2EXAA

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with farom
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
452
structure length
443
Chain Sequence
b'YITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYARIPLVRFESRLYKDIYQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
total genus 141
structure length 443
sequence length 452
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2exaA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2exaA02
2X02A 1NY0A 1S0WA 5HARA 4RX3A 5E2GA 4WZ5A 4N1HA 3MFDA 5GLAA 1ESIA 3WS0A 5EPHA 4E6WA 2IWDA 1M40A 2XD5A 2XK1A 3SS4A 3AGFA 1W79A 4MEZA 5E43A 2G2WA 1DJCA 4DDYA 4E3NA 3FKVA 4DE3A 5GLBA 2HP6A 4XUZA 5CERA 3QNBA 4FCFA 3WWXA 1BLHA 1KVMA 5CTNA 2ZC4B 3GV9A 5HX9A 3UNWA 5CHMA 4OPQA 3V5MA 3VOYA 1KE4A 4OQGA 3MKEA 3N8SA 5EECA 3HREA 2ZC7A 3C4OA 3VP0A 4KZAA 4BQMA 2PBYA 2HP5A 4IEDA 2ZMAA 1KE0A 5DF9A 4OPYA 5CEBA 3MXRA 3S4XA 2QMIA 4X68A 5JYPA 4JXVA 3ZVWA 1PI4A 1XKZA 2WGVA 3HUNA 2OV5A 1E3UA 4GDNA 2X01A 5A92A 2HDUA 3IF6A 4B4XA 5AQ7A 3S1YA 3HLCA 3NIAA 2XH9A 4KZ9A 3UE3A 3HLEA 3W8KA 3Q07A 2Y2KA 4O7DA 2EXBA 1K25A 2R9XA 2G2UA 2Y2HA 5F83A 3C4PA 3ZHHA 3LY3A 2BLSA 5CHJA 5F82A 4BD1A 1ES2A 3EQVA 3VFHA 1PWGA 4JKTA 4Y0TA 1YLWA 1LLBA 3G35A 3MXSA 4WEJA 3VSLA 2R9WA 3V3SA 5DTKA 4PM6A 1YMSA 3ISGA 3OZHA 3ZG9B 2H0YA 1OMEA 2I72A 4KQRA 5AQBA 1KVLA 1QMEA 3ZG7B 1BLPA 3ZCZA 3LY4A 2WKEA 3UPNA 1BLCA 4DKIA 2WGIA 3PBSA 4JF4A 3V50A 2CC1A 1I2WA 3UPPA 4CJNA 4LV3A 3VSKA 4OOMA 1CI9A 3PBRA 4E3IA 1G6AA 1KDWA 1PYYA 4DRTA 2XEPA 2XQZA 5E2HA 1N9BA 1ERQA 4M3KA 4Y0OA 4E3OA 1IYPA 1K6SA 1KGGA 3PAEA 3A3EA 3VMAA 4DF6A 1J9MA 5EOEA 2ZM2A 1K56D 4S2KA 3TG9A 3IF6C 1W8YA 3TSGA 1MXOA 3CMZA 3MBZA 3M6BA 4GB7A 3O87A 4R1GA 3G30A 1SDEA 3G34A 3VP1A 4UA9A 2J8YA 1C3BA 4LCMA 4RA7A 1Y54A 4KZ8A 1TDGA 4EUZA 2FFFB 1IEMA 5TFQA 2GDNA 3LCEA 4N1XA 1JWPA 3OCNA 1I5QA 4OH0A 4UA7A 1HZOA 2DCFA 3HUOA 5A91A 3IXDA 1GA0A 1PZOA 1BTLA 2J7VA 3ITBA 4KG5A 1NJ4A 4U0XA 3SH7A 1XA7A 4E6XA 4OOYA 3FZCA 4EBLA 3HLFA 2Y91A 3UE1A 5GLCA 4KG2A 2VGJA 5GHXA 2EXAA 3MKFA 3IWIA 1YLJA 2P9VB 3W4PA 5FQQA 3UDFA 5M18A 2EFXA 3NI9A 3W4OA 4KQOA 2ZD8A 4LENA 4OQIA 4S2OA 3G32A 4OLGA 1E4DA 1GA9A 4GZBA 3ZNYA 1ONHA 5M1AA 1M6KA 4IBRA 3BM6A 1EWZA 4KZ5A 4HEFA 3N7WA 3O3VA 3FYZA 3RXWA 2B5RA 3WS4A 1RGYA 2HDQA 2JBFA 4P85A 3WS2A 5KZHA 2V20A 4BLMA 3IF6B 4QU3A 1RP5A 4S2PA 2ZQ8A 5FQKA 2BG1A 4C75A 3MZEA 2WUQA 2Y2NA 5EE8A 5CGXA 2EX9A 1H5XA 2ZC3B 4D2OA 2XD1A 5FQJA 2J9OA 1NRFA 2JC7A 4X53A 1JWVA 2JCHA 3G4PA 1MKIA 3DW0A 4MBKA 4PM9A 4R4RA 3VOZA 4C3QA 5EVIA 5FI7A 3CG5A 5HL1A 4KZ6A 1ES4A 4KENB 5GL9A 4P87A 1NZUA 1RGZA 4OQ0A 4UA6A 4PMAA 4ZJ3A 1L0DA 1DY6A 5AQ9A 4H8RA 1ES5A 3BFFA 1YMXA 2V1ZA 1FSWA 1NYYA 1SDNA 1GHMA 2P74A 4QD4A 5EVLA 4KZ3A 1XGIA 4RVAA 5HAQA 4B4ZA 1MWUA 3M6HA 5EUAA 4K0XA 3WS1A 5A90A 2XFTA 1KGEA 3C7VA 2RCXA 3N8LA 3V39A 2EX2A 3IQAA 3ZG8B 4ZJ1A 3UO9A 2QPNA 4KZ7A 4N9LA 4S2IA 1PW8A 1ERMA 4JF5A 5AQAA 1MWSA 2EX8A 4FSFA 1L2SA 2JE5A 4HBUA 4WZ4A 1CEFA 4S2NA 3HL9A 1IKGA 4E3JA 3A3IA 4UHUA 3BYDA 1IKIA 1YLZA 3Q7VB 5DTSA 2XR0A 5FQIA 4EV4A 2Q9MA 3HBRA 1WE4A 4PM5A 2HP9A 5GHZA 4OPZA 3WRTA 1ZKJA 1JWZA 5GLDA 2IWCA 4EBNA 1TVFA 1K54C 1XX2A 3Q7ZA 1HTZA 2ZC5B 3BEBA 3P09A 3G2ZA 3UE0A 4UAAA 5EOOA 1CK3A 3G2YA 4DE0A 5HW3A 1PWDA 3BECA 4KZBA 1ZC2A 1NYMA 2Y2PA 3BFCA 2WGWA 4R3JA 4S2MA 3D4FA 5TGFA 3FWLA 4BENA 3C5AA 4GD6A 5EVID 3PBQA 1NXYA 3HUMA 4WEKA 5FQMA 1Q2PA 3O86A 4JXGA 4MNRA 2H5SA 5F1GA 4DXCA 5KSCA 3DWKA 2WKIA 1XPBA 1Q2QA 2WK0A 4K0WA 4OLDA 3VFFA 3ZG5A 2Y2GA 5BOHA 3RJUA 3V3RA 4X69A 5FAPA 4DE2A 2A49A 1GHIA 2Y2MA 4X6TA 5FASA 4XXRA 3BFDA 3GR2A 4ZTKA 4E3LA 3BFEA 2V2FF 1PI5A 4PPRA 5I94A 3HLGA 3A3FA 4GOGA 1IYQA 4N92A 4ZJ2A 4KQQA 4DE1A 1AXBA 4Y7PA 1L0EA 3HLBA 4IVKA 1ZG4A 2Q9NA 4ZAMA 1XA1A 4NK3A 1G68A 1YLYA 5D3OA 3GVBA 1IELA 1MPLA 3G31A 4OPRA 4X56A 4Q8IA 1CEGA 5FI2A 5G18A 3ZFZA 4QY6A 1O7EA 4R23A 5CRFA 2WAFA 3MZFA 1I2SA 2HDSA 1CI8A 1H8YA 1YT4A 2EFUA 3LEZA 3N6IA 4L0LA 2IWBA 1EROA 1YQSA 2ZM8A 3Q82A 5HFOA 1WYCA 3N8RA 5FQ9A 2Y55A 4P6BA 1WYBA 3IH8A 4IBXA 1DJAA 1ES3A 3WS5A 4BD0A 4ZBEA 1W8QA 3SH8A 2Y2QA 4GNUA 1JTGA 1PIOA 3PAGA 2Z2LB 1JTDA 3SS5A 3AGEA 3PBNA 4WMCD 4LCLA 3IWOA 1GCEA 4JBFA 4OKPA 1MWTA 2ZLYA 4JF6A 5DF8A 3ZNTA 2XLNA 1LI9A 1SKFA 2ZJ9A 1ZG6A 3IT9A 2A3UA 3QNCA 1VM1A 1ALQA 3IWQA 1FOFA 5FATA 5FAOA 3NDEA 2C6WB 1O07A 2ZQCA 4Z9QA 3HVFA 1SHVA 4EWFA 2X71A 4QY5A 3W4QA 1FSYA 4OOLA 3OPRA 4OVDA 2Y2OA 1LL5A 2XFSA 5CXWA 4WMCA 3JYIA 2XDMA 3ITAA 2ZQDA 1BLSA 3FV7A 1U60A 2WZZA 2ZQ9A 3GQZA 4EBPA 3OPHA 4MBHA 4CPKA 5FI6A 4PM8A 2WZXA 1KDSA 1S6RA 3IHAA 1LHYA 4MLLA 1YM1A 5FAQA 4YFMA 1K57C 4OQHA 1K54A 3RXXA 1KGFA 3ZG0A 4E3MA 3ZGAB 4Y0UA 2XF3A 1MWRA 1GHPA 1NZOA 4R4SA 3SS3A 3GSGA 3NY4A 2PU4A 4BJPA 4QB8A 2Y59A 4JXWA 3O88A 5J8XA 4KG6A 4R3BA 4IVIA 2H10A 3E2LA 3WRZA 2J9PA 4LV2A 5KSHA 3IH9A 2ZQAA 1W5DA 1BSGA 5FSRA 4ZDXA 1BZAA 2Z2MB 2E8IA 4N9KA 3BFGA 2WAEA 4HESA 4DXBA 4K91A 2DRWA 4F94A 3M2KA 3CJMA 3SH9A 1TEMA 3PBTA 4WZ5C 5DTTA 5FDHA 1KE3A 4S2NC 4B88A 4EQIA 5DVAA 3UPOA 1L0FA 1FCNA 4GD8A 1K55C 5CGSA 3M2JA 4JLFA 2WKHA 3UDIA 1K6RA 1MBLA 4JPMA 2WADA 4PM7A 5KMWA 5JYOA 1PWCA 1LI0A 1XXMA 3NCKA 5CEDA 5HAPA 1VQQA 2DNSA 4R0QA 5HAIA 1TDLA 1RCJA 3BRMA 2PU2A 4YINA 5EVIB 5DF7A 3CZDA 5F1FA 3N4IA 5A93A 3BLMA 1K55A 3HLWA 3OPLA 1BUEA 1SCWA 4S2JA 2H0TA 4DDSA 1YLTA 3NBLA 1E25A 1K56A 2VGKA 3DTMA 3MZDA 2QZ6A 3IXBA 1Z6FA 3P98A 2HDRA 3FKWA 3UY6A 3IXHA 4RYEA 3GRJA 2OLUA 4MBFA 1FR6A 1YLPA 5CTMA 1ESUA 1L0GA 2FFYA 4A5RA 3DWZA 1FQGA 5IHVA 3OCLA 3LO7A 4HBTA 4LV0A 1JVJA 4GDBA 1IYOA 2Y4AA 4GN2A 1EI5A 5M19A 1K4EA 3I7JA 4OP5A 1K4FA 5U47A 1LL9A 4OONA 2Y2IA 3OC2A 4P0MA 3UDXA 1IYSA 3E2KA 3PBOA 1K57A 1W7FA 4WYYA 2Y2JA 4U3TA 5L2FA 3A3DA 2Y2LA 2UWXA 2EX6A 3PTEA 3NC8A 3QHYA 1HD8A 2OLVA 3S22A 3AGDA 5E2FA 5FA7A 4S2LA 4GKUA 1PZPA 3OPPA 4KZ4A 5EVIC 4WM9A 2RL3A 3Q1FA 5CECA 3SOIA 5E2EA 4QHCA 4BL2A 2WYXA 5GHYA 2HPBA 1FCMA 2OSUA 3EQUA 1E3UD 1ONGA 3TOIA 1QMFA 3ZDJA 2C5WB 5CHUA 4BL3A 4U0TA 3GMWA 3VP3A 3NDGA 3IXGA 3Q7VA 3C7UA 1N4OA 3A3JA 1H8ZA 2ZQ7A 4FH4A 3IHBA 4RX2A 3UN7A 4XUXA 4LV1A 4OP8A 1FCOA 4WELA 4X55A 3HLDA 4QJGA 3B3XA 3ZVTA 1K38A 4ID4A 4JXSA 2ZC6B 3VP2A 3Q81A 3IF5A 4C6YA 2P9VA 1HVBA 3VP4A 1DJBA 1XGJA 3BLSA 4FH2A 5CGWA 4WBGA 1FR1A 4FD8A 2ZM0A 1BT5A 1BULA 4E3KA 2WGWB 1PW1A 1MY8A 1XP4A 2XGNA 3GTCA 4NETA 5TR7A
chains in the Genus database with same CATH superfamily
