VK3A 5HDCA 1BLHA 4CLCD 2ZQAA 4CLCA 2VKSA 3OC2A 2WAEA 2XROA 4X25A 5EVIB 2DBOA 4S0KA 3C8CA 4L9GA 4EBLA 3WS4A 4K91A 4R23A 5F6AA 4OQHA 1S6RA 2XA7S 3WS5A 2ZOIA 3WRTA 1LHYA 1XXMA 2GX5A 5TGFA 3RFBA 4L9FA 2XGNA 3HLFA 1OJGA 3W2ZA 1LSVA 2UWXA 1K4FA 1IELA 2DMWA 4H6JB 3RXXA 1YMSA 3DTMA 3QP8A 2JBFA 2H28A 5EECA 3RH8B 4G3VA 5GHXA 2JC7A 4PKYA 2ZMAA 4OQIA 3IHBA 3B42A 3ZG8B 3PBTA 4G3KA 4QWOA 3DW0A 3SS4A 3IQAA 3P98A 5HL1A 2VGKA 4K0WA 4NKPA 4IBXA 3KO5A 1Z09A 4WZ4A 5E2FA 3IXGA 2VV6A 4X68A 1AWIA 1FSYA 1A0KA 3R7WA 2ZQ9A 4JGOA 5EM0A 3F1NA 1DP9A 3LO7A 4OPZA 1OTDA 1L0GA 1NWZA 2JKRI 5J4EA 2K31A 4C3QA 5FI2A 4KQOA 4KG6A 3HLCA 3TRCA 3GQZA 2PBYA 4UQIM 3KX0X 1ALQA 4LRXC 3C4PA 4WF0A 4B4ZA 4Y15A 1KOUA 2XA7M 3BY8A 1O7EA 1CEGA 5EPHA 3DWKA 3OZHA 2H0TA 4EXOA 5HFOA 4P87A 3PD5A 4OOLA 1N9NA 3FZCA 1W63Q 2M7UA 3NI9A 3BFGA 3LUQA 1L0DA 4YFMA 3EQUA 1V9ZA 2ZC5B 4OQGA 1TEMA 3MZDA 5AQ9A 4WBGA 2V1ZA 2ZD8A 4JF6A 4AFIA 5FQQA 2DNSA 2QMIA 3BJNA 2B5RA 4ZJ2A 5AVEA 2B18A 3FV7A 3BFEA 1PRQA 2V2FF 4FD8A 1G5UA 2IWDA 4LV3A 4XUXA 3M2JA 4PKYG 3SH9A 1I2SA 4GHIB 2Z6CA 4OONA 4WYYA 4MBKA 1KVLA 1MKIA 4FCFA 1XPBA 3BM6A 3F1PB 5AQ7A 1K6RA 4E3MA 3T4TA 3QP6A 4WZ5A 1MZUA 3TE8A 2L4RA 1W8YA 3IWQA 5KZHA 2OAP1 1LT0A 5EVEA 2VA0A 5CRFA 3OCNA 1NYMA 4KENB 2OWHA 4HEFA 1JKEA 1FR6A 3H82A 3C7VA 5A91A 4L0LA 3MMHA 2YKHA 2L1MA 3TW8A 1Y4OA 3NDGA 1YMXA 5FQJA 1BLPA 3ZCZA 1YKDA 3MZFA 4EV4A 3ZG5A 1S67L 1BUEA 1FIKA 4JLFA 1ZC2A 2V1BA 5HSQA 2P9VA 5F69A 3R4KA 5DKLA 3HVFA 1S1ZA 1ES5A 2X01A 1PYYA 3E2KA 2D01A 3UE1A 1MWRA 3EQVA 3UDXA 4DF6A 3OPPA 4E3NA 3SZTA 4EQ1A 1L3LA 1TVFA 2K2NA 3LIAA 3NOPC 5DJTA 2MJ6A 1E4DA 1HVBA 4R38A 1KVMA 3KOCA 3KO6A 4LPZA 4RRBA 3UPOA 4DRTA 1FCOA 2WGWB 1YM1A 4E3OA 5A93A 3BFDA 4DE3A 5E2HA 4EBNA 2BLSA 1ESUA 1K55C 1NRFA 1V9YA 4HBTA 3F1OB 1JTGA 1Y28A 2Y2HA 4CQHA 4QJGA 5EOEA 3V67A 1NRJA 1XA7A 2HDUA 2JE5A 4O7DA 1GA9A 3BEBA 5A8BA 2PD8A 1K4EA 1P9RA 1ZHHB 5GLDA 2WKHA 1BSGA 4Y5FA 5CHMA 3MQ0A 2DRWA 3N8SA 4EETB 3JPUA 4N1HA 3GRJA 4OLDA 3GECA 2HL0A 3BECA 3C7UA 4GZBA 3PBSA 4X53A 4EWFA 3HLGA 1RP5A 4GD8A 3OPLA 1KGFA 3CJMA 2K7SA 1FR1A 2ZM2A 3FYZA 3UN7A 3GV9A 1DRMA 2HDSA 4PM7A 1NLYA 3D72A 4P85A 1NZOA 2WUQA 1F9IA 3QHYA 1ONHA 3T4KA 4HH3A 1ZTUA 3GVBA 3D9YA 1OTEA 4OVDA 3OPHA 1PNEA 1WYCA 5FAQA 4LV2A 4R3BA 2V0WA 1NYYA 4ZRRA 4EQIA 1MWTA 3O87A 3VSLA 2J9PA 1YLTA 1OTAA 3PD3A 3MQOA 1M40A 2R78A 3QNBA 3DTEA 4QB8A 2OOLA 3IBJA 1DP6A 2WKEA 4OKPA 2ZL1B 4MBFA 3PD2A 3Q07A 4DN0A 2QHKA 2PT7A 1VQQA 3IXBA 3G6OA 4KZ5A 2H5SA 4BD0A 2Y8HA 4RRCA 4I3AA 3L7HA 4KZ6A 5HPFA 4U0XA 4KQRA 2FZ0A 3NECA 4RVAA 3PYPA 5CHJA 5GHZA 3P01A 1HD8A 1I2WA 4X1MA 2W3GA 4HOIA 4X6TA 5FQMA 3EGXC 3PBOA 4DDSA 5M18A 2VJWA 3IBRA 4Y13A 5E2EA 3N8LA 1K54C 2WZZA 4Y0TA 4LRZE 2HP5A 3BFFA 3IT9A 5HZHA 4JXSA 4UA6A 5L2FA 1KDWA 5TJJA 5I94A 2WKPA 3LIEA 2YKFA 2WAFA 3KSFA 1ZG4A 3CITA 3IH8A 4MN7A 3QP1A 4YNRA 4BQMA 2A3UA 4KUKA 2JKTI 4FUWA 3IX4A 5HDDA 3MXQA 4QHCA 2XFSA 4KZ9A 1DJAA 5CEDA 4PM5A 4DE1A 3T4OA 4DKIA 4GS9B 4U0TA 1TS8A 3B47A 4P6ZS 2GDNA 3V39A 2QZ6A 3PR6A 3QP5A 4K0XA 4RRMA 3BYDA 1WYBA 1YLYA 2HJ9C 1L0EA 3V3SA 1ERQA 1H5XA 1CI9A 4RRDA 2V8CA 4RRQA 3VFHA 5EVID 3PTEA 3JYIA 1NZUA 2IWBA 5IU1A 1K56A 3S1YA 4PMAA 1DJBA 4DJ3A 3UE3A 4R0QA 1K0KA 4LV0A 4X1LA 5AJGA 2JKGA 4CLCC 5I5LA 4Q0JA 3ZYTA 4S02A 1TF1A 1ES3A 1TDGA 1MPLA 3UB7A 2ZLYA 4DE2A 3BLMA 1N9LA 4PHTA 3SOIA 1KGEA 2QYBA 1BT5A 3PBNA 3ZHHA 2XF3A 1PWGA 1S66L 3W8KA 3E4OA 4GKUA 4KZAA 1SDEA 2XD5A 3IS2A 3LY4A 4NG2A 1K57A 1XKZA 3K3DA 4HY8A 3IX3A 3L9KA 4NXFA 4ZJ1A 4KZ7A 4BBVA 2EA9A 3UB5P 4ARZA 1XFNA 4MN5A 3VP3A 1PFLA 3G4PA 4LGWA 2P04A 2RCXA 3W4QA 3O3VA 3ZFZA 3W4OA 3T1XA 1S0WA 4RX2A 5IS1A 4ZBEA 3KODA 3FKWA 1YAXA 3BWLA 2H10A 1NJ4A 2HGVA 3G2YA 5F5YA 4P6ZM 1EI5A 5JYOA 4MCWA 4JF5A 3A0SA 3T1QB 2W27A 3T1SA 5DF7A 3A3JA 3KO4A 4EEUA 3OCLA 5G4ZA 2JCHA 4KG2A 2XFTA 2G2UA 5L07A 1HTZA 1N4OA 2W3FA 5FQKA 2R9XA 4S03A 1E25A 4BBTA 5HWWA 2PU2A 4CLCB 1IOUA 2FFFB 4I3IA 4NEED 1D7EA 3ICYA 2HDRA 3MKFA 4Q8IA 4MBHA 2EX8A 1XJ4A 4BENA 4KZ3A 3DBAA 3IHAA 2P08A 3MFDA 2Q0OA 5DFXA 4MEZA 2JN7A 5KSHA 2JHEA 2NUTC 1KE0A 1OJ5A 3HUNA 5C5KA 1FCNA 2B02A 5AVFA 1XJ2A 1VETB 5G18A 4ESPA 4CJNA 3ITAA 1IYSA 5GLAA 4UA7A 2W1RA 4I39A 1D1JA 3E0YA 2FH5A 3U2AA 3NBLA 1T1CA 4Y0OA 3UNWA 4Z1WA 2R9WA 2CC1A 3MXSA 1W79A 4S0IA 3MS6A 3D3OA 4EU0A 1XX2A 3KYQA 3LEZA 3S4XA 4S2LA 2O9AA 3ZVTA 4D2OA 5HDSA 1FOFA 5HL6A 3WWXA 3ZDJA 3NC8A 3G35A 2XLNA 3R7WB 3MF0A 2V0UA 3CAXA 1JVJA 2EXBA 1M6KA 5G4YA 4BD1A 5KMWA 3F1PA 1CEFA 1IKGA 4KG5A 1IEMA 4O0PA 2WK0A 1PW8A 1SCWA 2JKTM 5IHVA 4RRKA 2VV7A 3IWOA 3VE4A 3OLOA 4S2JA 3S7PA 2Y2QA 4Y0UA 3NOUC 1ZG6A 4WZ5C 3PD4A 3SH7A 5K5BA 4RRLA 1MY8A 2HDQA 4Y7PA 3ZG0A 5L8MA 2EWWA 3DWZA 4XUZA 2RL3A 5GLCA 5HAPA 4BJPA 2HPBA 4GD6A 3H7WA 5FAOA 4FTXA 1N9OA 4NXGA 1SKFA 2IWCA 2Y91A 5FEGA 4QD4A 4XT2A 5CXWA 2V1AA 1ES4A 4E3LA 3GMWA 3G30A 5EFWA 1PZOA 2I9VA 3PBQA 5HWVA 3EWKA 2V20A 5DF9A 3EEHA 3LIDA 4BMWA 5TBMB 1Y2QA 4HJ4A 3TJZC 1GSVA 5EOOA 1P9WA 4IUHA 5TFQA 1UWNX 2EFXA 4WEJA 2ZC4B 3VFFA 2PAVP 1O07A 4LFUA 3VE3A 2EFUA 2WKQA 3VOYA 2WZXA 1MKMA 3CPTA 3CI6A 1VB6A 4JPMA 3Q82A 3VP4A 2ACGA 4KUOA 4MN6A 1MWUA 3JVUA 5F1GA 4OPRA 1PI5A 3QP4A 1DP8A 1IKIA 1WA9A 2PHYA 4EUVA 3F1OA 1PWDA 2J3TC 2KOIA 4LRYC 1G6AA 1LL8A 3UDFA 1TS7A 5EM1A 4X56A 3H9WA 2NUPC 5GLBA 4OPYA 5DF8A 3H82B 3AGFA 5HARA 4O8GA 4ZJ3A 3W4PA 1XP4A 2P7JA 2Y2JA 2O9BA 4PM9A 2E8IA 1VM1A 3N4IA 4JXVA 2D02A 3KYEA 1GSWA 3B3XA 2W1TA 4YINA 3LR0A 4Y3IA 4R3AA 3V3RA 3NOTC 4JF4A 5HPIA 1IYQA 1PW1A 2GJ3A 1SDNA 4JGPA 1BLCA 1Q2PA 1YPRA 5EUAA 1RGZA 3U4LP 3LI9A 3RXWA 1ES2A 1LSWA 4LLOB 1EW0A 2C6WB 3S7OA 3KNPA 3O5YA 4RRAA 2LB9A 4HP9A 3HL9A 2A49A 1QMFA 5CX7A 4PM8A 2XK1A 3I7JA 3LI8A 1XJ6A 2XEPA 3WS0A 3ZNTA 4LCLA 5F83A 1AXBA 4BL3A 5FASA 2ZMFA 3LGOA 2J80A 2ZL1A 4UHUA 3NY4A 5JYPA 4IVKA 2Q9NA 4BWIA 4H8RA 4IEDA 3ZG7B 3HUMA 4KZBA 5FI6A 3ZVWA 1OTIA 4X69A 1UGUA 2A2LA 5M19A 3RTYA 3SW1A 3A3IA 5HW3A 1XGJA 1OMEA 3UB9A 4UA9A 4DMZA 1CQAA 5CEBA 4E3KA 1YLZA 4R6LA 3UE0A
