2EXAA

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with farom
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
452
structure length
443
Chain Sequence
YITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYARIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
total genus 141
structure length 443
sequence length 452
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2exaA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2exaA02
1O07A 1DJBA 1MY8A 1XA7A 2E8IA 3PBOA 2JE5A 3BFGA 1IYOA 3LEZA 1TDGA 4FCFA 3ITBA 3CG5A 1N9BA 4EUZA 2C5WB 2OLUA 2H0TA 5DTKA 3HREA 3IXDA 4KZ7A 1KGEA 1K38A 5EVLA 1MKIA 1KDSA 5CXWA 1I2WA 1NZUA 3NIAA 2Y2OA 4PM6A 5F82A 4DKIA 3VP2A 4OKPA 4WZ5A 5FQKA 4DDSA 4PM8A 3M6HA 4OPZA 1L0GA 3C4PA 3W4QA 1S6RA 4O7DA 1SKFA 3IWOA 4MBHA 3GSGA 5F83A 5JYOA 2Y59A 3Q1FA 2Y2PA 4S2PA 2RL3A 3RXXA 1E3UA 3VP4A 4CJNA 3ZDJA 1BT5A 3W8KA 2XH9A 3C5AA 2EXAA 1NYMA 3FKWA 2XQZA 1BSGA 4QHCA 3BLSA 3UN7A 3HLWA 3G4PA 1W79A 2P74A 4E3LA 2V2FF 4OLGA 2Y2JA 4KQRA 2CC1A 5KZHA 4EBPA 5GL9A 1HTZA 4E6XA 3O86A 4X68A 4X69A 3ZNTA 3G31A 3GQZA 4DXCA 3MZEA 3M6BA 2RCXA 3IXBA 4FH2A 4NETA 1MWUA 4BL2A 1FSYA 4HBTA 4RYEA 1SDEA 3C7VA 5CGXA 1K55C 1PI4A 5E2GA 1BTLA 2JCHA 4XUZA 5FI2A 4FH4A 3LCEA 4P6BA 5GLCA 2EX9A 2ZLYA 3BLMA 5HAPA 5EECA 3WWXA 5HFOA 4R3JA 1ES2A 1PWGA 4DRTA 1GCEA 3VFHA 4MBFA 4R3BA 2WKHA 1MPLA 4PM9A 3TG9A 1YLTA 2WYXA 1I5QA 3MKEA 3P98A 4DF6A 2FFFB 2ZQDA 2BG1A 3VMAA 1PZOA 4JXVA 3MZFA 4LCLA 3VP1A 1L2SA 1K55A 3OCLA 4E3JA 3VOZA 2V1ZA 5A90A 1L0DA 1ZG4A 1I2SA 2Y2LA 2R9XA 3FV7A 2Y55A 3GMWA 3DWZA 4KZ6A 1L0EA 3QNCA 2WAFA 3OPPA 1IYSA 4OH0A 5FQIA 4WZ5C 4EWFA 3CJMA 4C3QA 5CTMA 4PMAA 2Q9NA 1M6KA 1PW1A 4OVDA 5AQAA 3IXGA 3OPLA 5HL1A 3A3IA 1XXMA 4OQ0A 2XR0A 3CMZA 4S2NC 1LL9A 3ZCZA 1CK3A 1RP5A 5FAPA 3ZNYA 4UHUA 5J8XA 5DTTA 1KVLA 4RX2A 5FA7A 4BJPA 2WGWA 1FCOA 4JXSA 5EVIB 3TOIA 4KENB 3LO7A 1M40A 2HPBA 4QY6A 3LY4A 3FZCA 1NZOA 4JF5A 4WEJA 3PBSA 2WUQA 3G35A 1YLZA 3PAEA 2X02A 3ZVTA 3WS4A 2WZZA 5FI7A 3V3SA 1H8ZA 3MXRA 4K0XA 3UE1A 3V5MA 3N6IA 2EX2A 1HVBA 2P9VA 3Q7ZA 4WZ4A 3N4IA 4JKTA 1PWDA 4L0LA 3UPNA 4GZBA 3SOIA 2HP6A 4A5RA 2Z2LB 4WBGA 4JBFA 5G18A 4EQIA 3IWIA 3NY4A 1ERMA 1J9MA 4OPRA 3I7JA 3IF5A 3V50A 3HLCA 2EXBA 3PBQA 2QZ6A 3IH9A 4P87A 1WYCA 3NCKA 3NI9A 2DCFA 3EQUA 4FD8A 5AQ9A 1TVFA 1IKGA 4B88A 1CEFA 1ESIA 3OPHA 2Y4AA 4ZJ2A 4UAAA 1LI9A 1VQQA 2Y2MA 2ZMAA 2A3UA 3GRJA 1W8YA 1KDWA 3A3FA 3AGDA 1BLPA 2IWCA 4KZ8A 1YLYA 3ZHHA 5TGFA 3WS2A 2ZM8A 1YMXA 4FSFA 5CEBA 3HUOA 1IYPA 3BFFA 2G2WA 2Y2HA 2XEPA 3UPOA 1PZPA 3HUNA 2Y2QA 3ZFZA 4JLFA 3HBRA 1ES5A 4E3KA 2IWDA 3N8LA 1GHPA 4S2IA 4ZJ3A 1KE4A 2ZJ9A 3NDEA 4OPYA 4UA7A 4PM5A 5HARA 1W5DA 2HP9A 1JVJA 5EOOA 3N7WA 5FQJA 4IVKA 3AGEA 4Y0UA 4JF6A 1QMEA 1ZKJA 3ZVWA 5CGWA 4H8RA 4MEZA 4E3MA 2WKEA 1ZG6A 4GNUA 2ZQ8A 4OONA 1Z6FA 2J9PA 5IHVA 1GHIA 4ZTKA 2HDSA 2XF3A 2XLNA 3BRMA 5CHJA 1H5XA 3BFDA 3FWLA 5FI6A 4F94A 1KGFA 1ZC2A 2QPNA 4X6TA 5CHMA 4LV2A 1N4OA 2PU4A 3IF6A 4KQQA 5BOHA 4GKUA 1XP4A 1FCNA 2IWBA 2Y2NA 1PWCA 1H8YA 4HEFA 1CI8A 3G2YA 1XGIA 3IXHA 3ISGA 4X53A 5EE8A 4BL3A 3UNWA 3A3DA 3BFEA 3G32A 3P09A 1Y54A 2WAEA 4JF4A 3ZG8B 3QHYA 4P0MA 4KZ9A 1E3UD 5DTSA 5FDHA 5M19A 2Y2GA 3O88A 1MXOA 3PBNA 5E2EA 2XDMA 4WMCA 1E4DA 4DXBA 3WS5A 5A91A 1DY6A 4KG6A 4N9KA 2HDQA 1HZOA 5GHYA 4RVAA 4QY5A 3N8RA 4OQHA 1Q2PA 3HVFA 2XD1A 1WE4A 4K0WA 4IVIA 3BFCA 3ZGAB 1GA0A 4GN2A 4NK3A 4U0TA 5CRFA 3OPRA 1EI5A 1K57C 4R4SA 2UWXA 2WKIA 1SDNA 5FQMA 1LLBA 5JYPA 2XFTA 3UE3A 1FQGA 2G2UA 3HUMA 4QU3A 2OLVA 3SS3A 1JTGA 2ZQ7A 1E25A 1BUEA 1Q2QA 1KE0A 5FQ9A 5FASA 1MWTA 2JBFA 3AGFA 4B4XA 1MBLA 4S2JA 2ZQCA 3LY3A 1LI0A 3JYIA 1QMFA 4OQGA 4R4RA 5FAQA 2EFUA 1RGZA 2ZM2A 4UA6A 3A3JA 5M1AA 1GHMA 3NDGA 4JXGA 4KZ3A 1K54C 1EWZA 4N1HA 1IYQA 4S2NA 5DF7A 3ZG7B 2DNSA 2WGWB 3UO9A 3ZG0A 1BZAA 5CGSA 4EV4A 3BYDA 4KQOA 4RA7A 1KVMA 3V39A 4P85A 5GHXA 3OZHA 4OP5A 3UE0A 2VGJA 4DE2A 3IF6C 3O3VA 4BLMA 3VSKA 3GV9A 1JWZA 1SHVA 3G30A 1PI5A 5CERA 1BLHA 1K56D 1K6SA 4GB7A 1FCMA 1VM1A 2Q9MA 4PM7A 1C3BA 2HDRA 3SH9A 3HLFA 5KSCA 2XGNA 2ZC4B 2JC7A 1FR6A 1IELA 3C7UA 3D4FA 3NBLA 4N92A 3IT9A 2QMIA 2ZC3B 2J9OA 1JWVA 5GLDA 2J8YA 1NRFA 2HDUA 3A3EA 3HL9A 1RCJA 4M3KA 3WRZA 1W8QA 4KG5A 3MXSA 3IWQA 4OOLA 4ZBEA 3V3RA 4BD1A 4LV0A 3RXWA 3FKVA 1YLWA 4K91A 4ZAMA 4EBNA 3M2KA 5HAIA 1IKIA 2ZQ9A 4E6WA 1XA1A 3SS4A 1OMEA 3C4OA 3VFFA 4N1XA 3IHBA 3QNBA 5HX9A 4OOYA 3SH7A 5GLAA 5EVID 4WMCD 4MBKA 2P9VB 3UPPA 4U0XA 4E3IA 5CTNA 3GR2A 5A92A 4PPRA 5I94A 1YQSA 2H5SA 4IEDA 1BLSA 2EFXA 3HLEA 3HLDA 2EX8A 3M2JA 1PW8A 3MBZA 3O87A 4X56A 4S2MA 4XXRA 3VSLA 4B4ZA 1ONHA 4QB8A 2PBYA 1K4EA 2XFSA 2ZD8A 3G2ZA 4OOMA 4YINA 2VGKA 3TSGA 4DE1A 5GHZA 4LV1A 1EROA 5EVIC 4HBUA 4Y7PA 4U3TA 4OLDA 1K4FA 2Y2KA 2A49A 4BQMA 5F1GA 4R23A 1G6AA 2XK1A 5DVAA 1JTDA 5AQ7A 4MLLA 1IEMA 4Q8IA 1BLCA 2X01A 4R1GA 2X71A 2HP5A 1G68A 5F1FA 1KGGA 5FAOA 3DW0A 1S0WA 4KZBA 2C6WB 2R9WA 4C75A 4WEKA 5EUAA 4S2KA 3DTMA 4Y0OA 1YT4A 3GTCA 3S4XA 4WELA 2H10A 1ESUA 3B3XA 4KZ5A 4BENA 4JXWA 1ALQA 1DJCA 3IQAA 1K6RA 1KE3A 1LHYA 2Z2MB 3S22A 4GD8A 1K25A 1YLPA 3HLBA 1ERQA 3OC2A 4X55A 4WM9A 2PU2A 4BD0A 4DDYA 4DE0A 1JWPA 3Q7VB 4ZDXA 3UDXA 1PYYA 4CPKA 4KG2A 3UDFA 3Q07A 4S2OA 3EQVA 3UDIA 3NC8A 2WK0A 2WADA 3DWKA 5EPHA 5EVIA 3VP3A 4Y0TA 5E43A 5E2HA 2Y2IA 2EX6A 4ID4A 4ZJ1A 3BECA 4LCMA 5DF8A 3VOYA 3IH8A 1YMSA 2ZQAA 5CEDA 4JPMA 4KZAA 3WS0A 3OCNA 1YLJA 1ES3A 2DRWA 3IF6B 3WRTA 2I72A 1LL5A 5FATA 4GDNA 1AXBA 1FSWA 1GA9A 4HESA 5CECA 3PBRA 1FOFA 1DJAA 3CZDA 3E2LA 3Q82A 4LENA 4WYYA 1PIOA 3Q81A 5TFQA 4DE3A 1U60A 5DF9A 3PTEA 1TDLA 5M18A 1K57A 3ZG5A 1NY0A 4OQIA 4E3NA 2WGIA 1NJ4A 4IBRA 3PBTA 3UY6A 4KZ4A 5TR7A 1WYBA 1FR1A 5U47A 1CEGA 1TEMA 4OPQA 3IHAA 2Y91A 5FSRA 1CI9A 3FYZA 5HW3A 2ZM0A 1W7FA 4GOGA 5KSHA 1O7EA 3RJUA 3MKFA 4D2OA 2BLSA 1K56A 3MFDA 2XD5A 1RGYA 4EBLA 3N8SA 3G34A 3W4PA 5A93A 2FFYA 1SCWA 4XUXA 2OV5A 1YM1A 5KMWA 5HAQA 4GDBA 5AQBA 2J7VA 3SH8A 4QJGA 4UA9A 2B5RA 4Z9QA 3MZDA 4MNRA 2WGVA 4YFMA 5CHUA 2WZXA 1XX2A 2ZC6B 1XPBA 1NXYA 3S1YA 2GDNA 2V20A 3E2KA 4IBXA 5L2FA 1MWSA 5D3OA 1ES4A 5E2FA 2ZC7A 4QD4A 2H0YA 4E3OA 4N9LA 1L0FA 3HLGA 1BULA 3WS1A 4GD6A 3ZG9B 3PAGA 1ONGA 1XKZA 4S2LA 1XGJA 4RX3A 5FQQA 3GVBA 3BM6A 3BEBA 4OP8A 1K54A 3VP0A 2OSUA 1HD8A 5EOEA 4C6YA 4R0QA 3SS5A 2ZC5B 1NYYA 3ITAA 5GLBA 3Q7VA 4LV3A 3W4OA 1MWRA
chains in the Genus database with same CATH superfamily
