2EX2A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
456
structure length
456
Chain Sequence
NVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 146
structure length 456
sequence length 456
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex2A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex2A02
2QZ6A 3O3VA 2P74A 5GHZA 4YINA 5EE8A 4ZJ1A 1FR6A 4WM9A 5CHJA 3RJUA 1GA0A 1KDWA 3IWQA 1N4OA 5FI6A 2HP5A 2V2FF 3NY4A 3G31A 1YLTA 1HTZA 1L0EA 2WZZA 2X71A 1ZKJA 2RCXA 4Y0OA 3FZCA 3ZNTA 4EBNA 4KZBA 3JYIA 2ZLYA 3VP4A 3VSKA 4Y7PA 4MEZA 1PW1A 2XF3A 5CECA 3ZG0A 4N1XA 2A3UA 4P0MA 2WKHA 2ZC5B 2BG1A 1FQGA 1HVBA 3RXXA 3GRJA 4EV4A 4U0TA 1G68A 3QHYA 2HP9A 3ZVTA 3Q7VB 2ZC6B 1K55A 1JWPA 1SDEA 4DE2A 3GVBA 5CEDA 1MWSA 4MLLA 5J8XA 3SOIA 2DCFA 3O86A 3FWLA 1GCEA 5CTMA 5CGXA 5FQQA 5EVIB 4HEFA 4Y0UA 3SH7A 4WYYA 5A93A 5FQIA 1BT5A 1YLYA 4LV2A 1ZC2A 3ZFZA 2XFSA 5GLCA 4WELA 2FFYA 3EQVA 1XA1A 1QMEA 4X69A 4E3MA 2V20A 1WYBA 4GOGA 4OP8A 1I2SA 2B5RA 4C3QA 3N8LA 4Q8IA 3UO9A 3SS3A 1K56D 4OPQA 1MPLA 1K55C 4DE0A 1PZPA 4LCLA 1ESUA 1KGGA 1YLZA 4EUZA 3LY3A 4X55A 2C5WB 1PZOA 5CHUA 1DY6A 3DW0A 3W4QA 1IKIA 5F1FA 1ERMA 1H8ZA 1Z6FA 4JF5A 4S2PA 1DJCA 3UNWA 5CXWA 2ZM0A 4IBRA 4XUXA 4RYEA 3HBRA 2WKEA 1GHIA 1K6SA 3IWIA 4UHUA 5FATA 3HLFA 2ZQ8A 3GMWA 5I94A 1S6RA 5F1GA 4OQHA 4KZ8A 4OOYA 4QU3A 3BEBA 2XDMA 4S2JA 1K57A 2Y2LA 3Q1FA 5IHVA 3MBZA 3BFGA 3TG9A 3GR2A 4JPMA 4WEJA 3NI9A 5DF9A 1ALQA 4DKIA 4ZDXA 3HUMA 4WMCD 3O87A 5U47A 4FD8A 4KENB 3CZDA 3ITBA 4R3JA 3BFCA 4EBPA 3PAGA 4KG5A 3UDIA 1YMXA 4JXWA 3G35A 3V3RA 1YMSA 2WGWA 2DNSA 4PM7A 3SS5A 5EOEA 4GZBA 3NDEA 1GA9A 3M2JA 4IVKA 1M6KA 1NXYA 1XP4A 5FI7A 3VP1A 3PBOA 1U60A 4PM8A 2Y2HA 1ZG4A 3VMAA 1K57C 4BENA 1EI5A 5EECA 4M3KA 4RX3A 2OSUA 3AGEA 2OLVA 2Y2PA 4KZ6A 4GD6A 2XFTA 5HAPA 2Y2JA 3V5MA 3UE3A 1CEFA 2Y2GA 1WE4A 3D4FA 3UE1A 4H8RA 4UA6A 3MXRA 3N8RA 4QY5A 1CK3A 1ONHA 2XR0A 5CTNA 1PW8A 1EWZA 2GDNA 2ZC4B 1K4FA 2ZQCA 4GD8A 2E8IA 2XGNA 2ZMAA 4JF4A 3PBSA 2ZM2A 1QMFA 1CI8A 1JWVA 5AQAA 5KSCA 4UA7A 4OPZA 5HX9A 1LHYA 1NYYA 5DTTA 2IWCA 5HAQA 5M18A 2DRWA 4IBXA 2CC1A 5KZHA 4Z9QA 4DRTA 3FKVA 3ZG8B 4GN2A 1YLJA 3HLWA 5FQMA 3AGFA 1KVLA 4S2OA 4JXSA 5EVID 4E3KA 1ES3A 3G34A 4KZ4A 2Z2LB 2XQZA 4OLGA 1W79A 3W4PA 1NJ4A 2Y91A 4P6BA 5M19A 2WAEA 2QMIA 2VGJA 2EX9A 4OPRA 4GDNA 4B88A 1ES4A 1O7EA 2P9VA 1XXMA 3MKFA 1NZUA 2WGVA 1MWUA 1YM1A 2Q9NA 2WADA 3OPHA 3DTMA 2HDSA 1TDGA 2ZQAA 4OONA 5GLDA 4ZJ3A 4BL2A 3DWKA 3TSGA 1FOFA 1KE4A 4OPYA 3UY6A 4A5RA 2BLSA 2Y2QA 1JTGA 3HVFA 3MFDA 1TDLA 1W8QA 3S1YA 4C6YA 1J9MA 1M40A 3IF5A 2JE5A 4ZJ2A 4BD1A 1MY8A 4KG6A 3Q07A 1SHVA 4OLDA 1IEMA 4WEKA 4E3LA 2HDQA 3AGDA 2WK0A 3Q7ZA 3PBRA 1CEGA 3S4XA 1WYCA 1PWGA 3NCKA 4FSFA 5AQBA 3BM6A 3IF6A 3WWXA 4PMAA 5DTKA 4OQIA 3BLSA 1LLBA 1XA7A 4PPRA 3LCEA 4HBUA 5FQKA 4E6XA 3IXHA 2EFUA 4L0LA 3N6IA 1ES5A 2JC7A 3B3XA 2H0YA 5CEBA 4S2IA 3WS1A 1IYSA 3ISGA 3OPRA 1CI9A 1GHPA 1K56A 3IH8A 4JLFA 5E2FA 1L0GA 5DF7A 2R9XA 2J9OA 4N9KA 3WRZA 1HZOA 1XPBA 1MWTA 3BFFA 3GSGA 3IF6C 4NETA 1ZG6A 4EQIA 4JXGA 4KZAA 3HL9A 3VFHA 3LY4A 3UN7A 1C3BA 1MXOA 5HW3A 1RGZA 2HP6A 3VP2A 1BZAA 3ZG9B 2H10A 1K6RA 2Q9MA 2Y4AA 2ZQDA 5L2FA 3NC8A 4X6TA 2H5SA 3G4PA 2R9WA 4GNUA 4KZ3A 2ZQ9A 4WZ5C 3OZHA 2IWBA 4BL3A 1K38A 1IYOA 3OCNA 1E25A 2XH9A 3VFFA 3CMZA 4D2OA 2I72A 2Y2NA 4XXRA 4MBKA 4BD0A 3C7UA 4K0XA 3M2KA 4ZBEA 1NZOA 3N8SA 3MKEA 3ZCZA 1KGFA 1BTLA 1E3UD 1L0DA 2XD5A 4B4XA 1MKIA 2HDUA 5E2GA 3PBNA 2UWXA 3ZG7B 3C7VA 4WMCA 5FA7A 5FDHA 4KQRA 3G2YA 1MWRA 5A91A 1E3UA 4LV0A 4RX2A 2EX8A 4DXBA 5KMWA 3A3EA 1W8YA 5AQ9A 3E2KA 3VP0A 3GQZA 4LCMA 1O07A 3DWZA 1FSYA 4X68A 2G2WA 4YFMA 3G32A 1DJAA 1XX2A 1YT4A 4S2MA 1FCOA 3Q81A 4LENA 2EXAA 3WRTA 4GDBA 4DF6A 1BLCA 1BLSA 2V1ZA 2FFFB 2ZD8A 3M6HA 1VQQA 1Y54A 3VOYA 4HBTA 4OOMA 1BULA 1YQSA 5GHYA 2OV5A 3BFDA 1ERQA 3HLGA 1G6AA 4OQGA 2HPBA 5FQJA 5EOOA 2XD1A 4KG2A 3G30A 5EPHA 2X01A 4WZ4A 3SH9A 4OH0A 3C5AA 3W8KA 4R0QA 2WUQA 3V39A 3HUNA 1SKFA 2Y2IA 3SS4A 4X56A 5TFQA 4QHCA 3P98A 1KE0A 2OLUA 1FCMA 3IHAA 4X53A 4N9LA 4DDSA 1RCJA 1TVFA 1N9BA 2ZC7A 4JF6A 4R1GA 5TR7A 3S22A 3VP3A 3V50A 4K0WA 3ZGAB 2WYXA 3Q7VA 2Z2MB 4R4SA 4E3IA 2G2UA 4UA9A 5A92A 1KVMA 3QNCA 5E2HA 4DE1A 4OQ0A 1K25A 3PTEA 1PYYA 4OVDA 4HESA 1YLPA 3A3FA 2J9PA 4MNRA 5EVIA 5FAPA 3OCLA 2EXBA 2HDRA 4O7DA 1LL5A 1PWDA 5CGWA 4GKUA 4P85A 4R4RA 3ZHHA 3BYDA 2XEPA 3OPPA 2WGWB 1RGYA 3EQUA 3V3SA 1IKGA 2PU2A 4QB8A 1L2SA 5HFOA 3Q82A 3CJMA 5CRFA 3UDXA 1RP5A 2EX2A 1IYPA 3IHBA 4CJNA 3TOIA 2Y55A 5JYPA 3HUOA 2J8YA 3WS0A 3ZVWA 4E3OA 2EX6A 3BLMA 2PBYA 1IELA 5HAIA 4E3JA 3M6BA 1KGEA 1AXBA 4R3BA 5FASA 5EVIC 4XUZA 3A3JA 5CGSA 1KE3A 5DTSA 1OMEA 5HL1A 4JKTA 5KSHA 3GV9A 4KZ9A 1VM1A 5E2EA 3G2ZA 4BQMA 5E43A 3PBTA 3MZEA 3C4PA 4MBFA 2JBFA 4PM6A 5DVAA 1K54A 4Y0TA 1JVJA 3GTCA 4P87A 1NRFA 3UPOA 1FCNA 1JWZA 3NBLA 1PIOA 2C6WB 4LV3A 4WZ5A 4CPKA 4N92A 5M1AA 2ZC3B 1I2WA 1MBLA 4QY6A 3BECA 5CHMA 1BLPA 3O88A 5D3OA 4FCFA 3MXSA 1JTDA 5TGFA 1HD8A 2IWDA 3N7WA 2P9VB 4K91A 4U3TA 1LL9A 4E6WA 3LO7A 2WKIA 3VOZA 4KQOA 1K54C 5GLAA 4B4ZA 4OKPA 3FYZA 3IWOA 4GB7A 5GL9A 4E3NA 3N4IA 2H0TA 3QNBA 2RL3A 3ZDJA 1PWCA 2ZJ9A 4IEDA 4UAAA 3WS5A 3HLBA 4EBLA 4OOLA 1BLHA 3FKWA 1FR1A 3ITAA 1BSGA 1PI4A 4JBFA 5EVLA 4NK3A 3UPNA 3IXGA 3E2LA 3IXBA 4PM5A 3FV7A 2ZM8A 1TEMA 3SH8A 1BUEA 2WGIA 5AQ7A 5FSRA 4KZ5A 5F83A 3NDGA 4DDYA 5FAQA 3IF6B 3ZG5A 3CG5A 4WBGA 1ES2A 1SDNA 3BFEA 5F82A 5EUAA 1H5XA 3WS4A 5FQ9A 3UE0A 4KZ7A 1XKZA 1FSWA 2WZXA 3UPPA 4FH4A 1ESIA 1L0FA 3NIAA 2Y2OA 5JYOA 4JXVA 2VGKA 1W5DA 1Q2QA 2WAFA 3HREA 1ONGA 5CERA 2XLNA 3ZNYA 2QPNA 4QJGA 3MZDA 3RXWA 3PAEA 5BOHA 5FAOA 4RVAA 3WS2A 1LI9A 3W4OA 1YLWA 1K4EA 2X02A 3LEZA 4ZAMA 4DE3A 1E4DA 4F94A 2JCHA 3IH9A 4R23A 4S2LA 4C75A 1PI5A 1EROA 1NY0A 2Y59A 4U0XA 2ZQ7A 4RA7A 4S2KA 3HLCA 4DXCA 5A90A 1I5QA 1S0WA 4S2NA 1XGJA 4ID4A 4BJPA 1LI0A 4MBHA 4IVIA 4QD4A 3A3DA 3MZFA 1H8YA 3HLDA 3I7JA 5G18A 5DF8A 1SCWA 3C4OA 4N1HA 3IT9A 2A49A 3OPLA 2EFXA 4KQQA 4EWFA 4OP5A 1Q2PA 2J7VA 3PBQA 2Y2MA 5GHXA 1GHMA 3UDFA 4BLMA 1W7FA 1DJBA 1KDSA 4FH2A 1IYQA 1NYMA 2XK1A 3A3IA 5FI2A 5GLBA 4PM9A 4S2NC 3BRMA 3P09A 4ZTKA 3OC2A 2PU4A 1XGIA 5HARA 3IQAA 3VSLA 4LV1A 2Y2KA 3IXDA 3HLEA