chains in the Genus database with same CATH topology
4OPZA 5EVID 3PTEA 2OSUA 4GOGA 3JYIA 3WS1A 1NZUA 4RRRA 1YLJA 1L0GA 2IWBA 1KDSA 5CERA 1K56A 4FSFA 4S2PA 3S1YA 4PMAA 1DJBA 2WGWA 3ITBA 3UE3A 4R0QA 4LV0A 3AGEA 4C3QA 4E6XA 5FI2A 4KQOA 2X71A 3O86A 4JKTA 4S02A 3ISGA 4KG6A 3HLCA 1ES3A 1TDGA 4QY5A 3GQZA 2PBYA 1BTLA 1MPLA 2ZLYA 1ALQA 4DE2A 3C4PA 1MBLA 3BLMA 3CMZA 1BLSA 4B4ZA 4LCMA 3SOIA 1KGEA 2Y59A 1BT5A 3PBNA 3UPPA 2Y2LA 3ZHHA 2XF3A 2ZQDA 4JBFA 1PWGA 2HKZA 3NIAA 1O7EA 2XH9A 5FSRA 3W8KA 4NBIA 1CEGA 5EPHA 3DWKA 4GKUA 2Z2LB 4KZAA 1SDEA 2XD5A 3LY4A 3OZHA 2H0TA 4MLLA 4IVIA 1K57A 1XKZA 5HFOA 3A3EA 4B4XA 1W8QA 4P87A 3PD5A 2XDMA 4N92A 4OOLA 4ZJ1A 4CPKA 3IF6A 3LMTA 4KZ7A 3FZCA 4UAAA 2HL1A 3VP3A 4B88A 3NI9A 3V50A 2C5WB 3BFGA 3G4PA 4BL2A 3BLSA 2VGJA 4RRIA 2WGIA 3S22A 2RCXA 1L0DA 4YFMA 3W4QA 3EQUA 4PM6A 3O3VA 3ZFZA 2ZC5B 4NETA 4OQGA 3W4OA 1TEMA 3MZDA 5AQ9A 4OOMA 1S0WA 5J61A 2P9VB 5F82A 4WBGA 4RX2A 4JXGA 4E3JA 2V1ZA 4NBJA 3PAGA 2ZD8A 4JF6A 4ZBEA 4KZ8A 5FQQA 3KODA 3FKWA 1L2SA 2H10A 2DNSA 5AQAA 1NJ4A 5FAPA 3MZEA 2QMIA 3G2YA 5EE8A 5GHYA 1MXOA 4LENA 2HL2A 1EI5A 1ZKJA 1WE4A 4WMCD 5JYOA 4JF5A 2B5RA 4RX3A 2XD1A 4DXBA 1DJCA 3FWLA 5DVAA 4ZJ2A 4DXCA 1RCJA 3FV7A 5CECA 3FKVA 4A5RA 3BFEA 5DF7A 4S2NA 5CGWA 3P09A 2V2FF 3A3JA 5FDHA 3KO4A 4GNUA 4FD8A 3OCLA 2IWDA 4RR7A 2JCHA 4KG2A 4LV3A 2XFTA 2G2UA 4P0MA 4XUXA 4QY6A 3N8RA 1SHVA 1HTZA 3GR2A 1N4OA 4WELA 5FQKA 3M2JA 2R9XA 4S03A 3PBRA 1E25A 3SH9A 1I2SA 1CK3A 1LI9A 2PU2A 4RRFA 1K55A 2FFFB 3G31A 4OONA 3SS3A 1K38A 4WYYA 3HBRA 3MKEA 1U60A 1Z6FA 1ERMA 4MBKA 1KVLA 3BFCA 1MKIA 1IYOA 4ID4A 2PU4A 4FCFA 4DDYA 4FH2A 1KE3A 2HDRA 2ZM0A 3A3DA 4HBUA 1XPBA 3BM6A 4JXWA 1GHMA 3MKFA 2EX9A 1K6RA 1LL5A 5AQ7A 1GHIA 1W7FA 4E3MA 1QMEA 3C4OA 1BULA 4ZDXA 4S0LA 4WZ5A 3Q7VB 4Q8IA 1W8YA 5A92A 4MBHA 4RR6A 2EX8A 3IWQA 3VOZA 5KZHA 3KO3A 4N9KA 3HLEA 4S2MA 4BENA 3VP0A 4KZ3A 2OLUA 4LV1A 3IHAA 1PWCA 3MFDA 2I72A 5CRFA 3OCNA 1NYMA 4MEZA 4KENB 4HEFA 1JKEA 1FR6A 4S2OA 3C7VA 5A91A 3BRMA 4L0LA 5KSHA 1YT4A 3HLBA 3TSGA 1KE0A 3HUNA 5EVIA 3NDGA 1YMXA 2XQZA 5AQBA 5FQJA 3TG9A 1BLPA 3ZCZA 1KE4A 2DCFA 3MZFA 1FCNA 4EV4A 3TOIA 2QPNA 1K57C 3ZG5A 5G18A 5DTSA 1BUEA 1HZOA 3G32A 3G34A 4JLFA 1ZC2A 3Q81A 3ZGAB 4CJNA 3OPRA 3ITAA 3IF5A 1IYSA 3IF6C 4UA7A 4OP8A 2P9VA 5GLAA 3D4FA 5CTNA 1Y54A 2ZM8A 4R1GA 5DTKA 4QU3A 1ONGA 4RRHA 1YQSA 3UPNA 3HVFA 3HLDA 5FATA 3UO9A 3NBLA 3UNWA 4Y0OA 2ZC6B 2R9WA 1ES5A 2CC1A 2H0YA 2WKIA 4FH4A 2X01A 3MXSA 4RR8A 5M1AA 1W79A 4S0IA 1PYYA 2Y2PA 3E2KA 3VMAA 3O88A 1E3UD 3C5AA 3UE1A 3HUOA 1XX2A 1FCMA 3KO9A 3IWIA 3LEZA 3S4XA 1MWRA 3EQVA 3IXHA 3UDXA 2Y2KA 2Y2IA 4S2LA 4DF6A 3OPPA 5HX9A 1GHPA 3ZVTA 2OV5A 3VP2A 4D2OA 4S2IA 2EX6A 4E3NA 3QNCA 4KZ4A 1PI4A 1TVFA 1FOFA 4GDNA 3WWXA 3ZDJA 3NDEA 3AGDA 3G35A 3NC8A 2XLNA 4S2NC 4R4SA 1E4DA 1HVBA 3N6IA 4N1XA 1KVMA 1C3BA 1I5QA 1JVJA 4S0JA 2EXBA 1M6KA 2OLVA 3IXDA 4GB7A 4BD1A 3KOCA 5KMWA 2HP9A 4RRBA 3GTCA 3UPOA 4DRTA 4HESA 2WGWB 1FCOA 4OH0A 1CEFA 1YM1A 5CGSA 4E3OA 5A93A 3BFDA 4DE3A 5E2HA 4EBNA 2BLSA 1IKGA 4KG5A 3Q7VA 1JTDA 1ESUA 1J7GA 1H8YA 1K55C 5GL9A 1NRFA 1IEMA 4HBTA 4WMCA 4R3JA 4N9LA 2WK0A 1JTGA 1PW8A 1SCWA 2Y2MA 5KSCA 3UY6A 2Y2HA 4OLGA 4P6BA 5E2GA 5IHVA 5F1FA 2EX2A 4RRKA 4QJGA 5EOEA 1Q2QA 2X02A 3IWOA 2WGVA 4WM9A 4S2JA 4ZAMA 5FQIA 1EROA 4C6YA 3MBZA 3LMVA 1XA7A 2HDUA 2JE5A 3Q7ZA 2Y2QA 4OP5A 4Y0UA 3G2ZA 2HP6A 3LMUA 4O7DA 1GA9A 1ZG6A 3BEBA 2Q9MA 1JWVA 3CG5A 4WZ5C 1K4EA 4OPQA 3PD4A 3M2KA 3SH7A 5GLDA 1K25A 4RRLA 2WKHA 3ZG9B 1BSGA 3A3FA 5EVLA 1MY8A 1PZPA 5CHMA 3N8SA 2DRWA 3SH8A 4EBPA 2HDQA 4N1HA 4Y7PA 3ZG0A 3VSKA 1GCEA 3CZDA 3GRJA 4OLDA 3DWZA 3M6HA 2Y2OA 2ZC3B 2RL3A 4XUZA 3KNFA 1FSWA 4GN2A 3IF6B 3HLWA 5GLCA 2HL0A 1TDLA 3SS5A 3BECA 2HPBA 4BJPA 3GSGA 4GD6A 5HAPA 5FAOA 3C7UA 1SKFA 2IWCA 2Y91A 2ZC7A 5EVIC 4GZBA 3PBSA 2Y55A 1K54A 4X53A 4EWFA 4QD4A 5CXWA 3HLGA 3RJUA 5CGXA 1RP5A 4GD8A 1ES4A 3OPLA 1KGFA 2WYXA 3CJMA 4E3LA 3E2LA 3GMWA 1FR1A 2ZM2A 3FYZA 3G30A 1JWZA 4ZTKA 5J8XA 3UN7A 1DY6A 2HDSA 3GV9A 1PZOA 4PM7A 3Q1FA 3PBQA 4P85A 1NZOA 2WUQA 4C75A 3QHYA 1FQGA 1ONHA 2V20A 2ZQ7A 5DF9A 5FA7A 3GVBA 3HREA 1Y2QA 5E43A 5DTTA 3N7WA 3KOBA 1ESIA 5EOOA 5TFQA 4OVDA 2OKVA 1L0FA 3OPHA 2EFXA 4WEJA 2ZC4B 1N9BA 1H8ZA 1WYCA 2ZJ9A 3VFFA 3KO7A 1XA1A 1CI8A 5FAQA 4LV2A 1LL9A 4R3BA 1NYYA 1O07A 4EQIA 2EFUA 3VOYA 3M6BA 1MWTA 2WZXA 3V5MA 1EWZA 3O87A 4X55A 4DE0A 3VSLA 2J9PA 1RGYA 2FFYA 4RRGA 4JPMA 4E3IA 1YLTA 1K56D 2ZQCA 3Q82A 3IH9A 3VP4A 4M3KA 3PD3A 1M40A 1XGIA 3MXRA 1NY0A 1MWUA 2P74A 5F1GA 5HAIA 2J9OA 1PI5A 4OPRA 1TC5A 2Y2NA 3QNBA 2G2WA 4U3TA 4EUZA 1IKIA 4QB8A 3VFHA 4NK3A 1PIOA 1PWDA 4OQ0A 2WKEA 4OKPA 1E3UA 3PAEA 4OOYA 1YLPA 4MBFA 3PD2A 3WRZA 5D3OA 1MWSA 1G6AA 3Q07A 3UDFA 4X56A 3VP1A 1IYPA 1BLHA 5GLBA 2ZQAA 4OPYA 1VQQA 5FQ9A 5DF8A 3IXBA 3AGFA 4KZ5A 5HARA 2H5SA 4BD0A 3OC2A 1KGGA 2WAEA 4ZJ3A 3W4PA 4WEKA 4RRCA 2WADA 1XP4A 4KZ6A 2Y2JA 4PPRA 4IBRA 4U0XA 5EVIB 4KQRA 2DBOA 4RVAA 3ZNYA 1J9MA 4S0KA 5BOHA 5A90A 5CHJA 4PM9A 5GHZA 2E8IA 3WS4A 4EBLA 1VM1A 4K91A 3N4IA 4JXVA 1HD8A 1I2WA 2BG1A 4R23A 3UDIA 3B3XA 4X6TA 4OQHA 4YINA 5FQMA 4S2KA 1S6RA 3WS5A 1K6SA 2J8YA 3PBOA 3WRTA 1LHYA 3V3RA 1XXMA 4DDSA 4JF4A 4F94A 5M18A 4GDBA 2Z2MB 5TGFA 1IYQA 1PW1A 5E2EA 2XGNA 3N8LA 3HLFA 1SDNA 1BLCA 1K54C 2UWXA 2WZZA 4Y0TA 1K4FA 1Q2PA 1IELA 2EXAA 5EUAA 1YMSA 1RGZA 2HP5A 2J7VA 3BFFA 3IT9A 3RXXA 4JXSA 4UA6A 2Y4AA 4BLMA 5L2FA 3RXWA 1YLWA 1KDWA 5TR7A 5I94A 3DTMA 4RRJA 2JBFA 5CHUA 2WAFA 1ES2A 1ZG4A 1LLBA 3IH8A 5EECA 1JWPA 4BQMA 4MNRA 2A3UA 2C6WB 5GHXA 3KNPA 4RRAA 2ZQ8A 2JC7A 3HL9A 2A49A 1QMFA 2ZMAA 