2E8IA 3PBOA 1IYOA 4FCFA 1N9BA 4EUZA 1JKEA 1YSPA 3EGDC 1MZUA 2H0TA 2LB5A 1KDSA 2HKZA 5CXWA 1NZUA 4DKIA 1TC5A 4WZ5A 4S0IA 3BQAA 4PKYG 2W1TA 3M6HA 4EEUA 2OAQ1 3GSGA 5F83A 5JYOA 5F68A 3Q1FA 2NUTC 3ZDJA 2IA2A 3QP2A 2HF6A 4KQRA 3CUEC 5DJUA 4EBPA 3G31A 4DXCA 2VZWA 4F3LA 3IXBA 1DP6A 4BL2A 5J7EA 4HH2A 1K55C 3GDIA 1BTLA 4MN5A 1J3WA 3W2ZA 3LCEA 3BLMA 5HAPA 1CF0A 1PWGA 1GCEA 3C38A 3VFHA 3OLOA 4MBFA 4R3BA 4PM9A 2PYPA 5DJTA 3TG9A 1YLTA 3MKEA 4O0PA 4DF6A 2FFFB 2W3HA 3LICA 2BG1A 4LRXC 3CAXA 4LCLA 1L2SA 4NKPA 2V1ZA 2XA7M 1L0DA 2R9XA 3FV7A 5EM1A 3DWZA 4QWOA 2WAFA 3KSHA 4WZ5C 2DBOA 2MJ6A 1PW1A 4OVDA 5MC7A 3EOIA 4IUKA 3A3IA 3ULFA 3CMZA 2W3DA 1CK3A 1RP5A 3K3DA 5FAPA 1JNUA 4HP9A 1KVLA 2GNXA 4JGQA 5DFYA 5FA7A 1M40A 1LSXA 3C30A 4RRBA 3R4KA 3PAEA 3MXRA 4K0XA 4I3JA 3V5MA 2VKSA 3N6IA 4NXGA 4JBFA 4R38A 5G18A 4EQIA 3MF0A 3I7JA 5HWWA 3HLCA 3A0RA 3NCKA 2OKVA 5AQ9A 3LR0A 4Y13A 1EW0A 5IT5A 4B88A 4UAAA 2A3UA 1KDWA 1BLPA 2IWCA 4KZ8A 1YLYA 3ZHHA 5F69A 3UPOA 1PZPA 3HUNA 3LIEA 5HSQA 5HPFA 1GHPA 5HD3A 3NDEA 2ZJ9A 4OPYA 3C2WA 4PM5A 5HARA 5FQJA 1JVJA 3BJNA 4Y0UA 4JF6A 2WKPA 5CGWA 3KO3A 1ZG6A 1TS6A 1MC0A 3A0SA 4MN7A 1Z6FA 4ZTKA 2XLNA 5CHJA 5FI6A 4S03A 1ZC2A 5CHMA 4LV2A 4KQQA 4GKUA 1XP4A 4RRJA 1CI8A 3G2YA 4BL3A 5FEFA 2B02A 2J80A 2GZAA 3ICYA 4JF4A 2P08A 3QHYA 3RH8B 2Y2GA 1MXOA 2YKHA 1E4DA 1DY6A 3MS6A 5HWVA 1HZOA 3N8RA 4MMNA 1S4SA 4OQHA 4K0WA 3HVFA 2XD1A 3ZGAB 1GA0A 4GN2A 5CRFA 1D1JA 2V9AA 5AVFA 2XFTA 2G2UA 4RRIA 1JTGA 4B4XA 1MBLA 4B93A 3LY3A 4XT2B 4R4RA 4RRGA 1RGZA 2ZM2A 5M1AA 4JXGA 4KZ3A 1K54C 4N1HA 4S2NA 5DF7A 2DNSA 3K2NA 5DKLA 3ZQ5A 2PD8A 3OZHA 1S66L 3QP4A 4BLMA 5F6AA 3GV9A 1BLHA 2Q9MA 3JVUA 4PM7A 4WLAA 4BMWA 2QHKA 3D4FA 3NBLA 2G7UA 2XSSA 1JWVA 5GLDA 4ETZA 1NRFA 2HDUA 3A3EA 4Y5FA 1W8QA 4KG5A 4JGOA 4MN6A 1XFNA 2ZQ9A 5DFXA 4E6WA 1XA1A 4DN0A 3VE4A 1UWPX 3VFFA 3IHBA 1VEUA 1XJ6A 4LGWA 4MBKA 1HLUP 2J3TC 2P9VB 4CLCB 4PPRA 2EFXA 3HLDA 1PW8A 3VSLA 2XFSA 2ZD8A 4YINA 4X25A 5EVIC 2V0WA 4U3TA 4OLDA 2Y2KA 4R23A 5A8BA 2X71A 2HP5A 2D02A 1ACFA 2QJ5A 2R9WA 4WEKA 3DTMA 3S4XA 4B9OA 2H10A 3B3XA 1ZHHB 1K6RA 1P97A 3S22A 4NG2A 3KNFA 1ERQA 4DDYA 4DE0A 1JWPA 4ZDXA 4RR8A 1F2KA 3HJIA 3B47A 2K31A 4DMZA 5EVIA 2WK0A 2WADA 3DWKA 2A24A 1VETA 5DF8A 3KYEA 4Y3IA 3OCNA 3WRTA 1LL5A 5FATA 5TBMA 1FSWA 1GA9A 5CECA 1PNEA 3Q82A 3Q81A 5TFQA 2KX6A 3EEHA 1NJ4A 4KZ4A 4OPQA 3KSIA 4S0LA 2I9VA 2JKTM 4D2OA 1K56A 2HL0A 4LFUA 1RGYA 4EBLA 3G34A 3W4PA 1SCWA 1YM1A 4GDBA 2J7VA 3MR0A 3SH8A 3TRCA 4G3KA 5CHUA 1NXYA 3NULA 1IOUA 5D3OA 5E2FA 1P0ZA 3FC7A 3A0VA 4GD6A 3ZG9B 3IBJA 4XT2A 3PAGA 4I39A 1XFQA 4S2LA 1YPRA 1XGJA 1K54A 5EOEA 4C6YA 4HQAA 3ITAA 3MSHA 3TW8A 4LV3A 2PR5A 4GHIB 3W4OA 1O07A 3UB9A 4R70A 2JE5A 3NJAA 3ITBA 1NWZA 3KO4A 4II7A 2OLUA 3IXDA 4PM6A 3VP2A 2LB9A 2HZ5A 1L0GA 3C4PA 3IX4A 3TJZC 3VE3A 3L9KA 2RL3A 3B33A 1E3UA 2K2NA 3VP4A 2K7SA 4CJNA 3SW1A 1BT5A 3W8KA 2PR6A 1NYMA 3FKWA 2XQZA 1BSGA 3BLSA 2HL1A 3HLWA 3G4PA 1FILA 1W79A 2P74A 4OLGA 3H7WA 5HZHA 2CC1A 5KZHA 4BBVA 1HTZA 3O86A 4X69A 3M6BA 3RTYA 2OOLA 4FH2A 4NETA 1FSYA 1SDEA 1BYWA 1V9YA 1PI4A 2JCHA 4XUZA 4CLCA 4P6BA 2EX9A 1TS8A 5EECA 3WWXA 4R3JA 5HWTA 3F1OA 1MPLA 3EGXC 2ZQDA 1PZOA 3MQOA 2VLGA 4EERA 3VP1A 3T12B 1K55A 1FIKA 3T4QA 1L0EA 3OPPA 2PT7A 3T4SA 4OH0A 3T4LA 3KSFA 4LRZE 4C3QA 5IU1A 3IXGA 1G5UA 3ZCZA 2XR0A 1LL9A 4MDZA 5DTTA 3UE6A 1K0KA 4RX2A 5EFWA 2WGWA 2PRFA 1F9IA 3TOIA 4KENB 1LSWA 3LO7A 3T1XA 1S67L 3LY4A 3PBSA 2WUQA 1G28A 3KX0X 3UE1A 3SZTA 1HVBA 3T1SA 5L07A 4EESA 4PKYA 3UB8A 4A5RA 2Z2LB 3F1NB 2WKRA 2VV8A 1ERMA 3U4LP 3IS2B 3LR4A 3PBQA 3IH9A 1F98A 3EQUA 3H82A 1TVFA 3UB7A 2Y2MA 2ZMAA 1NLZA 1W8YA 3AGDA 1ODVA 1YAXA 2G2WA 1OTAA 2JKFA 2Y2HA 1ES5A 2IWDA 5HDSA 1KE4A 3P7NA 1W5DA 2XRNA 5EOOA 3N7WA 5I5LA 3DTEA 1ZKJA 2HJEA 3ZVWA 4NXBA 4H8RA 4GNUA 5HDCA 2ZOIA 2J9PA 1XJ2A 2HDSA 3LR3A 2Y79A 1H5XA 3BFDA 4F94A 1KGFA 4X6TA 1N4OA 2PU4A 1NLYA 1H8YA 4HEFA 3ISGA 1T18A 3UNWA 3P09A 3KO7A 4KZ9A 5DTSA 5M19A 5AJGA 3O88A 1X0OA 5A91A 4N9KA 2HDQA 2HL2A 1MKMA 4RVAA 4QY5A 3KO9A 4IVIA 3BFCA 4JGPA 4R3AA 3LI8A 2Q0OA 2XA7S 1EI5A 1K57C 4RRMA 4R4SA 1SDNA 2OLVA 1E25A 2ZQ7A 1Q2QA 1OJGA 1MWTA 3LYXA 1D06A 2O9BA 4YOFA 3KYZA 3A3JA 2VV7A 1GHMA 3HCYA 3KODA 3ZG0A 1BZAA 4EW7A 3BYDA 2PDRA 1KVMA 2E8JA 4P85A 3LIBA 5G4ZA 3D9YA 3VSKA 4HHDA 1W63M 1K6SA 1VM1A 1C3BA 3HLFA 5KSCA 3T4KA 4Y15A 4N92A 2PYRA 3IT9A 2QMIA 2ZC3B 2J9OA 4ETXA 3HL9A 3F1PA 2VGLS 1TS0A 3IWQA 4OOLA 4ZBEA 3CLOA 2VJWA 3M2KA 4HH3A 4NBIA 1SKOB 5HAIA 1IKIA 2HV1A 4P6ZM 3UB5P 3QP5A 3SS4A 3GECA 4N1XA 3F1PB 3LMVA 5HX9A 4OOYA 3SH7A 5GLAA 4WMCD 2J3WA 5L10A 4E3IA 3GR2A 5A92A 1OTBA 1YQSA 1F5MA 4IEDA 3HLEA 3MBZA 2EX8A 3O87A 5DKKA 3OOVA 2PBYA 1K4EA 3TSGA 4DE1A 4RRRA 4Y7PA 2J3TD 1K4FA 2YKFA 2HGVA 1G6AA 5DVAA 1JTDA 3ZYTA 2JKRI 1N9LA 5FDSA 5FAOA 4K08A 4RRDA 4WF0A 5EUAA 3S7QA 3GTCA 4UQIS 2AVXA 4BENA 1ALQA 1DJCA 3IQAA 3PR6A 1LHYA 5F5YA 1K25A 3HLBA 4BD0A 4WM9A 3Q7VB 1TD5A 4YNRA 2VEAA 3Q07A 4Y2FA 3IBRA 3PD2A 3NC8A 1GSVA 4GCZA 3VP3A 5E43A 2Y2IA 2EWVA 4ZJ1A 3VOYA 1YMSA 2ZQAA 5CEDA 4JPMA 1YLJA 4GDNA 5CX7A 1DJAA 3S7NA 4ESPA 4D60A 3D72A 4I3IA 1TDLA 1T1CA 2O0YA 3F1NA 5M18A 1N9OA 3LEQA 4E3NA 4HY8A 3UY6A 4AFIA 3PBTA 3MJQA 1WYBA 1FR1A 2EWWA 3C8CA 1TEMA 5U47A 3IHAA 1CI9A 3FYZA 3NECA 4Y17A 1W7FA 5KSHA 2A2LA 3RJUA 3N8SA 2OV5A 2FH5A 5AQBA 2WGVA 2ZC6B 4X1MA 3E2KA 5L2FA 2PBDP 4MCWA 1ES4A 4QD4A 1H0MA 3KOBA 5TJJA 2Z6CA 3T1RA 1ONGA 2Z6DA 3VP0A 3PD4A 4R0QA 3Q7VA 3RXWA 2L4RA 3EWKA 4IJGA 3CG5A 1VHMA 3LR5A 4KUOA 2C5WB 1S4RA 5DTKA 4KZ7A 1KGEA 1K38A 3UMEA 1I2WA 2Y2OA 5F82A 4OKPA 5J61A 4FTXA 5FQKA 4DDSA 2BASA 3PHYA 4EEPA 1N9NA 4BBTA 1V9ZA 1S6RA 2ZOHA 2QJ7A 4O7DA 1SKFA 3FG8A 2Y59A 2Y2PA 4GS9A 4H6JB 4O01A 4S2PA 3RXXA 2XH9A 4QHCA 4HJ6A 4E3LA 3LI9A 2V2FF 5L8MA 1KOUA 1S1ZA 4X68A 4EUVA 2RCXA 4S0JA 1OTEA 2DMWA 3UB6A 5E2GA 1G6OA 3E4PA 5FI2A 4FH4A 5GLCA 2EA9A 2ZLYA 1ES2A 1UWNX 1SZVA 1I5QA 4L9FA 2V1BA 3VMAA 3MQ0A 2VA0A 2ZMFA 3OCLA 2PAVP 4E3JA 5A90A 1ZG4A 1I2SA 3F1OB 2KOIA 2W3EA 3QNCA 1IYSA 5FQIA 3NHQA 1T19A 4PMAA 2Q9NA 1WA9A 5AQAA 5HL1A 5FEGA 1XXMA 4OQ0A 5J4EA 2OWJA 1GSWA 1FCOA 4JXSA 5EVIB 1DRMA 3FZCA 4JF5A 1YLZA 1GSXA 3WS4A 2WZZA 3PYPA 1H8ZA 4ARZA 2JKTI 3Q7ZA 5KIZA 3N4IA 4JKTA 1PWDA 4L0LA 4PHTA 4GZBA 4WBGA 3PXPA 4NEED 3NY4A 4OPRA 2EXBA 4P87A 3L7HA 2VGLM 1WYCA 3NI9A 2B95A 2HJ9C 2DCFA 4FD8A 4YWZA 1CEFA 1ESIA 3OPHA 3S7OA 4ZJ2A 2VK3A 1A0KA 5TGFA 5CEBA 1Z09A 1IYPA 3BFFA 3E0YA 2Y2QA 4JLFA 2M7VA 3N8LA 4ZJ3A 4UA7A 2HP9A 3LIFA 4IVKA 3UMDA 4UEYA 1QMEA 1IFQA 5K5BA 2ZQ8A 1SKOA 4PAUA 3DTKA 5IHVA 3R7WB 1LSVA 2QPNA 5BOHA 2IWBA 1FCNA 2Y2NA 1ZTUA 4WL9A 4Q0JA 1XGIA 3IXHA 4X53A 3A3DA 3BFEA 1Y54A 4P0MA 1E3UD 2WKQA 5FDHA 5E2EA 4WMCA 3CUEA 1VETB 2M1CA 1WE4A 2M7UA 4NBJA 4NK3A 4U0TA 3K3CA 3E98A 5JYPA 1FQGA 4QU3A 4M4XA 1BUEA 4LRYC 4X1LA 1KE0A 3JPUA 2JBFA 4EQ1A 2VV6A 2ZQCA 1LI0A 3JYIA 1QMFA 3DBAA 1TS7A 4OQGA 2EFUA 5C5KA 3E4OA 5J3WA 4G3WA 5EM0A 3ZG7B 2WGWB 4GLQA 3UO9A 4RR6A 4EV4A 4KQOA 1NRJA 1J7GA 3V39A 5GHXA 4OP5A 3UE0A 2VGJA 2W3GA 3TE8A 3LMTA 1TF1A 3FPVA 3G6OA 1JWZA 1SHVA 3G30A 1PI5A 3HJKA 2JHEA 2HDRA 3R7WA 3SH9A 2B18A 2XGNA 3BW6A 1IELA 4UQIM 1OT9A 2J8YA 1OJ5A 4GHIA 3PD5A 4BWIA 3V3RA 1YSQA 2FZ0A 4BD1A 4E04A 5TBMB 4K91A 4ZAMA 2CMNA 4EXOA 4DJ3A 3C4OA 4CLCC 3QNBA 3JVVA 3UPPA 4U0XA 1H8MA 4KUKA 5CTNA 3OBFA 1UGUA 1BLSA 4X56A 4S2MA 4RR7A 4FUWA 4XXRA 4B4ZA 1ONHA 4QB8A 3G2ZA 2VGKA 5GHZA 1EROA 4HBUA 4L9EA 2XK1A 4GJ4A 5AQ7A 4MLLA 1IEMA 2P04A 4Q8IA 4Z1WA 2X01A 4R1GA 1G68A 5F1FA 3DW0A 1S0WA 4KZBA 4C75A 4WELA 3KSGA 3T4TA 4KZ5A 3CWFA 4GD8A 1YLPA 3KO5A 4RRKA 3T50A 3UDXA 4CPKA 1T1BA 4KG2A 3DAVA 3UDFA 2O9AA 3BY8A 4GW9A 3EQVA 5EPHA 4Y0TA 5E2HA 4ID4A 2W27A 2W1TB 1OTIA 2DRWA 5HDDA 4HESA 3PBRA 3E2LA 4WYYA 1CJFA 4DE3A 1K57A 2NUPC 2WGIA 1P9WA 2Y91A 4RRHA 5HW3A 2ZM0A 4NXFA 3MFDA 5A93A 2ZL1A 2FFYA 5KMWA 1OTDA 5HAQA 4QJGA 4UA9A 2B5RA 4Z9QA 3MZDA 4MNRA 4YFMA 2WZXA 1XPBA 3S1YA 2GDNA 2V20A 