1NY0A 4ZRRA 3DTKA 4RX3A 4PKYG 3A0VA 1M40A 3FG8A 3QNBA 3WWXA 3LR3A 5HX9A 3GV9A 3UNWA 4CLCD 2KLIA 1MKMA 4OPQA 3HREA 2HF6A 4KZAA 3OOVA 5CEBA 2OKVA 3E4QA 3ZVWA 3HUNA 4QPRA 3S1YA 2XH9A 4KZ9A 1H8MA 3HLEA 1T1CA 3W8KA 2Y2KA 2G2UA 4PHTA 2EWVA 2BLSA 1G28A 3VFHA 3KO7A 3G35A 2GZAA 2R9WA 2HZ5A 4HOIA 1YMSA 3OZHA 3ZG9B 2H0YA 1KVLA 3LICA 2B02A 2LB9A 2V1AA 3UPNA 4DMZA 3V50A 1TS7A 2J80A 4WN5A 3T4TA 1CI9A 3TJZC 3UB5P 4DRTA 3PD3A 1IYPA 4S2KA 3LMTA 3T1RA 3TSGA 3MBZA 3M6BA 4GB7A 3CHWP 3G34A 3VP1A 1STZA 4HP9A 1C3BA 3IX8A 1FIKA 3UE6A 5TFQA 4OH0A 4I3AA 4UA7A 4EBLA 1HZOA 1PZOA 2JN7A 3VOLA 1LT0A 2D02A 3FZCA 3HLFA 2VGJA 5FEGA 2EXAA 3MKFA 2P9VB 5FQQA 4S2OA 3G32A 1M6KA 4RR9A 3RXWA 2JBFA 4X1MA 5J4EA 1ZHHB 2ACGA 4GLQA 5FQKA 2WUQA 4GHIB 4D2OA 5FQJA 2XD1A 4X53A 1JWVA 4PM9A 1XJ2A 3CG5A 4H6JA 2VJWA 4P87A 3KSHA 4PMAA 1L0DA 1Y4OA 4LRXC 1ES5A 1SZVA 3BFFA 1FSWA 5HDDA 2L1MA 3LR5A 4KZ3A 4K0XA 5A90A 2XFTA 1KGEA 2EX2A 2VX8A 3IQAA 4S2IA 5AQAA 2ZL1B 2K7SA 1MWSA 2EX8A 3T12B 4FSFA 4HBUA 1CEFA 4MMNA 3IS2B 3MXQA 5L07A 5TBMA 5HWWA 4E3JA 2FZ0A 2HGVA 3A3IA 2Q9MA 3HBRA 1WE4A 2HP9A 4MCWA 1JWZA 4HHDA 2IWCA 2QJ7A 3H9WA 4NXFA 2A2LA 3JPUA 1HTZA 1DRMA 1SKOA 2XRNA 4EEPA 4Y13A 3G2YA 2OWJA 5HW3A 2HL0A 2Y2PA 4R3JA 3D4FA 4BENA 1OT6A 3C5AA 4GD6A 5EVID 3PBQA 3F1PB 1NXYA 4CLCC 3O86A 2H5SA 4DXCA 3DWKA 1ZTUA 1XPBA 4K0WA 3UB9A 3RJUA 4HQAA 4HJ4A 3V3RA 2QJ5A 4DE2A 4X6TA 2Y2MA 5FASA 3BFDA 4E3LA 3BFEA 4RRQA 4ESPA 1PI5A 3EGXC 4RRMA 3HLGA 4DJ2A 4GOGA 4ZJ2A 1AXBA 4NK3A 4RR8A 1G68A 3FC7A 4MDZA 4D60A 3G31A 3BY8A 5HL6A 4QY6A 1VB6A 3N6IA 3R7WA 2W3FA 1YQSA 3N8RA 3LFVA 5HD3A 4R6LA 4CLCA 4GS9B 2PR6A 3VE3A 4GNUA 2DBOA 1JTGA 3KO3A 3F1OB 4Y15A 3SS5A 3PBNA 3LYXA 5G4YA 3DBAA 3ZNTA 5HWVA 2XLNA 2ZJ9A 1VM1A 5HD5A 1ALQA 3JVUA 1J7GA 4L9EA 4IJGA 2ZQCA 3HVFA 4EWFA 2HL2A 2D01A 4KUKA 2JKGA 4QY5A 4OVDA 4P6ZM 3NHQA 5CXWA 4WMCA 2VGLM 4UEYA 1BLSA 4HH3A 3GQZA 2W3HA 3OPHA 2WZXA 2XSSA 3IHAA 1YM1A 3R4KA 2PDRA 1K57C 1KGFA 4Y0UA 2XA7M 4R4SA 3HJKA 4BJPA 2Y59A 4IHQA 3O88A 4KG6A 4IVIA 2H10A 4LV2A 5KSHA 4IUKA 2E8IA 4DXBA 3JVVA 3U2AA 2J3TC 1KE3A 2W3DA 4B88A 2Y79A 1K55C 3M2JA 2WKHA 3W2ZA 2WADA 1LI0A 5CEDA 1VQQA 2DNSA 2O0YA 3BRMA 1RCJA 2VZWA 5A93A 2PYPA 4MN6A 3BLMA 1SCWA 1YLTA 4RRDA 4O8GA 2QZ6A 1Z6FA 3P98A 3UY6A 2B95A 4LV0A 4HBTA 2OOLA 1IYOA 2Y4AA 5M19A 4OP5A 5U47A 5HWTA 3OC2A 3E2KA 2MJ6A 2UWXA 1TS8A 3S7QA 3S22A 3AGDA 1SKOB 5EVIC 4WM9A 1LSVA 5F68A 5CECA 3UB6A 4WF0A 4QHCA 5GHYA 1P97A 1OTAA 1ONGA 3ZDJA 1QMFA 2GX5A 5CHUA 3PD5A 4U0TA 3VP3A 1H8ZA 5AVFA 2ZQ7A 4FH4A 3IHBA 4RX2A 1F5MA 4QJGA 3LIAA 1GSWA 3IF5A 3PXPA 2INWA 4FH2A 1FR1A 2Z6DA 5L8MA 3GTCA 2HKZA 4NETA 2OWHA 5TR7A 5HARA 4N1HA 5GLAA 3E4OA 3WS0A 2IWDA 2XD5A 4RRBA 1W79A 4E3NA 1NWZA 4B9OA 5CHMA 3V5MA 5EECA 3MKEA 4P6ZS 2VA0A 1OJ5A 4BQMA 4GS9A 4OPYA 3MXRA 3LIFA 1DP9A 4JXVA 1PI4A 3RH8B 3FPWA 3IF6A 4LRYC 4B4XA 3UE3A 1K25A 2Y2HA 3C4PA 3QP4A 5J61A 1F2KA 1OTIA 4NXBA 4JKTA 1YLWA 3V3SA 5DTKA 4PM6A 4KQRA 5AQBA 1QMEA 3LY4A 3T50A 1BLCA 2WGIA 3PBSA 2LB5A 3NOTC 3UPPA 4JGOA 1L3LA 3V67A 1N9BA 4M3KA 4Y0OA 2KOIA 1MC0A 1K6SA 1J9MA 3TG9A 3CPTA 4RRGA 1SDEA 4LCMA 4EUZA 5DFYA 2GDNA 3ZNYA 3BQAA 4EU0A 4BBVA 1VEUA 1VETB 3ITBA 4KG5A 3SH7A 1XA7A 4OOYA 3UE1A 2V1BA 5GHXA 3W4PA 3UDFA 3NECA 3NI9A 3W4OA 4KQOA 2ZD8A 4Q0HA 3K3DA 2HL1A 5MC7A 5A8BA 2K2NA 4NKPA 1GA9A 4OLGA 4I39A 5M1AA 5EV0A 3O3VA 2BTFP 2B5RA 1G5UA 3WS4A 1OTBA 4P85A 5J3WA 4WUJA 4S2PA 1RP5A 4R70A 5I5LA 4ME4A 2Y2NA 1H5XA 2J9OA 1NRFA 2GJ3A 3KNFA 1MKIA 3DW0A 4KZ6A 2XA7S 2QHKA 1NZUA 1RGZA 4UA6A 4ZJ3A 2A24A 4S0JA 4NBJA 3LI8A 2W0NA 2P74A 4RVAA 1MWUA 3M6HA 5EUAA 3WS1A 3LUQA 3V39A 3ZG8B 4KZ7A 4N9LA 1ERMA 5AVEA 1L2SA 2JE5A 1OT9A 1NLZA 4RRLA 4S2NA 3HL9A 3MSHA 1YLZA 2XR0A 5C5KA 4EV4A 3E4PA 2AVXA 3WRTA 5GLDA 1K54C 3Q7ZA 2ZC5B 4KUOA 5KIZA 3G2ZA 2P7JA 4DE0A 4HIAA 5HZHA 1NYMA 2WKPA 3FWLA 4WEKA 4HJ3A 2VLGA 3H82A 1Q2PA 3HCYA 5KSCA 2WKIA 1Q2QA 5BOHA 5HDSA 3H7WA 4XXRA 4HY8A 1YPRA 4II7A 4PPRA 4Q0JA 3F1NB 2V8CA 1IYQA 4KQQA 2Y8HA 3HLBA 1ZG4A 2Q9NA 1XA1A 1YLYA 5D3OA 2Z6CA 5TJJA 1MPLA 4OPRA 4R23A 1O7EA 2WAFA 3MZFA 1PFLA 3IX4A 1H8YA 2EFUA 3Q82A 4BWIA 1UWPX 5FQ9A 4Q0IA 2Y55A 3IH8A 4E04A 4IBXA 3WS5A 4BD0A 4ZBEA 1LSWA 3PAGA 2Z2LB 1JTDA 3KOBA 2Q0OA 3IBRA 3IWOA 1MWTA 2W3EA 2ZLYA 4JF6A 1JNUA 5DF8A 3CLOA 2ZOIA 3QNCA 2ZOHA 3EOIA 3F1OA 2OAP1 1N9NA 4Z9QA 3KO9A 1YAXA 1P0ZA 2JKRM 2Y2OA 3CPTB 2E8JA 5DKLA 2ZQDA 2ZMFA 4Y17A 3FV7A 2ZQ9A 2WZZA 4EBPA 4LPZA 3RXXA 3ZG0A 1VEUB 3PD4A 3GSGA 1W63Q 5J8XA 2V9AA 3WRZA 1Z09A 3KSFA 1BSGA 5FSRA 1IFQA 2PHYA 3T1QB 1YSQA 3BFGA 2WAEA 4K91A 1TEMA 4WZ5C 5DTTA 1N9LA 4S2NC 5DVAA 1L0FA 4EEUA 4EERA 3H82B 4GD8A 4JLFA 3UDIA 1K6RA 4JPMA 2B18A 3IBJA 3TW8A 5JYOA 2WKRA 1XXMA 3E98A 2KDKA 4HNBA 5HAIA 4G3VA 4ARZA 5DF7A 3CZDA 5F1FA 1K55A 3HLWA 5G4ZA 3ICYA 2EWWA 4DDSA 5CX7A 1K56A 2V0UA 4RRHA 1S4RA 3DTMA 3MZDA 3KNPA 2HDRA 4RYEA 1L0GA 2FFYA 2M1CA 3MR0A 3DWZA 4K08A 3LO7A 4GDBA 1K4EA 1P9WA 2YKHA 2Y2IA 3LR0A 3P7NA 4OONA 4UQIS 3PBOA 3MQOA 2Y2JA 4U3TA 4HH2A 2Y2LA 3PTEA 2EX6A 3NC8A 4S0KA 2VK3A 3UB8A 5FA7A 1PZPA 3UMDA 5E2EA 4XT2B 2HPBA 2OSUA 3EQUA 1E3UD 3TOIA 1N9OA 2EA9A 3NDGA 5F6AA 3C7UA 1N4OA 3A3JA 1K0KA 4LV1A 4WELA 3HLDA 1TF1A 1OTDA 3B3XA 2VV8A 1K38A 4ID4A 4JXSA 3VP2A 4C6YA 2JKFA 1DJBA 2W27A 2ZM0A 1BULA 4E3KA 1PW1A 2XGNA 1S0WA 5E2GA 3MFDA 4E6WA 4Y2FA 3SS4A 4MEZA 1DJCA 3FKVA 4DE3A 5GLBA 5CERA 4XUZA 1BLHA 3H7WB 2M7UA 1PNEA 3NULA 3VOYA 5FL3A 3N8SA 1TD5A 5IS1A 3VP0A 2HP5A 4IEDA 1KE0A 4JGRA 2QMIA 5JYPA 2VKSA 1XKZA 4GDNA 5IU1A 5A92A 5F5YA 2HDUA 3ZQ5A 5AQ7A 2PD7A 3Q07A 2EXBA 5DJTA 1A0KA 3LY3A 5CHJA 5F82A 3EQVA 3D72A 2QYBA 4M4XA 4EXOA 3VSLA 2IA2A 4WEJA 3T4OA 3B42A 3PR6A 1XFNA 3QP8A 2VEAA 3ISGA 2I72A 1BLPA 4EQ1A 2OAQ1 1F98A 2WKEA 4DKIA 2CC1A 4LV3A 4HP4A 1KDWA 2XEPA 1D7EA 5E2HA 2P04A 4E3OA 5EVEA 1KGGA 3A3EA 1J3WA 4NXEA 4DF6A 4L9GA 5EOEA 3FPVA 1K56D 2ZM2A 3C38A 3MQQA 3O87A 3MQ0A 3G30A 4UA9A 2J8YA 4CQHA 1TC5A 4DJ3A 1TDGA 2JKTM 2FFFB 4N1XA 3HUOA 1GA0A 4E6XA 2Y91A 3LIBA 5GLCA 5DFXA 4KG2A 1YLJA 4JGPA 5M18A 2HJEA 2EFXA 4WL9A 4LENA 4Y3IA 1D1JA 1E4DA 4GZBA 1ONHA 3BM6A 3KYEA 4HEFA 3FYZA 4BBTA 3WS2A 5KZHA 2PBDP 4C75A 2ZQ8A 2BG1A 3MZEA 5EE8A 2EX9A 2HV1A 2JCHA 4R4RA 3VOZA 5FI7A 3LGOA 1DY6A 3MS6A 4LRZE 4H8RA 4H6JB 1SDNA 1LSXA 4QD4A 4CLCB 1XGIA 2ZMVA 5HAQA 3C7VA 4ZJ1A 3O5YA 3UO9A 2QPNA 1PRQA 4LFUA 1EW0A 4WZ4A 3BYDA 1Y28A 5EM1A 5FQIA 5GHZA 4OPZA 4EBNA 5TBMB 1XX2A 4RRCA 2V8FA 4AFIA 4S0IA 3CUEA 5AJGA 4DN0A 2UV0E 2WGWA 3C2WA 3KODA 4S2MA 2V0WA 4G3KA 1TS6A 5TGFA 1WA9A 4MN7A 4S0LA 5FQMA 4MNRA 4CLCE 1JKEA 3VFFA 2PD8A 4OLDA 4X69A 5FAPA 2A49A 1GHIA 3QP6A 3T4JA 4ETXA 4ZTKA 1X0OA 3EWKA 2V2FF 4PAUA 3BQ8A 2PT7A 2PR5A 1S4SA 2KX6A 4DE1A 4IVKA 5K5BA 2VGLS 2NUTC 3SZTA 3GVBA 5FI2A 4R3AA 1I2SA 2HDSA 1CI8A 1YT4A 1UGUA 1W63M 2A24B 4L0LA 2ZM8A 5HFOA 3KO4A 4P6BA 3DAVA 1BYWA 4Y5FA 3CITA 1W8QA 3SH8A 3KSGA 3DTIA 3AGEA 1HLUP 4WMCD 2QWSA 1GCEA 4OKPA 3QP5A 1MZUA 3IWQA 2VV6A 3PD2A 4Z1WA 1FOFA 5FATA 2C6WB 4JGQA 2PAVP 2X71A 2BASA 4OOLA 3OPRA 3KYZA 1LL5A 2J3WA 2WKQA 3JYIA 3GDIA 2XDMA 3ITAA 3LIDA 4RRJA 3T1SA 4MBHA 4CPKA 3UB7A 4PM8A 1KDSA 1S6RA 3F1PA 1K54A 4OQHA 1MWRA 1NZOA 3NY4A 4QB8A 2L4RA 3MFXA 4JXWA 3S7NA 4FUWA 2W1RA 4R3BA 3E2LA 3VV4A 4ZDXA 2ZQAA 1W5DA 1NRJA 4F94A 3M2KA 3CJMA 3PBTA 3NOUC 5DJUA 4EQIA 3UPOA 1DP6A 1FCNA 1V9ZA 5CGSA 4R38A 1MBLA 1GSXA 4O0PA 1UWNX 3BJNA 5HAPA 4R0QA 1H3QA 4NG2A 5J7EA 2GNXA 4I3IA 2VV7A 5EVIB 2J3TD 3E0YA 3F1NA 3OPLA 4YOFA 2O9CA 4S02A 1E25A 4ARZB 2VGKA 3BW6A 1OJGA 3FKWA 3IXHA 3GRJA 1FR6A 1YLPA 1LL8A 3K2NA 1ESUA 4S03A 1JVJA 1DP8A 1CQAA 2NUPC 3LMVA 1V9YA 3L7HA 1K4FA 4P0MA 3UDXA 3DTEA 2W3GA 1FILA 3QP2A 1W7FA 4WYYA 1S1ZA 1S67L 4UQIM 4B93A 3T1XA 2G7UA 1GSVA 2OLVA 2H28A 4KZ4A 3Q1FA 3GECA 4BL2A 3KSIA 1FCMA 4RRAA 3IXGA 3Q7VA 3C8CA 3UN7A 3BY9A 4X55A 4RRFA 4L9FA 3EEHA 1S66L 5IT5A 2JKTI 1HVBA 3D9YA 3BLSA 5CGWA 4FD8A 2O9BA 4RR6A 4GW9A 2WGWB 2X02A 4WZ5A 