chains in the Genus database with same CATH superfamily
2QZ6A 4ZJ1A 1GA0A 2VK3A 1N4OA 4I3IA 3NY4A 1PNEA 2WZZA 4Y0OA 3ZNTA 1OPXA 4KZBA 5F6AA 1S1ZA 3T1SA 3KOBA 2XF3A 5CECA 3CAXA 4P0MA 2ZC5B 1FQGA 2V9AA 3Q7VB 4I3AA 4DE2A 4LPZA 2W3EA 3GVBA 2DCFA 3KSGA 3KO4A 1YLYA 4LV2A 1XA1A 4Q8IA 3P01A 1MPLA 1XFQA 4X55A 5CHUA 2E8JA 3W4QA 3H82B 1ERMA 1DJCA 2HL2A 5CXWA 3HJIA 4XUXA 1D7EA 1GHIA 1K6SA 1SKOB 4RRAA 2QHKA 4JGOA 3GMWA 2VLGA 3IX4A 4OQHA 4YNRA 1MZUA 1K57A 2Y2LA 3GR2A 4EQ1A 4PKYA 3NI9A 1ALQA 3ITBA 4KG5A 5HD5A 1YMXA 3E0YA 3G35A 1GA9A 3M2JA 3DAVA 1XP4A 5FI7A 3KYEA 3PBOA 1U60A 4F3LA 2Y2HA 1EI5A 4M3KA 2LB5A 4KZ6A 4WN5A 1G5UA 5HAPA 2Y2JA 3UE3A 2WKQA 2Y2GA 3D4FA 4H8RA 4UA6A 3MXRA 3KOCA 2ZC4B 2GDNA 4GD8A 3MMHA 4ARZB 4WLAA 2M7VA 5HDCA 1S1YA 5AQAA 5KSCA 4OPZA 1LHYA 4FTXA 5HAQA 1ZTUA 1YLJA 2HL1A 1VB6A 1W79A 2WAEA 2QMIA 2VGJA 2D02A 1DP8A 1XXMA 1NZUA 2V8CA 1TF1A 3DWKA 1VHMA 3TSGA 4OPYA 3HVFA 1H3QA 3PR6A 4L9GA 3VE3A 3LICA 4RRRA 3IF5A 4BD1A 2YKHA 4DN0A 1MY8A 3LI9A 4WEKA 4HP9A 3AGDA 1IOUA 1WYCA 2L4RA 3NCKA 4Y2FA 4EW7A 1Z09A 5DTKA 4OQIA 1LLBA 4XT2A 3LCEA 3IXHA 3BY9A 2ZMFA 3H9WA 1ES5A 5CEBA 4S2IA 3EWKA 3WS1A 1CI9A 4LFUA 3IH8A 4JLFA 5E2FA 5DF7A 2R9XA 1MC0A 1HZOA 2DMWA 1MWTA 4PHTA 3GSGA 4KZAA 4NXFA 3H7WA 3UN7A 4M4XA 1N9OA 2PD7A 2Y4AA 3KO6A 4KZ3A 2R9WA 2IWBA 4XXRA 3ZQ5A 4ZBEA 4X25A 3MKEA 3ZCZA 1E3UD 1L0DA 4QPRA 3T4SA 5HWTA 2HV1A 3C7VA 5FA7A 2PAVP 1VETA 4KQRA 4LV0A 1V9ZA 2HJEA 1W8YA 4IHQA 2PYPA 5AQ9A 3E2KA 3GQZA 5DKLA 2G2WA 4EERA 1DJAA 1FCOA 3Q81A 2EXAA 4ETZA 4GDBA 2ZD8A 5DFYA 5GHYA 1YQSA 4OQGA 5EOOA 2W3DA 4OH0A 3HUNA 1SKFA 1FCMA 3IHAA 4N9LA 4DDSA 2HF6A 1TVFA 3S7QA 4JF6A 3RH8B 2P04A 2WYXA 3Q7VA 1F2KA 3NOUC 5E2HA 4OQ0A 1K25A 4HESA 1SZVA 2J9PA 1FILA 4R4RA 3ZHHA 3BYDA 2WGWB 4P6ZM 3V3SA 4QB8A 3Q82A 3U2AA 3CJMA 1RP5A 2EX2A 3IHBA 1K0KA 2EA9A 2Y55A 4Y5FA 5JYPA 1OTDA 3WS0A 1N9NA 2EX6A 1P0ZA 5HAIA 3H82A 1AXBA 1OMEA 5HL1A 4BQMA 5E43A 3EGDC 1T1CA 3MZEA 3LGOA 1K54A 1JVJA 3PD2A 1N9LA 3GTCA 1FCNA 5C5KA 3NBLA 1PIOA 2QKPA 3K2NA 4LV3A 4WZ5A 2MJ6A 4N92A 5M1AA 1I2WA 3BECA 5CHMA 5L09A 3O88A 3D3OA 3MXSA 2IWDA 4K91A 2KOIA 3MQ0A 5GLAA 3T4QA 4B4ZA 3T1XA 3FYZA 3IWOA 4LGWA 3N4IA 1XJ4A 1PWCA 3WS5A 4HI4A 4OOLA 2K2NA 5EVLA 1PI4A 2Y79A 2XRNA 5TJJA 3UPNA 3E2LA 4ARZA 5F83A 4CLCD 5KIZA 3NDGA 3KX0X 3QP4A 5HL6A 2VV8A 3LFVA 3BFEA 5F82A 5EUAA 2QYBA 1YSQA 1FSWA 2WZXA 4NG2A 1L0FA 3NIAA 2Y2OA 4JXVA 5L8MA 3GECA 3ZNYA 2XLNA 4HQAA 2UV0E 1T18A 3KYQA 5BOHA 5FAOA 1K4EA 4GHIB 3LEZA 4DE3A 2VGLM 5TBMA 3IH9A 4R23A 4C75A 4CLCC 4U0XA 1KOUA 4S2KA 1J7GA 4DXCA 2G7UA 5A90A 4S2NA 4EUVA 3E98A 1NRJA 4NXEA 1OTBA 3MZFA 1H8YA 2XSSA 3HLDA 5DF8A 4RRLA 2VV6A 1ZHHB 2A49A 2EFXA 2VA0A 3PBQA 3LR3A 5GHXA 1KDSA 2HZ5A 4FH2A 2XK1A 2VEAA 5IU1A 1GSWA 4ZTKA 1CJFA 1JNUA 5HZHA 3VV4A 5GHZA 4GS9B 5EE8A 3QP5A 5FI6A 2GZAA 1YLTA 1HTZA 2X71A 1ZKJA 2RCXA 3C2WA 5J4EA 3EOIA 3VSKA 4Y7PA 4MEZA 1PW1A 4I38A 1T1BA 2WKHA 2BG1A 1HVBA 3LIBA 2JN7A 1G68A 2HP9A 3A0VA 2I9VA 1JWPA 5FL3A 5CEDA 4MLLA 3G6OA 3SOIA 4Q0IA 1GCEA 5CGXA 5FQQA 4HEFA 4HH2A 4KUKA 5A93A 4MCWA 4RRQA 2M1CA 2NUPC 2XFSA 5GLCA 4WELA 2FFYA 3L9KA 1YSPA 2V20A 5HSQA 1AWIA 1I2SA 2B5RA 1K56D 4OPQA 1K55C 1PZPA 4LCLA 1DP9A 1ESUA 3TE8A 2WKPA 3KYZA 4CQHA 3LI8A 2Z6CA 4JF5A 1Z6FA 2ZM0A 2W3FA 1LL8A 2WKEA 1S4SA 3T4OA 1DRMA 5FATA 3HLFA 4GLQA 5F1GA 2PR5A 4OOYA 4QU3A 3BEBA 2XDMA 4BBVA 2D01A 4LRXC 4DKIA 4WMCD 4FD8A 1LSVA 4EU0A 1YMSA 2WGWA 1OT6A 4PM7A 4GZBA 3NDEA 4IVKA 1V9YA 4PM8A 1ZG4A 1STZA 1W63M 2O9AA 2Q0OA 2OSUA 4GD6A 2XFTA 3MJQA 1WE4A 3UE1A 2XR0A 2W27A 2E8IA 2BTFP 4L9EA 2LB9A 1T1AA 3PBSA 3LIDA 4CLCB 1NYYA 2B02A 5EVEA 4Z9QA 4DRTA 3ZG8B 4GN2A 2ZOHA 3HLWA 3KO9A 5EVID 4JXSA 3LUQA 1TD5A 4OLGA 3W4PA 2Y91A 4BBUA 4R6LA 4PKYG 2EX9A 4OPRA 1O7EA 3OPHA 2WGVA 1YM1A 2Q9NA 4ZJ3A 4EQIA 3DTMA 3D9YA 1J3WA 3ZYTA 4MN5A 4GW9A 4ZJ2A 4IUHA 4KG6A 2WK0A 3C30A 3PBRA 1CEGA 4RR8A 4FSFA 5AQBA 3T4TA 4RRGA 3A0RA 4E6XA 3QP1A 3UB6A 2JC7A 2PRFA 4DJ3A 4Y13A 3OPRA 4II7A 3C8CA 4GHIA 4NETA 4JXGA 3VFHA 4RRHA 1G6OA 4FUWA 3MQQA 2YKFA 3LIAA 2Q9MA 1K6RA 3K3DA 4X6TA 3UMDA 5DJTA 2ZL1A 4BL3A 2ZQ9A 5I5LA 4K08A 4Y15A 3T4JA 3VFFA 3B42A 3CMZA 2Y2NA 4K0XA 3UE6A 4O8GA 1KGFA 3KO5A 5F68A 4B4XA 1NWZA 1MKIA 2HDUA 3PBNA 3ZG7B 5FDHA 1MWRA 1E3UA 3BW6A 4RX2A 1CQAA 2EX8A 3LMUA 5KMWA 3A3EA 3KO7A 3VP0A 3ULFA 3D72A 4S2MA 3WRTA 1BLCA 2V1ZA 2FFFB 1Y54A 4GS9A 1BULA 2OV5A 1G6AA 4HNBA 2HPBA 2XD1A 2X01A 3G30A 5EPHA 2V8FA 5MC7A 3SH9A 3W8KA 4R0QA 2WUQA 5TFQA 3S22A 3VP3A 4R1GA 5TR7A 3V50A 4K0WA 5J7EA 1YKDA 2ZMVA 4DE1A 3PTEA 3TW8A 3TJZC 2XA7S 3LEQA 3OCLA 1LL5A 4GKUA 3UB7A 2JHEA 3OPPA 3CWFA 1RGYA 3EQUA 1IKGA 1VEUB 3RFBA 4NBJA 1L2SA 5HFOA 2AVXA 3TOIA 3HUOA 3ZVWA 