4IBXA 1W63Q 1PRQA 2H0YA 3CHWP 1L0FA 3LIDA 1BULA 2L1MA 4DJ2A 2W1RA 3V67A 2KLIA 4OP8A 3LGOA 1H3QA 2GJ3A 1HD8A 2OSUA 4WN5A 2ZC5B 1L3LA 1NYYA 5GLBA 1DP9A 3NOTC 1MWRA 1DJBA 1OT6A 1MY8A 1XA7A 2V1AA 3BFGA 3LEZA 1TDGA 4ARZB 2OAP1 3HREA 5EVLA 1MKIA 3NIAA 3LIAA 4PM8A 4OPZA 3W4QA 2QYBA 4S0KA 3IWOA 4MBHA 4HNBA 4JGRA 3LUQA 3C5AA 4L9GA 2EXAA 1XJ4A 3UN7A 4BBUA 2Y2JA 5GL9A 4E6XA 3ZNTA 3GQZA 3MZEA 4GS9B 4H6JA 4I5SA 2ZL1B 1MWUA 4HBTA 4RYEA 3C7VA 5CGXA 2V8FA 3IX8A 5EV0A 3CPTB 5HFOA 4RR9A 4DRTA 2WKHA 2INWA 3CITA 1VB6A 2WYXA 2KDKA 3P98A 3U2AA 4RRLA 4JXVA 3RFBA 1S1YA 3MZFA 3NOPC 1AWIA 3VOZA 2V8CA 2Y2LA 2Y55A 3GMWA 4KZ6A 5LBRA 4RRQA 2Y8HA 4HP4A 4EWFA 3CJMA 5CTMA 1M6KA 3OPLA 2JKRM 4S2NC 4ME4A 3ZNYA 4UHUA 5J8XA 2L0WA 4CQHA 3T4JA 4WUJA 3CPTA 2HPBA 4QY6A 1NZOA 4I3AA 4WEJA 3G35A 3IS2A 2X02A 3ZVTA 3VOLA 2H28A 3T4OA 5FI7A 3V3SA 4LPZA 2QKPA 2JN7A 2EX2A 2P9VA 4WZ4A 4G3VA 3EEAA 3UPNA 3BY9A 3SOIA 2HP6A 3E4QA 5HD5A 4P6ZS 3IWIA 3LMUA 1J9MA 3IF5A 3V50A 2ZBBA 2QZ6A 5HPIA 4RRAA 4Q0IA 1IKGA 2Y4AA 1LI9A 1VQQA 3GRJA 3A3FA 1OPXA 1DP8A 3WS2A 2ZM8A 5IS1A 1YMXA 3KYQA 4FSFA 3HUOA 2XEPA 4IUHA 3ZFZA 4E3KA 3HBRA 3T1QB 4S2IA 5FL3A 3AGEA 4HJ3A 2A24B 1Y4OA 4MEZA 4E3MA 2WKEA 1P9RA 4OONA 2O99A 3QP1A 1GHIA 2XF3A 3BRMA 3FWLA 3IF6A 4RRCA 1PWCA 3KNPA 2GX5A 2P7JA 5EE8A 3VV4A 3G32A 1LT0A 2WAEA 3ZG8B 4FOFA 4HJ4A 3PBNA 4KQDA 2R78A 2XDMA 5G4YA 4DXBA 3WS5A 4KG6A 5GHYA 3FPWA 3B42A 3QP8A 1Q2PA 4IHQA 3OPRA 4RQ9A 3MQQA 2UWXA 2WKIA 3BWLA 5EVEA 3S7PA 1T1AA 5FQMA 1LLBA 3UE3A 3HUMA 4F3LB 3SS3A 3O5YA 5FQ9A 5FASA 3AGFA 4S2JA 2ACGA 3IX3A 5FAQA 2QWSA 2VX8A 3BQ8A 4UA6A 1XJ3A 3NDGA 4CLCE 1EWZA 1IYQA 5CGSA 4RA7A 3H82B 2XROA 4DE2A 4Q0HA 3IF6C 3O3VA 5CERA 1K56D 4GB7A 1FCMA 4EETB 2W3FA 2UV0E 2ZC4B 2JC7A 1FR6A 3C7UA 4HOIA 1VEUB 4ZRRA 1RCJA 4M3KA 3WRZA 3MXSA 4I38A 4LLOB 4LV0A 3FKVA 1YLWA 4EBNA 1CQAA 3PD3A 3H7WB 3MXQA 1OMEA 5EVID 1D7EA 3CI6A 5I94A 2H5SA 3M2JA 2O9CA 4OOMA 4LV1A 3MMHA 2BTFP 3NOUC 2A49A 4BQMA 4HIAA 5F1GA 5L09A 1BLCA 1KGGA 2C6WB 3KOCA 4S2KA 4Y0OA 1LL8A 1YT4A 4S02A 1ESUA 4JXWA 5HL6A 1KE3A 2Z2MB 3H9WA 2PHYA 3OC2A 2V0UA 4X55A 2PU2A 1PYYA 3LFVA 4S2OA 3UDIA 1PFLA 2EX6A 4RRFA 3BECA 4LCMA 3IH8A 2ZMVA 3D3OA 4HI4A 4KZAA 1Y28A 3WS0A 5AVEA 1ES3A 3IF6B 2I72A 1AXBA 1FOFA 3CZDA 4LENA 4O8GA 1PIOA 2JKGA 1U60A 5DF9A 3PTEA 1Y2QA 3DTIA 3ZG5A 1NY0A 4QPRA 4OQIA 3KO6A 4IBRA 5TR7A 1YKDA 1CEGA 5FSRA 4GOGA 1O7EA 3MKFA 2BLSA 2W0NA 2XD5A 2D01A 4XUXA 4R6LA 3P01A 1XX2A 1MWSA 4EU0A 2ZC7A 1STZA 4E3OA 4N9LA 3HLGA 3WS1A 3QP6A 1XKZA 4NXEA 4RX3A 3MFXA 5FQQA 3GVBA 3BM6A 2OWHA 3BEBA 2PD7A 3SS5A 4CLCD 4BJPA
chains in the Genus database with same CATH topology
1O07A 1DJBA 1MY8A 1XA7A 2E8IA 3PBOA 2JE5A 3BFGA 1IYOA 3LEZA 1TDGA 4FCFA 3ITBA 3CG5A 1N9BA 4EUZA 1JKEA 3KO4A 2C5WB 2OLUA 2H0TA 5DTKA 3HREA 3IXDA 4KZ7A 1KGEA 1K38A 5EVLA 1MKIA 1KDSA 2HKZA 5CXWA 1I2WA 1NZUA 3NIAA 2Y2OA 4PM6A 5F82A 4DKIA 1TC5A 3VP2A 4OKPA 5J61A 4WZ5A 5FQKA 4S0IA 4DDSA 4PM8A 3M6HA 4OPZA 1L0GA 3C4PA 3W4QA 1S6RA 4O7DA 1SKFA 4S0KA 3IWOA 4MBHA 3GSGA 5F83A 5JYOA 2Y59A 3Q1FA 2Y2PA 4S2PA 2RL3A 3RXXA 1E3UA 3VP4A 4CJNA 3ZDJA 1BT5A 3W8KA 2XH9A 3C5AA 2EXAA 1NYMA 3FKWA 2XQZA 1BSGA 4QHCA 3BLSA 3UN7A 2HL1A 3HLWA 3G4PA 1W79A 2P74A 4E3LA 2V2FF 4OLGA 2Y2JA 4KQRA 2CC1A 5KZHA 4EBPA 5GL9A 1HTZA 4E6XA 3O86A 4X68A 4X69A 3ZNTA 3G31A 3GQZA 4DXCA 3MZEA 3M6BA 2RCXA 3IXBA 4FH2A 4NETA 1MWUA 4S0JA 4BL2A 1FSYA 4HBTA 4RYEA 1SDEA 3C7VA 5CGXA 1K55C 1PI4A 5E2GA 1BTLA 2JCHA 4XUZA 5FI2A 4FH4A 3LCEA 4P6BA 5GLCA 2EX9A 2ZLYA 3BLMA 5HAPA 5EECA 3WWXA 5HFOA 4R3JA 1ES2A 4RR9A 1PWGA 4DRTA 1GCEA 3VFHA 4MBFA 4R3BA 2WKHA 1MPLA 4PM9A 3TG9A 1YLTA 2WYXA 1I5QA 3MKEA 3P98A 4DF6A 2FFFB 2ZQDA 2BG1A 4RRLA 3VMAA 1PZOA 4JXVA 3MZFA 4LCLA 3VP1A 1L2SA 1K55A 3OCLA 4E3JA 3VOZA 2V1ZA 5A90A 1L0DA 1ZG4A 1I2SA 2Y2LA 2R9XA 3FV7A 2Y55A 3GMWA 3DWZA 4KZ6A 1L0EA 3QNCA 2WAFA 3OPPA 4RRQA 1IYSA 4OH0A 5FQIA 4WZ5C 4EWFA 2DBOA 3CJMA 4C3QA 5CTMA 4PMAA 2Q9NA 1M6KA 1PW1A 4OVDA 5AQAA 3IXGA 3OPLA 5HL1A 3A3IA 1XXMA 4OQ0A 2XR0A 3CMZA 4S2NC 1LL9A 3ZCZA 1CK3A 1RP5A 5FAPA 3ZNYA 4UHUA 5J8XA 5DTTA 1KVLA 4RX2A 5FA7A 4BJPA 2WGWA 1FCOA 4JXSA 5EVIB 3TOIA 4KENB 3LO7A 1M40A 2HPBA 4QY6A 3LY4A 3FZCA 4RRBA 1NZOA 4JF5A 4WEJA 3PBSA 2WUQA 3G35A 1YLZA 3PAEA 2X02A 3ZVTA 3WS4A 2WZZA 5FI7A 3V3SA 1H8ZA 3MXRA 4K0XA 3UE1A 3V5MA 3N6IA 2EX2A 1HVBA 2P9VA 3Q7ZA 4WZ4A 3N4IA 4JKTA 1PWDA 4L0LA 3UPNA 4GZBA 3SOIA 2HP6A 4A5RA 2Z2LB 4WBGA 4JBFA 5G18A 4EQIA 3IWIA 3LMUA 3NY4A 1ERMA 1J9MA 4OPRA 3I7JA 3IF5A 3V50A 3HLCA 2EXBA 3PBQA 2QZ6A 3IH9A 4P87A 1WYCA 3NCKA 3NI9A 4RRAA 2OKVA 2DCFA 3EQUA 4FD8A 5AQ9A 1TVFA 1IKGA 4B88A 1CEFA 1ESIA 3OPHA 2Y4AA 4ZJ2A 4UAAA 1LI9A 1VQQA 2Y2MA 2ZMAA 2A3UA 3GRJA 1W8YA 1KDWA 3A3FA 3AGDA 1BLPA 2IWCA 4KZ8A 1YLYA 3ZHHA 5TGFA 3WS2A 2ZM8A 1YMXA 4FSFA 5CEBA 3HUOA 1IYPA 3BFFA 2G2WA 2Y2HA 2XEPA 3UPOA 1PZPA 3HUNA 2Y2QA 3ZFZA 4JLFA 3HBRA 1ES5A 4E3KA 2IWDA 3N8LA 1GHPA 4S2IA 4ZJ3A 1KE4A 2ZJ9A 3NDEA 4OPYA 4UA7A 4PM5A 5HARA 1W5DA 2HP9A 1JVJA 5EOOA 3N7WA 5FQJA 4IVKA 3AGEA 4Y0UA 4JF6A 1QMEA 1ZKJA 3ZVWA 5CGWA 3KO3A 4H8RA 4MEZA 4E3MA 2WKEA 1ZG6A 4GNUA 2ZQ8A 4OONA 1Z6FA 2J9PA 5IHVA 1GHIA 4ZTKA 2HDSA 2XF3A 2XLNA 3BRMA 5CHJA 1H5XA 3BFDA 3FWLA 5FI6A 4F94A 4S03A 1KGFA 1ZC2A 2QPNA 4X6TA 5CHMA 4LV2A 1N4OA 2PU4A 3IF6A 4KQQA 5BOHA 4GKUA 1XP4A 1FCNA 2IWBA 4RRCA 2Y2NA 4RRJA 1PWCA 3KNPA 1H8YA 4HEFA 1CI8A 3G2YA 1XGIA 3IXHA 3ISGA 4X53A 5EE8A 4BL3A 3UNWA 3A3DA 3BFEA 3G32A 3P09A 1Y54A 2WAEA 4JF4A 3ZG8B 3QHYA 4P0MA 3KO7A 4KZ9A 1E3UD 5DTSA 5FDHA 5M19A 2Y2GA 3O88A 1MXOA 3PBNA 5E2EA 2XDMA 4WMCA 1E4DA 4DXBA 3WS5A 5A91A 1DY6A 4KG6A 4N9KA 2HDQA 1HZOA 5GHYA 2HL2A 4RVAA 4QY5A 3N8RA 3KO9A 4OQHA 1Q2PA 3HVFA 2XD1A 1WE4A 4K0WA 4IVIA 3BFCA 3ZGAB 1GA0A 4GN2A 4NBJA 4NK3A 4U0TA 5CRFA 3OPRA 1EI5A 1K57C 4RRMA 4R4SA 2UWXA 2WKIA 1SDNA 5FQMA 1LLBA 5JYPA 2XFTA 3UE3A 1FQGA 2G2UA 3HUMA 4QU3A 4RRIA 2OLVA 3SS3A 1JTGA 2ZQ7A 1E25A 1BUEA 1Q2QA 1KE0A 5FQ9A 5FASA 1MWTA 2JBFA 3AGFA 4B4XA 1MBLA 4S2JA 2ZQCA 3LY3A 1LI0A 3JYIA 1QMFA 4OQGA 4R4RA 4RRGA 5FAQA 2EFUA 1RGZA 2ZM2A 4UA6A 3A3JA 5M1AA 1GHMA 3NDGA 4JXGA 4KZ3A 1K54C 1EWZA 3KODA 4N1HA 1IYQA 4S2NA 5DF7A 3ZG7B 2DNSA 2WGWB 3UO9A 3ZG0A 4RR6A 1BZAA 5CGSA 4EV4A 3BYDA 4KQOA 4RA7A 1J7GA 1KVMA 3V39A 4P85A 5GHXA 3OZHA 4OP5A 3UE0A 2VGJA 4DE2A 3LMTA 3IF6C 3O3VA 4BLMA 3VSKA 3GV9A 1JWZA 1SHVA 3G30A 1PI5A 5CERA 1BLHA 1K56D 1K6SA 4GB7A 1FCMA 1VM1A 2Q9MA 4PM7A 1C3BA 2HDRA 3SH9A 3HLFA 5KSCA 2XGNA 2ZC4B 2JC7A 1FR6A 1IELA 3C7UA 3D4FA 3NBLA 4N92A 3IT9A 2QMIA 2ZC3B 2J9OA 1JWVA 5GLDA 2J8YA 1NRFA 2HDUA 3A3EA 3HL9A 1RCJA 4M3KA 3PD5A 3WRZA 1W8QA 4KG5A 3MXSA 3IWQA 4OOLA 4ZBEA 3V3RA 4BD1A 4LV0A 3RXWA 3FKVA 1YLWA 4K91A 4ZAMA 4EBNA 3M2KA 4NBIA 5HAIA 1IKIA 2ZQ9A 4E6WA 1XA1A 3PD3A 3SS4A 1OMEA 3C4OA 3VFFA 4N1XA 3IHBA 3QNBA 3LMVA 5HX9A 4OOYA 3SH7A 5GLAA 5EVID 4WMCD 4MBKA 2P9VB 3UPPA 4U0XA 4E3IA 5CTNA 3GR2A 5A92A 4PPRA 5I94A 1YQSA 2H5SA 4IEDA 1BLSA 2EFXA 3HLEA 3HLDA 2EX8A 3M2JA 1PW8A 3MBZA 3O87A 4X56A 4S2MA 4RR7A 4XXRA 3VSLA 4B4ZA 1ONHA 4QB8A 2PBYA 1K4EA 2XFSA 2ZD8A 3G2ZA 4OOMA 4YINA 2VGKA 3TSGA 4DE1A 5GHZA 4LV1A 1EROA 4RRRA 5EVIC 4HBUA 4Y7PA 