4RQ9A 1ESIA 5EPHA 2XK1A 4DDYA 3AGFA 5E43A 2G2WA 1KOUA 3TRCA 5HPFA 2HP6A 4FCFA 5HDCA 1KVMA 5CTNA 2ZC4B 1KE4A 4OQGA 2ZC7A 3C4OA 2PBYA 4X1LA 2ZMAA 5DF9A 4I38A 3S4XA 4X68A 4F3LA 2WGVA 2OV5A 5L10A 1E3UA 3D3OA 3T4QA 3HLCA 3NIAA 4O7DA 3LI9A 2R9XA 5L09A 5F83A 3ZHHA 4EETB 3CI6A 4BD1A 1ES2A 1PWGA 1S1YA 4Y0TA 1LLBA 3MXSA 4KQDA 1OMEA 3ZG7B 1P9RA 3ZCZA 4BMWA 2PRFA 4JF4A 1AWIA 1T18A 1I2WA 4CJNA 3VSKA 3S7OA 4OOMA 3PBRA 2XROA 4E3IA 1G6AA 1PYYA 2XQZA 1ERQA 3B47A 3KOCA 3PAEA 3VMAA 3NJAA 3S7PA 3IF6C 1W8YA 1MXOA 3CMZA 3CWFA 4R1GA 2O99A 3LMUA 4RA7A 1Y54A 4KZ8A 4NBIA 3P01A 1IEMA 2X01A 3LCEA 5A91A 1JWPA 3LEQA 1I5QA 3OCNA 2DCFA 3IXDA 3EEAA 3G6OA 1BTLA 2J7VA 1IOUA 1NJ4A 4U0XA 3NOPC 3KO5A 4RRRA 3IWIA 5DKKA 1H0MA 4OQIA 2YKFA 2CMNA 2JHEA 1ODVA 4IBRA 1EWZA 4KZ5A 3N7WA 4LLOB 3A0SA 1RGYA 2HDQA 4FTXA 2V20A 4BLMA 3IF6B 4QU3A 3MJQA 3HJIA 2ZBBA 5CGXA 1YKDA 2ZC3B 2JC7A 3A0RA 4FOFA 3G4PA 4C3QA 4MBKA 5EVIA 5HL1A 1ES4A 4KENB 4GJ4A 5GL9A 3U4LP 4OQ0A 4RRIA 3R7WB 5AQ9A 3MF0A 4F3LB 1YMXA 2V1ZA 1NYYA 2K31A 3TE8A 1GHMA 1NLYA 5EVLA 4I3JA 4B4ZA 2RCXA 3N8LA 1PW8A 4JF5A 4NXGA 1Y2QA 2P08A 1IKGA 2W1TB 4UHUA 5DTSA 1IKIA 1CJFA 3Q7VB 4QWOA 1XJ3A 4PM5A 1ZKJA 1TVFA 3BEBA 3P09A 4YWZA 3UE0A 5F69A 4UAAA 5EOOA 1VETA 1CK3A 3OLOA 1PWDA 3BECA 4KZBA 1ZC2A 3BFCA 3L9KA 3KYQA 3HUMA 4JXGA 5F1GA 4X25A 1ACFA 5FEFA 2WK0A 3ZG5A 2Y2GA 3UMEA 1CF0A 3GR2A 5I94A 2HJ9C 4EESA 3A3FA 4N92A 4Y7PA 1L0EA 4RRKA 4ZAMA 3PHYA 1D06A 1IELA 4X56A 4Q8IA 1CEGA 5G18A 3ZFZA 5CRFA 4O01A 5EFWA 3LEZA 2IWBA 1EROA 3C30A 1WYCA 4PKYA 1WYBA 1DJAA 1ES3A 3SW1A 3LIEA 2Y2QA 1F9IA 1PIOA 5FDSA 4YNRA 4LCLA 2DMWA 4JBFA 4EW7A 2R78A 1LI9A 1SKFA 1ZG6A 3IT9A 2A3UA 1G6OA 1XFQA 5FAOA 3NDEA 1O07A 2O9AA 1SHVA 3T4SA 1VHMA 3T4LA 3W4QA 1FSYA 1XJ6A 5LBRA 2XFSA 4G3WA 1U60A 4HI4A 4MN5A 5FI6A 4MLLA 1LHYA 3VE4A 5FAQA 4YFMA 4E3MA 3ZGAB 1XJ4A 2XF3A 3T4KA 1GHPA 1TS0A 3SS3A 3CUEC 2PU4A 2FH5A 2J9PA 3KX0X 3IH9A 1BZAA 2Z2MB 3OBFA 5HPIA 4N9KA 4HESA 2DRWA 3SH9A 5FDHA 4ETZA 1OTEA 4PM7A 2QKPA 3K3CA 5KMWA 1PWCA 3NCKA 3CAXA 4GCZA 1TDLA 2M7VA 4EUVA 2PU2A 4YINA 3N4IA 3LR4A 1BUEA 4S2JA 2H0TA 4HJ6A 3NBLA 3PYPA 3MMHA 3IXBA 2OLUA 4GHIA 4MBFA 5CTMA 4A5RA 2PYRA 1FQGA 3IX3A 5IHVA 3OCLA 1T1BA 1T19A 4GN2A 1EI5A 3I7JA 1LL9A 2JKRI 1IYSA 2W1TA 1K57A 5L2FA 3A3DA 3ULFA 4WLAA 4XT2A 3QHYA 1HD8A 2I9VA 5E2FA 4BBUA 4S2LA 4GKUA 3OPPA 2ZL1A 3EGDC 2RL3A 4I5SA 3SOIA 3RTYA 4NEED 2WYXA 3IS2A 4BL3A 2C5WB 4LGWA 3GMWA 3KO6A 3B33A 3QP1A 4XUXA 4OP8A 1FCOA 2L0WA 3BWLA 3RFBA 3ZVTA 2ZC6B 3Q81A 2P9VA 3VP4A 4RR7A 1YSPA 1XGJA 1OPXA 4WBGA 4IUHA 5EM0A 3ZYTA 1BT5A 5HSQA 1MY8A 1T1AA 1XP4A
chains in the Genus database with same CATH topology
2X02A 1NY0A 1S0WA 5HARA 4RX3A 5E2GA 4WZ5A 4N1HA 3MFDA 5GLAA 1ESIA 3WS0A 5EPHA 4E6WA 2IWDA 1M40A 2XD5A 2XK1A 3SS4A 3AGFA 1W79A 4MEZA 5E43A 2G2WA 1DJCA 4DDYA 4E3NA 3FKVA 4DE3A 5GLBA 2HP6A 4XUZA 5CERA 3QNBA 4FCFA 3WWXA 1BLHA 1KVMA 5CTNA 2ZC4B 3GV9A 5HX9A 3UNWA 5CHMA 4OPQA 3V5MA 3VOYA 1KE4A 4OQGA 3MKEA 3N8SA 5EECA 3HREA 2ZC7A 3C4OA 3VP0A 4KZAA 4BQMA 2PBYA 2HP5A 4IEDA 2ZMAA 1KE0A 5DF9A 4OPYA 5CEBA 3MXRA 3S4XA 2QMIA 2OKVA 4X68A 5JYPA 4JXVA 3ZVWA 1PI4A 1XKZA 2WGVA 3HUNA 2OV5A 1E3UA 4GDNA 2X01A 5A92A 2HDUA 3IF6A 4B4XA 5AQ7A 3S1YA 3HLCA 3NIAA 2XH9A 4KZ9A 3UE3A 3HLEA 3W8KA 3Q07A 2Y2KA 4O7DA 2EXBA 1K25A 2R9XA 2G2UA 2Y2HA 5F83A 3C4PA 3ZHHA 3LY3A 2BLSA 5CHJA 5F82A 4RRBA 5J61A 4BD1A 1ES2A 3EQVA 3VFHA 3KO7A 1PWGA 4JKTA 4Y0TA 1YLWA 1LLBA 3G35A 3MXSA 4WEJA 3VSLA 2R9WA 3V3SA 5DTKA 4PM6A 1YMSA 3ISGA 3OZHA 3ZG9B 2H0YA 1OMEA 2I72A 4KQRA 5AQBA 1KVLA 1QMEA 3ZG7B 1BLPA 3ZCZA 3LY4A 2WKEA 3UPNA 1BLCA 4DKIA 2WGIA 3PBSA 4JF4A 3V50A 2CC1A 1I2WA 3UPPA 4CJNA 4LV3A 3VSKA 4OOMA 1CI9A 3PBRA 4E3IA 1G6AA 1KDWA 1PYYA 4DRTA 2XEPA 2XQZA 3PD3A 5E2HA 1N9BA 1ERQA 4M3KA 4Y0OA 4E3OA 1IYPA 3KOCA 1K6SA 1KGGA 3PAEA 3A3EA 3VMAA 4DF6A 1J9MA 5EOEA 2ZM2A 1K56D 4S2KA 3LMTA 3TG9A 3IF6C 1W8YA 3TSGA 1MXOA 3CMZA 3MBZA 3M6BA 4GB7A 4RRGA 3O87A 4R1GA 3G30A 1SDEA 3G34A 3VP1A 4UA9A 2J8YA 1C3BA 4LCMA 4RA7A 1TC5A 1Y54A 3LMUA 4KZ8A 1TDGA 4NBIA 4EUZA 2FFFB 1IEMA 5TFQA 2GDNA 3LCEA 4N1XA 1JWPA 3OCNA 1I5QA 4OH0A 4UA7A 1HZOA 2DCFA 3HUOA 5A91A 3IXDA 1GA0A 1PZOA 1BTLA 2J7VA 3ITBA 4KG5A 1NJ4A 4U0XA 3SH7A 1XA7A 4E6XA 4OOYA 3FZCA 4EBLA 3HLFA 2Y91A 3UE1A 5GLCA 3KO5A 4RRRA 4KG2A 2VGJA 5GHXA 2EXAA 3MKFA 3IWIA 1YLJA 2P9VB 3W4PA 5FQQA 3UDFA 5M18A 2EFXA 3NI9A 3W4OA 4KQOA 2ZD8A 4LENA 2HL1A 4OQIA 4S2OA 3G32A 4OLGA 1E4DA 1GA9A 4GZBA 3ZNYA 1ONHA 5M1AA 1M6KA 4IBRA 3BM6A 1EWZA 4KZ5A 4HEFA 3N7WA 3O3VA 3FYZA 4RR9A 3RXWA 2B5RA 3WS4A 1RGYA 2HDQA 2JBFA 4P85A 3WS2A 5KZHA 2V20A 4BLMA 3IF6B 4QU3A 1RP5A 4S2PA 2ZQ8A 5FQKA 2BG1A 4C75A 3MZEA 2WUQA 2Y2NA 5EE8A 5CGXA 2EX9A 1H5XA 2ZC3B 4D2OA 2XD1A 5FQJA 2J9OA 1NRFA 2JC7A 4X53A 1JWVA 2JCHA 3KNFA 3G4PA 1MKIA 3DW0A 4MBKA 4PM9A 4R4RA 3VOZA 4C3QA 5EVIA 5FI7A 3CG5A 5HL1A 4KZ6A 1ES4A 4KENB 5GL9A 4P87A 1NZUA 1RGZA 4OQ0A 4UA6A 4PMAA 4ZJ3A 4RRIA 1L0DA 1DY6A 4S0JA 5AQ9A 4H8RA 1ES5A 3BFFA 1YMXA 4NBJA 2V1ZA 1FSWA 1NYYA 1SDNA 1GHMA 2P74A 4QD4A 5EVLA 4KZ3A 1XGIA 4RVAA 5HAQA 4B4ZA 1MWUA 3M6HA 5EUAA 4K0XA 3WS1A 5A90A 2XFTA 1KGEA 3C7VA 2RCXA 3N8LA 3V39A 2EX2A 3IQAA 3ZG8B 4ZJ1A 3UO9A 2QPNA 4KZ7A 4N9LA 4S2IA 1PW8A 1ERMA 4JF5A 5AQAA 1MWSA 2EX8A 1Y2QA 4FSFA 1L2SA 2JE5A 4HBUA 4WZ4A 1CEFA 4RRLA 4S2NA 3HL9A 1IKGA 4E3JA 3A3IA 4UHUA 3BYDA 1IKIA 1YLZA 3Q7VB 5DTSA 2XR0A 5FQIA 4EV4A 2Q9MA 3HBRA 1WE4A 4PM5A 2HP9A 5GHZA 4OPZA 3WRTA 1ZKJA 1JWZA 5GLDA 2IWCA 4EBNA 1TVFA 1K54C 1XX2A 3Q7ZA 1HTZA 2ZC5B 3BEBA 3P09A 4RRCA 4S0IA 3G2ZA 3UE0A 4UAAA 5EOOA 1CK3A 3G2YA 4DE0A 5HW3A 1PWDA 3BECA 4KZBA 2HL0A 1ZC2A 1NYMA 2Y2PA 3BFCA 2WGWA 4R3JA 3KODA 4S2MA 3D4FA 5TGFA 3FWLA 4BENA 3C5AA 4GD6A 5EVID 3PBQA 1NXYA 3HUMA 4WEKA 4S0LA 5FQMA 1Q2PA 3O86A 4JXGA 4MNRA 2H5SA 5F1GA 4DXCA 5KSCA 3DWKA 1JKEA 2WKIA 1XPBA 1Q2QA 2WK0A 4K0WA 4OLDA 3VFFA 3ZG5A 2Y2GA 5BOHA 3RJUA 3V3RA 4X69A 5FAPA 4DE2A 2A49A 1GHIA 2Y2MA 4X6TA 5FASA 4XXRA 3BFDA 3GR2A 4ZTKA 4E3LA 3BFEA 4RRQA 2V2FF 1PI5A 4PPRA 5I94A 4RRMA 3HLGA 3A3FA 4GOGA 1IYQA 4N92A 4ZJ2A 4KQQA 4DE1A 1AXBA 4Y7PA 1L0EA 3HLBA 4IVKA 1ZG4A 2Q9NA 4RRKA 4ZAMA 1XA1A 4NK3A 4RR8A 1G68A 1YLYA 5D3OA 3GVBA 1IELA 1MPLA 3G31A 4OPRA 4X56A 4Q8IA 1CEGA 5FI2A 5G18A 3ZFZA 4QY6A 1O7EA 4R23A 5CRFA 2WAFA 3MZFA 1I2SA 2HDSA 1CI8A 1H8YA 1YT4A 2EFUA 3LEZA 3N6IA 4L0LA 2IWBA 1EROA 1YQSA 2ZM8A 3Q82A 5HFOA 1WYCA 3N8RA 5FQ9A 2Y55A 4P6BA 3KO4A 1WYBA 3IH8A 4IBXA 1DJAA 1ES3A 3WS5A 4BD0A 4ZBEA 1W8QA 3SH8A 2Y2QA 4GNUA 2DBOA 1JTGA 3KO3A 1PIOA 3PAGA 2Z2LB 1JTDA 3SS5A 3AGEA 3PBNA 4WMCD 3KOBA 4LCLA 3IWOA 1GCEA 4JBFA 4OKPA 1MWTA 2ZLYA 4JF6A 5DF8A 3ZNTA 2XLNA 1LI9A 1SKFA 2ZJ9A 1ZG6A 3IT9A 2A3UA 3QNCA 1VM1A 1ALQA 3IWQA 3PD2A 1FOFA 5FATA 1J7GA 5FAOA 3NDEA 2C6WB 1O07A 2ZQCA 4Z9QA 3HVFA 1SHVA 4EWFA 2HL2A 3KO9A 2X71A 4QY5A 3W4QA 1FSYA 4OOLA 3OPRA 4OVDA 2Y2OA 1LL5A 2XFSA 5CXWA 4WMCA 3JYIA 2XDMA 3ITAA 2ZQDA 1BLSA 4RRJA 3FV7A 1U60A 2WZZA 2ZQ9A 3GQZA 4EBPA 3OPHA 4MBHA 4CPKA 5FI6A 4PM8A 2WZXA 1KDSA 1S6RA 3IHAA 1LHYA 4MLLA 1YM1A 5FAQA 4YFMA 1K57C 4OQHA 1K54A 3RXXA 1KGFA 3ZG0A 4E3MA 3ZGAB 4Y0UA 2XF3A 1MWRA 1GHPA 1NZOA 4R4SA 