4OQIA 3IHBA 4PM8A 2XK1A 4RA7A 5FI7A 4KQQA 1BZAA 4QHCA 2XFSA 3I7JA 4KZ9A 3PBTA 3ZG8B 4E6WA 5HAQA 1DJAA 1GA0A 3DW0A 3SS4A 2XEPA 3WS2A 4PM5A 5CEDA 1LI0A 3WS0A 3IQAA 3LY3A 4DE1A 1NXYA 3ZNTA 3P98A 4DKIA 1G68A 4LCLA 4U0TA 5F83A 1AXBA 4XXRA 2GDNA 5HL1A 2VGKA 4BL3A 3V39A 2QZ6A 4K0WA 5FASA 4Z9QA 4RR9A 4RYEA 4UHUA 3NY4A 4IBXA 5JYPA 3KO5A 4IVKA 5U47A 4WZ4A 2Q9NA 4K0XA 3LCEA 4H8RA 4RRMA 3BYDA 3NCKA 5E2FA 4IEDA 3ZG7B 4R4RA 3IXGA 1WYBA 3HUMA 1YLYA 4KZBA 5FI6A 3ZVWA 4X68A 5CTMA 4X69A 5M19A 3A3IA 5HW3A 1XGJA 1L0EA 1W5DA 3V3SA 1OMEA 1ERQA 4UA9A 1H5XA 1CI9A 1FSYA 4E3KA 5CEBA 4RRDA 2ZQ9A 1YLZA 4RRQA 3LO7A 2Y2GA 2XR0A 3UE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPZ A;  5EVI D;  3PTE A;  2OSU A;  4GOG A;  3JYI A;  3WS1 A;  1NZU A;  1YLJ A;  1L0G A;  2IWB A;  1KDS A;  5CER A;  1K56 A;  4FSF A;  4S2P A;  3S1Y A;  4PMA A;  1DJB A;  2WGW A;  3ITB A;  3UE3 A;  4R0Q A;  4LV0 A;  3AGE A;  4C3Q A;  4E6X A;  5FI2 A;  4KQO A;  2X71 A;  3O86 A;  4JKT A;  3ISG A;  4KG6 A;  3HLC A;  1ES3 A;  1TDG A;  4QY5 A;  3GQZ A;  2PBY A;  1BTL A;  1MPL A;  2ZLY A;  1ALQ A;  4DE2 A;  3C4P A;  1MBL A;  3BLM A;  3CMZ A;  1BLS A;  4B4Z A;  4LCM A;  3SOI A;  1KGE A;  2Y59 A;  1BT5 A;  3PBN A;  3UPP A;  2Y2L A;  3ZHH A;  2XF3 A;  2ZQD A;  4JBF A;  1PWG A;  3NIA A;  1O7E A;  2XH9 A;  5FSR A;  3W8K A;  1CEG A;  5EPH A;  3DWK A;  4GKU A;  2Z2L B;  4KZA A;  1SDE A;  2XD5 A;  3LY4 A;  3OZH A;  2H0T A;  4MLL A;  4IVI A;  1K57 A;  1XKZ A;  5HFO A;  3A3E A;  4B4X A;  1W8Q A;  4P87 A;  2XDM A;  4N92 A;  4OOL A;  4ZJ1 A;  4CPK A;  3IF6 A;  4KZ7 A;  3FZC A;  4UAA A;  3VP3 A;  4B88 A;  3NI9 A;  3V50 A;  2C5W B;  3BFG A;  3G4P A;  4BL2 A;  3BLS A;  2VGJ A;  2WGI A;  3S22 A;  2RCX A;  1L0D A;  4YFM A;  3W4Q A;  3EQU A;  4PM6 A;  3O3V A;  3ZFZ A;  2ZC5 B;  4NET A;  4OQG A;  3W4O A;  1TEM A;  3MZD A;  5AQ9 A;  4OOM A;  1S0W A;  2P9V B;  5F82 A;  4WBG A;  4RX2 A;  4JXG A;  4E3J A;  2V1Z A;  3PAG A;  2ZD8 A;  4JF6 A;  4ZBE A;  4KZ8 A;  5FQQ A;  3FKW A;  1L2S A;  2H10 A;  2DNS A;  5AQA A;  1NJ4 A;  5FAP A;  3MZE A;  2QMI A;  3G2Y A;  5EE8 A;  5GHY A;  1MXO A;  4LEN A;  1EI5 A;  1ZKJ A;  1WE4 A;  4WMC D;  5JYO A;  4JF5 A;  2B5R A;  4RX3 A;  2XD1 A;  4DXB A;  1DJC A;  3FWL A;  5DVA A;  4ZJ2 A;  4DXC A;  1RCJ A;  3FV7 A;  5CEC A;  3FKV A;  4A5R A;  3BFE A;  5DF7 A;  4S2N A;  5CGW A;  3P09 A;  2V2F F;  3A3J A;  5FDH A;  4GNU A;  4FD8 A;  3OCL A;  2IWD A;  2JCH A;  4KG2 A;  4LV3 A;  2XFT A;  2G2U A;  4P0M A;  4XUX A;  4QY6 A;  3N8R A;  1SHV A;  1HTZ A;  3GR2 A;  1N4O A;  4WEL A;  5FQK A;  3M2J A;  2R9X A;  3PBR A;  1E25 A;  3SH9 A;  1I2S A;  1CK3 A;  1LI9 A;  2PU2 A;  1K55 A;  2FFF B;  3G31 A;  4OON A;  3SS3 A;  1K38 A;  4WYY A;  3HBR A;  3MKE A;  1U60 A;  1Z6F A;  1ERM A;  4MBK A;  1KVL A;  3BFC A;  1MKI A;  1IYO A;  4ID4 A;  2PU4 A;  4FCF A;  4DDY A;  4FH2 A;  1KE3 A;  2HDR A;  2ZM0 A;  3A3D A;  4HBU A;  1XPB A;  3BM6 A;  4JXW A;  1GHM A;  3MKF A;  2EX9 A;  1K6R A;  1LL5 A;  5AQ7 A;  1GHI A;  1W7F A;  4E3M A;  1QME A;  3C4O A;  1BUL A;  4ZDX A;  4WZ5 A;  3Q7V B;  4Q8I A;  1W8Y A;  5A92 A;  4MBH A;  2EX8 A;  3IWQ A;  3VOZ A;  5KZH A;  4N9K A;  3HLE A;  4S2M A;  4BEN A;  3VP0 A;  4KZ3 A;  2OLU A;  4LV1 A;  3IHA A;  1PWC A;  3MFD A;  2I72 A;  5CRF A;  3OCN A;  1NYM A;  4MEZ A;  4KEN B;  4HEF A;  1FR6 A;  4S2O A;  3C7V A;  5A91 A;  3BRM A;  4L0L A;  5KSH A;  1YT4 A;  3HLB A;  3TSG A;  1KE0 A;  3HUN A;  5EVI A;  3NDG A;  1YMX A;  2XQZ A;  5AQB A;  5FQJ A;  3TG9 A;  1BLP A;  3ZCZ A;  1KE4 A;  2DCF A;  3MZF A;  1FCN A;  4EV4 A;  3TOI A;  2QPN A;  1K57 C;  3ZG5 A;  5G18 A;  5DTS A;  1BUE A;  1HZO A;  3G32 A;  3G34 A;  4JLF A;  1ZC2 A;  3Q81 A;  3ZGA B;  4CJN A;  3OPR A;  3ITA A;  3IF5 A;  1IYS A;  3IF6 C;  4UA7 A;  4OP8 A;  2P9V A;  5GLA A;  3D4F A;  5CTN A;  1Y54 A;  2ZM8 A;  4R1G A;  5DTK A;  4QU3 A;  1ONG A;  1YQS A;  3UPN A;  3HVF A;  3HLD A;  5FAT A;  3UO9 A;  3NBL A;  3UNW A;  4Y0O A;  2ZC6 B;  2R9W A;  1ES5 A;  2CC1 A;  2H0Y A;  2WKI A;  4FH4 A;  2X01 A;  3MXS A;  5M1A A;  1W79 A;  1PYY A;  2Y2P A;  3E2K A;  3VMA A;  3O88 A;  1E3U D;  3C5A A;  3UE1 A;  3HUO A;  1XX2 A;  1FCM A;  3IWI A;  3LEZ A;  3S4X A;  1MWR A;  3EQV A;  3IXH A;  3UDX A;  2Y2K A;  2Y2I A;  4S2L A;  4DF6 A;  3OPP A;  5HX9 A;  1GHP A;  3ZVT A;  2OV5 A;  3VP2 A;  4D2O A;  4S2I A;  2EX6 A;  4E3N A;  3QNC A;  4KZ4 A;  1PI4 A;  1TVF A;  1FOF A;  4GDN A;  3WWX A;  3ZDJ A;  3NDE A;  3AGD A;  3G35 A;  3NC8 A;  2XLN A;  4S2N C;  4R4S A;  1E4D A;  1HVB A;  3N6I A;  4N1X A;  1KVM A;  1C3B A;  1I5Q A;  1JVJ A;  2EXB A;  1M6K A;  2OLV A;  3IXD A;  4GB7 A;  4BD1 A;  5KMW A;  2HP9 A;  3GTC A;  3UPO A;  4DRT A;  4HES A;  2WGW B;  1FCO A;  4OH0 A;  1CEF A;  1YM1 A;  5CGS A;  4E3O A;  5A93 A;  3BFD A;  4DE3 A;  5E2H A;  4EBN A;  2BLS A;  1IKG A;  4KG5 A;  3Q7V A;  1JTD A;  1ESU A;  1H8Y A;  1K55 C;  5GL9 A;  1NRF A;  1IEM A;  4HBT A;  4WMC A;  4R3J A;  4N9L A;  2WK0 A;  1JTG A;  1PW8 A;  1SCW A;  2Y2M A;  5KSC A;  3UY6 A;  2Y2H A;  4OLG A;  4P6B A;  5E2G A;  5IHV A;  5F1F A;  2EX2 A;  4QJG A;  5EOE A;  1Q2Q A;  2X02 A;  3IWO A;  2WGV A;  4WM9 A;  4S2J A;  4ZAM A;  5FQI A;  1ERO A;  4C6Y A;  3MBZ A;  1XA7 A;  2HDU A;  2JE5 A;  3Q7Z A;  2Y2Q A;  4OP5 A;  4Y0U A;  3G2Z A;  2HP6 A;  4O7D A;  1GA9 A;  1ZG6 A;  3BEB A;  2Q9M A;  1JWV A;  3CG5 A;  4WZ5 C;  1K4E A;  4OPQ A;  3M2K A;  3SH7 A;  5GLD A;  1K25 A;  2WKH A;  3ZG9 B;  1BSG A;  3A3F A;  5EVL A;  1MY8 A;  1PZP A;  5CHM A;  3N8S A;  2DRW A;  3SH8 A;  4EBP A;  2HDQ A;  4N1H A;  4Y7P A;  3ZG0 A;  3VSK A;  1GCE A;  3CZD A;  3GRJ A;  4OLD A;  3DWZ A;  3M6H A;  2Y2O