4U3TA 4OLDA 1K4FA 2Y2KA 2A49A 4BQMA 5F1GA 4R23A 1G6AA 2XK1A 5DVAA 1JTDA 5AQ7A 4MLLA 1IEMA 4Q8IA 1BLCA 2X01A 4R1GA 2X71A 2HP5A 1G68A 5F1FA 1KGGA 5FAOA 3DW0A 1S0WA 4KZBA 2C6WB 2R9WA 4RRDA 4C75A 3KOCA 4WEKA 5EUAA 4S2KA 3DTMA 4Y0OA 1YT4A 3GTCA 3S4XA 4WELA 2H10A 4S02A 1ESUA 3B3XA 4KZ5A 4BENA 4JXWA 1ALQA 1DJCA 3IQAA 1K6RA 1KE3A 1LHYA 2Z2MB 3S22A 4GD8A 1K25A 1YLPA 3KO5A 3KNFA 4RRKA 3HLBA 1ERQA 3OC2A 4X55A 4WM9A 2PU2A 4BD0A 4DDYA 4DE0A 1JWPA 3Q7VB 4ZDXA 3UDXA 4RR8A 1PYYA 4CPKA 4KG2A 3UDFA 3Q07A 4S2OA 3EQVA 3UDIA 3PD2A 3NC8A 2WK0A 2WADA 3DWKA 5EPHA 5EVIA 3VP3A 4Y0TA 5E43A 5E2HA 2Y2IA 2EX6A 4ID4A 4ZJ1A 3BECA 4LCMA 5DF8A 3VOYA 4RRFA 3IH8A 1YMSA 2ZQAA 5CEDA 4JPMA 4KZAA 3WS0A 3OCNA 1YLJA 1ES3A 2DRWA 3IF6B 3WRTA 2I72A 1LL5A 5FATA 4GDNA 1AXBA 1FSWA 1GA9A 4HESA 5CECA 3PBRA 1FOFA 1DJAA 3CZDA 3E2LA 3Q82A 4LENA 4WYYA 1PIOA 3Q81A 5TFQA 4DE3A 1U60A 5DF9A 3PTEA 1TDLA 1Y2QA 5M18A 1K57A 3ZG5A 1NY0A 4OQIA 4E3NA 2WGIA 1NJ4A 4IBRA 3PBTA 3UY6A 4KZ4A 5TR7A 1WYBA 1FR1A 5U47A 1CEGA 1TEMA 4OPQA 3IHAA 4S0LA 2Y91A 5FSRA 1CI9A 3FYZA 5HW3A 2ZM0A 4RRHA 1W7FA 4GOGA 5KSHA 1O7EA 3RJUA 3MKFA 4D2OA 2BLSA 1K56A 3MFDA 2HL0A 2XD5A 1RGYA 4EBLA 3N8SA 3G34A 3W4PA 5A93A 2FFYA 1SCWA 4XUXA 2OV5A 1YM1A 5KMWA 5HAQA 4GDBA 5AQBA 2J7VA 3SH8A 4QJGA 4UA9A 2B5RA 4Z9QA 3MZDA 4MNRA 2WGVA 4YFMA 5CHUA 2WZXA 1XX2A 2ZC6B 1XPBA 1NXYA 3S1YA 2GDNA 2V20A 3E2KA 4IBXA 5L2FA 1MWSA 5D3OA 1ES4A 5E2FA 2ZC7A 4QD4A 2H0YA 4E3OA 4N9LA 1L0FA 3HLGA 1BULA 3WS1A 4GD6A 3ZG9B 3KOBA 3PAGA 1ONGA 1XKZA 4S2LA 1XGJA 4RX3A 5FQQA 3GVBA 3BM6A 3BEBA 4OP8A 1K54A 3VP0A 2OSUA 1HD8A 5EOEA 4C6YA 3PD4A 4R0QA 3SS5A 2ZC5B 1NYYA 3ITAA 5GLBA 3Q7VA 4LV3A 3W4OA 1MWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O07 A;  1DJB A;  1MY8 A;  1XA7 A;  2E8I A;  3PBO A;  2JE5 A;  3BFG A;  1IYO A;  3LEZ A;  1TDG A;  4FCF A;  3ITB A;  3CG5 A;  1N9B A;  4EUZ A;  2C5W B;  2OLU A;  2H0T A;  5DTK A;  3HRE A;  3IXD A;  4KZ7 A;  1KGE A;  1K38 A;  5EVL A;  1MKI A;  1KDS A;  5CXW A;  1I2W A;  1NZU A;  3NIA A;  2Y2O A;  4PM6 A;  5F82 A;  4DKI A;  3VP2 A;  4OKP A;  4WZ5 A;  5FQK A;  4DDS A;  4PM8 A;  3M6H A;  4OPZ A;  1L0G A;  3C4P A;  3W4Q A;  1S6R A;  4O7D A;  1SKF A;  3IWO A;  4MBH A;  3GSG A;  5F83 A;  5JYO A;  2Y59 A;  3Q1F A;  2Y2P A;  4S2P A;  2RL3 A;  3RXX A;  1E3U A;  3VP4 A;  4CJN A;  3ZDJ A;  1BT5 A;  3W8K A;  2XH9 A;  3C5A A;  2EXA A;  1NYM A;  3FKW A;  2XQZ A;  1BSG A;  4QHC A;  3BLS A;  3UN7 A;  3HLW A;  3G4P A;  1W79 A;  2P74 A;  4E3L A;  2V2F F;  4OLG A;  2Y2J A;  4KQR A;  2CC1 A;  5KZH A;  4EBP A;  5GL9 A;  1HTZ A;  4E6X A;  3O86 A;  4X68 A;  4X69 A;  3ZNT A;  3G31 A;  3GQZ A;  4DXC A;  3MZE A;  3M6B A;  2RCX A;  3IXB A;  4FH2 A;  4NET A;  1MWU A;  4BL2 A;  1FSY A;  4HBT A;  4RYE A;  1SDE A;  3C7V A;  5CGX A;  1K55 C;  1PI4 A;  5E2G A;  1BTL A;  2JCH A;  4XUZ A;  5FI2 A;  4FH4 A;  3LCE A;  4P6B A;  5GLC A;  2EX9 A;  2ZLY A;  3BLM A;  5HAP A;  5EEC A;  3WWX A;  5HFO A;  4R3J A;  1ES2 A;  1PWG A;  4DRT A;  1GCE A;  3VFH A;  4MBF A;  4R3B A;  2WKH A;  1MPL A;  4PM9 A;  3TG9 A;  1YLT A;  2WYX A;  1I5Q A;  3MKE A;  3P98 A;  4DF6 A;  2FFF B;  2ZQD A;  2BG1 A;  3VMA A;  1PZO A;  4JXV A;  3MZF A;  4LCL A;  3VP1 A;  1L2S A;  1K55 A;  3OCL A;  4E3J A;  3VOZ A;  2V1Z A;  5A90 A;  1L0D A;  1ZG4 A;  1I2S A;  2Y2L A;  2R9X A;  3FV7 A;  2Y55 A;  3GMW A;  3DWZ A;  4KZ6 A;  1L0E A;  3QNC A;  2WAF A;  3OPP A;  1IYS A;  4OH0 A;  5FQI A;  4WZ5 C;  4EWF A;  3CJM A;  4C3Q A;  5CTM A;  4PMA A;  2Q9N A;  1M6K A;  1PW1 A;  4OVD A;  5AQA A;  3IXG A;  3OPL A;  5HL1 A;  3A3I A;  1XXM A;  4OQ0 A;  2XR0 A;  3CMZ A;  4S2N C;  1LL9 A;  3ZCZ A;  1CK3 A;  1RP5 A;  5FAP A;  3ZNY A;  4UHU A;  5J8X A;  5DTT A;  1KVL A;  4RX2 A;  5FA7 A;  4BJP A;  2WGW A;  1FCO A;  4JXS A;  5EVI B;  3TOI A;  4KEN B;  3LO7 A;  1M40 A;  2HPB A;  4QY6 A;  3LY4 A;  3FZC A;  1NZO A;  4JF5 A;  4WEJ A;  3PBS A;  2WUQ A;  3G35 A;  1YLZ A;  3PAE A;  2X02 A;  3ZVT A;  3WS4 A;  2WZZ A;  5FI7 A;  3V3S A;  1H8Z A;  3MXR A;  4K0X A;  3UE1 A;  3V5M A;  3N6I A;  2EX2 A;  1HVB A;  2P9V A;  3Q7Z A;  4WZ4 A;  3N4I A;  4JKT A;  1PWD A;  4L0L A;  3UPN A;  4GZB A;  3SOI A;  2HP6 A;  4A5R A;  2Z2L B;  4WBG A;  4JBF A;  5G18 A;  4EQI A;  3IWI A;  3NY4 A;  1ERM A;  1J9M A;  4OPR A;  3I7J A;  3IF5 A;  3V50 A;  3HLC A;  2EXB A;  3PBQ A;  2QZ6 A;  3IH9 A;  4P87 A;  1WYC A;  3NCK A;  3NI9 A;  2DCF A;  3EQU A;  4FD8 A;  5AQ9 A;  1TVF A;  1IKG A;  4B88 A;  1CEF A;  1ESI A;  3OPH A;  2Y4A A;  4ZJ2 A;  4UAA A;  1LI9 A;  1VQQ A;  2Y2M A;  2ZMA A;  2A3U A;  3GRJ A;  1W8Y A;  1KDW A;  3A3F A;  3AGD A;  1BLP A;  2IWC A;  4KZ8 A;  1YLY A;  3ZHH A;  5TGF A;  3WS2 A;  2ZM8 A;  1YMX A;  4FSF A;  5CEB A;  3HUO A;  1IYP A;  3BFF A;  2G2W A;  2Y2H A;  2XEP A;  3UPO A;  1PZP A;  3HUN A;  2Y2Q A;  3ZFZ A;  4JLF A;  3HBR A;  1ES5 A;  4E3K A;  2IWD A;  3N8L A;  1GHP A;  4S2I A;  4ZJ3 A;  1KE4 A;  2ZJ9 A;  3NDE A;  4OPY A;  4UA7 A;  4PM5 A;  5HAR A;  1W5D A;  2HP9 A;  1JVJ A;  5EOO A;  3N7W A;  5FQJ A;  4IVK A;  3AGE A;  4Y0U A;  4JF6 A;  1QME A;  1ZKJ A;  3ZVW A;  5CGW A;  4H8R A;  4MEZ A;  4E3M A;  2WKE A;  1ZG6 A;  4GNU A;  2ZQ8 A;  4OON A;  1Z6F A;  2J9P A;  5IHV A;  1GHI A;  4ZTK A;  2HDS A;  2XF3 A;  2XLN A;  3BRM A;  5CHJ A;  1H5X A;  3BFD A;  3FWL A;  5FI6 A;  4F94 A;  1KGF A;  1ZC2 A;  2QPN A;  4X6T A;  5CHM A;  4LV2 A;  1N4O A;  2PU4 A;  3IF6 A;  4KQQ A;  5BOH A;  4GKU A;  1XP4 A;  1FCN A;  2IWB A;  2Y2N A;  1PWC A;  1H8Y A;  4HEF A;  1CI8 A;  3G2Y A;  1XGI A;  3IXH A;  3ISG A;  4X53 A;  5EE8 A;  4BL3 A;  3UNW A;  3A3D A;  3BFE A;  3G32 A;  3P09 A;  1Y54 A;  2WAE A;  4JF4 A;  3ZG8 B;  3QHY A;  4P0M A;  4KZ9 A;  1E3U D;  5DTS A;  5FDH A;  5M19 A;  2Y2G A;  3O88 A;  1MXO A;  3PBN A;  5E2E A;  2XDM A;  4WMC A;  1E4D A;  4DXB A;  3WS5 A;  5A91 A;  1DY6 A;  4KG6 A;  4N9K A;  2HDQ A;  1HZO A;  5GHY A;  4RVA A;  4QY5 A;  3N8R A;  4OQH A;  1Q2P A;  3HVF A;  2XD1 A;  1WE4 A;  4K0W A;  4IVI A;  3BFC A;  3ZGA B;  1GA0 A;  4GN2 A;  4NK3 A;  4U0T A;  5CRF A;  3OPR A;  1EI5 A;  1K57 C;  4R4S A;  2UWX A;  2WKI A;  1SDN A;  5FQM A;  1LLB A;  5JYP A;  2XFT A;  3UE3 A;  1FQG A;  2G2U A;  3HUM A;  4QU3 A;  2OLV A;  3SS3 A;  1JTG A;  2ZQ7 A;  1E25 A;  1BUE A;  1Q2Q A;  1KE0 A;  5FQ9 A;  5FAS A;  1MWT A;  2JBF A;  3AGF A;  4B4X A;  1MBL A;  4S2J A;  2ZQC A;  3LY3 A;  1LI0 A;  3JYI A;  1QMF A;  4OQG A;  4R4R A;  5FAQ A;  2EFU A;  1RGZ A;  2ZM2 A;  4UA6 A;  3A3J A;  5M1A A;  1GHM A;  3NDG A;  4JXG A;  4KZ3 A;  1K54 C;  1EWZ A;  4N1H A;  1IYQ A;  4S2N A;  5DF7 A;  3ZG7 B;  2DNS A;  2WGW B;  3UO9 A;  3ZG0 A;  1BZA A;  5CGS A;  4EV4 A;  3BYD A;  4KQO A;  4RA7 A;  1KVM A;  3V39 A;  4P85 A;  5GHX A;  3OZH A;  4OP5 A;  3UE0 A;  2VGJ A;  4DE2 A;  3IF6 C;  3O3V A;  4BLM A;  3VSK A;  3GV9 A;  1JWZ A;  1SHV A;  3G30 A;  1PI5 A;  5CER A;  1BLH A;  1K56 D;  1K6S A;  4GB7 A;  1FCM A;  1VM1 A;  2Q9M A;  4PM7 A;  1C3B A;  2HDR A;  3SH9 A;  3HLF A;  5KSC A;  2XGN A;  2ZC4 B;  2JC7 A;  