3MSHA 3W2ZA 2PBYA 2PD8A 4E3JA 3M6BA 4I3JA 5FASA 3A3JA 5CGSA 3C38A 5E2EA 3G2ZA 4D60A 4MBFA 2JBFA 2XROA 2PR6A 4Y0TA 4P87A 3PXPA 1JWZA 5AJGA 4FCFA 2W1TA 2JKTM 2P9VB 4U3TA 1LL9A 1S4RA 3NECA 4KQOA 4OKPA 5GL9A 2GX5A 5FEFA 3ZDJA 2IA2A 4IEDA 1OTIA 3HLBA 4EBLA 4ZRRA 3FKWA 2V1BA 2PBDP 4E04A 5AQ7A 4KZ5A 4DJ2A 3ZG5A 3CG5A 1TS7A 2INWA 1H5XA 1GSVA 4MDZA 5FQ9A 4KZ7A 3UB9A 1W5DA 1Q2QA 3HREA 1ONGA 4HOIA 1OT9A 3PAEA 1LI9A 1YLWA 4G3VA 2X02A 4AFIA 4FOFA 1EROA 3B47A 4P6ZS 2ZQ7A 4Q0HA 1S0WA 5A8BA 2JKGA 3LMVA 4B9OA 3A3DA 4DMZA 3QP6A 5G18A 5EM0A 3C4OA 3OPLA 4EWFA 2J3TD 4OP5A 1Q2PA 3S7PA 4WL9A 4BLMA 3QP8A 4HY8A 1NYMA 5HD3A 5FI2A 5GLBA 1XGIA 5HARA 3T1RA 3IX3A 2Y2KA 3M6HA 2L0WA 3O3VA 2P74A 4YINA 1FR6A 4WM9A 3KSIA 3RJUA 5CX7A 1KDWA 4I5SA 2HP5A 2V2FF 1L0EA 3JYIA 3VP4A 1SKOA 2K7SA 3RXXA 4U0TA 3UB8A 4EEPA 2J80A 3QHYA 3ZVTA 4BWIA 2JKFA 2W3GA 2ZC6B 1K55A 3F1PB 1SDEA 2P08A 3CLOA 5J8XA 5L07A 5CTMA 4Y0UA 3CUEA 4WYYA 4CLCE 5FQIA 3VE4A 4WF0A 3ZFZA 5G4YA 1XJ6A 4E3MA 4GOGA 4C3QA 3N8LA 3UO9A 4DE0A 1KGGA 1YLZA 3LY3A 2V0WA 2C5WB 5F1FA 4G3KA 3UNWA 4Z1WA 4IBRA 2KLIA 3JVUA 3LYXA 2VGLS 4Y17A 5I94A 1S6RA 4RRJA 4KZ8A 4S2JA 3Q1FA 3MBZA 3BFGA 4H6JB 4JPMA 5DF9A 4ZDXA 2VJWA 3SZTA 4KENB 3CZDA 4R3JA 3UDIA 1IFQA 3V3RA 3SS5A 5EOEA 4S0LA 1M6KA 1NXYA 1VEUA 4G3WA 2DBOA 3VMAA 4BENA 4MN7A 4RX3A 3AGEA 2OLVA 1H0MA 1BYWA 3LR0A 5DFXA 3V5MA 4GJ4A 1CEFA 3N8RA 4QY5A 1CK3A 1XJ3A 1ONHA 5CTNA 1EW0A 2ZQCA 2ZM2A 1CI8A 1Y4OA 1JWVA 4UA7A 4RRKA 5HX9A 5DTTA 1F5MA 4O0PA 5M18A 2DRWA 2CC1A 3FKVA 4MMNA 1L3LA 2PYRA 5FDSA 3AGFA 4E3KA 5EM1A 3G34A 4KZ4A 2Z2LB 2XQZA 1ACFA 3MXQA 2HGVA 4GDNA 1ES4A 2P9VA 3MKFA 4OONA 2ZQAA 4BL2A 1UWNX 1FOFA 4NEED 5IT5A 2Y2QA 3MFDA 4L9FA 1TDLA 4C6YA 5HDDA 4Y3IA 1J9MA 2O9CA 2P7JA 1OTEA 1M40A 2QJ7A 1SHVA 3KSHA 1WA9A 3Q7ZA 4RRDA 2KDKA 3BM6A 3WWXA 3BLSA 1XA7A 4PPRA 5FQKA 2EFUA 4RR9A 4L0LA 1PFLA 3N6IA 4RRFA 3BWLA 1X0OA 1IYSA 3S7NA 3E4OA 4N9KA 2J9OA 3UMEA 3BFFA 3IF6C 1P9WA 4BBTA 3HL9A 4JGQA 3LY4A 3F1NB 1Y2QA 3BQ8A 1T19A 5HW3A 5J3WA 3ZG9B 2H10A 2OOLA 2ZQDA 5L2FA 5HPFA 2H5SA 4WZ5C 4S0KA 3OCNA 2XH9A 2I72A 4MBKA 2HL0A 5K5BA 3M2KA 4X1LA 1LSWA 5E2GA 1TS6A 1Y28A 3G2YA 2PT7A 5F5YA 4DXBA 4LCMA 1O07A 3KSFA 1TS8A 4YFMA 3G32A 1XX2A 3ICYA 4O01A 3R7WB 3LMTA 1BLSA 3EEHA 4UQIS 1VQQA 4RRIA 2NUTC 4OOMA 4GCZA 3NULA 1ERQA 3HLGA 1UGUA 5FQJA 2W3HA 2M7UA 2JKTI 4RRCA 3V39A 2Y2IA 3SS4A 4X53A 4EESA 1RCJA 1N9BA 3KODA 2FZ0A 2Z2MB 3QNCA 3CI6A 4OVDA 1LT0A 1YLPA 3A3FA 4MNRA 1F9IA 5FAPA 5EFWA 2HDRA 5CGWA 1PWDA 4P85A 3CPTB 2XEPA 4YOFA 2JKRM 5LBRA 2PU2A 3KNPA 5CRFA 3UDXA 3LR4A 4CJNA 4KQDA 2J8YA 3LR5A 3VOLA 4E3OA 3K3CA 3BLMA 1GSXA 1IELA 3JPUA 5EVIC 1KE3A 5G4ZA 3E4PA 4PM6A 3C4PA 5DVAA 4IJGA 2OWJA 1OJ5A 1NRFA 3UPOA 2J3WA 3PD4A 4H6JA 4UEYA 2WKRA 4CPKA 4RQ9A 2ZC3B 1MBLA 2Z6DA 4QY6A 2OKVA 3MS6A 1P97A 1FIKA 4E3NA 3QNBA 2RL3A 3IBRA 2V1AA 3MF0A 1BLHA 2VZWA 3KNFA 3ITAA 3T50A 4NK3A 3IXGA 4PM5A 2ZM8A 3NOPC 4ME4A 5EV0A 3SH8A 2WGIA 3MQOA 3IF6B 3BJNA 2OWHA 1S66L 3CHWP 4WBGA 3MR0A 5HDSA 1ES2A 5AVEA 2QJ5A 3WS4A 3FPWA 1XKZA 4FH4A 5JYOA 2VGKA 4YWZA 5CERA 4QJGA 3MZDA 3W4OA 5FEGA 4ZAMA 3P7NA 1E4DA 4F94A 2JCHA 4S2LA 4PAUA 1PI5A 1NY0A 4HP4A 4HIAA 1XGJA 4ID4A 4MBHA 2W0NA 4IVIA 3DTIA 4QD4A 4JGRA 4N1HA 2J7VA 4KUOA 1GHMA 3T4LA 3UDFA 1IYQA 3A3IA 4S0JA 3TRCA 1D1JA 3P09A 2K31A 4LV1A 4DDYA 3PBTA 3HLEA 3IXDA 5CHJA 3IWQA 3G31A 4EBNA 3F1NA 3FZCA 4MN6A 4X1MA 5TBMB 2ZLYA 4RR7A 3ZG0A 4N1XA 2A3UA 3GRJA 4EV4A 1YPRA 1A0KA 1MWSA 2XA7M 4NBIA 3O86A 3IS2B 2L1MA 3FWLA 4R38A 5EVIB 3SH7A 1BT5A 1ZC2A 3SW1A 3EQVA 1QMEA 4X69A 1WYBA 4OP8A 3SS3A 4Q0JA 2GNXA 3R7WA 4EUZA 1PZOA 3PD5A 1DY6A 3DW0A 1IKIA 4R70A 1H8ZA 4S2PA 3QP2A 5J61A 4RYEA 3HBRA 2CMNA 3IWIA 4UHUA 1NLYA 4ESPA 2ZQ8A 3OOVA 4CLCA 2PHYA 2W1RA 5IHVA 4EXOA 1DP6A 3TG9A 3CITA 3JVVA 4WEJA 3HUMA 4RRBA 3O87A 5U47A 4EBPA 3BFCA 3U4LP 2PDRA 3PAGA 4JXWA 3CPTA 2DNSA 3VP1A 4LRYC 1K57C 5EECA 3B33A 3BY8A 2Y2PA 3FC7A 5F69A 3V67A 1PW8A 1EWZA 1K4FA 2OAP1 2XGNA 2ZMAA 4JF4A 2QWSA 4EEUA 1QMFA 1OJGA 2V0UA 4NXBA 4R3AA 2IWCA 4IBXA 3F1OB 5KZHA 4HH3A 1H8MA 5FQMA 3RTYA 1KVLA 4S2OA 1ES3A 5M19A 1NJ4A 4P6BA 1ODVA 4B88A 5AVFA 1MWUA 2WADA 3S4XA 2HDSA 1TDGA 5GLDA 1KE4A 2VV7A 3UY6A 4A5RA 2J3TC 2Y8HA 3DTEA 2BLSA 1JTGA 1W8QA 3S1YA 4EETB 4NKPA 2JE5A 3Q07A 1TC5A 4OLDA 1IEMA 4E3LA 2HDQA 4S03A 3NOTC 2A24B 1PWGA 2ZOIA 3IF6A 2HJ9C 4PMAA 1PRQA 4HJ6A 4HBUA 4LLOB 1UWPX 4RR6A 3HCYA 3B3XA 1TS0A 2H0YA 3ISGA 1GHPA 1K56A 1L0GA 3WRZA 1CF0A 1XPBA 3OBFA 3IBJA 4WUJA 1ZG6A 1YAXA 1C3BA 3PYPA 1MXOA 5L10A 2JKRI 1D06A 1RGZA 2HP6A 3VP2A 1BZAA 3NC8A 3G4PA 4GNUA 3OZHA 1K38A 1IYOA 3EGXC 5HWVA 1E25A 2ZBBA 4D2OA 4BD0A 3C7UA 1NZOA 3N8SA 3T12B 3PHYA 1XJ2A 1BTLA 4JGPA 2XD5A 2UWXA 4WMCA 5A91A 1XFNA 3DWZA 1FSYA 4X68A 3KO3A 1YT4A 4LENA 4DF6A 4BMWA 3VOYA 4HBTA 3BFDA 3T4KA 4KG2A 4WZ4A 1NLZA 3C5AA 2A2LA 3EEAA 2OAQ1 2EWWA 4X56A 4QHCA 3P98A 1KE0A 2OLUA 1F98A 2R78A 2ZC7A 2ZL1B 3ZGAB 2ACGA 4R4SA 4E3IA 2G2UA 3NHQA 4UA9A 1KVMA 5A92A 3PD3A 2FH5A 3L7HA 1PYYA 3IS2A 3FG8A 5EVIA 2EXBA 4O7DA 2VKSA 4F3LB 4B93A 1IYPA 3DBAA 1KGEA 4R3BA 4XUZA 2O9BA 5DTSA 4JKTA 2VX8A 3GV9A 2BASA 4KZ9A 5KSHA 1VM1A 2B18A 3HJKA 3NJAA 3T1QB 1S67L 2C6WB 1BLPA 5D3OA 5IS1A 1JTDA 5TGFA 1HD8A 3N7WA 2O0YA 4E6WA 2HKZA 3LO7A 2WKIA 3VOZA 1K54C 4GB7A 2H0TA 3DTKA 1HLUP 5HPIA 2ZJ9A 4UAAA 4HHDA 1JKEA 3FPVA 1FR1A 1BSGA 4JBFA 3IXBA 3FV7A 3O5YA 1TEMA 4S02A 3CUEC 1BUEA 5DKKA 5FSRA 5FAQA 4S0IA 3IX8A 4LRZE 4XT2B 1SDNA 3F1OA 2GJ3A 1P9RA 3UE0A 3R4KA 4ETXA 3UPPA 1ESIA 2B95A 4IUKA 2WAFA 2O99A 2QPNA 4QWOA 1LSXA 3RXWA 4NXGA 4I39A 4RVAA 3WS2A 2W1TB 3GDIA 3E4QA 3OLOA 3H7WB 3S7OA 1OTAA 5DJUA 2Y59A 3LIFA 2KX6A 4RRMA 4RA7A 3HLCA 2EWVA 2H28A 3UB5P 1I5QA 4BJPA 3F1PA 1LI0A 3LIEA 5HWWA 2A24A 3I7JA 1SCWA 3IT9A 4KQQA 1VETB 4HJ3A 2Y2MA 1G28A 1W7FA 1DJBA 3BQAA 3MFXA 4PM9A 4S2NC 3BRMA 1MKMA 4UQIM 3OC2A 2PU4A 3IQAA 3VSLA 4HJ4A 3A0SA 1W63Q