A;  2ZC3 B;  2RL3 A;  4XUZ A;  1FSW A;  4GN2 A;  3IF6 B;  3HLW A;  5GLC A;  1TDL A;  3SS5 A;  3BEC A;  2HPB A;  4BJP A;  3GSG A;  4GD6 A;  5HAP A;  5FAO A;  3C7U A;  1SKF A;  2IWC A;  2Y91 A;  2ZC7 A;  5EVI C;  4GZB A;  3PBS A;  2Y55 A;  1K54 A;  4X53 A;  4EWF A;  4QD4 A;  5CXW A;  3HLG A;  3RJU A;  5CGX A;  1RP5 A;  4GD8 A;  1ES4 A;  3OPL A;  1KGF A;  2WYX A;  3CJM A;  4E3L A;  3E2L A;  3GMW A;  1FR1 A;  2ZM2 A;  3FYZ A;  3G30 A;  1JWZ A;  4ZTK A;  5J8X A;  3UN7 A;  1DY6 A;  2HDS A;  3GV9 A;  1PZO A;  4PM7 A;  3Q1F A;  3PBQ A;  4P85 A;  1NZO A;  2WUQ A;  4C75 A;  3QHY A;  1FQG A;  1ONH A;  2V20 A;  2ZQ7 A;  5DF9 A;  5FA7 A;  3GVB A;  3HRE A;  5E43 A;  5DTT A;  3N7W A;  1ESI A;  5EOO A;  5TFQ A;  4OVD A;  1L0F A;  3OPH A;  2EFX A;  4WEJ A;  2ZC4 B;  1N9B A;  1H8Z A;  1WYC A;  2ZJ9 A;  3VFF A;  1XA1 A;  1CI8 A;  5FAQ A;  4LV2 A;  1LL9 A;  4R3B A;  1NYY A;  1O07 A;  4EQI A;  2EFU A;  3VOY A;  3M6B A;  1MWT A;  2WZX A;  3V5M A;  1EWZ A;  3O87 A;  4X55 A;  4DE0 A;  3VSL A;  2J9P A;  1RGY A;  2FFY A;  4JPM A;  4E3I A;  1YLT A;  1K56 D;  2ZQC A;  3Q82 A;  3IH9 A;  3VP4 A;  4M3K A;  1M40 A;  1XGI A;  3MXR A;  1NY0 A;  1MWU A;  2P74 A;  5F1G A;  5HAI A;  2J9O A;  1PI5 A;  4OPR A;  2Y2N A;  3QNB A;  2G2W A;  4U3T A;  4EUZ A;  1IKI A;  4QB8 A;  3VFH A;  4NK3 A;  1PIO A;  1PWD A;  4OQ0 A;  2WKE A;  4OKP A;  1E3U A;  3PAE A;  4OOY A;  1YLP A;  4MBF A;  3WRZ A;  5D3O A;  1MWS A;  1G6A A;  3Q07 A;  3UDF A;  4X56 A;  3VP1 A;  1IYP A;  1BLH A;  5GLB A;  2ZQA A;  4OPY A;  1VQQ A;  5FQ9 A;  5DF8 A;  3IXB A;  3AGF A;  4KZ5 A;  5HAR A;  2H5S A;  4BD0 A;  3OC2 A;  1KGG A;  2WAE A;  4ZJ3 A;  3W4P A;  4WEK A;  2WAD A;  1XP4 A;  4KZ6 A;  2Y2J A;  4PPR A;  4IBR A;  4U0X A;  5EVI B;  4KQR A;  4RVA A;  3ZNY A;  1J9M A;  5BOH A;  5A90 A;  5CHJ A;  4PM9 A;  5GHZ A;  2E8I A;  3WS4 A;  4EBL A;  1VM1 A;  4K91 A;  3N4I A;  4JXV A;  1HD8 A;  1I2W A;  2BG1 A;  4R23 A;  3UDI A;  3B3X A;  4X6T A;  4OQH A;  4YIN A;  5FQM A;  4S2K A;  1S6R A;  3WS5 A;  1K6S A;  2J8Y A;  3PBO A;  3WRT A;  1LHY A;  3V3R A;  1XXM A;  4DDS A;  4JF4 A;  4F94 A;  5M18 A;  4GDB A;  2Z2M B;  5TGF A;  1IYQ A;  1PW1 A;  5E2E A;  2XGN A;  3N8L A;  3HLF A;  1SDN A;  1BLC A;  1K54 C;  2UWX A;  2WZZ A;  4Y0T A;  1K4F A;  1Q2P A;  1IEL A;  2EXA A;  5EUA A;  1YMS A;  1RGZ A;  2HP5 A;  2J7V A;  3BFF A;  3IT9 A;  3RXX A;  4JXS A;  4UA6 A;  2Y4A A;  4BLM A;  5L2F A;  3RXW A;  1YLW A;  1KDW A;  5TR7 A;  5I94 A;  3DTM A;  2JBF A;  5CHU A;  2WAF A;  1ES2 A;  1ZG4 A;  1LLB A;  3IH8 A;  5EEC A;  1JWP A;  4BQM A;  4MNR A;  2A3U A;  2C6W B;  5GHX A;  2ZQ8 A;  2JC7 A;  3HL9 A;  2A49 A;  1QMF A;  2ZMA A;  4OQI A;  3IHB A;  4PM8 A;  2XK1 A;  4RA7 A;  5FI7 A;  4KQQ A;  1BZA A;  4QHC A;  2XFS A;  3I7J A;  4KZ9 A;  3PBT A;  3ZG8 B;  4E6W A;  5HAQ A;  1DJA A;  1GA0 A;  3DW0 A;  3SS4 A;  2XEP A;  3WS2 A;  4PM5 A;  5CED A;  1LI0 A;  3WS0 A;  3IQA A;  3LY3 A;  4DE1 A;  1NXY A;  3ZNT A;  3P98 A;  4DKI A;  1G68 A;  4LCL A;  4U0T A;  5F83 A;  1AXB A;  4XXR A;  2GDN A;  5HL1 A;  2VGK A;  4BL3 A;  3V39 A;  2QZ6 A;  4K0W A;  5FAS A;  4Z9Q A;  4RYE A;  4UHU A;  3NY4 A;  4IBX A;  5JYP A;  4IVK A;  5U47 A;  4WZ4 A;  2Q9N A;  4K0X A;  3LCE A;  4H8R A;  3BYD A;  3NCK A;  5E2F A;  4IED A;  3ZG7 B;  4R4R A;  3IXG A;  1WYB A;  3HUM A;  1YLY A;  4KZB A;  5FI6 A;  3ZVW A;  4X68 A;  5CTM A;  4X69 A;  5M19 A;  3A3I A;  5HW3 A;  1XGJ A;  1L0E A;  1W5D A;  3V3S A;  1OME A;  1ERQ A;  4UA9 A;  1H5X A;  1CI9 A;  1FSY A;  4E3K A;  5CEB A;  2ZQ9 A;  1YLZ A;  3LO7 A;  2Y2G A;  2XR0 A;  3UE0 A; 
#chains in the Genus database with same CATH topology
 2OSU A;  4RRR A;  3WS1 A;  2BAS A;  3KSG A;  4S2P A;  3C38 A;  1HLU P;  4E6X A;  2X71 A;  4JKT A;  2XSS A;  4MMN A;  5FL3 A;  1SKO A;  1IFQ A;  4EEP A;  3FPW A;  1BTL A;  3P7N A;  1MBL A;  1BLS A;  4LCM A;  2Y59 A;  2Y2L A;  4JBF A;  3EOI A;  3NIA A;  3MQQ A;  2XH9 A;  2M7V A;  4NBI A;  5DJU A;  2Z2L B;  2KDK A;  1OT9 A;  2OWJ A;  1W8Q A;  4B93 A;  2HZ5 A;  4CPK A;  3IF6 A;  1S1Y A;  2HL1 A;  3A0V A;  5FDS A;  3V50 A;  4PM6 A;  4EES A;  3OOV A;  4GS9 A;  5F82 A;  4HI4 A;  4E3J A;  4F3L A;  1W63 M;  5FAP A;  3MZE A;  1TD5 A;  5GHY A;  4LEN A;  4WMC D;  1WE4 A;  4NXE A;  4DXB A;  5DVA A;  1RCJ A;  2CMN A;  3CUE A;  5CEC A;  3FKV A;  4S2N A;  5CGW A;  3P09 A;  4GW9 A;  5FDH A;  4GNU A;  5EV0 A;  2KLI A;  1P97 A;  4RR7 A;  1CJF A;  4II7 A;  4HQA A;  4QY6 A;  3N8R A;  4NXB A;  3PBR A;  1LI9 A;  1SZV A;  4RRF A;  1K38 A;  3MKE A;  1ERM A;  4Y2F A;  1IYO A;  4ID4 A;  2PU4 A;  4FH2 A;  2ZM0 A;  4HBU A;  1GHM A;  3ULF A;  4DJ2 A;  1YSP A;  2EX9 A;  4HJ3 A;  1W7F A;  3C4O A;  1BUL A;  4ZDX A;  4S0L A;  1H3Q A;  3HJK A;  3Q7V B;  4RR6 A;  5A92 A;  3EEA A;  1TS6 A;  3KO3 A;  4N9K A;  4HHD A;  4S2M A;  3S7N A;  4LV1 A;  4IUK A;  2Y79 A;  3LFV A;  4S2O A;  3BRM A;  3FPV A;  3LIF A;  1YSQ A;  2KX6 A;  4FOF A;  3OBF A;  1F98 A;  1YT4 A;  4M4X A;  3PXP A;  5EVI A;  1XJ3 A;  2XQZ A;  2PYR A;  4HNB A;  1KE4 A;  3E4Q A;  2QPN A;  1K57 C;  5DTS A;  1HZO A;  3G32 A;  3G34 A;  1X0O A;  2A24 B;  3ZGA B;  3OPR A;  2QKP A;  3FC7 A;  3IF5 A;  2L0W A;  4OP8 A;  5CTN A;  3E98 A;  2ZM8 A;  5DTK A;  4I3J A;  3UPN A;  4R70 A;  4CLC E;  5J7E A;  3HLD A;  5FAT A;  2ZC6 B;  2JKF A;  4H6J A;  2WKI A;  3C30 A;  4FH4 A;  4RR8 A;  3BW6 A;  3O88 A;  1E3U D;  3C5A A;  1FCM A;  3IXH A;  2Y2I A;  3LR5 A;  5HX9 A;  4K08 A;  2OV5 A;  4IHQ A;  3VP2 A;  3QNC A;  4KZ4 A;  4ETX A;  4L9E A;  4GDN A;  3AGD A;  5LBR A;  4R4S A;  3JVV A;  3N6I A;  2PR5 A;  1C3B A;  1I5Q A;  5L10 A;  4S0J A;  2OLV A;  3LEQ A;  2QWS A;  3IXD