1FR6 A;  1IEL A;  3C7U A;  3D4F A;  3NBL A;  4N92 A;  3IT9 A;  2QMI A;  2ZC3 B;  2J9O A;  1JWV A;  5GLD A;  2J8Y A;  1NRF A;  2HDU A;  3A3E A;  3HL9 A;  1RCJ A;  4M3K A;  3WRZ A;  1W8Q A;  4KG5 A;  3MXS A;  3IWQ A;  4OOL A;  4ZBE A;  3V3R A;  4BD1 A;  4LV0 A;  3RXW A;  3FKV A;  1YLW A;  4K91 A;  4ZAM A;  4EBN A;  3M2K A;  5HAI A;  1IKI A;  2ZQ9 A;  4E6W A;  1XA1 A;  3SS4 A;  1OME A;  3C4O A;  3VFF A;  4N1X A;  3IHB A;  3QNB A;  5HX9 A;  4OOY A;  3SH7 A;  5GLA A;  5EVI D;  4WMC D;  4MBK A;  2P9V B;  3UPP A;  4U0X A;  4E3I A;  5CTN A;  3GR2 A;  5A92 A;  4PPR A;  5I94 A;  1YQS A;  2H5S A;  4IED A;  1BLS A;  2EFX A;  3HLE A;  3HLD A;  2EX8 A;  3M2J A;  1PW8 A;  3MBZ A;  3O87 A;  4X56 A;  4S2M A;  4XXR A;  3VSL A;  4B4Z A;  1ONH A;  4QB8 A;  2PBY A;  1K4E A;  2XFS A;  2ZD8 A;  3G2Z A;  4OOM A;  4YIN A;  2VGK A;  3TSG A;  4DE1 A;  5GHZ A;  4LV1 A;  1ERO A;  5EVI C;  4HBU A;  4Y7P A;  4U3T A;  4OLD A;  1K4F A;  2Y2K A;  2A49 A;  4BQM A;  5F1G A;  4R23 A;  1G6A A;  2XK1 A;  5DVA A;  1JTD A;  5AQ7 A;  4MLL A;  1IEM A;  4Q8I A;  1BLC A;  2X01 A;  4R1G A;  2X71 A;  2HP5 A;  1G68 A;  5F1F A;  1KGG A;  5FAO A;  3DW0 A;  1S0W A;  4KZB A;  2C6W B;  2R9W A;  4C75 A;  4WEK A;  5EUA A;  4S2K A;  3DTM A;  4Y0O A;  1YT4 A;  3GTC A;  3S4X A;  4WEL A;  2H10 A;  1ESU A;  3B3X A;  4KZ5 A;  4BEN A;  4JXW A;  1ALQ A;  1DJC A;  3IQA A;  1K6R A;  1KE3 A;  1LHY A;  2Z2M B;  3S22 A;  4GD8 A;  1K25 A;  1YLP A;  3HLB A;  1ERQ A;  3OC2 A;  4X55 A;  4WM9 A;  2PU2 A;  4BD0 A;  4DDY A;  4DE0 A;  1JWP A;  3Q7V B;  4ZDX A;  3UDX A;  1PYY A;  4CPK A;  4KG2 A;  3UDF A;  3Q07 A;  4S2O A;  3EQV A;  3UDI A;  3NC8 A;  2WK0 A;  2WAD A;  3DWK A;  5EPH A;  5EVI A;  3VP3 A;  4Y0T A;  5E43 A;  5E2H A;  2Y2I A;  2EX6 A;  4ID4 A;  4ZJ1 A;  3BEC A;  4LCM A;  5DF8 A;  3VOY A;  3IH8 A;  1YMS A;  2ZQA A;  5CED A;  4JPM A;  4KZA A;  3WS0 A;  3OCN A;  1YLJ A;  1ES3 A;  2DRW A;  3IF6 B;  3WRT A;  2I72 A;  1LL5 A;  5FAT A;  4GDN A;  1AXB A;  1FSW A;  1GA9 A;  4HES A;  5CEC A;  3PBR A;  1FOF A;  1DJA A;  3CZD A;  3E2L A;  3Q82 A;  4LEN A;  4WYY A;  1PIO A;  3Q81 A;  5TFQ A;  4DE3 A;  1U60 A;  5DF9 A;  3PTE A;  1TDL A;  5M18 A;  1K57 A;  3ZG5 A;  1NY0 A;  4OQI A;  4E3N A;  2WGI A;  1NJ4 A;  4IBR A;  3PBT A;  3UY6 A;  4KZ4 A;  5TR7 A;  1WYB A;  1FR1 A;  5U47 A;  1CEG A;  1TEM A;  4OPQ A;  3IHA A;  2Y91 A;  5FSR A;  1CI9 A;  3FYZ A;  5HW3 A;  2ZM0 A;  1W7F A;  4GOG A;  5KSH A;  1O7E A;  3RJU A;  3MKF A;  4D2O A;  2BLS A;  1K56 A;  3MFD A;  2XD5 A;  1RGY A;  4EBL A;  3N8S A;  3G34 A;  3W4P A;  5A93 A;  2FFY A;  1SCW A;  4XUX A;  2OV5 A;  1YM1 A;  5KMW A;  5HAQ A;  4GDB A;  5AQB A;  2J7V A;  3SH8 A;  4QJG A;  4UA9 A;  2B5R A;  4Z9Q A;  3MZD A;  4MNR A;  2WGV A;  4YFM A;  5CHU A;  2WZX A;  1XX2 A;  2ZC6 B;  1XPB A;  1NXY A;  3S1Y A;  2GDN A;  2V20 A;  3E2K A;  4IBX A;  5L2F A;  1MWS A;  5D3O A;  1ES4 A;  5E2F A;  2ZC7 A;  4QD4 A;  2H0Y A;  4E3O A;  4N9L A;  1L0F A;  3HLG A;  1BUL A;  3WS1 A;  4GD6 A;  3ZG9 B;  3PAG A;  1ONG A;  1XKZ A;  4S2L A;  1XGJ A;  4RX3 A;  5FQQ A;  3GVB A;  3BM6 A;  3BEB A;  4OP8 A;  1K54 A;  3VP0 A;  2OSU A;  1HD8 A;  5EOE A;  4C6Y A;  4R0Q A;  3SS5 A;  2ZC5 B;  1NYY A;  3ITA A;  5GLB A;  3Q7V A;  4LV3 A;  3W4O A;  1MWR A; 
#chains in the Genus database with same CATH topology
 2E8I A;  3PBO A;  1IYO A;  4FCF A;  1N9B A;  4EUZ A;  1JKE A;  1YSP A;  3EGD C;  1MZU A;  2H0T A;  2LB5 A;  1KDS A;  2HKZ A;  5CXW A;  1NZU A;  4DKI A;  1TC5 A;  4WZ5 A;  4S0I A;  3BQA A;  4PKY G;  2W1T A;  3M6H A;  4EEU A;  2OAQ 1;  3GSG A;  5F83 A;  5JYO A;  5F68 A;  3Q1F A;  2NUT C;  3ZDJ A;  2IA2 A;  3QP2 A;  2HF6 A;  4KQR A;  3CUE C;  5DJU A;  4EBP A;  3G31 A;  4DXC A;  2VZW A;  4F3L A;  3IXB A;  1DP6 A;  4BL2 A;  5J7E A;  4HH2 A;  1K55 C;  3GDI A;  1BTL A;  4MN5 A;  1J3W A;  3W2Z A;  3LCE A;  3BLM A;  5HAP A;  1CF0 A;  1PWG A;  1GCE A;  3C38 A;  3VFH A;  3OLO A;  4MBF A;  4R3B A;  4PM9 A;  2PYP A;  5DJT A;  3TG9 A;  1YLT A;  3MKE A;  4O0P A;  4DF6 A;  2FFF B;  2W3H A;  3LIC A;  2BG1 A;  4LRX C;  3CAX A;  4LCL A;  1L2S A;  4NKP A;  2V1Z A;  2XA7 M;  1L0D A;  2R9X A;  3FV7 A;  5EM1 A;  3DWZ A;  4QWO A;  2WAF A;  3KSH A;  4WZ5 C;  2DBO A;  2MJ6 A;  1PW1 A;  4OVD A;  5MC7 A;  3EOI A;  4IUK A;  3A3I A;  3ULF A;  3CMZ A;  2W3D A;  1CK3 A;  1RP5 A;  3K3D A;  5FAP A;  1JNU A;  4HP9 A;  1KVL A;  2GNX A;  4JGQ A;  5DFY A;  5FA7 A;  1M40 A;  1LSX A;  3C30 A;  4RRB A;  3R4K A;  3PAE A;  3MXR A;  4K0X A;  4I3J A;  3V5M A;  2VKS A;  3N6I A;  4NXG A;  4JBF A;  4R38 A;  5G18 A;  4EQI A;  3MF0 A;  3I7J A;  5HWW A;  3HLC A;  3A0R A;  3NCK A;  2OKV A;  5AQ9 A;  3LR0 A;  4Y13 A;  1EW0 A;  5IT5 A;  4B88 A;  4UAA A;  2A3U A;  1KDW A;  1BLP A;  2IWC A;  4KZ8 A;  1YLY A;  3ZHH A;  5F69 A;  3UPO A;  1PZP A;  3HUN A;  3LIE A;  5HSQ A;  5HPF A;  1GHP A;  5HD3 A;  3NDE A;  2ZJ9 A;  4OPY A;  3C2W A;  4PM5 A;  5HAR A;  5FQJ A;  1JVJ A;  3BJN A;  4Y0U A;  4JF6 A;  2WKP A;  5CGW A;  3KO3 A;  1ZG6 A;  1TS6 A;  1MC0 A;  3A0S A;  4MN7 A;  1Z6F A;  4ZTK A;  2XLN A;  5CHJ A;  5FI6 A;  4S03 A;  1ZC2 A;  5CHM A;  4LV2 A;  4KQQ A;  4GKU A;  1XP4 A;  4RRJ A;  1CI8 A;  3G2Y A;  4BL3 A;  5FEF A;  2B02 A;  2J80 A;  2GZA A;  3ICY A;  4JF4 A;  2P08 A;  3QHY A;  3RH8 B;  2Y2G A;  1MXO A;  2YKH A;  1E4D A;  1DY6 A;  3MS6 A;  5HWV A;  1HZO A;  3N8R A;  4MMN A;  1S4S A;  4OQH A;  4K0W A;  3HVF A;  2XD1 A;  3ZGA B;  1GA0 A;  4GN2 A;  5CRF A;  1D1J A;  2V9A A;  5AVF A;  2XFT A;  2G2U A;  4RRI A;  1JTG A;  4B4X A;  1MBL A;  4B93 A;  3LY3 A;  4XT2 B;  4R4R A;  4RRG A;  1RGZ A;  2ZM2 A;  5M1A A;  4JXG A;  4KZ3 A;  1K54 C;  4N1H A;  4S2N A;  5DF7 A;  2DNS A;  3K2N A;  5DKL A;  3ZQ5 A;  2PD8 A;  3OZH A;  1S66 L;  3QP4 A;  4BLM A;  5F6A A;  3GV9 A;  1BLH A;  2Q9M A;  3JVU A;  4PM7 A;  4WLA A;  4BMW A;  2QHK A;  3D4F A;  3NBL A;  2G7U A;  2XSS A;  1JWV A;  5GLD A;  4ETZ A;  1NRF A;  2HDU A;  3A3E A;  4Y5F A;  1W8Q A;  4KG5 A;  4JGO A;  4MN6 A;  1XFN A;  2ZQ9 A;  5DFX A;  4E6W A;  1XA1 A;  4DN0 A;  3VE4 A;  1UWP X;  3VFF A;  3IHB A;  1VEU A;  1XJ6 A;  4LGW A;  4MBK A;  1HLU P;  2J3T C;  2P9V B;  4CLC B;  4PPR A;  2EFX A;  3HLD A;  1PW8 A;  3VSL A;  2XFS A;  2ZD8 A;  4YIN A;  4X25 A;  5EVI C;  2V0W A;  4U3T A;  4OLD A;  2Y2K A;  4R23 A;  5A8B A;  2X71 A;  2HP5 A;  2D02 A;  1ACF A;  2QJ5 A;  2R9W A;  4WEK A;  3DTM A;  3S4X A;  4B9O A;  2H10 A;  3B3X A;  1ZHH B;  1K6R A;  1P97 A;  3S22 A;  4NG2 A;  3KNF A;  1ERQ A;  4DDY A;  4DE0 A;  1JWP A;  4ZDX A;  4RR8 A;  1F2K A;  3HJI A;  3B47 A;  2K31 A;  4DMZ A;  5EVI A;  2WK0 A;  2WAD A;  3DWK A;  2A24 A;  1VET A;  5DF8 A;  3KYE A;  4Y3I A;  3OCN A;  3WRT A;  1LL5 A;  5FAT A;  5TBM A;  1FSW A;  1GA9 A;  5CEC A;  1PNE A;  3Q82 A;  3Q81 A;  5TFQ A;  2KX6 A;  3EEH A;  1NJ4 A;  4KZ4 A;  4OPQ A;  3KSI A;  4S0L A;  2I9V A;  2JKT M;  4D2O A;  1K56 A;  2HL0 A;  4LFU A;  1RGY A;  4EBL A;  3G34 A;  3W4P A;  1SCW A;  1YM1 A;  4GDB A;  2J7V A;  