chains in the Genus database with same CATH topology
2QZ6A 3O3VA 2P74A 5GHZA 4YINA 5EE8A 4ZJ1A 1FR6A 4WM9A 5CHJA 3RJUA 1GA0A 1KDWA 3IWQA 1N4OA 5FI6A 2HP5A 2V2FF 3NY4A 3G31A 1YLTA 1HTZA 1L0EA 2WZZA 2X71A 1ZKJA 2RCXA 4Y0OA 3FZCA 3ZNTA 4EBNA 4KZBA 3JYIA 2ZLYA 3VP4A 4RR7A 3VSKA 4Y7PA 4MEZA 3KOBA 1PW1A 2XF3A 5CECA 3ZG0A 4N1XA 2A3UA 4P0MA 2WKHA 2ZC5B 2BG1A 1FQGA 1HVBA 3RXXA 3GRJA 4EV4A 4U0TA 1G68A 3QHYA 2HP9A 3ZVTA 3Q7VB 2ZC6B 1K55A 1JWPA 1SDEA 4DE2A 3GVBA 5CEDA 1MWSA 4MLLA 5J8XA 4NBIA 3SOIA 2DCFA 3O86A 3FWLA 3KO4A 1GCEA 5CTMA 5CGXA 5FQQA 5EVIB 4HEFA 4Y0UA 3SH7A 4WYYA 5A93A 5FQIA 1BT5A 1YLYA 4LV2A 1ZC2A 3ZFZA 4RRQA 2XFSA 5GLCA 4WELA 2FFYA 3EQVA 1XA1A 1QMEA 4X69A 4E3MA 2V20A 1WYBA 4GOGA 4OP8A 1I2SA 2B5RA 4C3QA 3N8LA 4Q8IA 3UO9A 3SS3A 1K56D 4OPQA 1MPLA 1K55C 4DE0A 1PZPA 4LCLA 1ESUA 1KGGA 1YLZA 4EUZA 3LY3A 4X55A 2C5WB 1PZOA 5CHUA 3PD5A 1DY6A 3DW0A 3W4QA 1IKIA 5F1FA 1ERMA 1H8ZA 1Z6FA 4JF5A 4S2PA 1DJCA 3UNWA 2HL2A 5CXWA 5J61A 2ZM0A 4IBRA 4XUXA 4RYEA 3HBRA 2WKEA 1GHIA 1K6SA 3IWIA 4RRAA 4UHUA 5FATA 3HLFA 2ZQ8A 3GMWA 5I94A 1S6RA 4RRJA 5F1GA 4OQHA 4KZ8A 4OOYA 4QU3A 3BEBA 2XDMA 4S2JA 1K57A 2Y2LA 3Q1FA 5IHVA 3MBZA 3BFGA 3TG9A 3GR2A 4JPMA 4WEJA 3NI9A 5DF9A 1ALQA 4DKIA 4ZDXA 3HUMA 4WMCD 4RRBA 3O87A 5U47A 4FD8A 4KENB 3CZDA 3ITBA 4R3JA 3BFCA 4EBPA 3PAGA 4KG5A 3UDIA 1YMXA 4JXWA 3G35A 3V3RA 1YMSA 2WGWA 2DNSA 4PM7A 3SS5A 5EOEA 4GZBA 3NDEA 1GA9A 3M2JA 4IVKA 1M6KA 4S0LA 1NXYA 1XP4A 5FI7A 3VP1A 3PBOA 1U60A 4PM8A 2DBOA 2Y2HA 1ZG4A 3VMAA 1K57C 4BENA 1EI5A 5EECA 4M3KA 4RX3A 2OSUA 3AGEA 2OLVA 2Y2PA 4KZ6A 4GD6A 2XFTA 5HAPA 2Y2JA 3V5MA 3UE3A 1CEFA 2Y2GA 1WE4A 3D4FA 3UE1A 4H8RA 4UA6A 3MXRA 3N8RA 4QY5A 1CK3A 1ONHA 2XR0A 5CTNA 1PW8A 3KOCA 1EWZA 2GDNA 2ZC4B 1K4FA 2ZQCA 4GD8A 2E8IA 2XGNA 2ZMAA 4JF4A 3PBSA 2ZM2A 1QMFA 1CI8A 1JWVA 5AQAA 5KSCA 4UA7A 4RRKA 4OPZA 5HX9A 1LHYA 1NYYA 5DTTA 2IWCA 5HAQA 5M18A 2DRWA 4IBXA 2CC1A 5KZHA 4Z9QA 4DRTA 3FKVA 3ZG8B 4GN2A 1YLJA 3HLWA 2HL1A 5FQMA 3AGFA 1KVLA 4S2OA 4JXSA 5EVID 4E3KA 1ES3A 3G34A 4KZ4A 3KO9A 2Z2LB 2XQZA 4OLGA 1W79A 3W4PA 1NJ4A 2Y91A 4P6BA 5M19A 2WAEA 2QMIA 2VGJA 2EX9A 4OPRA 4GDNA 4B88A 1ES4A 1O7EA 2P9VA 1XXMA 3MKFA 1NZUA 2WGVA 1MWUA 1YM1A 2Q9NA 2WADA 3OPHA 3DTMA 2HDSA 1TDGA 2ZQAA 4OONA 5GLDA 4ZJ3A 4BL2A 3DWKA 3TSGA 1FOFA 1KE4A 4OPYA 3UY6A 4A5RA 2BLSA 2Y2QA 1JTGA 3HVFA 3MFDA 1TDLA 1W8QA 3S1YA 4C6YA 1J9MA 4RRRA 1M40A 3IF5A 2JE5A 4ZJ2A 4BD1A 1MY8A 4KG6A 3Q07A 1TC5A 1SHVA 4OLDA 1IEMA 4WEKA 4E3LA 2HDQA 4S03A 3AGDA 2WK0A 3Q7ZA 3PBRA 4RRDA 1CEGA 3S4XA 1WYCA 1PWGA 3NCKA 4RR8A 4FSFA 5AQBA 3BM6A 3IF6A 3WWXA 4PMAA 5DTKA 4OQIA 3BLSA 1LLBA 1XA7A 4PPRA 4RRGA 3LCEA 4HBUA 5FQKA 4E6XA 3IXHA 2EFUA 4RR9A 4L0LA 4RR6A 3N6IA 4RRFA 1ES5A 2JC7A 3B3XA 2H0YA 5CEBA 4S2IA 3WS1A 1IYSA 3ISGA 3OPRA 1CI9A 1GHPA 1K56A 3IH8A 4JLFA 5E2FA 1L0GA 5DF7A 2R9XA 2J9OA 4N9KA 3WRZA 1HZOA 1XPBA 1MWTA 3BFFA 3GSGA 3IF6C 4NETA 1ZG6A 4EQIA 4JXGA 4KZAA 3HL9A 3VFHA 3LY4A 4RRHA 1Y2QA 3UN7A 1C3BA 1MXOA 5HW3A 1RGZA 2HP6A 3VP2A 1BZAA 3ZG9B 2H10A 1K6RA 2Q9MA 2Y4AA 2ZQDA 5L2FA 3NC8A 4X6TA 2H5SA 3G4PA 2R9WA 4GNUA 4KZ3A 2ZQ9A 4WZ5C 3OZHA 2IWBA 4BL3A 1K38A 1IYOA 4S0KA 3OCNA 1E25A 2XH9A 3VFFA 3CMZA 4D2OA 2I72A 2Y2NA 4XXRA 4MBKA 4BD0A 3C7UA 4K0XA 3M2KA 4ZBEA 1NZOA 3N8SA 2HL0A 3MKEA 3ZCZA 1KGFA 1BTLA 3KO5A 1E3UD 1L0DA 2XD5A 4B4XA 1MKIA 2HDUA 5E2GA 3PBNA 2UWXA 3ZG7B 3C7VA 4WMCA 5FA7A 5FDHA 4KQRA 3G2YA 1MWRA 5A91A 1E3UA 4LV0A 4RX2A 2EX8A 4DXBA 3LMUA 5KMWA 3A3EA 1W8YA 5AQ9A 3E2KA 3KO7A 3VP0A 3GQZA 4LCMA 1O07A 3DWZA 1FSYA 4X68A 2G2WA 4YFMA 3G32A 3KO3A 1DJAA 1XX2A 1YT4A 4S2MA 1FCOA 3Q81A 4LENA 2EXAA 3WRTA 4GDBA 3LMTA 4DF6A 1BLCA 1BLSA 2V1ZA 2FFFB 2ZD8A 3M6HA 1VQQA 1Y54A 3VOYA 4RRIA 4HBTA 4OOMA 1BULA 1YQSA 5GHYA 2OV5A 3BFDA 1ERQA 3HLGA 1G6AA 4OQGA 2HPBA 5FQJA 5EOOA 2XD1A 4KG2A 3G30A 5EPHA 2X01A 4WZ4A 3SH9A 4OH0A 3C5AA 3W8KA 4R0QA 4RRCA 2WUQA 3V39A 3HUNA 1SKFA 2Y2IA 3SS4A 4X56A 5TFQA 4QHCA 3P98A 1KE0A 2OLUA 1FCMA 3IHAA 4X53A 4N9LA 4DDSA 1RCJA 1TVFA 1N9BA 2ZC7A 4JF6A 4R1GA 5TR7A 3S22A 3VP3A 3KODA 3V50A 4K0WA 3ZGAB 2WYXA 3Q7VA 2Z2MB 4R4SA 4E3IA 2G2UA 4UA9A 5A92A 1KVMA 3QNCA 5E2HA 3PD3A 4DE1A 4OQ0A 1K25A 3PTEA 1PYYA 4OVDA 4HESA 1YLPA 3A3FA 2J9PA 4MNRA 5EVIA 5FAPA 3OCLA 2EXBA 2HDRA 4O7DA 1LL5A 1PWDA 5CGWA 4GKUA 4P85A 4R4RA 3ZHHA 3BYDA 2XEPA 3OPPA 2WGWB 1RGYA 3EQUA 3V3SA 1IKGA 4NBJA 2PU2A 4QB8A 1L2SA 5HFOA 3Q82A 3KNPA 3CJMA 5CRFA 3UDXA 1RP5A 2EX2A 1IYPA 3IHBA 4CJNA 3TOIA 2Y55A 5JYPA 3HUOA 2J8YA 3WS0A 3ZVWA 4E3OA 2EX6A 3BLMA 2PBYA 1IELA 5HAIA 4E3JA 3M6BA 1KGEA 1AXBA 4R3BA 5FASA 5EVIC 4XUZA 3A3JA 5CGSA 1KE3A 5DTSA 1OMEA 5HL1A 4JKTA 5KSHA 3GV9A 4KZ9A 1VM1A 5E2EA 3G2ZA 4BQMA 5E43A 3PBTA 3MZEA 3C4PA 4MBFA 2JBFA 4PM6A 5DVAA 1K54A 4Y0TA 1JVJA 3PD2A 3GTCA 4P87A 1NRFA 3UPOA 1FCNA 1JWZA 3PD4A 3NBLA 1PIOA 2C6WB 4LV3A 4WZ5A 4CPKA 4N92A 5M1AA 2ZC3B 1I2WA 1MBLA 4QY6A 3BECA 5CHMA 1BLPA 2OKVA 3O88A 5D3OA 4FCFA 3MXSA 1JTDA 5TGFA 1HD8A 2IWDA 3N7WA 2P9VB 