3SS3A 3GSGA 3NY4A 3PD4A 2PU4A 4BJPA 4QB8A 2Y59A 4JXWA 3O88A 5J8XA 4KG6A 4R3BA 4IVIA 2H10A 3E2LA 3WRZA 2J9PA 4LV2A 5KSHA 3IH9A 2ZQAA 1W5DA 1BSGA 5FSRA 4ZDXA 1BZAA 2Z2MB 2E8IA 4N9KA 3BFGA 2WAEA 4HESA 4DXBA 4K91A 2DRWA 4F94A 3M2KA 3CJMA 3SH9A 1TEMA 3PBTA 4WZ5C 5DTTA 5FDHA 1KE3A 4S2NC 4B88A 4EQIA 5DVAA 3UPOA 1L0FA 1FCNA 4GD8A 1K55C 5CGSA 3M2JA 4JLFA 2WKHA 3UDIA 1K6RA 1MBLA 4JPMA 2WADA 4PM7A 5KMWA 5JYOA 1PWCA 1LI0A 1XXMA 3NCKA 5CEDA 5HAPA 1VQQA 2DNSA 4R0QA 5HAIA 1TDLA 1RCJA 3BRMA 2PU2A 4YINA 5EVIB 5DF7A 3CZDA 5F1FA 3N4IA 5A93A 3BLMA 1K55A 3HLWA 3OPLA 1BUEA 1SCWA 4S2JA 2H0TA 4DDSA 1YLTA 4S02A 3NBLA 1E25A 4RRDA 1K56A 2VGKA 4RRHA 3DTMA 3MZDA 2QZ6A 3IXBA 1Z6FA 3KNPA 3P98A 2HDRA 3FKWA 3UY6A 3IXHA 4RYEA 3GRJA 2OLUA 4MBFA 1FR6A 1YLPA 5CTMA 1ESUA 1L0GA 2FFYA 4A5RA 3DWZA 1FQGA 4S03A 5IHVA 3OCLA 3LO7A 4HBTA 4LV0A 1JVJA 4GDBA 1IYOA 2Y4AA 4GN2A 1EI5A 5M19A 3LMVA 1K4EA 3I7JA 4OP5A 1K4FA 5U47A 1LL9A 4OONA 2Y2IA 3OC2A 4P0MA 3UDXA 1IYSA 3E2KA 3PBOA 1K57A 1W7FA 4WYYA 2Y2JA 4U3TA 5L2FA 3A3DA 2Y2LA 2UWXA 2EX6A 3PTEA 3NC8A 4S0KA 3QHYA 1HD8A 2OLVA 3S22A 3AGDA 5E2FA 5FA7A 4S2LA 4GKUA 1PZPA 3OPPA 4KZ4A 5EVIC 4WM9A 2RL3A 3Q1FA 5CECA 3SOIA 5E2EA 4QHCA 4BL2A 2WYXA 5GHYA 2HPBA 1FCMA 2OSUA 3EQUA 1E3UD 1ONGA 3TOIA 1QMFA 3ZDJA 2C5WB 5CHUA 4BL3A 3PD5A 4RRAA 4U0TA 3GMWA 3VP3A 3NDGA 3IXGA 3Q7VA 3C7UA 1N4OA 3A3JA 1H8ZA 2ZQ7A 4FH4A 3IHBA 4RX2A 3UN7A 4XUXA 4LV1A 4OP8A 1FCOA 4WELA 4X55A 3HLDA 4QJGA 4RRFA 3B3XA 3ZVTA 1K38A 4ID4A 4JXSA 2ZC6B 3VP2A 3Q81A 3IF5A 4C6YA 2P9VA 1HVBA 3VP4A 1DJBA 1XGJA 4RR7A 3BLSA 4FH2A 5CGWA 4WBGA 1FR1A 4FD8A 2ZM0A 4RR6A 1BT5A 1BULA 4E3KA 2WGWB 1PW1A 1MY8A 1XP4A 2XGNA 3GTCA 2HKZA 4NETA 5TR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X02 A;  1NY0 A;  1S0W A;  5HAR A;  4RX3 A;  5E2G A;  4WZ5 A;  4N1H A;  3MFD A;  5GLA A;  1ESI A;  3WS0 A;  5EPH A;  4E6W A;  2IWD A;  1M40 A;  2XD5 A;  2XK1 A;  3SS4 A;  3AGF A;  1W79 A;  4MEZ A;  5E43 A;  2G2W A;  1DJC A;  4DDY A;  4E3N A;  3FKV A;  4DE3 A;  5GLB A;  2HP6 A;  4XUZ A;  5CER A;  3QNB A;  4FCF A;  3WWX A;  1BLH A;  1KVM A;  5CTN A;  2ZC4 B;  3GV9 A;  5HX9 A;  3UNW A;  5CHM A;  4OPQ A;  3V5M A;  3VOY A;  1KE4 A;  4OQG A;  3MKE A;  3N8S A;  5EEC A;  3HRE A;  2ZC7 A;  3C4O A;  3VP0 A;  4KZA A;  4BQM A;  2PBY A;  2HP5 A;  4IED A;  2ZMA A;  1KE0 A;  5DF9 A;  4OPY A;  5CEB A;  3MXR A;  3S4X A;  2QMI A;  4X68 A;  5JYP A;  4JXV A;  3ZVW A;  1PI4 A;  1XKZ A;  2WGV A;  3HUN A;  2OV5 A;  1E3U A;  4GDN A;  2X01 A;  5A92 A;  2HDU A;  3IF6 A;  4B4X A;  5AQ7 A;  3S1Y A;  3HLC A;  3NIA A;  2XH9 A;  4KZ9 A;  3UE3 A;  3HLE A;  3W8K A;  3Q07 A;  2Y2K A;  4O7D A;  2EXB A;  1K25 A;  2R9X A;  2G2U A;  2Y2H A;  5F83 A;  3C4P A;  3ZHH A;  3LY3 A;  2BLS A;  5CHJ A;  5F82 A;  4BD1 A;  1ES2 A;  3EQV A;  3VFH A;  1PWG A;  4JKT A;  4Y0T A;  1YLW A;  1LLB A;  3G35 A;  3MXS A;  4WEJ A;  3VSL A;  2R9W A;  3V3S A;  5DTK A;  4PM6 A;  1YMS A;  3ISG A;  3OZH A;  3ZG9 B;  2H0Y A;  1OME A;  2I72 A;  4KQR A;  5AQB A;  1KVL A;  1QME A;  3ZG7 B;  1BLP A;  3ZCZ A;  3LY4 A;  2WKE A;  3UPN A;  1BLC A;  4DKI A;  2WGI A;  3PBS A;  4JF4 A;  3V50 A;  2CC1 A;  1I2W A;  3UPP A;  4CJN A;  4LV3 A;  3VSK A;  4OOM A;  1CI9 A;  3PBR A;  4E3I A;  1G6A A;  1KDW A;  1PYY A;  4DRT A;  2XEP A;  2XQZ A;  5E2H A;  1N9B A;  1ERQ A;  4M3K A;  4Y0O A;  4E3O A;  1IYP A;  1K6S A;  1KGG A;  3PAE A;  3A3E A;  3VMA A;  4DF6 A;  1J9M A;  5EOE A;  2ZM2 A;  1K56 D;  4S2K A;  3TG9 A;  3IF6 C;  1W8Y A;  3TSG A;  1MXO A;  3CMZ A;  3MBZ A;  3M6B A;  4GB7 A;  3O87 A;  4R1G A;  3G30 A;  1SDE A;  3G34 A;  3VP1 A;  4UA9 A;  2J8Y A;  1C3B A;  4LCM A;  4RA7 A;  1Y54 A;  4KZ8 A;  1TDG A;  4EUZ A;  2FFF B;  1IEM A;  5TFQ A;  2GDN A;  3LCE A;  4N1X A;  1JWP A;  3OCN A;  1I5Q A;  4OH0 A;  4UA7 A;  1HZO A;  2DCF A;  3HUO A;  5A91 A;  3IXD A;  1GA0 A;  1PZO A;  1BTL A;  2J7V A;  3ITB A;  4KG5 A;  1NJ4 A;  4U0X A;  3SH7 A;  1XA7 A;  4E6X A;  4OOY A;  3FZC A;  4EBL A;  3HLF A;  2Y91 A;  3UE1 A;  5GLC A;  4KG2 A;  2VGJ A;  5GHX A;  2EXA A;  3MKF A;  3IWI A;  1YLJ A;  2P9V B;  3W4P A;  5FQQ A;  3UDF A;  5M18 A;  2EFX A;  3NI9 A;  3W4O A;  4KQO A;  2ZD8 A;  4LEN A;  4OQI A;  4S2O A;  3G32 A;  4OLG A;  1E4D A;  1GA9 A;  4GZB A;  3ZNY A;  1ONH A;  5M1A A;  1M6K A;  4IBR A;  3BM6 A;  1EWZ A;  4KZ5 A;  4HEF A;  3N7W A;  3O3V A;  3FYZ A;  3RXW A;  2B5R A;  3WS4 A;  1RGY A;  2HDQ A;  2JBF A;  4P85 A;  3WS2 A;  5KZH A;  2V20 A;  4BLM A;  3IF6 B;  4QU3 A;  1RP5 A;  4S2P A;  2ZQ8 A;  5FQK A;  2BG1 A;  4C75 A;  3MZE A;  2WUQ A;  2Y2N A;  5EE8 A;  5CGX A;  2EX9 A;  1H5X A;  2ZC3 B;  4D2O A;  2XD1 A;  5FQJ A;  2J9O A;  1NRF A;  2JC7 A;  4X53 A;  1JWV A;  2JCH A;  3G4P A;  1MKI A;  3DW0 A;  4MBK A;  4PM9 A;  4R4R A;  3VOZ A;  4C3Q A;  5EVI A;  5FI7 A;  3CG5 A;  5HL1 A;  4KZ6 A;  1ES4 A;  4KEN B;  5GL9 A;  4P87 A;  1NZU A;  1RGZ A;  4OQ0 A;  4UA6 A;  4PMA A;  4ZJ3 A;  1L0D A;  1DY6 A;  5AQ9 A;  4H8R A;  1ES5 A;  3BFF A;  1YMX A;  2V1Z A;  1FSW A;  1NYY A;  1SDN A;  1GHM A;  2P74 A;  4QD4 A;  5EVL A;  4KZ3 A;  1XGI A;  4RVA A;  5HAQ A;  4B4Z A;  1MWU A;  3M6H A;  5EUA A;  4K0X A;  3WS1 A;  5A90 A;  2XFT A;  1KGE A;  3C7V A;  2RCX A;  3N8L A;  3V39 A;  2EX2 A;  3IQA A;  3ZG8 B;  4ZJ1 A;  3UO9 A;  2QPN A;  4KZ7 A;  4N9L A;  4S2I A;  1PW8 A;  1ERM A;  4JF5 A;  5AQA A;  1MWS A;  2EX8 A;  4FSF A;  1L2S A;  2JE5 A;  4HBU A;  4WZ4 A;  1CEF A;  4S2N A;  3HL9 A;  1IKG A;  4E3J A;  3A3I A;  4UHU A;  3BYD A;  1IKI A;  1YLZ A;  3Q7V B;  5DTS A;  2XR0 A;  5FQI A;  4EV4 A;  2Q9M A;  3HBR A;  1WE4 A;  4PM5 A;  2HP9 A;  5GHZ A;  4OPZ A;  3WRT A;  1ZKJ A;  1JWZ A;  5GLD A;  2IWC A;  4EBN A;  1TVF A;  1K54 C;  1XX2 A;  3Q7Z A;  1HTZ A;  2ZC5 B;  3BEB A;  3P09 A;  3G2Z A;  3UE0 A;  4UAA A;  5EOO A;  1CK3 A;  3G2Y A;  4DE0 A;  5HW3 A;  1PWD A;  3BEC A;  4KZB A;  1ZC2 A;  1NYM A;  2Y2P A;  3BFC A;  2WGW A;  4R3J A;  4S2M A;  3D4F A;  5TGF A;  3FWL A;  4BEN A;  3C5A A;  4GD6 A;  5EVI D;  3PBQ A;  1NXY A;  3HUM A;  4WEK A;  5FQM A;  1Q2P A;  3O86 A;  4JXG A;  4MNR A;  2H5S A;  5F1G A;  4DXC A;  5KSC A;  3DWK A;  2WKI A;  1XPB A;  1Q2Q A;  2WK0 A;  4K0W A;  4OLD A;  3VFF A;  3ZG5 A;  2Y2G A;  5BOH A;  3RJU A;  3V3R A;  4X69 A;  5FAP A;  4DE2 A;  2A49 A;  1GHI A;  2Y2M A;  4X6T A;  5FAS A;  4XXR A;  3BFD A;  3GR2 A;  4ZTK A;  4E3L A;  3BFE A;  2V2F F;  1PI5 A;  4PPR A;  5I94 A;  3HLG A;  3A3F A;  4GOG A;  1IYQ A;  4N92 A;  4ZJ2 A;  4KQQ A;  4DE1 A;  1AXB A;  4Y7P A;  1L0E A;  3HLB A;  4IVK A;  1ZG4 A;  2Q9N A;  4ZAM A;  1XA1 A;  4NK3 A;  1G68 A;  1YLY A;  5D3O A;  3GVB A;  1IEL A;  1MPL A;  3G31 A;  4OPR A;  4X56 A;  4Q8I A;  1CEG A;  5FI2 A;  5G18 A;  3ZFZ A;  4QY6 A;  1O7E A;  4R23 A;  5CRF A;  2WAF A;  3MZF A;  1I2S A;  2HDS A;  1CI8 A;  1H8Y A;  1YT4 A;  2EFU A;  3LEZ A;  3N6I A;  4L0L A;  2IWB A;  1ERO A;  1YQS A;  2ZM8 A;  3Q82 A;  5HFO A;  1WYC A;  3N8R A;  5FQ9 A;  2Y55 A;  4P6B A;  1WYB A;  3IH8 A;  4IBX A;  1DJA A;  1ES3 A;  3WS5 A;  4BD0 A;  