3MR0 A;  3SH8 A;  3TRC A;  4G3K A;  5CHU A;  1NXY A;  3NUL A;  1IOU A;  5D3O A;  5E2F A;  1P0Z A;  3FC7 A;  3A0V A;  4GD6 A;  3ZG9 B;  3IBJ A;  4XT2 A;  3PAG A;  4I39 A;  1XFQ A;  4S2L A;  1YPR A;  1XGJ A;  1K54 A;  5EOE A;  4C6Y A;  4HQA A;  3ITA A;  3MSH A;  3TW8 A;  4LV3 A;  2PR5 A;  4GHI B;  3W4O A;  1O07 A;  3UB9 A;  4R70 A;  2JE5 A;  3NJA A;  3ITB A;  1NWZ A;  3KO4 A;  4II7 A;  2OLU A;  3IXD A;  4PM6 A;  3VP2 A;  2LB9 A;  2HZ5 A;  1L0G A;  3C4P A;  3IX4 A;  3TJZ C;  3VE3 A;  3L9K A;  2RL3 A;  3B33 A;  1E3U A;  2K2N A;  3VP4 A;  2K7S A;  4CJN A;  3SW1 A;  1BT5 A;  3W8K A;  2PR6 A;  1NYM A;  3FKW A;  2XQZ A;  1BSG A;  3BLS A;  2HL1 A;  3HLW A;  3G4P A;  1FIL A;  1W79 A;  2P74 A;  4OLG A;  3H7W A;  5HZH A;  2CC1 A;  5KZH A;  4BBV A;  1HTZ A;  3O86 A;  4X69 A;  3M6B A;  3RTY A;  2OOL A;  4FH2 A;  4NET A;  1FSY A;  1SDE A;  1BYW A;  1V9Y A;  1PI4 A;  2JCH A;  4XUZ A;  4CLC A;  4P6B A;  2EX9 A;  1TS8 A;  5EEC A;  3WWX A;  4R3J A;  5HWT A;  3F1O A;  1MPL A;  3EGX C;  2ZQD A;  1PZO A;  3MQO A;  2VLG A;  4EER A;  3VP1 A;  3T12 B;  1K55 A;  1FIK A;  3T4Q A;  1L0E A;  3OPP A;  2PT7 A;  3T4S A;  4OH0 A;  3T4L A;  3KSF A;  4LRZ E;  4C3Q A;  5IU1 A;  3IXG A;  1G5U A;  3ZCZ A;  2XR0 A;  1LL9 A;  4MDZ A;  5DTT A;  3UE6 A;  1K0K A;  4RX2 A;  5EFW A;  2WGW A;  2PRF A;  1F9I A;  3TOI A;  4KEN B;  1LSW A;  3LO7 A;  3T1X A;  1S67 L;  3LY4 A;  3PBS A;  2WUQ A;  1G28 A;  3KX0 X;  3UE1 A;  3SZT A;  1HVB A;  3T1S A;  5L07 A;  4EES A;  4PKY A;  3UB8 A;  4A5R A;  2Z2L B;  3F1N B;  2WKR A;  2VV8 A;  1ERM A;  3U4L P;  3IS2 B;  3LR4 A;  3PBQ A;  3IH9 A;  1F98 A;  3EQU A;  3H82 A;  1TVF A;  3UB7 A;  2Y2M A;  2ZMA A;  1NLZ A;  1W8Y A;  3AGD A;  1ODV A;  1YAX A;  2G2W A;  1OTA A;  2JKF A;  2Y2H A;  1ES5 A;  2IWD A;  5HDS A;  1KE4 A;  3P7N A;  1W5D A;  2XRN A;  5EOO A;  3N7W A;  5I5L A;  3DTE A;  1ZKJ A;  2HJE A;  3ZVW A;  4NXB A;  4H8R A;  4GNU A;  5HDC A;  2ZOI A;  2J9P A;  1XJ2 A;  2HDS A;  3LR3 A;  2Y79 A;  1H5X A;  3BFD A;  4F94 A;  1KGF A;  4X6T A;  1N4O A;  2PU4 A;  1NLY A;  1H8Y A;  4HEF A;  3ISG A;  1T18 A;  3UNW A;  3P09 A;  3KO7 A;  4KZ9 A;  5DTS A;  5M19 A;  5AJG A;  3O88 A;  1X0O A;  5A91 A;  4N9K A;  2HDQ A;  2HL2 A;  1MKM A;  4RVA A;  4QY5 A;  3KO9 A;  4IVI A;  3BFC A;  4JGP A;  4R3A A;  3LI8 A;  2Q0O A;  2XA7 S;  1EI5 A;  1K57 C;  4RRM A;  4R4S A;  1SDN A;  2OLV A;  1E25 A;  2ZQ7 A;  1Q2Q A;  1OJG A;  1MWT A;  3LYX A;  1D06 A;  2O9B A;  4YOF A;  3KYZ A;  3A3J A;  2VV7 A;  1GHM A;  3HCY A;  3KOD A;  3ZG0 A;  1BZA A;  4EW7 A;  3BYD A;  2PDR A;  1KVM A;  2E8J A;  4P85 A;  3LIB A;  5G4Z A;  3D9Y A;  3VSK A;  4HHD A;  1W63 M;  1K6S A;  1VM1 A;  1C3B A;  3HLF A;  5KSC A;  3T4K A;  4Y15 A;  4N92 A;  2PYR A;  3IT9 A;  2QMI A;  2ZC3 B;  2J9O A;  4ETX A;  3HL9 A;  3F1P A;  2VGL S;  1TS0 A;  3IWQ A;  4OOL A;  4ZBE A;  3CLO A;  2VJW A;  3M2K A;  4HH3 A;  4NBI A;  1SKO B;  5HAI A;  1IKI A;  2HV1 A;  4P6Z M;  3UB5 P;  3QP5 A;  3SS4 A;  3GEC A;  4N1X A;  3F1P B;  3LMV A;  5HX9 A;  4OOY A;  3SH7 A;  5GLA A;  4WMC D;  2J3W A;  5L10 A;  4E3I A;  3GR2 A;  5A92 A;  1OTB A;  1YQS A;  1F5M A;  4IED A;  3HLE A;  3MBZ A;  2EX8 A;  3O87 A;  5DKK A;  3OOV A;  2PBY A;  1K4E A;  3TSG A;  4DE1 A;  4RRR A;  4Y7P A;  2J3T D;  1K4F A;  2YKF A;  2HGV A;  1G6A A;  5DVA A;  1JTD A;  3ZYT A;  2JKR I;  1N9L A;  5FDS A;  5FAO A;  4K08 A;  4RRD A;  4WF0 A;  5EUA A;  3S7Q A;  3GTC A;  4UQI S;  2AVX A;  4BEN A;  1ALQ A;  1DJC A;  3IQA A;  3PR6 A;  1LHY A;  5F5Y A;  1K25 A;  3HLB A;  4BD0 A;  4WM9 A;  3Q7V B;  1TD5 A;  4YNR A;  2VEA A;  3Q07 A;  4Y2F A;  3IBR A;  3PD2 A;  3NC8 A;  1GSV A;  4GCZ A;  3VP3 A;  5E43 A;  2Y2I A;  2EWV A;  4ZJ1 A;  3VOY A;  1YMS A;  2ZQA A;  5CED A;  4JPM A;  1YLJ A;  4GDN A;  5CX7 A;  1DJA A;  3S7N A;  4ESP A;  4D60 A;  3D72 A;  4I3I A;  1TDL A;  1T1C A;  2O0Y A;  3F1N A;  5M18 A;  1N9O A;  3LEQ A;  4E3N A;  4HY8 A;  3UY6 A;  4AFI A;  3PBT A;  3MJQ A;  1WYB A;  1FR1 A;  2EWW A;  3C8C A;  1TEM A;  5U47 A;  3IHA A;  1CI9 A;  3FYZ A;  3NEC A;  4Y17 A;  1W7F A;  5KSH A;  2A2L A;  3RJU A;  3N8S A;  2OV5 A;  2FH5 A;  5AQB A;  2WGV A;  2ZC6 B;  4X1M A;  3E2K A;  5L2F A;  2PBD P;  4MCW A;  1ES4 A;  4QD4 A;  1H0M A;  3KOB A;  5TJJ A;  2Z6C A;  3T1R A;  1ONG A;  2Z6D A;  3VP0 A;  3PD4 A;  4R0Q A;  3Q7V A;  3RXW A;  2L4R A;  3EWK A;  4IJG A;  3CG5 A;  1VHM A;  3LR5 A;  4KUO A;  2C5W B;  1S4R A;  5DTK A;  4KZ7 A;  1KGE A;  1K38 A;  3UME A;  1I2W A;  2Y2O A;  5F82 A;  4OKP A;  5J61 A;  4FTX A;  5FQK A;  4DDS A;  2BAS A;  3PHY A;  4EEP A;  1N9N A;  4BBT A;  1V9Z A;  1S6R A;  2ZOH A;  2QJ7 A;  4O7D A;  1SKF A;  3FG8 A;  2Y59 A;  2Y2P A;  4GS9 A;  4H6J B;  4O01 A;  4S2P A;  3RXX A;  2XH9 A;  4QHC A;  4HJ6 A;  4E3L A;  3LI9 A;  2V2F F;  5L8M A;  1KOU A;  1S1Z A;  4X68 A;  4EUV A;  2RCX A;  4S0J A;  1OTE A;  2DMW A;  3UB6 A;  5E2G A;  1G6O A;  3E4P A;  5FI2 A;  4FH4 A;  5GLC A;  2EA9 A;  2ZLY A;  1ES2 A;  1UWN X;  1SZV A;  1I5Q A;  4L9F A;  2V1B A;  3VMA A;  3MQ0 A;  2VA0 A;  2ZMF A;  3OCL A;  2PAV P;  4E3J A;  5A90 A;  1ZG4 A;  1I2S A;  3F1O B;  2KOI A;  2W3E A;  3QNC A;  1IYS A;  5FQI A;  3NHQ A;  1T19 A;  4PMA A;  2Q9N A;  1WA9 A;  5AQA A;  5HL1 A;  5FEG A;  1XXM A;  4OQ0 A;  5J4E A;  2OWJ A;  1GSW A;  1FCO A;  4JXS A;  5EVI B;  1DRM A;  3FZC A;  4JF5 A;  1YLZ A;  1GSX A;  3WS4 A;  2WZZ A;  3PYP A;  1H8Z A;  4ARZ A;  2JKT I;  3Q7Z A;  5KIZ A;  3N4I A;  4JKT A;  1PWD A;  4L0L A;  4PHT A;  4GZB A;  4WBG A;  3PXP A;  4NEE D;  3NY4 A;  4OPR A;  2EXB A;  4P87 A;  3L7H A;  2VGL M;  1WYC A;  3NI9 A;  2B95 A;  2HJ9 C;  2DCF A;  4FD8 A;  4YWZ A;  1CEF A;  1ESI A;  3OPH A;  3S7O A;  4ZJ2 A;  2VK3 A;  1A0K A;  5TGF A;  5CEB A;  1Z09 A;  1IYP A;  3BFF A;  3E0Y A;  2Y2Q A;  4JLF A;  2M7V A;  3N8L A;  4ZJ3 A;  4UA7 A;  2HP9 A;  3LIF A;  4IVK A;  3UMD A;  4UEY A;  1QME A;  1IFQ A;  5K5B A;  2ZQ8 A;  1SKO A;  4PAU A;  3DTK A;  5IHV A;  3R7W B;  1LSV A;  2QPN A;  5BOH A;  2IWB A;  1FCN A;  2Y2N A;  1ZTU A;  4WL9 A;  4Q0J A;  1XGI A;  3IXH A;  4X53 A;  3A3D A;  3BFE A;  1Y54 A;  4P0M A;  1E3U D;  2WKQ A;  5FDH A;  5E2E A;  4WMC A;  3CUE A;  1VET B;  2M1C A;  1WE4 A;  2M7U A;  4NBJ A;  4NK3 A;  4U0T A;  3K3C A;  3E98 A;  5JYP A;  1FQG A;  4QU3 A;  4M4X A;  1BUE A;  4LRY C;  4X1L A;  1KE0 A;  3JPU A;  2JBF A;  4EQ1 A;  2VV6 A;  2ZQC A;  1LI0 A;  3JYI A;  1QMF A;  3DBA A;  1TS7 A;  4OQG A;  2EFU A;  5C5K A;  3E4O A;  5J3W A;  4G3W A;  5EM0 A;  3ZG7 B;  2WGW B;  4GLQ A;  3UO9 A;  4RR6 A;  4EV4 A;  4KQO A;  1NRJ A;  1J7G A;  3V39 A;  5GHX A;  4OP5 A;  3UE0 A;  2VGJ A;  2W3G A;  3TE8 A;  3LMT A;  1TF1 A;  3FPV A;  3G6O A;  1JWZ A;  1SHV A;  3G30 A;  1PI5 A;  3HJK A;  2JHE A;  2HDR A;  3R7W A;  3SH9 A;  2B18 A;  2XGN A;  3BW6 A;  1IEL A;  4UQI M;  1OT9 A;  2J8Y A;  1OJ5 A;  4GHI A;  3PD5 A;  4BWI A;  3V3R A;  1YSQ A;  2FZ0 A;  4BD1 A;  4E04 A;  5TBM B;  4K91 A;  4ZAM A;  2CMN A;  4EXO A;  4DJ3 A;  3C4O A;  4CLC C;  