A;  1VEU B;  3GTC A;  5HWT A;  4OH0 A;  4UQI S;  2HV1 A;  4ETZ A;  1J7G A;  1H8Y A;  5GL9 A;  4R3J A;  3UY6 A;  5E2G A;  5F1F A;  2EX2 A;  2X02 A;  4WM9 A;  4ZAM A;  3MBZ A;  3LMV A;  2VV8 A;  3Q7Z A;  4OP5 A;  3MFX A;  3G2Z A;  2HP6 A;  3UB8 A;  1JWV A;  4OPQ A;  1UWP X;  2VGL S;  3M2K A;  3IS2 B;  3A3F A;  3SH8 A;  4EBP A;  2W3D A;  3KSH A;  1VET A;  3M6H A;  2ZC3 B;  3HLW A;  1TDL A;  3GSG A;  4ARZ B;  2Y55 A;  3VOL A;  1OPX A;  4HH2 A;  4ZTK A;  5J8X A;  3DTK A;  3Q1F A;  2ZQ7 A;  3B33 A;  5FA7 A;  5E43 A;  3N7W A;  3K3C A;  3LR3 A;  1N9B A;  3KO7 A;  1XA1 A;  4B9O A;  1CI8 A;  1LL9 A;  3M6B A;  2PYP A;  1EWZ A;  4DE0 A;  4RRG A;  2FFY A;  4E3I A;  2ZMV A;  2ZQC A;  1G6O A;  1XGI A;  1NY0 A;  2PD7 A;  2P74 A;  5HAI A;  2J9O A;  4G3W A;  4IJG A;  4U3T A;  4EUZ A;  1PIO A;  2PBD P;  4OQ0 A;  5MC7 A;  4OOY A;  1YLP A;  5HD3 A;  3WRZ A;  1MWS A;  2J3W A;  5FEF A;  3QP2 A;  3LYX A;  3VP1 A;  1IYP A;  2PR6 A;  2HF6 A;  4GHI A;  5FQ9 A;  2O9C A;  3F1N B;  1KGG A;  1VHM A;  2VGL M;  4WEK A;  2WAD A;  4PPR A;  4IBR A;  3ZNY A;  1J9M A;  5BOH A;  5A90 A;  3CHW P;  2BG1 A;  3UDI A;  4WL9 A;  4S2K A;  1K6S A;  4Y17 A;  2J8Y A;  4F94 A;  4GDB A;  1H8M A;  2Z2M B;  2VEA A;  4Q0I A;  2EXA A;  2J7V A;  5TBM A;  1F2K A;  4YOF A;  2Y4A A;  4BLM A;  1YLW A;  3A0R A;  5TR7 A;  5J3W A;  5DKK A;  4RRJ A;  5CHU A;  4EW7 A;  1LLB A;  1JWP A;  4MNR A;  4PAU A;  2ZQ8 A;  2O99 A;  3MSH A;  4RA7 A;  5FI7 A;  4KQQ A;  1BZA A;  4E6W A;  5HAQ A;  2QJ7 A;  1GA0 A;  3WS2 A;  1LI0 A;  3LY3 A;  1NXY A;  1G68 A;  4XXR A;  1S4R A;  4Z9Q A;  4RR9 A;  1XFQ A;  4RYE A;  3NUL A;  5U47 A;  3KSI A;  3LCE A;  3NCK A;  4R4R A;  5CTM A;  3T12 B;  3S7Q A;  1W5D A;  3CLO A;  4UEY A;  2O0Y A;  5DFY A;  5DTT A;  2Y2G A;  2XR0 A;  2ZBB A;  4GOG A;  1YLJ A;  1KDS A;  5CER A;  3LIB A;  4FSF A;  2WGW A;  3ITB A;  3AGE A;  3O86 A;  3ISG A;  3H7W B;  4QY5 A;  3CMZ A;  4XT2 B;  3UPP A;  3T4Q A;  2ZQD A;  2HKZ A;  5FSR A;  2OAQ 1;  4MLL A;  4IVI A;  2W3E A;  3ZQ5 A;  3K2N A;  2B95 A;  3A3E A;  4B4X A;  2XDM A;  4N92 A;  3LMT A;  3NHQ A;  3DAV A;  3PHY A;  4UAA A;  3BQ8 A;  2W0N A;  4B88 A;  2C5W B;  3BY9 A;  4BL2 A;  3BLS A;  2VGJ A;  4RRI A;  2WGI A;  3S22 A;  2UV0 E;  4NET A;  2J3T D;  4OOM A;  5J61 A;  2P9V B;  3CPT B;  4JXG A;  4NBJ A;  3PAG A;  3UME A;  4KZ8 A;  2BTF P;  1L2S A;  5AQA A;  2GZA A;  3VV4 A;  5EE8 A;  3HCY A;  1MXO A;  4I38 A;  2HL2 A;  1ZKJ A;  4RX3 A;  2XD1 A;  1DJC A;  3FWL A;  4DXC A;  3KYZ A;  4A5R A;  1OTB A;  2W3H A;  2INW A;  4QPR A;  2V9A A;  2Z6D A;  5F68 A;  4P0M A;  1ODV A;  1SHV A;  3GR2 A;  4WEL A;  1P0Z A;  1CK3 A;  1K55 A;  3G31 A;  3SS3 A;  1T18 A;  3UE6 A;  1S4S A;  3HBR A;  4Q0H A;  1U60 A;  1Z6F A;  3BFC A;  4DDY A;  1KE3 A;  3A3D A;  2ZOH A;  4JXW A;  2PRF A;  1LL5 A;  1GHI A;  1QME A;  1D06 A;  3UMD A;  1H0M A;  3VOZ A;  3HLE A;  3VP0 A;  2W1T B;  2OLU A;  1PWC A;  2I72 A;  3LR4 A;  3MR0 A;  4YWZ A;  2JKR M;  4WLA A;  3HLB A;  3TSG A;  3BQA A;  5AQB A;  3T4J A;  3T4L A;  3IX8 A;  3TG9 A;  2DCF A;  3TOI A;  3FG8 A;  4E04 A;  4HJ6 A;  4WN5 A;  3Q81 A;  3IF6 C;  3D4F A;  1Y54 A;  2AVX A;  4R1G A;  4RRH A;  2VX8 A;  1ONG A;  4QU3 A;  1T19 A;  1GSX A;  1YQS A;  1FIL A;  3UO9 A;  2H0Y A;  5M1A A;  2Y2P A;  3T4S A;  3VMA A;  4HIA A;  4JGQ A;  3HUO A;  3KO9 A;  3IWI A;  4RQ9 A;  2Y2K A;  2HJE A;  1GHP A;  3T1R A;  3EGD C;  2EX6 A;  4S2I A;  1PI4 A;  1G28 A;  4GJ4 A;  3CUE C;  3NDE A;  4I5S A;  4S2N C;  3T50 A;  1F5M A;  4N1X A;  3C2W A;  4GB7 A;  4D60 A;  4BBU A;  3E4P A;  2HP9 A;  2WKR A;  4JGR A;  4HES A;  1CF0 A;  5CGS A;  5L09 A;  3Q7V A;  1JTD A;  4WMC A;  3GDI A;  4N9L A;  2VZW A;  1SKO B;  2Y2M A;  5KSC A;  1T1B A;  2GNX A;  4OLG A;  2E8J A;  4P6B A;  1Q2Q A;  2EWV A;  2WGV A;  5FQI A;  1ERO A;  4C6Y A;  2XRN A;  3LMU A;  4WUJ A;  2Q9M A;  3CG5 A;  3LIC A;  1K25 A;  3NJA A;  3ZG9 B;  4KQD A;  5EVL A;  1PZP A;  2VLG A;  1TS0 A;  3VSK A;  1GCE A;  3CZD A;  5KIZ A;  2LB5 A;  2Y2O A;  3KNF A;  1FSW A;  4GN2 A;  3IF6 B;  2A24 A;  3SS5 A;  2ZC7 A;  4ME4 A;  4GCZ A;  5EVI C;  1K54 A;  1T1A A;  3RJU A;  5CGX A;  4HP4 A;  2WYX A;  1JNU A;  3E2L A;  1JWZ A;  1DY6 A;  1OT6 A;  2V8F A;  3CWF A;  4F3L B;  1ACF A;  1MC0 A;  4C75 A;  4O01 A;  1FQG A;  3HRE A;  3DTI A;  5IT5 A;  4GLQ A;  2M1C A;  3KOB A;  3UB6 A;  1ESI A;  2PDR A;  2OKV A;  1L0F A;  5HD5 A;  2ZJ9 A;  1H8Z A;  4EER A;  1STZ A;  3V5M A;  4X55 A;  1RGY A;  1K56 D;  3IH9 A;  4MDZ A;  1NLZ A;  1BYW A;  4M3K A;  1VEU A;  3MXR A;  1J3W A;  3HJI A;  1LSX A;  1TC5 A;  2Y2N A;  2G2W A;  4NK3 A;  2QJ5 A;  1E3U A;  3PAE A;  2G7U A;  5D3O A;  2IA2 A;  3MJQ A;  2VK3 A;  5HDC A;  1BLH A;  4CLC D;  2ZQA A;  4CLC A;  2VKS A;  3OC2 A;  2WAE A;  2XRO A;  4X25 A;  5EVI B;  2DBO A;  4S0K A;  3C8C A;  4L9G A;  4EBL A;  3WS4 A;  4K91 A;  4R23 A;  5F6A A;  4OQH A;  1S6R A;  2XA7 S;  3WS5 A;  2ZOI A;  3WRT A;  1LHY A;  1XXM A;  2GX5 A;  5TGF A;  3RFB A;  4L9F A;  2XGN A;  3HLF A;  1OJG A;  3W2Z A;  1LSV A;  2UWX A;  1K4F A;  1IEL A;  2DMW A;  4H6J B;  3RXX A;  1YMS A;  3DTM A;  3QP8 A;  2JBF A;  2H28 A;  5EEC A;  3RH8 B;  4G3V A;  5GHX A;  2JC7 A;  4PKY A;  2ZMA A;  4OQI A;  3IHB A;  3B42 A;  3ZG8 B;  3PBT A;  4G3K A;  4QWO A;  3DW0 A;  3SS4 A;  3IQA A;  3P98 A;  5HL1 A;  2VGK A;  4K0W A;  4NKP A;  4IBX A;  3KO5 A;  1Z09 A;  4WZ4 A;  5E2F A;  3IXG A;  2VV6 A;  4X68 A;  1AWI A;  1FSY A;  1A0K A;  3R7W A;  2ZQ9 A;  4JGO A;  5EM0 A;  3F1N A;  1DP9 A;  3LO7 A;  4OPZ A;  1OTD A;  1L0G A;  1NWZ A;  2JKR I;  5J4E A;  2K31 A;  4C3Q A;  5FI2 A;  4KQO A;  4KG6 A;  3HLC A;  3TRC A;  3GQZ A;  2PBY A;  