4ZBE A;  1W8Q A;  3SH8 A;  2Y2Q A;  4GNU A;  1JTG A;  1PIO A;  3PAG A;  2Z2L B;  1JTD A;  3SS5 A;  3AGE A;  3PBN A;  4WMC D;  4LCL A;  3IWO A;  1GCE A;  4JBF A;  4OKP A;  1MWT A;  2ZLY A;  4JF6 A;  5DF8 A;  3ZNT A;  2XLN A;  1LI9 A;  1SKF A;  2ZJ9 A;  1ZG6 A;  3IT9 A;  2A3U A;  3QNC A;  1VM1 A;  1ALQ A;  3IWQ A;  1FOF A;  5FAT A;  5FAO A;  3NDE A;  2C6W B;  1O07 A;  2ZQC A;  4Z9Q A;  3HVF A;  1SHV A;  4EWF A;  2X71 A;  4QY5 A;  3W4Q A;  1FSY A;  4OOL A;  3OPR A;  4OVD A;  2Y2O A;  1LL5 A;  2XFS A;  5CXW A;  4WMC A;  3JYI A;  2XDM A;  3ITA A;  2ZQD A;  1BLS A;  3FV7 A;  1U60 A;  2WZZ A;  2ZQ9 A;  3GQZ A;  4EBP A;  3OPH A;  4MBH A;  4CPK A;  5FI6 A;  4PM8 A;  2WZX A;  1KDS A;  1S6R A;  3IHA A;  1LHY A;  4MLL A;  1YM1 A;  5FAQ A;  4YFM A;  1K57 C;  4OQH A;  1K54 A;  3RXX A;  1KGF A;  3ZG0 A;  4E3M A;  3ZGA B;  4Y0U A;  2XF3 A;  1MWR A;  1GHP A;  1NZO A;  4R4S A;  3SS3 A;  3GSG A;  3NY4 A;  2PU4 A;  4BJP A;  4QB8 A;  2Y59 A;  4JXW A;  3O88 A;  5J8X A;  4KG6 A;  4R3B A;  4IVI A;  2H10 A;  3E2L A;  3WRZ A;  2J9P A;  4LV2 A;  5KSH A;  3IH9 A;  2ZQA A;  1W5D A;  1BSG A;  5FSR A;  4ZDX A;  1BZA A;  2Z2M B;  2E8I A;  4N9K A;  3BFG A;  2WAE A;  4HES A;  4DXB A;  4K91 A;  2DRW A;  4F94 A;  3M2K A;  3CJM A;  3SH9 A;  1TEM A;  3PBT A;  4WZ5 C;  5DTT A;  5FDH A;  1KE3 A;  4S2N C;  4B88 A;  4EQI A;  5DVA A;  3UPO A;  1L0F A;  1FCN A;  4GD8 A;  1K55 C;  5CGS A;  3M2J A;  4JLF A;  2WKH A;  3UDI A;  1K6R A;  1MBL A;  4JPM A;  2WAD A;  4PM7 A;  5KMW A;  5JYO A;  1PWC A;  1LI0 A;  1XXM A;  3NCK A;  5CED A;  5HAP A;  1VQQ A;  2DNS A;  4R0Q A;  5HAI A;  1TDL A;  1RCJ A;  3BRM A;  2PU2 A;  4YIN A;  5EVI B;  5DF7 A;  3CZD A;  5F1F A;  3N4I A;  5A93 A;  3BLM A;  1K55 A;  3HLW A;  3OPL A;  1BUE A;  1SCW A;  4S2J A;  2H0T A;  4DDS A;  1YLT A;  3NBL A;  1E25 A;  1K56 A;  2VGK A;  3DTM A;  3MZD A;  2QZ6 A;  3IXB A;  1Z6F A;  3P98 A;  2HDR A;  3FKW A;  3UY6 A;  3IXH A;  4RYE A;  3GRJ A;  2OLU A;  4MBF A;  1FR6 A;  1YLP A;  5CTM A;  1ESU A;  1L0G A;  2FFY A;  4A5R A;  3DWZ A;  1FQG A;  5IHV A;  3OCL A;  3LO7 A;  4HBT A;  4LV0 A;  1JVJ A;  4GDB A;  1IYO A;  2Y4A A;  4GN2 A;  1EI5 A;  5M19 A;  1K4E A;  3I7J A;  4OP5 A;  1K4F A;  5U47 A;  1LL9 A;  4OON A;  2Y2I A;  3OC2 A;  4P0M A;  3UDX A;  1IYS A;  3E2K A;  3PBO A;  1K57 A;  1W7F A;  4WYY A;  2Y2J A;  4U3T A;  5L2F A;  3A3D A;  2Y2L A;  2UWX A;  2EX6 A;  3PTE A;  3NC8 A;  3QHY A;  1HD8 A;  2OLV A;  3S22 A;  3AGD A;  5E2F A;  5FA7 A;  4S2L A;  4GKU A;  1PZP A;  3OPP A;  4KZ4 A;  5EVI C;  4WM9 A;  2RL3 A;  3Q1F A;  5CEC A;  3SOI A;  5E2E A;  4QHC A;  4BL2 A;  2WYX A;  5GHY A;  2HPB A;  1FCM A;  2OSU A;  3EQU A;  1E3U D;  1ONG A;  3TOI A;  1QMF A;  3ZDJ A;  2C5W B;  5CHU A;  4BL3 A;  4U0T A;  3GMW A;  3VP3 A;  3NDG A;  3IXG A;  3Q7V A;  3C7U A;  1N4O A;  3A3J A;  1H8Z A;  2ZQ7 A;  4FH4 A;  3IHB A;  4RX2 A;  3UN7 A;  4XUX A;  4LV1 A;  4OP8 A;  1FCO A;  4WEL A;  4X55 A;  3HLD A;  4QJG A;  3B3X A;  3ZVT A;  1K38 A;  4ID4 A;  4JXS A;  2ZC6 B;  3VP2 A;  3Q81 A;  3IF5 A;  4C6Y A;  2P9V A;  1HVB A;  3VP4 A;  1DJB A;  1XGJ A;  3BLS A;  4FH2 A;  5CGW A;  4WBG A;  1FR1 A;  4FD8 A;  2ZM0 A;  1BT5 A;  1BUL A;  4E3K A;  2WGW B;  1PW1 A;  1MY8 A;  1XP4 A;  2XGN A;  3GTC A;  4NET A;  5TR7 A; 
#chains in the Genus database with same CATH topology
 1NY0 A;  4ZRR A;  3DTK A;  4RX3 A;  4PKY G;  3A0V A;  1M40 A;  3FG8 A;  3QNB A;  3WWX A;  3LR3 A;  5HX9 A;  3GV9 A;  3UNW A;  4CLC D;  2KLI A;  1MKM A;  4OPQ A;  3HRE A;  2HF6 A;  4KZA A;  3OOV A;  5CEB A;  2OKV A;  3E4Q A;  3ZVW A;  3HUN A;  4QPR A;  3S1Y A;  2XH9 A;  4KZ9 A;  1H8M A;  3HLE A;  1T1C A;  3W8K A;  2Y2K A;  2G2U A;  4PHT A;  2EWV A;  2BLS A;  1G28 A;  3VFH A;  3KO7 A;  3G35 A;  2GZA A;  2R9W A;  2HZ5 A;  4HOI A;  1YMS A;  3OZH A;  3ZG9 B;  2H0Y A;  1KVL A;  3LIC A;  2B02 A;  2LB9 A;  2V1A A;  3UPN A;  4DMZ A;  3V50 A;  1TS7 A;  2J80 A;  4WN5 A;  3T4T A;  1CI9 A;  3TJZ C;  3UB5 P;  4DRT A;  3PD3 A;  1IYP A;  4S2K A;  3LMT A;  3T1R A;  3TSG A;  3MBZ A;  3M6B A;  4GB7 A;  3CHW P;  3G34 A;  3VP1 A;  1STZ A;  4HP9 A;  1C3B A;  3IX8 A;  1FIK A;  3UE6 A;  5TFQ A;  4OH0 A;  4I3A A;  4UA7 A;  4EBL A;  1HZO A;  1PZO A;  2JN7 A;  3VOL A;  1LT0 A;  2D02 A;  3FZC A;  3HLF A;  2VGJ A;  5FEG A;  2EXA A;  3MKF A;  2P9V B;  5FQQ A;  4S2O A;  3G32 A;  1M6K A;  4RR9 A;  3RXW A;  2JBF A;  4X1M A;  5J4E A;  1ZHH B;  2ACG A;  4GLQ A;  5FQK A;  2WUQ A;  4GHI B;  4D2O A;  5FQJ A;  2XD1 A;  4X53 A;  1JWV A;  4PM9 A;  1XJ2 A;  3CG5 A;  4H6J A;  2VJW A;  4P87 A;  3KSH A;  4PMA A;  1L0D A;  1Y4O A;  4LRX C;  1ES5 A;  1SZV A;  3BFF A;  1FSW A;  5HDD A;  2L1M A;  3LR5 A;  4KZ3 A;  4K0X A;  5A90 A;  2XFT A;  1KGE A;  2EX2 A;  2VX8 A;  3IQA A;  4S2I A;  5AQA A;  2ZL1 B;  2K7S A;  1MWS A;  2EX8 A;  3T12 B;  4FSF A;  4HBU A;  1CEF A;  4MMN A;  3IS2 B;  3MXQ A;  5L07 A;  5TBM A;  5HWW A;  4E3J A;  2FZ0 A;  2HGV A;  3A3I A;  2Q9M A;  3HBR A;  1WE4 A;  2HP9 A;  4MCW A;  1JWZ A;  4HHD A;  2IWC A;  2QJ7 A;  3H9W A;  4NXF A;  2A2L A;  3JPU A;  1HTZ A;  1DRM A;  1SKO A;  2XRN A;  4EEP A;  4Y13 A;  3G2Y A;  2OWJ A;  5HW3 A;  2HL0 A;  2Y2P A;  4R3J A;  3D4F A;  4BEN A;  1OT6 A;  3C5A A;  4GD6 A;  5EVI D;  3PBQ A;  3F1P B;  1NXY A;  4CLC C;  3O86 A;  2H5S A;  4DXC A;  3DWK A;  1ZTU A;  1XPB A;  4K0W A;  3UB9 A;  3RJU A;  4HQA A;  4HJ4 A;  3V3R A;  2QJ5 A;  4DE2 A;  4X6T A;  2Y2M A;  5FAS A;  3BFD A;  4E3L A;  3BFE A;  4RRQ A;  4ESP A;  1PI5 A;  3EGX C;  4RRM A;  3HLG A;  4DJ2 A;  4GOG A;  4ZJ2 A;  1AXB A;  4NK3 A;  4RR8 A;  1G68 A;  3FC7 A;  4MDZ A;  4D60 A;  3G31 A;  3BY8 A;  5HL6 A;  4QY6 A;  1VB6 A;  3N6I A;  3R7W A;  2W3F A;  1YQS A;  3N8R A;  3LFV A;  5HD3 A;  4R6L A;  4CLC A;  4GS9 B;  2PR6 A;  3VE3 A;  4GNU A;  2DBO A;  1JTG A;  3KO3 A;  3F1O B;  4Y15 A;  3SS5 A;  3PBN A;  3LYX A;  5G4Y A;  3DBA A;  3ZNT A;  5HWV A;  2XLN A;  2ZJ9 A;  1VM1 A;  5HD5 A;  1ALQ A;  3JVU A;  1J7G A;  4L9E A;  4IJG A;  2ZQC A;  3HVF A;  4EWF A;  2HL2 A;  2D01 A;  4KUK A;  2JKG A;  4QY5 A;  4OVD A;  4P6Z M;  3NHQ A;  5CXW A;  4WMC A;  2VGL M;  4UEY A;  1BLS A;  4HH3 A;  3GQZ A;  2W3H A;  3OPH A;  2WZX A;  2XSS A;  3IHA A;  1YM1 A;  3R4K A;  2PDR A;  1K57 C;  1KGF A;  4Y0U A;  2XA7 M;  4R4S A;  3HJK A;  4BJP A;  2Y59 A;  4IHQ A;  3O88 A;  4KG6 A;  4IVI A;  2H10 A;  4LV2 A;  5KSH A;  4IUK A;  2E8I A;  4DXB A;  3JVV A;  3U2A A;  2J3T C;  1KE3 A;  2W3D A;  4B88 A;  2Y79 A;  1K55 C;  3M2J A;  2WKH A;  3W2Z A;  2WAD A;  1LI0 A;  5CED A;  1VQQ A;  2DNS A;  2O0Y A;  3BRM A;  1RCJ A;  2VZW A;  5A93 A;  2PYP A;  4MN6 A;  3BLM A;  1SCW A;  1YLT A;  4RRD A;  4O8G A;  2QZ6 A;  1Z6F A;  3P98 A;  3UY6 A;  2B95 A;  4LV0 A;  4HBT A;  2OOL A;  1IYO A;  2Y4A A;  5M19 A;  4OP5 A;  5U47 A;  5HWT A;  3OC2 A;  3E2K A;  2MJ6 A;  2UWX A;  1TS8 A;  3S7Q A;  3S22 A;  3AGD A;  1SKO B;  5EVI C;  4WM9 A;  1LSV A;  5F68 A;  5CEC A;  3UB6 A;  4WF0 A;  4QHC A;  5GHY A;  1P97 A;  1OTA A;  1ONG