3QNB A;  3JVV A;  3UPP A;  4U0X A;  1H8M A;  4KUK A;  5CTN A;  3OBF A;  1UGU A;  1BLS A;  4X56 A;  4S2M A;  4RR7 A;  4FUW A;  4XXR A;  4B4Z A;  1ONH A;  4QB8 A;  3G2Z A;  2VGK A;  5GHZ A;  1ERO A;  4HBU A;  4L9E A;  2XK1 A;  4GJ4 A;  5AQ7 A;  4MLL A;  1IEM A;  2P04 A;  4Q8I A;  4Z1W A;  2X01 A;  4R1G A;  1G68 A;  5F1F A;  3DW0 A;  1S0W A;  4KZB A;  4C75 A;  4WEL A;  3KSG A;  3T4T A;  4KZ5 A;  3CWF A;  4GD8 A;  1YLP A;  3KO5 A;  4RRK A;  3T50 A;  3UDX A;  4CPK A;  1T1B A;  4KG2 A;  3DAV A;  3UDF A;  2O9A A;  3BY8 A;  4GW9 A;  3EQV A;  5EPH A;  4Y0T A;  5E2H A;  4ID4 A;  2W27 A;  2W1T B;  1OTI A;  2DRW A;  5HDD A;  4HES A;  3PBR A;  3E2L A;  4WYY A;  1CJF A;  4DE3 A;  1K57 A;  2NUP C;  2WGI A;  1P9W A;  2Y91 A;  4RRH A;  5HW3 A;  2ZM0 A;  4NXF A;  3MFD A;  5A93 A;  2ZL1 A;  2FFY A;  5KMW A;  1OTD A;  5HAQ A;  4QJG A;  4UA9 A;  2B5R A;  4Z9Q A;  3MZD A;  4MNR A;  4YFM A;  2WZX A;  1XPB A;  3S1Y A;  2GDN A;  2V20 A;  4IBX A;  1W63 Q;  1PRQ A;  2H0Y A;  3CHW P;  1L0F A;  3LID A;  1BUL A;  2L1M A;  4DJ2 A;  2W1R A;  3V67 A;  2KLI A;  4OP8 A;  3LGO A;  1H3Q A;  2GJ3 A;  1HD8 A;  2OSU A;  4WN5 A;  2ZC5 B;  1L3L A;  1NYY A;  5GLB A;  1DP9 A;  3NOT C;  1MWR A;  1DJB A;  1OT6 A;  1MY8 A;  1XA7 A;  2V1A A;  3BFG A;  3LEZ A;  1TDG A;  4ARZ B;  2OAP 1;  3HRE A;  5EVL A;  1MKI A;  3NIA A;  3LIA A;  4PM8 A;  4OPZ A;  3W4Q A;  2QYB A;  4S0K A;  3IWO A;  4MBH A;  4HNB A;  4JGR A;  3LUQ A;  3C5A A;  4L9G A;  2EXA A;  1XJ4 A;  3UN7 A;  4BBU A;  2Y2J A;  5GL9 A;  4E6X A;  3ZNT A;  3GQZ A;  3MZE A;  4GS9 B;  4H6J A;  4I5S A;  2ZL1 B;  1MWU A;  4HBT A;  4RYE A;  3C7V A;  5CGX A;  2V8F A;  3IX8 A;  5EV0 A;  3CPT B;  5HFO A;  4RR9 A;  4DRT A;  2WKH A;  2INW A;  3CIT A;  1VB6 A;  2WYX A;  2KDK A;  3P98 A;  3U2A A;  4RRL A;  4JXV A;  3RFB A;  1S1Y A;  3MZF A;  3NOP C;  1AWI A;  3VOZ A;  2V8C A;  2Y2L A;  2Y55 A;  3GMW A;  4KZ6 A;  5LBR A;  4RRQ A;  2Y8H A;  4HP4 A;  4EWF A;  3CJM A;  5CTM A;  1M6K A;  3OPL A;  2JKR M;  4S2N C;  4ME4 A;  3ZNY A;  4UHU A;  5J8X A;  2L0W A;  4CQH A;  3T4J A;  4WUJ A;  3CPT A;  2HPB A;  4QY6 A;  1NZO A;  4I3A A;  4WEJ A;  3G35 A;  3IS2 A;  2X02 A;  3ZVT A;  3VOL A;  2H28 A;  3T4O A;  5FI7 A;  3V3S A;  4LPZ A;  2QKP A;  2JN7 A;  2EX2 A;  2P9V A;  4WZ4 A;  4G3V A;  3EEA A;  3UPN A;  3BY9 A;  3SOI A;  2HP6 A;  3E4Q A;  5HD5 A;  4P6Z S;  3IWI A;  3LMU A;  1J9M A;  3IF5 A;  3V50 A;  2ZBB A;  2QZ6 A;  5HPI A;  4RRA A;  4Q0I A;  1IKG A;  2Y4A A;  1LI9 A;  1VQQ A;  3GRJ A;  3A3F A;  1OPX A;  1DP8 A;  3WS2 A;  2ZM8 A;  5IS1 A;  1YMX A;  3KYQ A;  4FSF A;  3HUO A;  2XEP A;  4IUH A;  3ZFZ A;  4E3K A;  3HBR A;  3T1Q B;  4S2I A;  5FL3 A;  3AGE A;  4HJ3 A;  2A24 B;  1Y4O A;  4MEZ A;  4E3M A;  2WKE A;  1P9R A;  4OON A;  2O99 A;  3QP1 A;  1GHI A;  2XF3 A;  3BRM A;  3FWL A;  3IF6 A;  4RRC A;  1PWC A;  3KNP A;  2GX5 A;  2P7J A;  5EE8 A;  3VV4 A;  3G32 A;  1LT0 A;  2WAE A;  3ZG8 B;  4FOF A;  4HJ4 A;  3PBN A;  4KQD A;  2R78 A;  2XDM A;  5G4Y A;  4DXB A;  3WS5 A;  4KG6 A;  5GHY A;  3FPW A;  3B42 A;  3QP8 A;  1Q2P A;  4IHQ A;  3OPR A;  4RQ9 A;  3MQQ A;  2UWX A;  2WKI A;  3BWL A;  5EVE A;  3S7P A;  1T1A A;  5FQM A;  1LLB A;  3UE3 A;  3HUM A;  4F3L B;  3SS3 A;  3O5Y A;  5FQ9 A;  5FAS A;  3AGF A;  4S2J A;  2ACG A;  3IX3 A;  5FAQ A;  2QWS A;  2VX8 A;  3BQ8 A;  4UA6 A;  1XJ3 A;  3NDG A;  4CLC E;  1EWZ A;  1IYQ A;  5CGS A;  4RA7 A;  3H82 B;  2XRO A;  4DE2 A;  4Q0H A;  3IF6 C;  3O3V A;  5CER A;  1K56 D;  4GB7 A;  1FCM A;  4EET B;  2W3F A;  2UV0 E;  2ZC4 B;  2JC7 A;  1FR6 A;  3C7U A;  4HOI A;  1VEU B;  4ZRR A;  1RCJ A;  4M3K A;  3WRZ A;  3MXS A;  4I38 A;  4LLO B;  4LV0 A;  3FKV A;  1YLW A;  4EBN A;  1CQA A;  3PD3 A;  3H7W B;  3MXQ A;  1OME A;  5EVI D;  1D7E A;  3CI6 A;  5I94 A;  2H5S A;  3M2J A;  2O9C A;  4OOM A;  4LV1 A;  3MMH A;  2BTF P;  3NOU C;  2A49 A;  4BQM A;  4HIA A;  5F1G A;  5L09 A;  1BLC A;  1KGG A;  2C6W B;  3KOC A;  4S2K A;  4Y0O A;  1LL8 A;  1YT4 A;  4S02 A;  1ESU A;  4JXW A;  5HL6 A;  1KE3 A;  2Z2M B;  3H9W A;  2PHY A;  3OC2 A;  2V0U A;  4X55 A;  2PU2 A;  1PYY A;  3LFV A;  4S2O A;  3UDI A;  1PFL A;  2EX6 A;  4RRF A;  3BEC A;  4LCM A;  3IH8 A;  2ZMV A;  3D3O A;  4HI4 A;  4KZA A;  1Y28 A;  3WS0 A;  5AVE A;  1ES3 A;  3IF6 B;  2I72 A;  1AXB A;  1FOF A;  3CZD A;  4LEN A;  4O8G A;  1PIO A;  2JKG A;  1U60 A;  5DF9 A;  3PTE A;  1Y2Q A;  3DTI A;  3ZG5 A;  1NY0 A;  4QPR A;  4OQI A;  3KO6 A;  4IBR A;  5TR7 A;  1YKD A;  1CEG A;  5FSR A;  4GOG A;  1O7E A;  3MKF A;  2BLS A;  2W0N A;  2XD5 A;  2D01 A;  4XUX A;  4R6L A;  3P01 A;  1XX2 A;  1MWS A;  4EU0 A;  2ZC7 A;  1STZ A;  4E3O A;  4N9L A;  3HLG A;  3WS1 A;  3QP6 A;  1XKZ A;  4NXE A;  4RX3 A;  3MFX A;  5FQQ A;  3GVB A;  3BM6 A;  2OWH A;  3BEB A;  2PD7 A;  3SS5 A;  4CLC D;  4BJP A; 
#chains in the Genus database with same CATH homology
 1O07 A;  1DJB A;  1MY8 A;  1XA7 A;  2E8I A;  3PBO A;  2JE5 A;  3BFG A;  1IYO A;  3LEZ A;  1TDG A;  4FCF A;  3ITB A;  3CG5 A;  1N9B A;  4EUZ A;  1JKE A;  3KO4 A;  2C5W B;  2OLU A;  2H0T A;  5DTK A;  3HRE A;  3IXD A;  4KZ7 A;  1KGE A;  1K38 A;  5EVL A;  1MKI A;  1KDS A;  2HKZ A;  5CXW A;  1I2W A;  1NZU A;  3NIA A;  2Y2O A;  4PM6 A;  5F82 A;  4DKI A;  1TC5 A;  3VP2 A;  4OKP A;  5J61 A;  4WZ5 A;  5FQK A;  4S0I A;  4DDS A;  4PM8 A;  3M6H A;  4OPZ A;  1L0G A;  3C4P A;  3W4Q A;  1S6R A;  4O7D A;  1SKF A;  4S0K A;  3IWO A;  4MBH A;  3GSG A;  5F83 A;  5JYO A;  2Y59 A;  3Q1F A;  2Y2P A;  4S2P A;  2RL3 A;  3RXX A;  1E3U A;  3VP4 A;  4CJN A;  3ZDJ A;  1BT5 A;  3W8K A;  2XH9 A;  3C5A A;  2EXA A;  1NYM A;  3FKW A;  2XQZ A;  1BSG A;  4QHC A;  3BLS A;  3UN7 A;  2HL1 A;  3HLW A;  3G4P A;  1W79 A;  2P74 A;  4E3L A;  2V2F F;  4OLG A;  2Y2J A;  4KQR A;  2CC1 A;  5KZH A;  4EBP A;  5GL9 A;  1HTZ A;  4E6X A;  3O86 A;  4X68 A;  4X69 A;  3ZNT A;  3G31 A;  3GQZ A;  4DXC A;  3MZE A;  3M6B A;  2RCX A;  3IXB A;  4FH2 A;  4NET A;  1MWU A;  4S0J A;  4BL2 A;  1FSY A;  4HBT A;  4RYE A;  1SDE A;  3C7V A;  5CGX A;  1K55 C;  1PI4 A;  5E2G A;  1BTL A;  2JCH A;  4XUZ A;  5FI2 A;  4FH4 A;  3LCE A;  4P6B A;  5GLC A;  2EX9 A;  2ZLY A;  3BLM A;  5HAP A;  5EEC A;  3WWX A;  5HFO A;  4R3J A;  1ES2 A;  4RR9 A;  1PWG A;  4DRT A;  1GCE A;  3VFH A;  4MBF A;  4R3B A;  2WKH A;  1MPL A;  4PM9 A;  3TG9 A;  1YLT A;  2WYX A;  1I5Q A;  3MKE A;  3P98 A;  4DF6 A;  2FFF B;  2ZQD A;  2BG1 A;  4RRL A;  3VMA A;  1PZO A;  4JXV A;  3MZF A;  4LCL A;  3VP1 A;  1L2S A;  1K55 A;  3OCL A;  4E3J A;  3VOZ A;  2V1Z A;  5A90 A;  1L0D A;  1ZG4 A;  1I2S A;  2Y2L A;  2R9X A;  3FV7 A;  2Y55 A;  3GMW A;  3DWZ A;  4KZ6 A;  1L0E A;  3QNC A;  2WAF A;  3OPP A;  4RRQ A;  1IYS A;  4OH0 A;  5FQI A;  4WZ5 C;  4EWF A;  2DBO A;  3CJM A;  4C3Q A;  5CTM A;  4PMA A;  2Q9N A;  1M6K A;  1PW1 A;  4OVD A;  5AQA A;  3IXG A;  3OPL A;  5HL1 A;  3A3I A;  1XXM A;  4OQ0 A;  2XR0 A;  3CMZ A;  4S2N C;  1LL9 A;  3ZCZ A;  1CK3 A;  1RP5 A;  5FAP A;  3ZNY A;  4UHU A;  5J8X A;  5DTT A;  1KVL A;  4RX2 A;  5FA7 