4UQI M;  3KX0 X;  1ALQ A;  4LRX C;  3C4P A;  4WF0 A;  4B4Z A;  4Y15 A;  1KOU A;  2XA7 M;  3BY8 A;  1O7E A;  1CEG A;  5EPH A;  3DWK A;  3OZH A;  2H0T A;  4EXO A;  5HFO A;  4P87 A;  3PD5 A;  4OOL A;  1N9N A;  3FZC A;  1W63 Q;  2M7U A;  3NI9 A;  3BFG A;  3LUQ A;  1L0D A;  4YFM A;  3EQU A;  1V9Z A;  2ZC5 B;  4OQG A;  1TEM A;  3MZD A;  5AQ9 A;  4WBG A;  2V1Z A;  2ZD8 A;  4JF6 A;  4AFI A;  5FQQ A;  2DNS A;  2QMI A;  3BJN A;  2B5R A;  4ZJ2 A;  5AVE A;  2B18 A;  3FV7 A;  3BFE A;  1PRQ A;  2V2F F;  4FD8 A;  1G5U A;  2IWD A;  4LV3 A;  4XUX A;  3M2J A;  4PKY G;  3SH9 A;  1I2S A;  4GHI B;  2Z6C A;  4OON A;  4WYY A;  4MBK A;  1KVL A;  1MKI A;  4FCF A;  1XPB A;  3BM6 A;  3F1P B;  5AQ7 A;  1K6R A;  4E3M A;  3T4T A;  3QP6 A;  4WZ5 A;  1MZU A;  3TE8 A;  2L4R A;  1W8Y A;  3IWQ A;  5KZH A;  2OAP 1;  1LT0 A;  5EVE A;  2VA0 A;  5CRF A;  3OCN A;  1NYM A;  4KEN B;  2OWH A;  4HEF A;  1JKE A;  1FR6 A;  3H82 A;  3C7V A;  5A91 A;  4L0L A;  3MMH A;  2YKH A;  2L1M A;  3TW8 A;  1Y4O A;  3NDG A;  1YMX A;  5FQJ A;  1BLP A;  3ZCZ A;  1YKD A;  3MZF A;  4EV4 A;  3ZG5 A;  1S67 L;  1BUE A;  1FIK A;  4JLF A;  1ZC2 A;  2V1B A;  5HSQ A;  2P9V A;  5F69 A;  3R4K A;  5DKL A;  3HVF A;  1S1Z A;  1ES5 A;  2X01 A;  1PYY A;  3E2K A;  2D01 A;  3UE1 A;  1MWR A;  3EQV A;  3UDX A;  4DF6 A;  3OPP A;  4E3N A;  3SZT A;  4EQ1 A;  1L3L A;  1TVF A;  2K2N A;  3LIA A;  3NOP C;  5DJT A;  2MJ6 A;  1E4D A;  1HVB A;  4R38 A;  1KVM A;  3KOC A;  3KO6 A;  4LPZ A;  4RRB A;  3UPO A;  4DRT A;  1FCO A;  2WGW B;  1YM1 A;  4E3O A;  5A93 A;  3BFD A;  4DE3 A;  5E2H A;  4EBN A;  2BLS A;  1ESU A;  1K55 C;  1NRF A;  1V9Y A;  4HBT A;  3F1O B;  1JTG A;  1Y28 A;  2Y2H A;  4CQH A;  4QJG A;  5EOE A;  3V67 A;  1NRJ A;  1XA7 A;  2HDU A;  2JE5 A;  4O7D A;  1GA9 A;  3BEB A;  5A8B A;  2PD8 A;  1K4E A;  1P9R A;  1ZHH B;  5GLD A;  2WKH A;  1BSG A;  4Y5F A;  5CHM A;  3MQ0 A;  2DRW A;  3N8S A;  4EET B;  3JPU A;  4N1H A;  3GRJ A;  4OLD A;  3GEC A;  2HL0 A;  3BEC A;  3C7U A;  4GZB A;  3PBS A;  4X53 A;  4EWF A;  3HLG A;  1RP5 A;  4GD8 A;  3OPL A;  1KGF A;  3CJM A;  2K7S A;  1FR1 A;  2ZM2 A;  3FYZ A;  3UN7 A;  3GV9 A;  1DRM A;  2HDS A;  4PM7 A;  1NLY A;  3D72 A;  4P85 A;  1NZO A;  2WUQ A;  1F9I A;  3QHY A;  1ONH A;  3T4K A;  4HH3 A;  1ZTU A;  3GVB A;  3D9Y A;  1OTE A;  4OVD A;  3OPH A;  1PNE A;  1WYC A;  5FAQ A;  4LV2 A;  4R3B A;  2V0W A;  1NYY A;  4ZRR A;  4EQI A;  1MWT A;  3O87 A;  3VSL A;  2J9P A;  1YLT A;  1OTA A;  3PD3 A;  3MQO A;  1M40 A;  2R78 A;  3QNB A;  3DTE A;  4QB8 A;  2OOL A;  3IBJ A;  1DP6 A;  2WKE A;  4OKP A;  2ZL1 B;  4MBF A;  3PD2 A;  3Q07 A;  4DN0 A;  2QHK A;  2PT7 A;  1VQQ A;  3IXB A;  3G6O A;  4KZ5 A;  2H5S A;  4BD0 A;  2Y8H A;  4RRC A;  4I3A A;  3L7H A;  4KZ6 A;  5HPF A;  4U0X A;  4KQR A;  2FZ0 A;  3NEC A;  4RVA A;  3PYP A;  5CHJ A;  5GHZ A;  3P01 A;  1HD8 A;  1I2W A;  4X1M A;  2W3G A;  4HOI A;  4X6T A;  5FQM A;  3EGX C;  3PBO A;  4DDS A;  5M18 A;  2VJW A;  3IBR A;  4Y13 A;  5E2E A;  3N8L A;  1K54 C;  2WZZ A;  4Y0T A;  4LRZ E;  2HP5 A;  3BFF A;  3IT9 A;  5HZH A;  4JXS A;  4UA6 A;  5L2F A;  1KDW A;  5TJJ A;  5I94 A;  2WKP A;  3LIE A;  2YKF A;  2WAF A;  3KSF A;  1ZG4 A;  3CIT A;  3IH8 A;  4MN7 A;  3QP1 A;  4YNR A;  4BQM A;  2A3U A;  4KUK A;  2JKT I;  4FUW A;  3IX4 A;  5HDD A;  3MXQ A;  4QHC A;  2XFS A;  4KZ9 A;  1DJA A;  5CED A;  4PM5 A;  4DE1 A;  3T4O A;  4DKI A;  4GS9 B;  4U0T A;  1TS8 A;  3B47 A;  4P6Z S;  2GDN A;  3V39 A;  2QZ6 A;  3PR6 A;  3QP5 A;  4K0X A;  4RRM A;  3BYD A;  1WYB A;  1YLY A;  2HJ9 C;  1L0E A;  3V3S A;  1ERQ A;  1H5X A;  1CI9 A;  4RRD A;  2V8C A;  4RRQ A;  3VFH A;  5EVI D;  3PTE A;  3JYI A;  1NZU A;  2IWB A;  5IU1 A;  1K56 A;  3S1Y A;  4PMA A;  1DJB A;  4DJ3 A;  3UE3 A;  4R0Q A;  1K0K A;  4LV0 A;  4X1L A;  5AJG A;  2JKG A;  4CLC C;  5I5L A;  4Q0J A;  3ZYT A;  4S02 A;  1TF1 A;  1ES3 A;  1TDG A;  1MPL A;  3UB7 A;  2ZLY A;  4DE2 A;  3BLM A;  1N9L A;  4PHT A;  3SOI A;  1KGE A;  2QYB A;  1BT5 A;  3PBN A;  3ZHH A;  2XF3 A;  1PWG A;  1S66 L;  3W8K A;  3E4O A;  4GKU A;  4KZA A;  1SDE A;  2XD5 A;  3IS2 A;  3LY4 A;  4NG2 A;  1K57 A;  1XKZ A;  3K3D A;  4HY8 A;  3IX3 A;  3L9K A;  4NXF A;  4ZJ1 A;  4KZ7 A;  4BBV A;  2EA9 A;  3UB5 P;  4ARZ A;  1XFN A;  4MN5 A;  3VP3 A;  1PFL A;  3G4P A;  4LGW A;  2P04 A;  2RCX A;  3W4Q A;  3O3V A;  3ZFZ A;  3W4O A;  3T1X A;  1S0W A;  4RX2 A;  5IS1 A;  4ZBE A;  3KOD A;  3FKW A;  1YAX A;  3BWL A;  2H10 A;  1NJ4 A;  2HGV A;  3G2Y A;  5F5Y A;  4P6Z M;  1EI5 A;  5JYO A;  4MCW A;  4JF5 A;  3A0S A;  3T1Q B;  2W27 A;  3T1S A;  5DF7 A;  3A3J A;  3KO4 A;  4EEU A;  3OCL A;  5G4Z A;  2JCH A;  4KG2 A;  2XFT A;  2G2U A;  5L07 A;  1HTZ A;  1N4O A;  2W3F A;  5FQK A;  2R9X A;  4S03 A;  1E25 A;  4BBT A;  5HWW A;  2PU2 A;  4CLC B;  1IOU A;  2FFF B;  4I3I A;  4NEE D;  1D7E A;  3ICY A;  2HDR A;  3MKF A;  4Q8I A;  4MBH A;  2EX8 A;  1XJ4 A;  4BEN A;  4KZ3 A;  3DBA A;  3IHA A;  2P08 A;  3MFD A;  2Q0O A;  5DFX A;  4MEZ A;  2JN7 A;  5KSH A;  2JHE A;  2NUT C;  1KE0 A;  1OJ5 A;  3HUN A;  5C5K A;  1FCN A;  2B02 A;  5AVF A;  1XJ2 A;  1VET B;  5G18 A;  4ESP A;  4CJN A;  3ITA A;  1IYS A;  5GLA A;  4UA7 A;  2W1R A;  4I39 A;  1D1J A;  3E0Y A;  2FH5 A;  3U2A A;  3NBL A;  1T1C A;  4Y0O A;  3UNW A;  4Z1W A;  2R9W A;  2CC1 A;  3MXS A;  1W79 A;  4S0I A;  3MS6 A;  3D3O A;  4EU0 A;  1XX2 A;  3KYQ A;  3LEZ A;  3S4X A;  4S2L A;  2O9A A;  3ZVT A;  4D2O A;  5HDS A;  1FOF A;  5HL6 A;  3WWX A;  3ZDJ A;  3NC8 A;  3G35 A;  2XLN A;  3R7W B;  3MF0 A;  2V0U A;  3CAX A;  1JVJ A;  2EXB A;  1M6K A;  5G4Y A;  4BD1 A;  5KMW A;  3F1P A;  1CEF A;  1IKG A;  4KG5 A;  1IEM A;  4O0P A;  2WK0 A;  