A;  3ZDJ A;  1QMF A;  2GX5 A;  5CHU A;  3PD5 A;  4U0T A;  3VP3 A;  1H8Z A;  5AVF A;  2ZQ7 A;  4FH4 A;  3IHB A;  4RX2 A;  1F5M A;  4QJG A;  3LIA A;  1GSW A;  3IF5 A;  3PXP A;  2INW A;  4FH2 A;  1FR1 A;  2Z6D A;  5L8M A;  3GTC A;  2HKZ A;  4NET A;  2OWH A;  5TR7 A;  5HAR A;  4N1H A;  5GLA A;  3E4O A;  3WS0 A;  2IWD A;  2XD5 A;  4RRB A;  1W79 A;  4E3N A;  1NWZ A;  4B9O A;  5CHM A;  3V5M A;  5EEC A;  3MKE A;  4P6Z S;  2VA0 A;  1OJ5 A;  4BQM A;  4GS9 A;  4OPY A;  3MXR A;  3LIF A;  1DP9 A;  4JXV A;  1PI4 A;  3RH8 B;  3FPW A;  3IF6 A;  4LRY C;  4B4X A;  3UE3 A;  1K25 A;  2Y2H A;  3C4P A;  3QP4 A;  5J61 A;  1F2K A;  1OTI A;  4NXB A;  4JKT A;  1YLW A;  3V3S A;  5DTK A;  4PM6 A;  4KQR A;  5AQB A;  1QME A;  3LY4 A;  3T50 A;  1BLC A;  2WGI A;  3PBS A;  2LB5 A;  3NOT C;  3UPP A;  4JGO A;  1L3L A;  3V67 A;  1N9B A;  4M3K A;  4Y0O A;  2KOI A;  1MC0 A;  1K6S A;  1J9M A;  3TG9 A;  3CPT A;  4RRG A;  1SDE A;  4LCM A;  4EUZ A;  5DFY A;  2GDN A;  3ZNY A;  3BQA A;  4EU0 A;  4BBV A;  1VEU A;  1VET B;  3ITB A;  4KG5 A;  3SH7 A;  1XA7 A;  4OOY A;  3UE1 A;  2V1B A;  5GHX A;  3W4P A;  3UDF A;  3NEC A;  3NI9 A;  3W4O A;  4KQO A;  2ZD8 A;  4Q0H A;  3K3D A;  2HL1 A;  5MC7 A;  5A8B A;  2K2N A;  4NKP A;  1GA9 A;  4OLG A;  4I39 A;  5M1A A;  5EV0 A;  3O3V A;  2BTF P;  2B5R A;  1G5U A;  3WS4 A;  1OTB A;  4P85 A;  5J3W A;  4WUJ A;  4S2P A;  1RP5 A;  4R70 A;  5I5L A;  4ME4 A;  2Y2N A;  1H5X A;  2J9O A;  1NRF A;  2GJ3 A;  3KNF A;  1MKI A;  3DW0 A;  4KZ6 A;  2XA7 S;  2QHK A;  1NZU A;  1RGZ A;  4UA6 A;  4ZJ3 A;  2A24 A;  4S0J A;  4NBJ A;  3LI8 A;  2W0N A;  2P74 A;  4RVA A;  1MWU A;  3M6H A;  5EUA A;  3WS1 A;  3LUQ A;  3V39 A;  3ZG8 B;  4KZ7 A;  4N9L A;  1ERM A;  5AVE A;  1L2S A;  2JE5 A;  1OT9 A;  1NLZ A;  4RRL A;  4S2N A;  3HL9 A;  3MSH A;  1YLZ A;  2XR0 A;  5C5K A;  4EV4 A;  3E4P A;  2AVX A;  3WRT A;  5GLD A;  1K54 C;  3Q7Z A;  2ZC5 B;  4KUO A;  5KIZ A;  3G2Z A;  2P7J A;  4DE0 A;  4HIA A;  5HZH A;  1NYM A;  2WKP A;  3FWL A;  4WEK A;  4HJ3 A;  2VLG A;  3H82 A;  1Q2P A;  3HCY A;  5KSC A;  2WKI A;  1Q2Q A;  5BOH A;  5HDS A;  3H7W A;  4XXR A;  4HY8 A;  1YPR A;  4II7 A;  4PPR A;  4Q0J A;  3F1N B;  2V8C A;  1IYQ A;  4KQQ A;  2Y8H A;  3HLB A;  1ZG4 A;  2Q9N A;  1XA1 A;  1YLY A;  5D3O A;  2Z6C A;  5TJJ A;  1MPL A;  4OPR A;  4R23 A;  1O7E A;  2WAF A;  3MZF A;  1PFL A;  3IX4 A;  1H8Y A;  2EFU A;  3Q82 A;  4BWI A;  1UWP X;  5FQ9 A;  4Q0I A;  2Y55 A;  3IH8 A;  4E04 A;  4IBX A;  3WS5 A;  4BD0 A;  4ZBE A;  1LSW A;  3PAG A;  2Z2L B;  1JTD A;  3KOB A;  2Q0O A;  3IBR A;  3IWO A;  1MWT A;  2W3E A;  2ZLY A;  4JF6 A;  1JNU A;  5DF8 A;  3CLO A;  2ZOI A;  3QNC A;  2ZOH A;  3EOI A;  3F1O A;  2OAP 1;  1N9N A;  4Z9Q A;  3KO9 A;  1YAX A;  1P0Z A;  2JKR M;  2Y2O A;  3CPT B;  2E8J A;  5DKL A;  2ZQD A;  2ZMF A;  4Y17 A;  3FV7 A;  2ZQ9 A;  2WZZ A;  4EBP A;  4LPZ A;  3RXX A;  3ZG0 A;  1VEU B;  3PD4 A;  3GSG A;  1W63 Q;  5J8X A;  2V9A A;  3WRZ A;  1Z09 A;  3KSF A;  1BSG A;  5FSR A;  1IFQ A;  2PHY A;  3T1Q B;  1YSQ A;  3BFG A;  2WAE A;  4K91 A;  1TEM A;  4WZ5 C;  5DTT A;  1N9L A;  4S2N C;  5DVA A;  1L0F A;  4EEU A;  4EER A;  3H82 B;  4GD8 A;  4JLF A;  3UDI A;  1K6R A;  4JPM A;  2B18 A;  3IBJ A;  3TW8 A;  5JYO A;  2WKR A;  1XXM A;  3E98 A;  2KDK A;  4HNB A;  5HAI A;  4G3V A;  4ARZ A;  5DF7 A;  3CZD A;  5F1F A;  1K55 A;  3HLW A;  5G4Z A;  3ICY A;  2EWW A;  4DDS A;  5CX7 A;  1K56 A;  2V0U A;  4RRH A;  1S4R A;  3DTM A;  3MZD A;  3KNP A;  2HDR A;  4RYE A;  1L0G A;  2FFY A;  2M1C A;  3MR0 A;  3DWZ A;  4K08 A;  3LO7 A;  4GDB A;  1K4E A;  1P9W A;  2YKH A;  2Y2I A;  3LR0 A;  3P7N A;  4OON A;  4UQI S;  3PBO A;  3MQO A;  2Y2J A;  4U3T A;  4HH2 A;  2Y2L A;  3PTE A;  2EX6 A;  3NC8 A;  4S0K A;  2VK3 A;  3UB8 A;  5FA7 A;  1PZP A;  3UMD A;  5E2E A;  4XT2 B;  2HPB A;  2OSU A;  3EQU A;  1E3U D;  3TOI A;  1N9O A;  2EA9 A;  3NDG A;  5F6A A;  3C7U A;  1N4O A;  3A3J A;  1K0K A;  4LV1 A;  4WEL A;  3HLD A;  1TF1 A;  1OTD A;  3B3X A;  2VV8 A;  1K38 A;  4ID4 A;  4JXS A;  3VP2 A;  4C6Y A;  2JKF A;  1DJB A;  2W27 A;  2ZM0 A;  1BUL A;  4E3K A;  1PW1 A;  2XGN A;  1S0W A;  5E2G A;  3MFD A;  4E6W A;  4Y2F A;  3SS4 A;  4MEZ A;  1DJC A;  3FKV A;  4DE3 A;  5GLB A;  5CER A;  4XUZ A;  1BLH A;  3H7W B;  2M7U A;  1PNE A;  3NUL A;  3VOY A;  5FL3 A;  3N8S A;  1TD5 A;  5IS1 A;  3VP0 A;  2HP5 A;  4IED A;  1KE0 A;  4JGR A;  2QMI A;  5JYP A;  2VKS A;  1XKZ A;  4GDN A;  5IU1 A;  5A92 A;  5F5Y A;  2HDU A;  3ZQ5 A;  5AQ7 A;  2PD7 A;  3Q07 A;  2EXB A;  5DJT A;  1A0K A;  3LY3 A;  5CHJ A;  5F82 A;  3EQV A;  3D72 A;  2QYB A;  4M4X A;  4EXO A;  3VSL A;  2IA2 A;  4WEJ A;  3T4O A;  3B42 A;  3PR6 A;  1XFN A;  3QP8 A;  2VEA A;  3ISG A;  2I72 A;  1BLP A;  4EQ1 A;  2OAQ 1;  1F98 A;  2WKE A;  4DKI A;  2CC1 A;  4LV3 A;  4HP4 A;  1KDW A;  2XEP A;  1D7E A;  5E2H A;  2P04 A;  4E3O A;  5EVE A;  1KGG A;  3A3E A;  1J3W A;  4NXE A;  4DF6 A;  4L9G A;  5EOE A;  3FPV A;  1K56 D;  2ZM2 A;  3C38 A;  3MQQ A;  3O87 A;  3MQ0 A;  3G30 A;  4UA9 A;  2J8Y A;  4CQH A;  1TC5 A;  4DJ3 A;  1TDG A;  2JKT M;  2FFF B;  4N1X A;  3HUO A;  1GA0 A;  4E6X A;  2Y91 A;  3LIB A;  5GLC A;  5DFX A;  4KG2 A;  1YLJ A;  4JGP A;  5M18 A;  2HJE A;  2EFX A;  4WL9 A;  4LEN A;  4Y3I A;  1D1J A;  1E4D A;  4GZB A;  1ONH A;  3BM6 A;  3KYE A;  4HEF A;  3FYZ A;  4BBT A;  3WS2 A;  5KZH A;  2PBD P;  4C75 A;  2ZQ8 A;  2BG1 A;  3MZE A;  5EE8 A;  2EX9 A;  2HV1 A;  2JCH A;  4R4R A;  3VOZ A;  5FI7 A;  3LGO A;  1DY6 A;  3MS6 A;  4LRZ E;  4H8R A;  4H6J B;  1SDN A;  1LSX A;  4QD4 A;  4CLC B;  1XGI A;  2ZMV A;  5HAQ A;  3C7V A;  4ZJ1 A;  3O5Y A;  3UO9 A;  2QPN A;  1PRQ A;  4LFU A;  1EW0 A;  4WZ4 A;  3BYD A;  1Y28 A;  5EM1 A;  5FQI A;  5GHZ A;  4OPZ A;  4EBN A;  5TBM B;  1XX2 A;  4RRC A;  2V8F A;  4AFI A;  4S0I A;  3CUE A;  5AJG A;  4DN0 A;  2UV0 E;  2WGW A;  3C2W A;  3KOD A;  4S2M A;  2V0W A;  4G3K A;  1TS6 A;  5TGF A;  1WA9 A;  4MN7 A;  4S0L A;  5FQM A;  4MNR A;  4CLC E;  1JKE A;  3VFF A;  2PD8 A;  4OLD A;  4X69 A;  5FAP A;  2A49 A;  1GHI A;  3QP6 A;  3T4J A;  4ETX A;  4ZTK A;  1X0O A;  3EWK A;  2V2F F;  4PAU A;  3BQ8 A;  2PT7 A;  2PR5 A;  1S4S A;  2KX6 A;  4DE1 A;  4IVK A;  5K5B A;  2VGL S;  2NUT C;  3SZT A;  3GVB A;  5FI2 A;  4R3A A;  1I2S A;  2HDS A;  1CI8 A;  1YT4 A;  1UGU A;  1W63 M;  2A24 B;  4L0L A;  2ZM8 A;  5HFO A;  3KO4 A;  4P6B A;  3DAV A;  1BYW A;  4Y5F A;  3CIT A;  1W8Q A;  3SH8 A;  3KSG A;  3DTI A;  3AGE A;  1HLU P;  4WMC D;  2QWS A;  1GCE A;  4OKP A;  3QP5 A;  1MZU A;  3IWQ A;  2VV6 A;  3PD2 A;  4Z1W A;  1FOF A;  5FAT A;  2C6W B;  4JGQ A;  2PAV P;  2X71 A;  2BAS A;  4OOL A;  3OPR A;  3KYZ A;  1LL5 A;  2J3W A;  2WKQ A;  3JYI A;  3GDI A;  2XDM A;  3ITA A;  3LID A;  4RRJ A;  3T1S A;  4MBH A;  4CPK A;  3UB7 A;  4PM8 A;  1KDS A;  1S6R A;  3F1P A;  1K54 A;  4OQH A;  1MWR A;  1NZO A;  3NY4 A;  4QB8 A;  2L4R A;  3MFX A;  4JXW A;  3S7N A;  4FUW A;  2W1R A;  4R3B A;  3E2L A;  3VV4 A;  4ZDX A;  2ZQA A;  1W5D A;  1NRJ A;  4F94 A;  3M2K A;  