4K91A 4U3TA 1LL9A 4E6WA 2HKZA 3LO7A 2WKIA 3VOZA 4KQOA 1K54C 5GLAA 4B4ZA 4OKPA 3FYZA 3IWOA 4GB7A 5GL9A 4E3NA 3N4IA 2H0TA 3QNBA 2RL3A 3ZDJA 1PWCA 2ZJ9A 4IEDA 4UAAA 3WS5A 3HLBA 4EBLA 4OOLA 1JKEA 1BLHA 3FKWA 1FR1A 3KNFA 3ITAA 1BSGA 1PI4A 4JBFA 5EVLA 4NK3A 3UPNA 3IXGA 3E2LA 3IXBA 4PM5A 3FV7A 2ZM8A 1TEMA 4S02A 3SH8A 1BUEA 2WGIA 5AQ7A 5FSRA 4KZ5A 5F83A 3NDGA 4DDYA 5FAQA 3IF6B 3ZG5A 3CG5A 4S0IA 4WBGA 1ES2A 1SDNA 3BFEA 5F82A 5EUAA 1H5XA 3WS4A 5FQ9A 3UE0A 4KZ7A 1XKZA 1FSWA 2WZXA 3UPPA 4FH4A 1ESIA 1L0FA 3NIAA 2Y2OA 5JYOA 4JXVA 2VGKA 1W5DA 1Q2QA 2WAFA 3HREA 1ONGA 5CERA 2XLNA 3ZNYA 2QPNA 4QJGA 3MZDA 3RXWA 3PAEA 5BOHA 5FAOA 4RVAA 3WS2A 1LI9A 3W4OA 1YLWA 1K4EA 2X02A 3LEZA 4ZAMA 4DE3A 1E4DA 4F94A 2JCHA 3IH9A 4R23A 4S2LA 4C75A 1PI5A 1EROA 1NY0A 2Y59A 4U0XA 4RRMA 2ZQ7A 4RA7A 4S2KA 3HLCA 1J7GA 4DXCA 5A90A 1I5QA 1S0WA 4S2NA 1XGJA 4ID4A 4BJPA 1LI0A 4MBHA 4IVIA 3LMVA 4QD4A 3A3DA 3MZFA 1H8YA 3HLDA 3I7JA 5G18A 5DF8A 1SCWA 3C4OA 4N1HA 4RRLA 3IT9A 2A49A 3OPLA 2EFXA 4KQQA 4EWFA 4OP5A 1Q2PA 2J7VA 3PBQA 2Y2MA 5GHXA 1GHMA 3UDFA 4BLMA 1W7FA 1DJBA 1KDSA 4FH2A 1IYQA 1NYMA 2XK1A 3A3IA 5FI2A 5GLBA 4S0JA 4PM9A 4S2NC 3BRMA 3P09A 4ZTKA 3OC2A 2PU4A 1XGIA 5HARA 3IQAA 3VSLA 4LV1A 2Y2KA 3IXDA 3HLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZ6 A;  3O3V A;  2P74 A;  5GHZ A;  4YIN A;  5EE8 A;  4ZJ1 A;  1FR6 A;  4WM9 A;  5CHJ A;  3RJU A;  1GA0 A;  1KDW A;  3IWQ A;  1N4O A;  5FI6 A;  2HP5 A;  2V2F F;  3NY4 A;  3G31 A;  1YLT A;  1HTZ A;  1L0E A;  2WZZ A;  2X71 A;  1ZKJ A;  2RCX A;  4Y0O A;  3FZC A;  3ZNT A;  4EBN A;  4KZB A;  3JYI A;  2ZLY A;  3VP4 A;  3VSK A;  4Y7P A;  4MEZ A;  1PW1 A;  2XF3 A;  5CEC A;  3ZG0 A;  4N1X A;  2A3U A;  4P0M A;  2WKH A;  2ZC5 B;  2BG1 A;  1FQG A;  1HVB A;  3RXX A;  3GRJ A;  4EV4 A;  4U0T A;  1G68 A;  3QHY A;  2HP9 A;  3ZVT A;  3Q7V B;  2ZC6 B;  1K55 A;  1JWP A;  1SDE A;  4DE2 A;  3GVB A;  5CED A;  1MWS A;  4MLL A;  5J8X A;  3SOI A;  2DCF A;  3O86 A;  3FWL A;  1GCE A;  5CTM A;  5CGX A;  5FQQ A;  5EVI B;  4HEF A;  4Y0U A;  3SH7 A;  4WYY A;  5A93 A;  5FQI A;  1BT5 A;  1YLY A;  4LV2 A;  1ZC2 A;  3ZFZ A;  2XFS A;  5GLC A;  4WEL A;  2FFY A;  3EQV A;  1XA1 A;  1QME A;  4X69 A;  4E3M A;  2V20 A;  1WYB A;  4GOG A;  4OP8 A;  1I2S A;  2B5R A;  4C3Q A;  3N8L A;  4Q8I A;  3UO9 A;  3SS3 A;  1K56 D;  4OPQ A;  1MPL A;  1K55 C;  4DE0 A;  1PZP A;  4LCL A;  1ESU A;  1KGG A;  1YLZ A;  4EUZ A;  3LY3 A;  4X55 A;  2C5W B;  1PZO A;  5CHU A;  1DY6 A;  3DW0 A;  3W4Q A;  1IKI A;  5F1F A;  1ERM A;  1H8Z A;  1Z6F A;  4JF5 A;  4S2P A;  1DJC A;  3UNW A;  5CXW A;  2ZM0 A;  4IBR A;  4XUX A;  4RYE A;  3HBR A;  2WKE A;  1GHI A;  1K6S A;  3IWI A;  4UHU A;  5FAT A;  3HLF A;  2ZQ8 A;  3GMW A;  5I94 A;  1S6R A;  5F1G A;  4OQH A;  4KZ8 A;  4OOY A;  4QU3 A;  3BEB A;  2XDM A;  4S2J A;  1K57 A;  2Y2L A;  3Q1F A;  5IHV A;  3MBZ A;  3BFG A;  3TG9 A;  3GR2 A;  4JPM A;  4WEJ A;  3NI9 A;  5DF9 A;  1ALQ A;  4DKI A;  4ZDX A;  3HUM A;  4WMC D;  3O87 A;  5U47 A;  4FD8 A;  4KEN B;  3CZD A;  3ITB A;  4R3J A;  3BFC A;  4EBP A;  3PAG A;  4KG5 A;  3UDI A;  1YMX A;  4JXW A;  3G35 A;  3V3R A;  1YMS A;  2WGW A;  2DNS A;  4PM7 A;  3SS5 A;  5EOE A;  4GZB A;  3NDE A;  1GA9 A;  3M2J A;  4IVK A;  1M6K A;  1NXY A;  1XP4 A;  5FI7 A;  3VP1 A;  3PBO A;  1U60 A;  4PM8 A;  2Y2H A;  1ZG4 A;  3VMA A;  1K57 C;  4BEN A;  1EI5 A;  5EEC A;  4M3K A;  4RX3 A;  2OSU A;  3AGE A;  2OLV A;  2Y2P A;  4KZ6 A;  4GD6 A;  2XFT A;  5HAP A;  2Y2J A;  3V5M A;  3UE3 A;  1CEF A;  2Y2G A;  1WE4 A;  3D4F A;  3UE1 A;  4H8R A;  4UA6 A;  3MXR A;  3N8R A;  4QY5 A;  1CK3 A;  1ONH A;  2XR0 A;  5CTN A;  1PW8 A;  1EWZ A;  2GDN A;  2ZC4 B;  1K4F A;  2ZQC A;  4GD8 A;  2E8I A;  2XGN A;  2ZMA A;  4JF4 A;  3PBS A;  2ZM2 A;  1QMF A;  1CI8 A;  1JWV A;  5AQA A;  5KSC A;  4UA7 A;  4OPZ A;  5HX9 A;  1LHY A;  1NYY A;  5DTT A;  2IWC A;  5HAQ A;  5M18 A;  2DRW A;  4IBX A;  2CC1 A;  5KZH A;  4Z9Q A;  4DRT A;  3FKV A;  3ZG8 B;  4GN2 A;  1YLJ A;  3HLW A;  5FQM A;  3AGF A;  1KVL A;  4S2O A;  4JXS A;  5EVI D;  4E3K A;  1ES3 A;  3G34 A;  4KZ4 A;  2Z2L B;  2XQZ A;  4OLG A;  1W79 A;  3W4P A;  1NJ4 A;  2Y91 A;  4P6B A;  5M19 A;  2WAE A;  2QMI A;  2VGJ A;  2EX9 A;  4OPR A;  4GDN A;  4B88 A;  1ES4 A;  1O7E A;  2P9V A;  1XXM A;  3MKF A;  1NZU A;  2WGV A;  1MWU A;  1YM1 A;  2Q9N A;  2WAD A;  3OPH A;  3DTM A;  2HDS A;  1TDG A;  2ZQA A;  4OON A;  5GLD A;  4ZJ3 A;  4BL2 A;  3DWK A;  3TSG A;  1FOF A;  1KE4 A;  4OPY A;  3UY6 A;  4A5R A;  2BLS A;  2Y2Q A;  1JTG A;  3HVF A;  3MFD A;  1TDL A;  1W8Q A;  3S1Y A;  4C6Y A;  1J9M A;  1M40 A;  3IF5 A;  2JE5 A;  4ZJ2 A;  4BD1 A;  1MY8 A;  4KG6 A;  3Q07 A;  1SHV A;  4OLD A;  1IEM A;  4WEK A;  4E3L A;  2HDQ A;  3AGD A;  2WK0 A;  3Q7Z A;  3PBR A;  1CEG A;  3S4X A;  1WYC A;  1PWG A;  3NCK A;  4FSF A;  5AQB A;  3BM6 A;  3IF6 A;  3WWX A;  4PMA A;  5DTK A;  4OQI A;  3BLS A;  1LLB A;  1XA7 A;  4PPR A;  3LCE A;  4HBU A;  5FQK A;  4E6X A;  3IXH A;  2EFU A;  4L0L A;  3N6I A;  1ES5 A;  2JC7 A;  3B3X A;  2H0Y A;  5CEB A;  4S2I A;  3WS1 A;  1IYS A;  3ISG A;  3OPR A;  1CI9 A;  1GHP A;  1K56 A;  3IH8 A;  4JLF A;  5E2F A;  1L0G A;  5DF7 A;  2R9X A;  2J9O A;  4N9K A;  3WRZ A;  1HZO A;  1XPB A;  1MWT A;  3BFF A;  3GSG A;  3IF6 C;  4NET A;  1ZG6 A;  4EQI A;  4JXG A;  4KZA A;  3HL9 A;  3VFH A;  3LY4 A;  