1PW8 A;  1SCW A;  2JKT M;  5IHV A;  4RRK A;  2VV7 A;  3IWO A;  3VE4 A;  3OLO A;  4S2J A;  3S7P A;  2Y2Q A;  4Y0U A;  3NOU C;  1ZG6 A;  4WZ5 C;  3PD4 A;  3SH7 A;  5K5B A;  4RRL A;  1MY8 A;  2HDQ A;  4Y7P A;  3ZG0 A;  5L8M A;  2EWW A;  3DWZ A;  4XUZ A;  2RL3 A;  5GLC A;  5HAP A;  4BJP A;  2HPB A;  4GD6 A;  3H7W A;  5FAO A;  4FTX A;  1N9O A;  4NXG A;  1SKF A;  2IWC A;  2Y91 A;  5FEG A;  4QD4 A;  4XT2 A;  5CXW A;  2V1A A;  1ES4 A;  4E3L A;  3GMW A;  3G30 A;  5EFW A;  1PZO A;  2I9V A;  3PBQ A;  5HWV A;  3EWK A;  2V20 A;  5DF9 A;  3EEH A;  3LID A;  4BMW A;  5TBM B;  1Y2Q A;  4HJ4 A;  3TJZ C;  1GSV A;  5EOO A;  1P9W A;  4IUH A;  5TFQ A;  1UWN X;  2EFX A;  4WEJ A;  2ZC4 B;  3VFF A;  2PAV P;  1O07 A;  4LFU A;  3VE3 A;  2EFU A;  2WKQ A;  3VOY A;  2WZX A;  1MKM A;  3CPT A;  3CI6 A;  1VB6 A;  4JPM A;  3Q82 A;  3VP4 A;  2ACG A;  4KUO A;  4MN6 A;  1MWU A;  3JVU A;  5F1G A;  4OPR A;  1PI5 A;  3QP4 A;  1DP8 A;  1IKI A;  1WA9 A;  2PHY A;  4EUV A;  3F1O A;  1PWD A;  2J3T C;  2KOI A;  4LRY C;  1G6A A;  1LL8 A;  3UDF A;  1TS7 A;  5EM1 A;  4X56 A;  3H9W A;  2NUP C;  5GLB A;  4OPY A;  5DF8 A;  3H82 B;  3AGF A;  5HAR A;  4O8G A;  4ZJ3 A;  3W4P A;  1XP4 A;  2P7J A;  2Y2J A;  2O9B A;  4PM9 A;  2E8I A;  1VM1 A;  3N4I A;  4JXV A;  2D02 A;  3KYE A;  1GSW A;  3B3X A;  2W1T A;  4YIN A;  3LR0 A;  4Y3I A;  4R3A A;  3V3R A;  3NOT C;  4JF4 A;  5HPI A;  1IYQ A;  1PW1 A;  2GJ3 A;  1SDN A;  4JGP A;  1BLC A;  1Q2P A;  1YPR A;  5EUA A;  1RGZ A;  3U4L P;  3LI9 A;  3RXW A;  1ES2 A;  1LSW A;  4LLO B;  1EW0 A;  2C6W B;  3S7O A;  3KNP A;  3O5Y A;  4RRA A;  2LB9 A;  4HP9 A;  3HL9 A;  2A49 A;  1QMF A;  5CX7 A;  4PM8 A;  2XK1 A;  3I7J A;  3LI8 A;  1XJ6 A;  2XEP A;  3WS0 A;  3ZNT A;  4LCL A;  5F83 A;  1AXB A;  4BL3 A;  5FAS A;  2ZMF A;  3LGO A;  2J80 A;  2ZL1 A;  4UHU A;  3NY4 A;  5JYP A;  4IVK A;  2Q9N A;  4BWI A;  4H8R A;  4IED A;  3ZG7 B;  3HUM A;  4KZB A;  5FI6 A;  3ZVW A;  1OTI A;  4X69 A;  1UGU A;  2A2L A;  5M19 A;  3RTY A;  3SW1 A;  3A3I A;  5HW3 A;  1XGJ A;  1OME A;  3UB9 A;  4UA9 A;  4DMZ A;  1CQA A;  5CEB A;  4E3K A;  1YLZ A;  4R6L A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 4OPZ A;  5EVI D;  3PTE A;  2OSU A;  4GOG A;  3JYI A;  3WS1 A;  1NZU A;  4RRR A;  1YLJ A;  1L0G A;  2IWB A;  1KDS A;  5CER A;  1K56 A;  4FSF A;  4S2P A;  3S1Y A;  4PMA A;  1DJB A;  2WGW A;  3ITB A;  3UE3 A;  4R0Q A;  4LV0 A;  3AGE A;  4C3Q A;  4E6X A;  5FI2 A;  4KQO A;  2X71 A;  3O86 A;  4JKT A;  4S02 A;  3ISG A;  4KG6 A;  3HLC A;  1ES3 A;  1TDG A;  4QY5 A;  3GQZ A;  2PBY A;  1BTL A;  1MPL A;  2ZLY A;  1ALQ A;  4DE2 A;  3C4P A;  1MBL A;  3BLM A;  3CMZ A;  1BLS A;  4B4Z A;  4LCM A;  3SOI A;  1KGE A;  2Y59 A;  1BT5 A;  3PBN A;  3UPP A;  2Y2L A;  3ZHH A;  2XF3 A;  2ZQD A;  4JBF A;  1PWG A;  2HKZ A;  3NIA A;  1O7E A;  2XH9 A;  5FSR A;  3W8K A;  4NBI A;  1CEG A;  5EPH A;  3DWK A;  4GKU A;  2Z2L B;  4KZA A;  1SDE A;  2XD5 A;  3LY4 A;  3OZH A;  2H0T A;  4MLL A;  4IVI A;  1K57 A;  1XKZ A;  5HFO A;  3A3E A;  4B4X A;  1W8Q A;  4P87 A;  3PD5 A;  2XDM A;  4N92 A;  4OOL A;  4ZJ1 A;  4CPK A;  3IF6 A;  3LMT A;  4KZ7 A;  3FZC A;  4UAA A;  2HL1 A;  3VP3 A;  4B88 A;  3NI9 A;  3V50 A;  2C5W B;  3BFG A;  3G4P A;  4BL2 A;  3BLS A;  2VGJ A;  4RRI A;  2WGI A;  3S22 A;  2RCX A;  1L0D A;  4YFM A;  3W4Q A;  3EQU A;  4PM6 A;  3O3V A;  3ZFZ A;  2ZC5 B;  4NET A;  4OQG A;  3W4O A;  1TEM A;  3MZD A;  5AQ9 A;  4OOM A;  1S0W A;  5J61 A;  2P9V B;  5F82 A;  4WBG A;  4RX2 A;  4JXG A;  4E3J A;  2V1Z A;  4NBJ A;  3PAG A;  2ZD8 A;  4JF6 A;  4ZBE A;  4KZ8 A;  5FQQ A;  3KOD A;  3FKW A;  1L2S A;  2H10 A;  2DNS A;  5AQA A;  1NJ4 A;  5FAP A;  3MZE A;  2QMI A;  3G2Y A;  5EE8 A;  5GHY A;  1MXO A;  4LEN A;  2HL2 A;  1EI5 A;  1ZKJ A;  1WE4 A;  4WMC D;  5JYO A;  4JF5 A;  2B5R A;  4RX3 A;  2XD1 A;  4DXB A;  1DJC A;  3FWL A;  5DVA A;  4ZJ2 A;  4DXC A;  1RCJ A;  3FV7 A;  5CEC A;  3FKV A;  4A5R A;  3BFE A;  5DF7 A;  4S2N A;  5CGW A;  3P09 A;  2V2F F;  3A3J A;  5FDH A;  3KO4 A;  4GNU A;  4FD8 A;  3OCL A;  2IWD A;  4RR7 A;  2JCH A;  4KG2 A;  4LV3 A;  2XFT A;  2G2U A;  4P0M A;  4XUX A;  4QY6 A;  3N8R A;  1SHV A;  1HTZ A;  3GR2 A;  1N4O A;  4WEL A;  5FQK A;  3M2J A;  2R9X A;  4S03 A;  3PBR A;  1E25 A;  3SH9 A;  1I2S A;  1CK3 A;  1LI9 A;  2PU2 A;  4RRF A;  1K55 A;  2FFF B;  3G31 A;  4OON A;  3SS3 A;  1K38 A;  4WYY A;  3HBR A;  3MKE A;  1U60 A;  1Z6F A;  1ERM A;  4MBK A;  1KVL A;  3BFC A;  1MKI A;  1IYO A;  4ID4 A;  2PU4 A;  4FCF A;  4DDY A;  4FH2 A;  1KE3 A;  2HDR A;  2ZM0 A;  3A3D A;  4HBU A;  1XPB A;  3BM6 A;  4JXW A;  1GHM A;  3MKF A;  2EX9 A;  1K6R A;  1LL5 A;  5AQ7 A;  1GHI A;  1W7F A;  4E3M A;  1QME A;  3C4O A;  1BUL A;  4ZDX A;  4S0L A;  4WZ5 A;  3Q7V B;  4Q8I A;  1W8Y A;  5A92 A;  4MBH A;  4RR6 A;  2EX8 A;  3IWQ A;  3VOZ A;  5KZH A;  3KO3 A;  4N9K A;  3HLE A;  4S2M A;  4BEN A;  3VP0 A;  4KZ3 A;  2OLU A;  4LV1 A;  3IHA A;  1PWC A;  3MFD A;  2I72 A;  5CRF A;  3OCN A;  1NYM A;  4MEZ A;  4KEN B;  4HEF A;  1JKE A;  1FR6 A;  4S2O A;  3C7V A;  5A91 A;  3BRM A;  4L0L A;  5KSH A;  1YT4 A;  3HLB A;  3TSG A;  1KE0 A;  3HUN A;  5EVI A;  3NDG A;  1YMX A;  2XQZ A;  5AQB A;  5FQJ A;  3TG9 A;  1BLP A;  3ZCZ A;  1KE4 A;  2DCF A;  3MZF A;  1FCN A;  4EV4 A;  3TOI A;  2QPN A;  1K57 C;  3ZG5 A;  5G18 A;  5DTS A;  1BUE A;  1HZO A;  3G32 A;  3G34 A;  4JLF A;  1ZC2 A;  3Q81 A;  3ZGA B;  4CJN A;  3OPR A;  3ITA A;  3IF5 A;  1IYS A;  3IF6 C;  4UA7 A;  4OP8 A;  2P9V A;  5GLA A;  3D4F A;  5CTN A;  1Y54 A;  2ZM8 A;  4R1G A;  5DTK A;  4QU3 A;  1ONG A;  4RRH A;  1YQS A;  3UPN A;  3HVF A;  3HLD A;  5FAT A;  3UO9 A;  3NBL A;  3UNW A;  4Y0O