3CJM A;  3PBT A;  3NOU C;  5DJU A;  4EQI A;  3UPO A;  1DP6 A;  1FCN A;  1V9Z A;  5CGS A;  4R38 A;  1MBL A;  1GSX A;  4O0P A;  1UWN X;  3BJN A;  5HAP A;  4R0Q A;  1H3Q A;  4NG2 A;  5J7E A;  2GNX A;  4I3I A;  2VV7 A;  5EVI B;  2J3T D;  3E0Y A;  3F1N A;  3OPL A;  4YOF A;  2O9C A;  4S02 A;  1E25 A;  4ARZ B;  2VGK A;  3BW6 A;  1OJG A;  3FKW A;  3IXH A;  3GRJ A;  1FR6 A;  1YLP A;  1LL8 A;  3K2N A;  1ESU A;  4S03 A;  1JVJ A;  1DP8 A;  1CQA A;  2NUP C;  3LMV A;  1V9Y A;  3L7H A;  1K4F A;  4P0M A;  3UDX A;  3DTE A;  2W3G A;  1FIL A;  3QP2 A;  1W7F A;  4WYY A;  1S1Z A;  1S67 L;  4UQI M;  4B93 A;  3T1X A;  2G7U A;  1GSV A;  2OLV A;  2H28 A;  4KZ4 A;  3Q1F A;  3GEC A;  4BL2 A;  3KSI A;  1FCM A;  4RRA A;  3IXG A;  3Q7V A;  3C8C A;  3UN7 A;  3BY9 A;  4X55 A;  4RRF A;  4L9F A;  3EEH A;  1S66 L;  5IT5 A;  2JKT I;  1HVB A;  3D9Y A;  3BLS A;  5CGW A;  4FD8 A;  2O9B A;  4RR6 A;  4GW9 A;  2WGW B;  2X02 A;  4WZ5 A;  4RQ9 A;  1ESI A;  5EPH A;  2XK1 A;  4DDY A;  3AGF A;  5E43 A;  2G2W A;  1KOU A;  3TRC A;  5HPF A;  2HP6 A;  4FCF A;  5HDC A;  1KVM A;  5CTN A;  2ZC4 B;  1KE4 A;  4OQG A;  2ZC7 A;  3C4O A;  2PBY A;  4X1L A;  2ZMA A;  5DF9 A;  4I38 A;  3S4X A;  4X68 A;  4F3L A;  2WGV A;  2OV5 A;  5L10 A;  1E3U A;  3D3O A;  3T4Q A;  3HLC A;  3NIA A;  4O7D A;  3LI9 A;  2R9X A;  5L09 A;  5F83 A;  3ZHH A;  4EET B;  3CI6 A;  4BD1 A;  1ES2 A;  1PWG A;  1S1Y A;  4Y0T A;  1LLB A;  3MXS A;  4KQD A;  1OME A;  3ZG7 B;  1P9R A;  3ZCZ A;  4BMW A;  2PRF A;  4JF4 A;  1AWI A;  1T18 A;  1I2W A;  4CJN A;  3VSK A;  3S7O A;  4OOM A;  3PBR A;  2XRO A;  4E3I A;  1G6A A;  1PYY A;  2XQZ A;  1ERQ A;  3B47 A;  3KOC A;  3PAE A;  3VMA A;  3NJA A;  3S7P A;  3IF6 C;  1W8Y A;  1MXO A;  3CMZ A;  3CWF A;  4R1G A;  2O99 A;  3LMU A;  4RA7 A;  1Y54 A;  4KZ8 A;  4NBI A;  3P01 A;  1IEM A;  2X01 A;  3LCE A;  5A91 A;  1JWP A;  3LEQ A;  1I5Q A;  3OCN A;  2DCF A;  3IXD A;  3EEA A;  3G6O A;  1BTL A;  2J7V A;  1IOU A;  1NJ4 A;  4U0X A;  3NOP C;  3KO5 A;  4RRR A;  3IWI A;  5DKK A;  1H0M A;  4OQI A;  2YKF A;  2CMN A;  2JHE A;  1ODV A;  4IBR A;  1EWZ A;  4KZ5 A;  3N7W A;  4LLO B;  3A0S A;  1RGY A;  2HDQ A;  4FTX A;  2V20 A;  4BLM A;  3IF6 B;  4QU3 A;  3MJQ A;  3HJI A;  2ZBB A;  5CGX A;  1YKD A;  2ZC3 B;  2JC7 A;  3A0R A;  4FOF A;  3G4P A;  4C3Q A;  4MBK A;  5EVI A;  5HL1 A;  1ES4 A;  4KEN B;  4GJ4 A;  5GL9 A;  3U4L P;  4OQ0 A;  4RRI A;  3R7W B;  5AQ9 A;  3MF0 A;  4F3L B;  1YMX A;  2V1Z A;  1NYY A;  2K31 A;  3TE8 A;  1GHM A;  1NLY A;  5EVL A;  4I3J A;  4B4Z A;  2RCX A;  3N8L A;  1PW8 A;  4JF5 A;  4NXG A;  1Y2Q A;  2P08 A;  1IKG A;  2W1T B;  4UHU A;  5DTS A;  1IKI A;  1CJF A;  3Q7V B;  4QWO A;  1XJ3 A;  4PM5 A;  1ZKJ A;  1TVF A;  3BEB A;  3P09 A;  4YWZ A;  3UE0 A;  5F69 A;  4UAA A;  5EOO A;  1VET A;  1CK3 A;  3OLO A;  1PWD A;  3BEC A;  4KZB A;  1ZC2 A;  3BFC A;  3L9K A;  3KYQ A;  3HUM A;  4JXG A;  5F1G A;  4X25 A;  1ACF A;  5FEF A;  2WK0 A;  3ZG5 A;  2Y2G A;  3UME A;  1CF0 A;  3GR2 A;  5I94 A;  2HJ9 C;  4EES A;  3A3F A;  4N92 A;  4Y7P A;  1L0E A;  4RRK A;  4ZAM A;  3PHY A;  1D06 A;  1IEL A;  4X56 A;  4Q8I A;  1CEG A;  5G18 A;  3ZFZ A;  5CRF A;  4O01 A;  5EFW A;  3LEZ A;  2IWB A;  1ERO A;  3C30 A;  1WYC A;  4PKY A;  1WYB A;  1DJA A;  1ES3 A;  3SW1 A;  3LIE A;  2Y2Q A;  1F9I A;  1PIO A;  5FDS A;  4YNR A;  4LCL A;  2DMW A;  4JBF A;  4EW7 A;  2R78 A;  1LI9 A;  1SKF A;  1ZG6 A;  3IT9 A;  2A3U A;  1G6O A;  1XFQ A;  5FAO A;  3NDE A;  1O07 A;  2O9A A;  1SHV A;  3T4S A;  1VHM A;  3T4L A;  3W4Q A;  1FSY A;  1XJ6 A;  5LBR A;  2XFS A;  4G3W A;  1U60 A;  4HI4 A;  4MN5 A;  5FI6 A;  4MLL A;  1LHY A;  3VE4 A;  5FAQ A;  4YFM A;  4E3M A;  3ZGA B;  1XJ4 A;  2XF3 A;  3T4K A;  1GHP A;  1TS0 A;  3SS3 A;  3CUE C;  2PU4 A;  2FH5 A;  2J9P A;  3KX0 X;  3IH9 A;  1BZA A;  2Z2M B;  3OBF A;  5HPI A;  4N9K A;  4HES A;  2DRW A;  3SH9 A;  5FDH A;  4ETZ A;  1OTE A;  4PM7 A;  2QKP A;  3K3C A;  5KMW A;  1PWC A;  3NCK A;  3CAX A;  4GCZ A;  1TDL A;  2M7V A;  4EUV A;  2PU2 A;  4YIN A;  3N4I A;  3LR4 A;  1BUE A;  4S2J A;  2H0T A;  4HJ6 A;  3NBL A;  3PYP A;  3MMH A;  3IXB A;  2OLU A;  4GHI A;  4MBF A;  5CTM A;  4A5R A;  2PYR A;  1FQG A;  3IX3 A;  5IHV A;  3OCL A;  1T1B A;  1T19 A;  4GN2 A;  1EI5 A;  3I7J A;  1LL9 A;  2JKR I;  1IYS A;  2W1T A;  1K57 A;  5L2F A;  3A3D A;  3ULF A;  4WLA A;  4XT2 A;  3QHY A;  1HD8 A;  2I9V A;  5E2F A;  4BBU A;  4S2L A;  4GKU A;  3OPP A;  2ZL1 A;  3EGD C;  2RL3 A;  4I5S A;  3SOI A;  3RTY A;  4NEE D;  2WYX A;  3IS2 A;  4BL3 A;  2C5W B;  4LGW A;  3GMW A;  3KO6 A;  3B33 A;  3QP1 A;  4XUX A;  4OP8 A;  1FCO A;  2L0W A;  3BWL A;  3RFB A;  3ZVT A;  2ZC6 B;  3Q81 A;  2P9V A;  3VP4 A;  4RR7 A;  1YSP A;  1XGJ A;  1OPX A;  4WBG A;  4IUH A;  5EM0 A;  3ZYT A;  1BT5 A;  5HSQ A;  1MY8 A;  1T1A A;  1XP4 A; 
#chains in the Genus database with same CATH homology
 2X02 A;  1NY0 A;  1S0W A;  5HAR A;  4RX3 A;  5E2G A;  4WZ5 A;  4N1H A;  3MFD A;  5GLA A;  1ESI A;  3WS0 A;  5EPH A;  4E6W A;  2IWD A;  1M40 A;  2XD5 A;  2XK1 A;  3SS4 A;  3AGF A;  1W79 A;  4MEZ A;  5E43 A;  2G2W A;  1DJC A;  4DDY A;  4E3N A;  3FKV A;  4DE3 A;  5GLB A;  2HP6 A;  4XUZ A;  5CER A;  3QNB A;  4FCF A;  3WWX A;  1BLH A;  1KVM A;  5CTN A;  2ZC4 B;  3GV9 A;  5HX9 A;  3UNW A;  5CHM A;  4OPQ A;  3V5M A;  3VOY A;  1KE4 A;  4OQG A;  3MKE A;  3N8S A;  5EEC A;  3HRE A;  2ZC7 A;  3C4O A;  3VP0 A;  4KZA A;  4BQM A;  2PBY A;  2HP5 A;  4IED A;  2ZMA A;  1KE0 A;  5DF9 A;  4OPY A;  5CEB A;  3MXR A;  3S4X A;  2QMI A;  2OKV A;  4X68 A;  5JYP A;  4JXV A;  3ZVW A;  1PI4 A;  1XKZ A;  2WGV A;  3HUN A;  2OV5 A;  1E3U A;  4GDN A;  2X01 A;  5A92 A;  2HDU A;  3IF6 A;  4B4X A;  5AQ7 A;  3S1Y A;  3HLC A;  3NIA A;  2XH9 A;  4KZ9 A;  3UE3 A;  3HLE A;  3W8K A;  3Q07 A;  2Y2K A;  4O7D A;  2EXB A;  1K25 A;  2R9X A;  2G2U A;  2Y2H A;  5F83 A;  3C4P A;  3ZHH A;  3LY3 A;  2BLS A;  5CHJ A;  5F82 A;  4RRB A;  5J61 A;  4BD1 A;  1ES2 A;  3EQV A;  3VFH A;  3KO7 A;  1PWG A;  4JKT A;  4Y0T A;  1YLW A;  1LLB A;  3G35 A;  3MXS A;  4WEJ A;  3VSL A;  2R9W A;  3V3S A;  5DTK A;  4PM6 A;  1YMS A;  3ISG A;  3OZH A;  3ZG9 B;  2H0Y A;  1OME A;  2I72 A;  4KQR A;  5AQB A;  1KVL A;  1QME A;  3ZG7 B;  1BLP A;  3ZCZ A;  3LY4 A;  2WKE A;  3UPN A;  1BLC A;  4DKI A;  2WGI A;  3PBS A;  4JF4 A;  3V50 A;  2CC1 A;  1I2W A;  3UPP A;  4CJN A;  4LV3 A;  3VSK A;  4OOM A;  1CI9 A;  3PBR A;  4E3I A;  1G6A A;  1KDW A;  1PYY A;  4DRT A;  2XEP A;  2XQZ A;  3PD3 A;  5E2H A;  1N9B A;  1ERQ A;  4M3K A;  4Y0O A;  4E3O A;  1IYP A;  3KOC A;  1K6S A;  1KGG A;  3PAE A;  3A3E A;  3VMA A;  4DF6 A;  1J9M A;  5EOE A;  2ZM2 A;  1K56 D;  4S2K A;  3LMT A;  3TG9 A;  3IF6 C;  1W8Y A;  3TSG A;  1MXO A;  3CMZ A;  3MBZ A;  3M6B A;  4GB7 A;  4RRG A;  3O87 A;  4R1G A;  3G30 A;  1SDE A;  3G34 A;  3VP1 A;  4UA9 A;  2J8Y A;  1C3B A;  4LCM A;  4RA7 A;  1TC5 A;  1Y54 A;  3LMU A;  4KZ8 A;  1TDG A;  4NBI A;  4EUZ A;  2FFF B;  1IEM A;  5TFQ A;  2GDN A;  3LCE A;  4N1X A;  1JWP A;  3OCN A;  