3UN7 A;  1C3B A;  1MXO A;  5HW3 A;  1RGZ A;  2HP6 A;  3VP2 A;  1BZA A;  3ZG9 B;  2H10 A;  1K6R A;  2Q9M A;  2Y4A A;  2ZQD A;  5L2F A;  3NC8 A;  4X6T A;  2H5S A;  3G4P A;  2R9W A;  4GNU A;  4KZ3 A;  2ZQ9 A;  4WZ5 C;  3OZH A;  2IWB A;  4BL3 A;  1K38 A;  1IYO A;  3OCN A;  1E25 A;  2XH9 A;  3VFF A;  3CMZ A;  4D2O A;  2I72 A;  2Y2N A;  4XXR A;  4MBK A;  4BD0 A;  3C7U A;  4K0X A;  3M2K A;  4ZBE A;  1NZO A;  3N8S A;  3MKE A;  3ZCZ A;  1KGF A;  1BTL A;  1E3U D;  1L0D A;  2XD5 A;  4B4X A;  1MKI A;  2HDU A;  5E2G A;  3PBN A;  2UWX A;  3ZG7 B;  3C7V A;  4WMC A;  5FA7 A;  5FDH A;  4KQR A;  3G2Y A;  1MWR A;  5A91 A;  1E3U A;  4LV0 A;  4RX2 A;  2EX8 A;  4DXB A;  5KMW A;  3A3E A;  1W8Y A;  5AQ9 A;  3E2K A;  3VP0 A;  3GQZ A;  4LCM A;  1O07 A;  3DWZ A;  1FSY A;  4X68 A;  2G2W A;  4YFM A;  3G32 A;  1DJA A;  1XX2 A;  1YT4 A;  4S2M A;  1FCO A;  3Q81 A;  4LEN A;  2EXA A;  3WRT A;  4GDB A;  4DF6 A;  1BLC A;  1BLS A;  2V1Z A;  2FFF B;  2ZD8 A;  3M6H A;  1VQQ A;  1Y54 A;  3VOY A;  4HBT A;  4OOM A;  1BUL A;  1YQS A;  5GHY A;  2OV5 A;  3BFD A;  1ERQ A;  3HLG A;  1G6A A;  4OQG A;  2HPB A;  5FQJ A;  5EOO A;  2XD1 A;  4KG2 A;  3G30 A;  5EPH A;  2X01 A;  4WZ4 A;  3SH9 A;  4OH0 A;  3C5A A;  3W8K A;  4R0Q A;  2WUQ A;  3V39 A;  3HUN A;  1SKF A;  2Y2I A;  3SS4 A;  4X56 A;  5TFQ A;  4QHC A;  3P98 A;  1KE0 A;  2OLU A;  1FCM A;  3IHA A;  4X53 A;  4N9L A;  4DDS A;  1RCJ A;  1TVF A;  1N9B A;  2ZC7 A;  4JF6 A;  4R1G A;  5TR7 A;  3S22 A;  3VP3 A;  3V50 A;  4K0W A;  3ZGA B;  2WYX A;  3Q7V A;  2Z2M B;  4R4S A;  4E3I A;  2G2U A;  4UA9 A;  5A92 A;  1KVM A;  3QNC A;  5E2H A;  4DE1 A;  4OQ0 A;  1K25 A;  3PTE A;  1PYY A;  4OVD A;  4HES A;  1YLP A;  3A3F A;  2J9P A;  4MNR A;  5EVI A;  5FAP A;  3OCL A;  2EXB A;  2HDR A;  4O7D A;  1LL5 A;  1PWD A;  5CGW A;  4GKU A;  4P85 A;  4R4R A;  3ZHH A;  3BYD A;  2XEP A;  3OPP A;  2WGW B;  1RGY A;  3EQU A;  3V3S A;  1IKG A;  2PU2 A;  4QB8 A;  1L2S A;  5HFO A;  3Q82 A;  3CJM A;  5CRF A;  3UDX A;  1RP5 A;  2EX2 A;  1IYP A;  3IHB A;  4CJN A;  3TOI A;  2Y55 A;  5JYP A;  3HUO A;  2J8Y A;  3WS0 A;  3ZVW A;  4E3O A;  2EX6 A;  3BLM A;  2PBY A;  1IEL A;  5HAI A;  4E3J A;  3M6B A;  1KGE A;  1AXB A;  4R3B A;  5FAS A;  5EVI C;  4XUZ A;  3A3J A;  5CGS A;  1KE3 A;  5DTS A;  1OME A;  5HL1 A;  4JKT A;  5KSH A;  3GV9 A;  4KZ9 A;  1VM1 A;  5E2E A;  3G2Z A;  4BQM A;  5E43 A;  3PBT A;  3MZE A;  3C4P A;  4MBF A;  2JBF A;  4PM6 A;  5DVA A;  1K54 A;  4Y0T A;  1JVJ A;  3GTC A;  4P87 A;  1NRF A;  3UPO A;  1FCN A;  1JWZ A;  3NBL A;  1PIO A;  2C6W B;  4LV3 A;  4WZ5 A;  4CPK A;  4N92 A;  5M1A A;  2ZC3 B;  1I2W A;  1MBL A;  4QY6 A;  3BEC A;  5CHM A;  1BLP A;  3O88 A;  5D3O A;  4FCF A;  3MXS A;  1JTD A;  5TGF A;  1HD8 A;  2IWD A;  3N7W A;  2P9V B;  4K91 A;  4U3T A;  1LL9 A;  4E6W A;  3LO7 A;  2WKI A;  3VOZ A;  4KQO A;  1K54 C;  5GLA A;  4B4Z A;  4OKP A;  3FYZ A;  3IWO A;  4GB7 A;  5GL9 A;  4E3N A;  3N4I A;  2H0T A;  3QNB A;  2RL3 A;  3ZDJ A;  1PWC A;  2ZJ9 A;  4IED A;  4UAA A;  3WS5 A;  3HLB A;  4EBL A;  4OOL A;  1BLH A;  3FKW A;  1FR1 A;  3ITA A;  1BSG A;  1PI4 A;  4JBF A;  5EVL A;  4NK3 A;  3UPN A;  3IXG A;  3E2L A;  3IXB A;  4PM5 A;  3FV7 A;  2ZM8 A;  1TEM A;  3SH8 A;  1BUE A;  2WGI A;  5AQ7 A;  5FSR A;  4KZ5 A;  5F83 A;  3NDG A;  4DDY A;  5FAQ A;  3IF6 B;  3ZG5 A;  3CG5 A;  4WBG A;  1ES2 A;  1SDN A;  3BFE A;  5F82 A;  5EUA A;  1H5X A;  3WS4 A;  5FQ9 A;  3UE0 A;  4KZ7 A;  1XKZ A;  1FSW A;  2WZX A;  3UPP A;  4FH4 A;  1ESI A;  1L0F A;  3NIA A;  2Y2O A;  5JYO A;  4JXV A;  2VGK A;  1W5D A;  1Q2Q A;  2WAF A;  3HRE A;  1ONG A;  5CER A;  2XLN A;  3ZNY A;  2QPN A;  4QJG A;  3MZD A;  3RXW A;  3PAE A;  5BOH A;  5FAO A;  4RVA A;  3WS2 A;  1LI9 A;  3W4O A;  1YLW A;  1K4E A;  2X02 A;  3LEZ A;  4ZAM A;  4DE3 A;  1E4D A;  4F94 A;  2JCH A;  3IH9 A;  4R23 A;  4S2L A;  4C75 A;  1PI5 A;  1ERO A;  1NY0 A;  2Y59 A;  4U0X A;  2ZQ7 A;  4RA7 A;  4S2K A;  3HLC A;  4DXC A;  5A90 A;  1I5Q A;  1S0W A;  4S2N A;  1XGJ A;  4ID4 A;  4BJP A;  1LI0 A;  4MBH A;  4IVI A;  4QD4 A;  3A3D A;  3MZF A;  1H8Y A;  3HLD A;  3I7J A;  5G18 A;  5DF8 A;  1SCW A;  3C4O A;  4N1H A;  3IT9 A;  2A49 A;  3OPL A;  2EFX A;  4KQQ A;  4EWF A;  4OP5 A;  1Q2P A;  2J7V A;  3PBQ A;  2Y2M A;  5GHX A;  1GHM A;  3UDF A;  4BLM A;  1W7F A;  1DJB A;  1KDS A;  4FH2 A;  1IYQ A;  1NYM A;  2XK1 A;  3A3I A;  5FI2 A;  5GLB A;  4PM9 A;  4S2N C;  3BRM A;  3P09 A;  4ZTK A;  3OC2 A;  2PU4 A;  1XGI A;  5HAR A;  3IQA A;  3VSL A;  4LV1 A;  2Y2K A;  3IXD A;  3HLE A; 
#chains in the Genus database with same CATH topology