A;  2ZC6 B;  2R9W A;  1ES5 A;  2CC1 A;  2H0Y A;  2WKI A;  4FH4 A;  2X01 A;  3MXS A;  4RR8 A;  5M1A A;  1W79 A;  4S0I A;  1PYY A;  2Y2P A;  3E2K A;  3VMA A;  3O88 A;  1E3U D;  3C5A A;  3UE1 A;  3HUO A;  1XX2 A;  1FCM A;  3KO9 A;  3IWI A;  3LEZ A;  3S4X A;  1MWR A;  3EQV A;  3IXH A;  3UDX A;  2Y2K A;  2Y2I A;  4S2L A;  4DF6 A;  3OPP A;  5HX9 A;  1GHP A;  3ZVT A;  2OV5 A;  3VP2 A;  4D2O A;  4S2I A;  2EX6 A;  4E3N A;  3QNC A;  4KZ4 A;  1PI4 A;  1TVF A;  1FOF A;  4GDN A;  3WWX A;  3ZDJ A;  3NDE A;  3AGD A;  3G35 A;  3NC8 A;  2XLN A;  4S2N C;  4R4S A;  1E4D A;  1HVB A;  3N6I A;  4N1X A;  1KVM A;  1C3B A;  1I5Q A;  1JVJ A;  4S0J A;  2EXB A;  1M6K A;  2OLV A;  3IXD A;  4GB7 A;  4BD1 A;  3KOC A;  5KMW A;  2HP9 A;  4RRB A;  3GTC A;  3UPO A;  4DRT A;  4HES A;  2WGW B;  1FCO A;  4OH0 A;  1CEF A;  1YM1 A;  5CGS A;  4E3O A;  5A93 A;  3BFD A;  4DE3 A;  5E2H A;  4EBN A;  2BLS A;  1IKG A;  4KG5 A;  3Q7V A;  1JTD A;  1ESU A;  1J7G A;  1H8Y A;  1K55 C;  5GL9 A;  1NRF A;  1IEM A;  4HBT A;  4WMC A;  4R3J A;  4N9L A;  2WK0 A;  1JTG A;  1PW8 A;  1SCW A;  2Y2M A;  5KSC A;  3UY6 A;  2Y2H A;  4OLG A;  4P6B A;  5E2G A;  5IHV A;  5F1F A;  2EX2 A;  4RRK A;  4QJG A;  5EOE A;  1Q2Q A;  2X02 A;  3IWO A;  2WGV A;  4WM9 A;  4S2J A;  4ZAM A;  5FQI A;  1ERO A;  4C6Y A;  3MBZ A;  3LMV A;  1XA7 A;  2HDU A;  2JE5 A;  3Q7Z A;  2Y2Q A;  4OP5 A;  4Y0U A;  3G2Z A;  2HP6 A;  3LMU A;  4O7D A;  1GA9 A;  1ZG6 A;  3BEB A;  2Q9M A;  1JWV A;  3CG5 A;  4WZ5 C;  1K4E A;  4OPQ A;  3PD4 A;  3M2K A;  3SH7 A;  5GLD A;  1K25 A;  4RRL A;  2WKH A;  3ZG9 B;  1BSG A;  3A3F A;  5EVL A;  1MY8 A;  1PZP A;  5CHM A;  3N8S A;  2DRW A;  3SH8 A;  4EBP A;  2HDQ A;  4N1H A;  4Y7P A;  3ZG0 A;  3VSK A;  1GCE A;  3CZD A;  3GRJ A;  4OLD A;  3DWZ A;  3M6H A;  2Y2O A;  2ZC3 B;  2RL3 A;  4XUZ A;  3KNF A;  1FSW A;  4GN2 A;  3IF6 B;  3HLW A;  5GLC A;  2HL0 A;  1TDL A;  3SS5 A;  3BEC A;  2HPB A;  4BJP A;  3GSG A;  4GD6 A;  5HAP A;  5FAO A;  3C7U A;  1SKF A;  2IWC A;  2Y91 A;  2ZC7 A;  5EVI C;  4GZB A;  3PBS A;  2Y55 A;  1K54 A;  4X53 A;  4EWF A;  4QD4 A;  5CXW A;  3HLG A;  3RJU A;  5CGX A;  1RP5 A;  4GD8 A;  1ES4 A;  3OPL A;  1KGF A;  2WYX A;  3CJM A;  4E3L A;  3E2L A;  3GMW A;  1FR1 A;  2ZM2 A;  3FYZ A;  3G30 A;  1JWZ A;  4ZTK A;  5J8X A;  3UN7 A;  1DY6 A;  2HDS A;  3GV9 A;  1PZO A;  4PM7 A;  3Q1F A;  3PBQ A;  4P85 A;  1NZO A;  2WUQ A;  4C75 A;  3QHY A;  1FQG A;  1ONH A;  2V20 A;  2ZQ7 A;  5DF9 A;  5FA7 A;  3GVB A;  3HRE A;  1Y2Q A;  5E43 A;  5DTT A;  3N7W A;  3KOB A;  1ESI A;  5EOO A;  5TFQ A;  4OVD A;  2OKV A;  1L0F A;  3OPH A;  2EFX A;  4WEJ A;  2ZC4 B;  1N9B A;  1H8Z A;  1WYC A;  2ZJ9 A;  3VFF A;  3KO7 A;  1XA1 A;  1CI8 A;  5FAQ A;  4LV2 A;  1LL9 A;  4R3B A;  1NYY A;  1O07 A;  4EQI A;  2EFU A;  3VOY A;  3M6B A;  1MWT A;  2WZX A;  3V5M A;  1EWZ A;  3O87 A;  4X55 A;  4DE0 A;  3VSL A;  2J9P A;  1RGY A;  2FFY A;  4RRG A;  4JPM A;  4E3I A;  1YLT A;  1K56 D;  2ZQC A;  3Q82 A;  3IH9 A;  3VP4 A;  4M3K A;  3PD3 A;  1M40 A;  1XGI A;  3MXR A;  1NY0 A;  1MWU A;  2P74 A;  5F1G A;  5HAI A;  2J9O A;  1PI5 A;  4OPR A;  1TC5 A;  2Y2N A;  3QNB A;  2G2W A;  4U3T A;  4EUZ A;  1IKI A;  4QB8 A;  3VFH A;  4NK3 A;  1PIO A;  1PWD A;  4OQ0 A;  2WKE A;  4OKP A;  1E3U A;  3PAE A;  4OOY A;  1YLP A;  4MBF A;  3PD2 A;  3WRZ A;  5D3O A;  1MWS A;  1G6A A;  3Q07 A;  3UDF A;  4X56 A;  3VP1 A;  1IYP A;  1BLH A;  5GLB A;  2ZQA A;  4OPY A;  1VQQ A;  5FQ9 A;  5DF8 A;  3IXB A;  3AGF A;  4KZ5 A;  5HAR A;  2H5S A;  4BD0 A;  3OC2 A;  1KGG A;  2WAE A;  4ZJ3 A;  3W4P A;  4WEK A;  4RRC A;  2WAD A;  1XP4 A;  4KZ6 A;  2Y2J A;  4PPR A;  4IBR A;  4U0X A;  5EVI B;  4KQR A;  2DBO A;  4RVA A;  3ZNY A;  1J9M A;  4S0K A;  5BOH A;  5A90 A;  5CHJ A;  4PM9 A;  5GHZ A;  2E8I A;  3WS4 A;  4EBL A;  1VM1 A;  4K91 A;  3N4I A;  4JXV A;  1HD8 A;  1I2W A;  2BG1 A;  4R23 A;  3UDI A;  3B3X A;  4X6T A;  4OQH A;  4YIN A;  5FQM A;  4S2K A;  1S6R A;  3WS5 A;  1K6S A;  2J8Y A;  3PBO A;  3WRT A;  1LHY A;  3V3R A;  1XXM A;  4DDS A;  4JF4 A;  4F94 A;  5M18 A;  4GDB A;  2Z2M B;  5TGF A;  1IYQ A;  1PW1 A;  5E2E A;  2XGN A;  3N8L A;  3HLF A;  1SDN A;  1BLC A;  1K54 C;  2UWX A;  2WZZ A;  4Y0T A;  1K4F A;  1Q2P A;  1IEL A;  2EXA A;  5EUA A;  1YMS A;  1RGZ A;  2HP5 A;  2J7V A;  3BFF A;  3IT9 A;  3RXX A;  4JXS A;  4UA6 A;  2Y4A A;  4BLM A;  5L2F A;  3RXW A;  1YLW A;  1KDW A;  5TR7 A;  5I94 A;  3DTM A;  4RRJ A;  2JBF A;  5CHU A;  2WAF A;  1ES2 A;  1ZG4 A;  1LLB A;  3IH8 A;  5EEC A;  1JWP A;  4BQM A;  4MNR A;  2A3U A;  2C6W B;  5GHX A;  3KNP A;  4RRA A;  2ZQ8 A;  2JC7 A;  3HL9 A;  2A49 A;  1QMF A;  2ZMA A;  4OQI A;  3IHB A;  4PM8 A;  2XK1 A;  4RA7 A;  5FI7 A;  4KQQ A;  1BZA A;  4QHC A;  2XFS A;  3I7J A;  4KZ9 A;  3PBT A;  3ZG8 B;  4E6W A;  5HAQ A;  1DJA A;  1GA0 A;  3DW0 A;  3SS4 A;  2XEP A;  3WS2 A;  4PM5 A;  5CED A;  1LI0 A;  3WS0 A;  3IQA A;  3LY3 A;  4DE1 A;  1NXY A;  3ZNT A;  3P98 A;  4DKI A;  1G68 A;  4LCL A;  4U0T A;  5F83 A;  1AXB A;  4XXR A;  2GDN A;  5HL1 A;  2VGK A;  4BL3 A;  3V39 A;  2QZ6 A;  4K0W A;  5FAS A;  4Z9Q A;  4RR9 A;  4RYE A;  4UHU A;  3NY4 A;  4IBX A;  5JYP A;  3KO5 A;  4IVK A;  5U47 A;  4WZ4 A;  2Q9N A;  4K0X A;  3LCE A;  4H8R A;  4RRM A;  3BYD A;  3NCK A;  5E2F A;  4IED A;  3ZG7 B;  4R4R A;  3IXG A;  1WYB A;  3HUM A;  1YLY A;  4KZB A;  5FI6 A;  3ZVW A;  4X68 A;  5CTM A;  4X69 A;  5M19 A;  3A3I A;  5HW3 A;  1XGJ A;  1L0E A;  1W5D A;  3V3S A;  1OME A;  1ERQ A;  4UA9 A;  1H5X A;  1CI9 A;  1FSY A;  4E3K A;  5CEB A;  4RRD A;  2ZQ9 A;  1YLZ A;  4RRQ A;  3LO7 A;  2Y2G A;  2XR0 A;  3UE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...