A;  4BJP A;  2WGW A;  1FCO A;  4JXS A;  5EVI B;  3TOI A;  4KEN B;  3LO7 A;  1M40 A;  2HPB A;  4QY6 A;  3LY4 A;  3FZC A;  4RRB A;  1NZO A;  4JF5 A;  4WEJ A;  3PBS A;  2WUQ A;  3G35 A;  1YLZ A;  3PAE A;  2X02 A;  3ZVT A;  3WS4 A;  2WZZ A;  5FI7 A;  3V3S A;  1H8Z A;  3MXR A;  4K0X A;  3UE1 A;  3V5M A;  3N6I A;  2EX2 A;  1HVB A;  2P9V A;  3Q7Z A;  4WZ4 A;  3N4I A;  4JKT A;  1PWD A;  4L0L A;  3UPN A;  4GZB A;  3SOI A;  2HP6 A;  4A5R A;  2Z2L B;  4WBG A;  4JBF A;  5G18 A;  4EQI A;  3IWI A;  3LMU A;  3NY4 A;  1ERM A;  1J9M A;  4OPR A;  3I7J A;  3IF5 A;  3V50 A;  3HLC A;  2EXB A;  3PBQ A;  2QZ6 A;  3IH9 A;  4P87 A;  1WYC A;  3NCK A;  3NI9 A;  4RRA A;  2OKV A;  2DCF A;  3EQU A;  4FD8 A;  5AQ9 A;  1TVF A;  1IKG A;  4B88 A;  1CEF A;  1ESI A;  3OPH A;  2Y4A A;  4ZJ2 A;  4UAA A;  1LI9 A;  1VQQ A;  2Y2M A;  2ZMA A;  2A3U A;  3GRJ A;  1W8Y A;  1KDW A;  3A3F A;  3AGD A;  1BLP A;  2IWC A;  4KZ8 A;  1YLY A;  3ZHH A;  5TGF A;  3WS2 A;  2ZM8 A;  1YMX A;  4FSF A;  5CEB A;  3HUO A;  1IYP A;  3BFF A;  2G2W A;  2Y2H A;  2XEP A;  3UPO A;  1PZP A;  3HUN A;  2Y2Q A;  3ZFZ A;  4JLF A;  3HBR A;  1ES5 A;  4E3K A;  2IWD A;  3N8L A;  1GHP A;  4S2I A;  4ZJ3 A;  1KE4 A;  2ZJ9 A;  3NDE A;  4OPY A;  4UA7 A;  4PM5 A;  5HAR A;  1W5D A;  2HP9 A;  1JVJ A;  5EOO A;  3N7W A;  5FQJ A;  4IVK A;  3AGE A;  4Y0U A;  4JF6 A;  1QME A;  1ZKJ A;  3ZVW A;  5CGW A;  3KO3 A;  4H8R A;  4MEZ A;  4E3M A;  2WKE A;  1ZG6 A;  4GNU A;  2ZQ8 A;  4OON A;  1Z6F A;  2J9P A;  5IHV A;  1GHI A;  4ZTK A;  2HDS A;  2XF3 A;  2XLN A;  3BRM A;  5CHJ A;  1H5X A;  3BFD A;  3FWL A;  5FI6 A;  4F94 A;  4S03 A;  1KGF A;  1ZC2 A;  2QPN A;  4X6T A;  5CHM A;  4LV2 A;  1N4O A;  2PU4 A;  3IF6 A;  4KQQ A;  5BOH A;  4GKU A;  1XP4 A;  1FCN A;  2IWB A;  4RRC A;  2Y2N A;  4RRJ A;  1PWC A;  3KNP A;  1H8Y A;  4HEF A;  1CI8 A;  3G2Y A;  1XGI A;  3IXH A;  3ISG A;  4X53 A;  5EE8 A;  4BL3 A;  3UNW A;  3A3D A;  3BFE A;  3G32 A;  3P09 A;  1Y54 A;  2WAE A;  4JF4 A;  3ZG8 B;  3QHY A;  4P0M A;  3KO7 A;  4KZ9 A;  1E3U D;  5DTS A;  5FDH A;  5M19 A;  2Y2G A;  3O88 A;  1MXO A;  3PBN A;  5E2E A;  2XDM A;  4WMC A;  1E4D A;  4DXB A;  3WS5 A;  5A91 A;  1DY6 A;  4KG6 A;  4N9K A;  2HDQ A;  1HZO A;  5GHY A;  2HL2 A;  4RVA A;  4QY5 A;  3N8R A;  3KO9 A;  4OQH A;  1Q2P A;  3HVF A;  2XD1 A;  1WE4 A;  4K0W A;  4IVI A;  3BFC A;  3ZGA B;  1GA0 A;  4GN2 A;  4NBJ A;  4NK3 A;  4U0T A;  5CRF A;  3OPR A;  1EI5 A;  1K57 C;  4RRM A;  4R4S A;  2UWX A;  2WKI A;  1SDN A;  5FQM A;  1LLB A;  5JYP A;  2XFT A;  3UE3 A;  1FQG A;  2G2U A;  3HUM A;  4QU3 A;  4RRI A;  2OLV A;  3SS3 A;  1JTG A;  2ZQ7 A;  1E25 A;  1BUE A;  1Q2Q A;  1KE0 A;  5FQ9 A;  5FAS A;  1MWT A;  2JBF A;  3AGF A;  4B4X A;  1MBL A;  4S2J A;  2ZQC A;  3LY3 A;  1LI0 A;  3JYI A;  1QMF A;  4OQG A;  4R4R A;  4RRG A;  5FAQ A;  2EFU A;  1RGZ A;  2ZM2 A;  4UA6 A;  3A3J A;  5M1A A;  1GHM A;  3NDG A;  4JXG A;  4KZ3 A;  1K54 C;  1EWZ A;  3KOD A;  4N1H A;  1IYQ A;  4S2N A;  5DF7 A;  3ZG7 B;  2DNS A;  2WGW B;  3UO9 A;  3ZG0 A;  4RR6 A;  1BZA A;  5CGS A;  4EV4 A;  3BYD A;  4KQO A;  4RA7 A;  1J7G A;  1KVM A;  3V39 A;  4P85 A;  5GHX A;  3OZH A;  4OP5 A;  3UE0 A;  2VGJ A;  4DE2 A;  3LMT A;  3IF6 C;  3O3V A;  4BLM A;  3VSK A;  3GV9 A;  1JWZ A;  1SHV A;  3G30 A;  1PI5 A;  5CER A;  1BLH A;  1K56 D;  1K6S A;  4GB7 A;  1FCM A;  1VM1 A;  2Q9M A;  4PM7 A;  1C3B A;  2HDR A;  3SH9 A;  3HLF A;  5KSC A;  2XGN A;  2ZC4 B;  2JC7 A;  1FR6 A;  1IEL A;  3C7U A;  3D4F A;  3NBL A;  4N92 A;  3IT9 A;  2QMI A;  2ZC3 B;  2J9O A;  1JWV A;  5GLD A;  2J8Y A;  1NRF A;  2HDU A;  3A3E A;  3HL9 A;  1RCJ A;  4M3K A;  3PD5 A;  3WRZ A;  1W8Q A;  4KG5 A;  3MXS A;  3IWQ A;  4OOL A;  4ZBE A;  3V3R A;  4BD1 A;  4LV0 A;  3RXW A;  3FKV A;  1YLW A;  4K91 A;  4ZAM A;  4EBN A;  3M2K A;  4NBI A;  5HAI A;  1IKI A;  2ZQ9 A;  4E6W A;  1XA1 A;  3PD3 A;  3SS4 A;  1OME A;  3C4O A;  3VFF A;  4N1X A;  3IHB A;  3QNB A;  3LMV A;  5HX9 A;  4OOY A;  3SH7 A;  5GLA A;  5EVI D;  4WMC D;  4MBK A;  2P9V B;  3UPP A;  4U0X A;  4E3I A;  5CTN A;  3GR2 A;  5A92 A;  4PPR A;  5I94 A;  1YQS A;  2H5S A;  4IED A;  1BLS A;  2EFX A;  3HLE A;  3HLD A;  2EX8 A;  3M2J A;  1PW8 A;  3MBZ A;  3O87 A;  4X56 A;  4S2M A;  4RR7 A;  4XXR A;  3VSL A;  4B4Z A;  1ONH A;  4QB8 A;  2PBY A;  1K4E A;  2XFS A;  2ZD8 A;  3G2Z A;  4OOM A;  4YIN A;  2VGK A;  3TSG A;  4DE1 A;  5GHZ A;  4LV1 A;  1ERO A;  4RRR A;  5EVI C;  4HBU A;  4Y7P A;  4U3T A;  4OLD A;  1K4F A;  2Y2K A;  2A49 A;  4BQM A;  5F1G A;  4R23 A;  1G6A A;  2XK1 A;  5DVA A;  1JTD A;  5AQ7 A;  4MLL A;  1IEM A;  4Q8I A;  1BLC A;  2X01 A;  4R1G A;  2X71 A;  2HP5 A;  1G68 A;  5F1F A;  1KGG A;  5FAO A;  3DW0 A;  1S0W A;  4KZB A;  2C6W B;  2R9W A;  4RRD A;  4C75 A;  3KOC A;  4WEK A;  5EUA A;  4S2K A;  3DTM A;  4Y0O A;  1YT4 A;  3GTC A;  3S4X A;  4WEL A;  2H10 A;  4S02 A;  1ESU A;  3B3X A;  4KZ5 A;  4BEN A;  4JXW A;  1ALQ A;  1DJC A;  3IQA A;  1K6R A;  1KE3 A;  1LHY A;  2Z2M B;  3S22 A;  4GD8 A;  1K25 A;  1YLP A;  3KO5 A;  3KNF A;  4RRK A;  3HLB A;  1ERQ A;  3OC2 A;  4X55 A;  4WM9 A;  2PU2 A;  4BD0 A;  4DDY A;  4DE0 A;  1JWP A;  3Q7V B;  4ZDX A;  3UDX A;  4RR8 A;  1PYY A;  4CPK A;  4KG2 A;  3UDF A;  3Q07 A;  4S2O A;  3EQV A;  3UDI A;  3PD2 A;  3NC8 A;  2WK0 A;  2WAD A;  3DWK A;  5EPH A;  5EVI A;  3VP3 A;  4Y0T A;  5E43 A;  5E2H A;  2Y2I A;  2EX6 A;  4ID4 A;  4ZJ1 A;  3BEC A;  4LCM A;  5DF8 A;  3VOY A;  4RRF A;  3IH8 A;  1YMS A;  2ZQA A;  5CED A;  4JPM A;  4KZA A;  3WS0 A;  3OCN A;  1YLJ A;  1ES3 A;  2DRW A;  3IF6 B;  3WRT A;  2I72 A;  1LL5 A;  5FAT A;  4GDN A;  1AXB A;  1FSW A;  1GA9 A;  4HES A;  5CEC A;  3PBR A;  1FOF A;  1DJA A;  3CZD A;  3E2L A;  3Q82 A;  4LEN A;  4WYY A;  1PIO A;  3Q81 A;  5TFQ A;  4DE3 A;  1U60 A;  5DF9 A;  3PTE A;  1TDL A;  1Y2Q A;  5M18 A;  1K57 A;  3ZG5 A;  1NY0 A;  4OQI A;  4E3N A;  2WGI A;  1NJ4 A;  4IBR A;  3PBT A;  3UY6 A;  4KZ4 A;  5TR7 A;  1WYB A;  1FR1 A;  5U47 A;  1CEG A;  1TEM A;  4OPQ A;  3IHA A;  4S0L A;  2Y91 A;  5FSR A;  1CI9 A;  3FYZ A;  5HW3 A;  2ZM0 A;  4RRH A;  1W7F A;  4GOG A;  5KSH A;  1O7E A;  3RJU A;  3MKF A;  4D2O A;  2BLS A;  1K56 A;  3MFD A;  2HL0 A;  2XD5 A;  1RGY A;  4EBL A;  3N8S A;  3G34 A;  3W4P A;  5A93 A;  2FFY A;  1SCW A;  4XUX A;  2OV5 A;  1YM1 A;  5KMW A;  5HAQ A;  4GDB A;  5AQB A;  2J7V A;  3SH8 A;  4QJG A;  4UA9 A;  2B5R A;  4Z9Q A;  3MZD A;  4MNR A;  2WGV A;  4YFM A;  5CHU A;  2WZX A;  1XX2 A;  2ZC6 B;  1XPB A;  1NXY A;  3S1Y A;  2GDN A;  2V20 A;  3E2K A;  4IBX A;  5L2F A;  1MWS A;  5D3O A;  1ES4 A;  5E2F A;  2ZC7 A;  4QD4 A;  2H0Y A;  4E3O A;  4N9L A;  1L0F A;  3HLG A;  1BUL A;  3WS1 A;  4GD6 A;  3ZG9 B;  3KOB A;  3PAG A;  1ONG A;  1XKZ A;  4S2L A;  1XGJ A;  4RX3 A;  5FQQ A;  3GVB A;  3BM6 A;  3BEB A;  4OP8 A;  1K54 A;  3VP0 A;  2OSU A;  1HD8 A;  5EOE A;  4C6Y A;  3PD4 A;  4R0Q A;  3SS5 A;  2ZC5 B;  1NYY A;  3ITA A;  5GLB A;  3Q7V A;  4LV3 A;  3W4O A;  1MWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...