1I5Q A;  4OH0 A;  4UA7 A;  1HZO A;  2DCF A;  3HUO A;  5A91 A;  3IXD A;  1GA0 A;  1PZO A;  1BTL A;  2J7V A;  3ITB A;  4KG5 A;  1NJ4 A;  4U0X A;  3SH7 A;  1XA7 A;  4E6X A;  4OOY A;  3FZC A;  4EBL A;  3HLF A;  2Y91 A;  3UE1 A;  5GLC A;  3KO5 A;  4RRR A;  4KG2 A;  2VGJ A;  5GHX A;  2EXA A;  3MKF A;  3IWI A;  1YLJ A;  2P9V B;  3W4P A;  5FQQ A;  3UDF A;  5M18 A;  2EFX A;  3NI9 A;  3W4O A;  4KQO A;  2ZD8 A;  4LEN A;  2HL1 A;  4OQI A;  4S2O A;  3G32 A;  4OLG A;  1E4D A;  1GA9 A;  4GZB A;  3ZNY A;  1ONH A;  5M1A A;  1M6K A;  4IBR A;  3BM6 A;  1EWZ A;  4KZ5 A;  4HEF A;  3N7W A;  3O3V A;  3FYZ A;  4RR9 A;  3RXW A;  2B5R A;  3WS4 A;  1RGY A;  2HDQ A;  2JBF A;  4P85 A;  3WS2 A;  5KZH A;  2V20 A;  4BLM A;  3IF6 B;  4QU3 A;  1RP5 A;  4S2P A;  2ZQ8 A;  5FQK A;  2BG1 A;  4C75 A;  3MZE A;  2WUQ A;  2Y2N A;  5EE8 A;  5CGX A;  2EX9 A;  1H5X A;  2ZC3 B;  4D2O A;  2XD1 A;  5FQJ A;  2J9O A;  1NRF A;  2JC7 A;  4X53 A;  1JWV A;  2JCH A;  3KNF A;  3G4P A;  1MKI A;  3DW0 A;  4MBK A;  4PM9 A;  4R4R A;  3VOZ A;  4C3Q A;  5EVI A;  5FI7 A;  3CG5 A;  5HL1 A;  4KZ6 A;  1ES4 A;  4KEN B;  5GL9 A;  4P87 A;  1NZU A;  1RGZ A;  4OQ0 A;  4UA6 A;  4PMA A;  4ZJ3 A;  4RRI A;  1L0D A;  1DY6 A;  4S0J A;  5AQ9 A;  4H8R A;  1ES5 A;  3BFF A;  1YMX A;  4NBJ A;  2V1Z A;  1FSW A;  1NYY A;  1SDN A;  1GHM A;  2P74 A;  4QD4 A;  5EVL A;  4KZ3 A;  1XGI A;  4RVA A;  5HAQ A;  4B4Z A;  1MWU A;  3M6H A;  5EUA A;  4K0X A;  3WS1 A;  5A90 A;  2XFT A;  1KGE A;  3C7V A;  2RCX A;  3N8L A;  3V39 A;  2EX2 A;  3IQA A;  3ZG8 B;  4ZJ1 A;  3UO9 A;  2QPN A;  4KZ7 A;  4N9L A;  4S2I A;  1PW8 A;  1ERM A;  4JF5 A;  5AQA A;  1MWS A;  2EX8 A;  1Y2Q A;  4FSF A;  1L2S A;  2JE5 A;  4HBU A;  4WZ4 A;  1CEF A;  4RRL A;  4S2N A;  3HL9 A;  1IKG A;  4E3J A;  3A3I A;  4UHU A;  3BYD A;  1IKI A;  1YLZ A;  3Q7V B;  5DTS A;  2XR0 A;  5FQI A;  4EV4 A;  2Q9M A;  3HBR A;  1WE4 A;  4PM5 A;  2HP9 A;  5GHZ A;  4OPZ A;  3WRT A;  1ZKJ A;  1JWZ A;  5GLD A;  2IWC A;  4EBN A;  1TVF A;  1K54 C;  1XX2 A;  3Q7Z A;  1HTZ A;  2ZC5 B;  3BEB A;  3P09 A;  4RRC A;  4S0I A;  3G2Z A;  3UE0 A;  4UAA A;  5EOO A;  1CK3 A;  3G2Y A;  4DE0 A;  5HW3 A;  1PWD A;  3BEC A;  4KZB A;  2HL0 A;  1ZC2 A;  1NYM A;  2Y2P A;  3BFC A;  2WGW A;  4R3J A;  3KOD A;  4S2M A;  3D4F A;  5TGF A;  3FWL A;  4BEN A;  3C5A A;  4GD6 A;  5EVI D;  3PBQ A;  1NXY A;  3HUM A;  4WEK A;  4S0L A;  5FQM A;  1Q2P A;  3O86 A;  4JXG A;  4MNR A;  2H5S A;  5F1G A;  4DXC A;  5KSC A;  3DWK A;  1JKE A;  2WKI A;  1XPB A;  1Q2Q A;  2WK0 A;  4K0W A;  4OLD A;  3VFF A;  3ZG5 A;  2Y2G A;  5BOH A;  3RJU A;  3V3R A;  4X69 A;  5FAP A;  4DE2 A;  2A49 A;  1GHI A;  2Y2M A;  4X6T A;  5FAS A;  4XXR A;  3BFD A;  3GR2 A;  4ZTK A;  4E3L A;  3BFE A;  4RRQ A;  2V2F F;  1PI5 A;  4PPR A;  5I94 A;  4RRM A;  3HLG A;  3A3F A;  4GOG A;  1IYQ A;  4N92 A;  4ZJ2 A;  4KQQ A;  4DE1 A;  1AXB A;  4Y7P A;  1L0E A;  3HLB A;  4IVK A;  1ZG4 A;  2Q9N A;  4RRK A;  4ZAM A;  1XA1 A;  4NK3 A;  4RR8 A;  1G68 A;  1YLY A;  5D3O A;  3GVB A;  1IEL A;  1MPL A;  3G31 A;  4OPR A;  4X56 A;  4Q8I A;  1CEG A;  5FI2 A;  5G18 A;  3ZFZ A;  4QY6 A;  1O7E A;  4R23 A;  5CRF A;  2WAF A;  3MZF A;  1I2S A;  2HDS A;  1CI8 A;  1H8Y A;  1YT4 A;  2EFU A;  3LEZ A;  3N6I A;  4L0L A;  2IWB A;  1ERO A;  1YQS A;  2ZM8 A;  3Q82 A;  5HFO A;  1WYC A;  3N8R A;  5FQ9 A;  2Y55 A;  4P6B A;  3KO4 A;  1WYB A;  3IH8 A;  4IBX A;  1DJA A;  1ES3 A;  3WS5 A;  4BD0 A;  4ZBE A;  1W8Q A;  3SH8 A;  2Y2Q A;  4GNU A;  2DBO A;  1JTG A;  3KO3 A;  1PIO A;  3PAG A;  2Z2L B;  1JTD A;  3SS5 A;  3AGE A;  3PBN A;  4WMC D;  3KOB A;  4LCL A;  3IWO A;  1GCE A;  4JBF A;  4OKP A;  1MWT A;  2ZLY A;  4JF6 A;  5DF8 A;  3ZNT A;  2XLN A;  1LI9 A;  1SKF A;  2ZJ9 A;  1ZG6 A;  3IT9 A;  2A3U A;  3QNC A;  1VM1 A;  1ALQ A;  3IWQ A;  3PD2 A;  1FOF A;  5FAT A;  1J7G A;  5FAO A;  3NDE A;  2C6W B;  1O07 A;  2ZQC A;  4Z9Q A;  3HVF A;  1SHV A;  4EWF A;  2HL2 A;  3KO9 A;  2X71 A;  4QY5 A;  3W4Q A;  1FSY A;  4OOL A;  3OPR A;  4OVD A;  2Y2O A;  1LL5 A;  2XFS A;  5CXW A;  4WMC A;  3JYI A;  2XDM A;  3ITA A;  2ZQD A;  1BLS A;  4RRJ A;  3FV7 A;  1U60 A;  2WZZ A;  2ZQ9 A;  3GQZ A;  4EBP A;  3OPH A;  4MBH A;  4CPK A;  5FI6 A;  4PM8 A;  2WZX A;  1KDS A;  1S6R A;  3IHA A;  1LHY A;  4MLL A;  1YM1 A;  5FAQ A;  4YFM A;  1K57 C;  4OQH A;  1K54 A;  3RXX A;  1KGF A;  3ZG0 A;  4E3M A;  3ZGA B;  4Y0U A;  2XF3 A;  1MWR A;  1GHP A;  1NZO A;  4R4S A;  3SS3 A;  3GSG A;  3NY4 A;  3PD4 A;  2PU4 A;  4BJP A;  4QB8 A;  2Y59 A;  4JXW A;  3O88 A;  5J8X A;  4KG6 A;  4R3B A;  4IVI A;  2H10 A;  3E2L A;  3WRZ A;  2J9P A;  4LV2 A;  5KSH A;  3IH9 A;  2ZQA A;  1W5D A;  1BSG A;  5FSR A;  4ZDX A;  1BZA A;  2Z2M B;  2E8I A;  4N9K A;  3BFG A;  2WAE A;  4HES A;  4DXB A;  4K91 A;  2DRW A;  4F94 A;  3M2K A;  3CJM A;  3SH9 A;  1TEM A;  3PBT A;  4WZ5 C;  5DTT A;  5FDH A;  1KE3 A;  4S2N C;  4B88 A;  4EQI A;  5DVA A;  3UPO A;  1L0F A;  1FCN A;  4GD8 A;  1K55 C;  5CGS A;  3M2J A;  4JLF A;  2WKH A;  3UDI A;  1K6R A;  1MBL A;  4JPM A;  2WAD A;  4PM7 A;  5KMW A;  5JYO A;  1PWC A;  1LI0 A;  1XXM A;  3NCK A;  5CED A;  5HAP A;  1VQQ A;  2DNS A;  4R0Q A;  5HAI A;  1TDL A;  1RCJ A;  3BRM A;  2PU2 A;  4YIN A;  5EVI B;  5DF7 A;  3CZD A;  5F1F A;  3N4I A;  5A93 A;  3BLM A;  1K55 A;  3HLW A;  3OPL A;  1BUE A;  1SCW A;  4S2J A;  2H0T A;  4DDS A;  1YLT A;  4S02 A;  3NBL A;  1E25 A;  4RRD A;  1K56 A;  2VGK A;  4RRH A;  3DTM A;  3MZD A;  2QZ6 A;  3IXB A;  1Z6F A;  3KNP A;  3P98 A;  2HDR A;  3FKW A;  3UY6 A;  3IXH A;  4RYE A;  3GRJ A;  2OLU A;  4MBF A;  1FR6 A;  1YLP A;  5CTM A;  1ESU A;  1L0G A;  2FFY A;  4A5R A;  3DWZ A;  1FQG A;  4S03 A;  5IHV A;  3OCL A;  3LO7 A;  4HBT A;  4LV0 A;  1JVJ A;  4GDB A;  1IYO A;  2Y4A A;  4GN2 A;  1EI5 A;  5M19 A;  3LMV A;  1K4E A;  3I7J A;  4OP5 A;  1K4F A;  5U47 A;  1LL9 A;  4OON A;  2Y2I A;  3OC2 A;  4P0M A;  3UDX A;  1IYS A;  3E2K A;  3PBO A;  1K57 A;  1W7F A;  4WYY A;  2Y2J A;  4U3T A;  5L2F A;  3A3D A;  2Y2L A;  2UWX A;  2EX6 A;  3PTE A;  3NC8 A;  4S0K A;  3QHY A;  1HD8 A;  2OLV A;  3S22 A;  3AGD A;  5E2F A;  5FA7 A;  4S2L A;  4GKU A;  1PZP A;  3OPP A;  4KZ4 A;  5EVI C;  4WM9 A;  2RL3 A;  3Q1F A;  5CEC A;  3SOI A;  5E2E A;  4QHC A;  4BL2 A;  2WYX A;  5GHY A;  2HPB A;  1FCM A;  2OSU A;  3EQU A;  1E3U D;  1ONG A;  3TOI A;  1QMF A;  3ZDJ A;  2C5W B;  5CHU A;  4BL3 A;  3PD5 A;  4RRA A;  4U0T A;  3GMW A;  3VP3 A;  3NDG A;  3IXG A;  3Q7V A;  3C7U A;  1N4O A;  3A3J A;  1H8Z A;  2ZQ7 A;  4FH4 A;  3IHB A;  4RX2 A;  3UN7 A;  4XUX A;  4LV1 A;  4OP8 A;  1FCO A;  4WEL A;  4X55 A;  3HLD A;  4QJG A;  4RRF A;  3B3X A;  3ZVT A;  1K38 A;  4ID4 A;  4JXS A;  2ZC6 B;  3VP2 A;  3Q81 A;  3IF5 A;  4C6Y A;  2P9V A;  1HVB A;  3VP4 A;  1DJB A;  1XGJ A;  4RR7 A;  3BLS A;  4FH2 A;  5CGW A;  4WBG A;  1FR1 A;  4FD8 A;  2ZM0 A;  4RR6 A;  1BT5 A;  1BUL A;  4E3K A;  2WGW B;  1PW1 A;  1MY8 A;  1XP4 A;  2XGN A;  3GTC A;  2HKZ A;  4NET A;  5TR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...