 2QZ6 A;  4ZJ1 A;  1GA0 A;  2VK3 A;  1N4O A;  4I3I A;  3NY4 A;  1PNE A;  2WZZ A;  4Y0O A;  3ZNT A;  1OPX A;  4KZB A;  5F6A A;  1S1Z A;  3T1S A;  3KOB A;  2XF3 A;  5CEC A;  3CAX A;  4P0M A;  2ZC5 B;  1FQG A;  2V9A A;  3Q7V B;  4I3A A;  4DE2 A;  4LPZ A;  2W3E A;  3GVB A;  2DCF A;  3KSG A;  3KO4 A;  1YLY A;  4LV2 A;  1XA1 A;  4Q8I A;  3P01 A;  1MPL A;  1XFQ A;  4X55 A;  5CHU A;  2E8J A;  3W4Q A;  3H82 B;  1ERM A;  1DJC A;  2HL2 A;  5CXW A;  3HJI A;  4XUX A;  1D7E A;  1GHI A;  1K6S A;  1SKO B;  4RRA A;  2QHK A;  4JGO A;  3GMW A;  2VLG A;  3IX4 A;  4OQH A;  4YNR A;  1MZU A;  1K57 A;  2Y2L A;  3GR2 A;  4EQ1 A;  4PKY A;  3NI9 A;  1ALQ A;  3ITB A;  4KG5 A;  5HD5 A;  1YMX A;  3E0Y A;  3G35 A;  1GA9 A;  3M2J A;  3DAV A;  1XP4 A;  5FI7 A;  3KYE A;  3PBO A;  1U60 A;  4F3L A;  2Y2H A;  1EI5 A;  4M3K A;  2LB5 A;  4KZ6 A;  4WN5 A;  1G5U A;  5HAP A;  2Y2J A;  3UE3 A;  2WKQ A;  2Y2G A;  3D4F A;  4H8R A;  4UA6 A;  3MXR A;  3KOC A;  2ZC4 B;  2GDN A;  4GD8 A;  3MMH A;  4ARZ B;  4WLA A;  2M7V A;  5HDC A;  1S1Y A;  5AQA A;  5KSC A;  4OPZ A;  1LHY A;  4FTX A;  5HAQ A;  1ZTU A;  1YLJ A;  2HL1 A;  1VB6 A;  1W79 A;  2WAE A;  2QMI A;  2VGJ A;  2D02 A;  1DP8 A;  1XXM A;  1NZU A;  2V8C A;  1TF1 A;  3DWK A;  1VHM A;  3TSG A;  4OPY A;  3HVF A;  1H3Q A;  3PR6 A;  4L9G A;  3VE3 A;  3LIC A;  4RRR A;  3IF5 A;  4BD1 A;  2YKH A;  4DN0 A;  1MY8 A;  3LI9 A;  4WEK A;  4HP9 A;  3AGD A;  1IOU A;  1WYC A;  2L4R A;  3NCK A;  4Y2F A;  4EW7 A;  1Z09 A;  5DTK A;  4OQI A;  1LLB A;  4XT2 A;  3LCE A;  3IXH A;  3BY9 A;  2ZMF A;  3H9W A;  1ES5 A;  5CEB A;  4S2I A;  3EWK A;  3WS1 A;  1CI9 A;  4LFU A;  3IH8 A;  4JLF A;  5E2F A;  5DF7 A;  2R9X A;  1MC0 A;  1HZO A;  2DMW A;  1MWT A;  4PHT A;  3GSG A;  4KZA A;  4NXF A;  3H7W A;  3UN7 A;  4M4X A;  1N9O A;  2PD7 A;  2Y4A A;  3KO6 A;  4KZ3 A;  2R9W A;  2IWB A;  4XXR A;  3ZQ5 A;  4ZBE A;  4X25 A;  3MKE A;  3ZCZ A;  1E3U D;  1L0D A;  4QPR A;  3T4S A;  5HWT A;  2HV1 A;  3C7V A;  5FA7 A;  2PAV P;  1VET A;  4KQR A;  4LV0 A;  1V9Z A;  2HJE A;  1W8Y A;  4IHQ A;  2PYP A;  5AQ9 A;  3E2K A;  3GQZ A;  5DKL A;  2G2W A;  4EER A;  1DJA A;  1FCO A;  3Q81 A;  2EXA A;  4ETZ A;  4GDB A;  2ZD8 A;  5DFY A;  5GHY A;  1YQS A;  4OQG A;  5EOO A;  2W3D A;  4OH0 A;  3HUN A;  1SKF A;  1FCM A;  3IHA A;  4N9L A;  4DDS A;  2HF6 A;  1TVF A;  3S7Q A;  4JF6 A;  3RH8 B;  2P04 A;  2WYX A;  3Q7V A;  1F2K A;  3NOU C;  5E2H A;  4OQ0 A;  1K25 A;  4HES A;  1SZV A;  2J9P A;  1FIL A;  4R4R A;  3ZHH A;  3BYD A;  2WGW B;  4P6Z M;  3V3S A;  4QB8 A;  3Q82 A;  3U2A A;  3CJM A;  1RP5 A;  2EX2 A;  3IHB A;  1K0K A;  2EA9 A;  2Y55 A;  4Y5F A;  5JYP A;  1OTD A;  3WS0 A;  1N9N A;  2EX6 A;  1P0Z A;  5HAI A;  3H82 A;  1AXB A;  1OME A;  5HL1 A;  4BQM A;  5E43 A;  3EGD C;  1T1C A;  3MZE A;  3LGO A;  1K54 A;  1JVJ A;  3PD2 A;  1N9L A;  3GTC A;  1FCN A;  5C5K A;  3NBL A;  1PIO A;  2QKP A;  3K2N A;  4LV3 A;  4WZ5 A;  2MJ6 A;  4N92 A;  5M1A A;  1I2W A;  3BEC A;  5CHM A;  5L09 A;  3O88 A;  3D3O A;  3MXS A;  2IWD A;  4K91 A;  2KOI A;  3MQ0 A;  5GLA A;  3T4Q A;  4B4Z A;  3T1X A;  3FYZ A;  3IWO A;  4LGW A;  3N4I A;  1XJ4 A;  1PWC A;  3WS5 A;  4HI4 A;  4OOL A;  2K2N A;  5EVL A;  1PI4 A;  2Y79 A;  2XRN A;  5TJJ A;  3UPN A;  3E2L A;  4ARZ A;  5F83 A;  4CLC D;  5KIZ A;  3NDG A;  3KX0 X;  3QP4 A;  5HL6 A;  2VV8 A;  3LFV A;  3BFE A;  5F82 A;  5EUA A;  2QYB A;  1YSQ A;  1FSW A;  2WZX A;  4NG2 A;  1L0F A;  3NIA A;  2Y2O A;  4JXV A;  5L8M A;  3GEC A;  3ZNY A;  2XLN A;  4HQA A;  2UV0 E;  1T18 A;  3KYQ A;  5BOH A;  5FAO A;  1K4E A;  4GHI B;  3LEZ A;  4DE3 A;  2VGL M;  5TBM A;  3IH9 A;  4R23 A;  4C75 A;  4CLC C;  4U0X A;  1KOU A;  4S2K A;  1J7G A;  4DXC A;  2G7U A;  5A90 A;  4S2N A;  4EUV A;  3E98 A;  1NRJ A;  4NXE A;  1OTB A;  3MZF A;  1H8Y A;  2XSS A;  3HLD A;  5DF8 A;  4RRL A;  2VV6 A;  1ZHH B;  2A49 A;  2EFX A;  2VA0 A;  3PBQ A;  3LR3 A;  5GHX A;  1KDS A;  2HZ5 A;  4FH2 A;  2XK1 A;  2VEA A;  5IU1 A;  1GSW A;  4ZTK A;  1CJF A;  1JNU A;  5HZH A;  3VV4 A;  5GHZ A;  4GS9 B;  5EE8 A;  3QP5 A;  5FI6 A;  2GZA A;  1YLT A;  1HTZ A;  2X71 A;  1ZKJ A;  2RCX A;  3C2W A;  5J4E A;  3EOI A;  3VSK A;  4Y7P A;  4MEZ A;  1PW1 A;  4I38 A;  1T1B A;  2WKH A;  2BG1 A;  1HVB A;  3LIB A;  2JN7 A;  1G68 A;  2HP9 A;  3A0V A;  2I9V A;  1JWP A;  5FL3 A;  5CED A;  4MLL A;  3G6O A;  3SOI A;  4Q0I A;  1GCE A;  5CGX A;  5FQQ A;  4HEF A;  4HH2 A;  4KUK A;  5A93 A;  4MCW A;  4RRQ A;  2M1C A;  2NUP C;  2XFS A;  5GLC A;  4WEL A;  2FFY A;  3L9K A;  1YSP A;  2V20 A;  5HSQ A;  1AWI A;  1I2S A;  2B5R A;  1K56 D;  4OPQ A;  1K55 C;  1PZP A;  4LCL A;  1DP9 A;  1ESU A;  3TE8 A;  2WKP A;  3KYZ A;  4CQH A;  3LI8 A;  2Z6C A;  4JF5 A;  1Z6F A;  2ZM0 A;  2W3F A;  1LL8 A;  2WKE A;  1S4S A;  3T4O A;  1DRM A;  5FAT A;  3HLF A;  4GLQ A;  5F1G A;  2PR5 A;  4OOY A;  4QU3 A;  3BEB A;  2XDM A;  4BBV A;  2D01 A;  4LRX C;  4DKI A;  4WMC D;  4FD8 A;  1LSV A;  4EU0 A;  1YMS A;  2WGW A;  1OT6 A;  4PM7 A;  4GZB A;  3NDE A;  4IVK A;  1V9Y A;  4PM8 A;  1ZG4 A;  1STZ A;  1W63 M;  2O9A A;  2Q0O A;  2OSU A;  4GD6 A;  2XFT A;  3MJQ A;  1WE4 A;  3UE1 A;  2XR0 A;  2W27 A;  2E8I A;  2BTF P;  4L9E A;  2LB9 A;  1T1A A;  3PBS A;  3LID A;  4CLC B;  1NYY A;  2B02 A;  5EVE A;  4Z9Q A;  4DRT A;  3ZG8 B;  4GN2 A;  2ZOH A;  3HLW A;  3KO9 A;  5EVI D;  4JXS A;  3LUQ A;  1TD5 A;  4OLG A;  3W4P A;  2Y91 A;  4BBU A;  4R6L A;  4PKY G;  2EX9 A;  4OPR A;  1O7E A;  3OPH A;  2WGV A;  1YM1 A;  2Q9N A;  4ZJ3 A;  4EQI A;  3DTM A;  3D9Y A;  1J3W A;  3ZYT A;  4MN5 A;  4GW9 A;  4ZJ2 A;  4IUH A;  4KG6 A;  2WK0 A;  3C30 A;  3PBR A;  1CEG A;  4RR8 A;  4FSF A;  5AQB A;  3T4T A;  4RRG A;  3A0R A;  4E6X A;  3QP1 A;  3UB6 A;  2JC7 A;  2PRF A;  4DJ3 A;  4Y13 A;  3OPR A;  4II7 A;  3C8C A;  4GHI A;  4NET A;  4JXG A;  3VFH A;  4RRH A;  1G6O A;  4FUW A;  3MQQ A;  2YKF A;  3LIA A;  2Q9M A;  1K6R A;  3K3D A;  4X6T A;  3UMD A;  5DJT A;  2ZL1 A;  4BL3 A;  2ZQ9 A;  5I5L A;  4K08 A;  4Y15 A;  3T4J A;  3VFF A;  3B42 A;  3CMZ A;  2Y2N A;  4K0X A;  3UE6 A;  4O8G A;  1KGF A;  3KO5 A;  5F68 A;  4B4X A;  1NWZ A;  1MKI A;  2HDU A;  3PBN A;  3ZG7 B;  5FDH A;  1MWR A;  1E3U A;  3BW6 A;  4RX2 A;  1CQA A;  2EX8 A;  3LMU A;  5KMW A;  3A3E A;  3KO7 A;  3VP0 A;  3ULF A;  3D72 A;  4S2M A;  3WRT A;  1BLC A;  2V1Z A;  2FFF B;  1Y54 A;  4GS9 A;  1BUL A;  2OV5 A;  1G6A A;  4HNB A;  2HPB A;  2XD1 A;  2X01 A;  3G30 A;  5EPH A;  2V8F A;  5MC7 A;  3SH9 A;  3W8K A;  4R0Q A;  2WUQ A;  5TFQ A;  3S22 A;  3VP3 A;  4R1G A;  5TR7 A;  3V50 A;  4K0W A;  5J7E A;  1YKD A;  2ZMV A;  4DE1 A;  3PTE A;  3TW8 A;  3TJZ C;  2XA7 S;  3LEQ A;  3OCL A;  1LL5 A;  4GKU A;  3UB7 A;  2JHE A;  3OPP A;  3CWF A;  1RGY A;  3EQU A;  1IKG A;  1VEU B;  3RFB A;  4NBJ A;  1L2S A;  5HFO A;  2AVX A;  3TOI A;  3HUO A;  3ZVW A;  3MSH A;  3W2Z A;  2PBY A;  2PD8 A;  4E3J A;  3M6B A;  4I3J A;  5FAS A;  3A3J A;  5CGS A;  3C38 A;  5E2E A;  3G2Z A;  4D60 A;  4MBF A;  2JBF A;  2XRO A;  2PR6 A;  4Y0T A;  4P87 A;  3PXP A;  1JWZ A;  5AJG A;  4FCF A;  2W1T A;  2JKT M;  2P9V B;  4U3T A;  1LL9 A;  1S4R A;  3NEC A;  4KQO A;  4OKP A;  5GL9 A;  2GX5 A;  5FEF A;  3ZDJ A;  2IA2 A;  4IED A;  1OTI A;  3HLB A;  4EBL A;  4ZRR A;  3FKW A;  2V1B A;  2PBD P;  4E04 A;  5AQ7 A;  4KZ5 A;  4DJ2 A;  3ZG5 A;  3CG5 A;  1TS7 A;  2INW A;  1H5X A;  1GSV A;  4MDZ A;  5FQ9 A;  4KZ7 A;  3UB9 A;  1W5D A;  1Q2Q A;  3HRE A;  1ONG A;  4HOI A;  1OT9 A;  3PAE A;  1LI9 A;  1YLW A;  4G3V A;  2X02 A;  4AFI A;  4FOF A;  1ERO A;  3B47 A;  4P6Z S;  2ZQ7 A;  4Q0H A;  1S0W A;  5A8B A;  2JKG A;  3LMV A;  4B9O A;  3A3D A;  4DMZ A;  3QP6 A;  5G18 A;  5EM0 A;  3C4O A;  3OPL A;  4EWF A;  2J3T D;  4OP5 A;  1Q2P A;  3S7P A;  4WL9 A;  4BLM A;  3QP8 A;  4HY8 A;  1NYM A;  5HD3 A;  5FI2 A;  5GLB A;  1XGI A;  5HAR A;  3T1R A;  3IX3 A;  2Y2K A;  3M6H A;  2L0W A;  3O3V A;  2P74 A;  4YIN A;  1FR6 A;  4WM9 A;  3KSI A;  3RJU A;  5CX7 A;  1KDW A;  4I5S A;  2HP5 A;  2V2F F;  1L0E A;  3JYI A;  3VP4 A;  1SKO A;  2K7S A;  3RXX A;  4U0T A;  3UB8 A;  4EEP A;  2J80 A;  3QHY A;  3ZVT A;  4BWI A;  2JKF A;  2W3G A;  2ZC6 B;  1K55 A;  3F1P B;  1SDE A;  2P08 A;  3CLO A;  5J8X A;  5L07 A;  5CTM A;  4Y0U A;  3CUE A;  4WYY A;  4CLC E;  5FQI A;  3VE4 A;  4WF0 A;  3ZFZ A;  5G4Y A;  1XJ6 A;  4E3M A;  4GOG A;  4C3Q A;  3N8L A;  3UO9 A;  4DE0 A;  1KGG A;  1YLZ A;  3LY3 A;  2V0W A;  2C5W B;  5F1F A;  4G3K A;  3UNW A;  4Z1W A;  4IBR A;  2KLI A;  3JVU A;  3LYX A;  2VGL S;  4Y17 A;  5I94 A;  1S6R A;  4RRJ A;  4KZ8 A;  4S2J A;  3Q1F A;  3MBZ A;  3BFG A;  4H6J B;  4JPM A;  5DF9 A;  4ZDX A;  2VJW A;  3SZT A;  4KEN B;  3CZD A;  4R3J A;  3UDI A;  1IFQ A;  3V3R A;  3SS5 A;  5EOE A;  4S0L A;  1M6K A;  1NXY A;  1VEU A;  4G3W A;  2DBO A;  3VMA A;  4BEN A;  4MN7 A;  4RX3 A;  3AGE A;  2OLV A;  1H0M A;  1BYW A;  3LR0 A;  5DFX A;  3V5M A;  4GJ4 A;  1CEF A;  3N8R A;  4QY5 A;  1CK3 A;  1XJ3 A;  1ONH A;  5CTN A;  1EW0 A;  2ZQC A;  2ZM2 A;  1CI8 A;  1Y4O A;  1JWV A;  4UA7 A;  4RRK A;  5HX9 A;  5DTT A;  1F5M A;  4O0P A;  5M18 A;  2DRW A;  2CC1 A;  3FKV A;  4MMN A;  1L3L A;  2PYR A;  5FDS A;  3AGF A;  4E3K A;  5EM1 A;  3G34 A;  4KZ4 A;  2Z2L B;  2XQZ A;  1ACF A;  3MXQ A;  2HGV A;  4GDN A;  1ES4 A;  2P9V A;  3MKF A;  4OON A;  2ZQA A;  4BL2 A;  1UWN X;  1FOF A;  4NEE D;  5IT5 A;  2Y2Q A;  3MFD A;  4L9F A;  1TDL A;  4C6Y A;  5HDD A;  4Y3I A;  1J9M A;  2O9C A;  2P7J A;  1OTE A;  1M40 A;  2QJ7 A;  1SHV A;  3KSH A;  1WA9 A;  3Q7Z A;  4RRD A;  2KDK A;  3BM6 A;  3WWX A;  3BLS A;  1XA7 A;  4PPR A;  5FQK A;  2EFU A;  4RR9 A;  4L0L A;  1PFL A;  3N6I A;  4RRF A;  3BWL A;  1X0O A;  1IYS A;  3S7N A;  3E4O A;  4N9K A;  2J9O A;  3UME A;  3BFF A;  3IF6 C;  1P9W A;  4BBT A;  3HL9 A;  4JGQ A;  3LY4 A;  3F1N B;  1Y2Q A;  3BQ8 A;  1T19 A;  5HW3 A;  5J3W A;  3ZG9 B;  2H10 A;  2OOL A;  2ZQD A;  5L2F A;  5HPF A;  2H5S A;  4WZ5 C;  4S0K A;  3OCN A;  2XH9 A;  2I72 A;  4MBK A;  2HL0 A;  5K5B A;  3M2K A;  4X1L A;  1LSW A;  5E2G A;  1TS6 A;  1Y28 A;  3G2Y A;  2PT7 A;  5F5Y A;  4DXB A;  4LCM A;  1O07 A;  3KSF A;  1TS8 A;  4YFM A;  3G32 A;  1XX2 A;  3ICY A;  4O01 A;  3R7W B;  3LMT A;  1BLS A;  3EEH A;  4UQI S;  1VQQ A;  4RRI A;  2NUT C;  4OOM A;  4GCZ A;  3NUL A;  1ERQ A;  3HLG A;  1UGU A;  5FQJ A;  2W3H A;  2M7U A;  2JKT I;  4RRC A;  3V39 A;  2Y2I A;  3SS4 A;  4X53 A;  4EES A;  1RCJ A;  1N9B A;  3KOD A;  2FZ0 A;  2Z2M B;  3QNC A;  3CI6 A;  4OVD A;  1LT0 A;  1YLP A;  3A3F A;  4MNR A;  1F9I A;  5FAP A;  5EFW A;  2HDR A;  5CGW A;  1PWD A;  4P85 A;  3CPT B;  2XEP A;  4YOF A;  2JKR M;  5LBR A;  2PU2 A;  3KNP A;  5CRF A;  3UDX A;  3LR4 A;  4CJN A;  4KQD A;  2J8Y A;  3LR5 A;  3VOL A;  4E3O A;  3K3C A;  3BLM A;  1GSX A;  1IEL A;  3JPU A;  5EVI C;  1KE3 A;  5G4Z A;  3E4P A;  4PM6 A;  3C4P A;  5DVA A;  4IJG A;  2OWJ A;  1OJ5 A;  1NRF A;  3UPO A;  2J3W A;  3PD4 A;  4H6J A;  4UEY A;  2WKR A;  4CPK A;  4RQ9 A;  2ZC3 B;  1MBL A;  2Z6D A;  4QY6 A;  2OKV A;  3MS6 A;  1P97 A;  1FIK A;  4E3N A;  3QNB A;  2RL3 A;  3IBR A;  2V1A A;  3MF0 A;  1BLH A;  2VZW A;  3KNF A;  3ITA A;  3T50 A;  4NK3 A;  3IXG A;  4PM5 A;  2ZM8 A;  3NOP C;  4ME4 A;  5EV0 A;  3SH8 A;  2WGI A;  3MQO A;  3IF6 B;  3BJN A;  2OWH A;  1S66 L;  3CHW P;  4WBG A;  3MR0 A;  5HDS A;  1ES2 A;  5AVE A;  2QJ5 A;  3WS4 A;  3FPW A;  1XKZ A;  4FH4 A;  5JYO A;  2VGK A;  4YWZ A;  5CER A;  4QJG A;  3MZD A;  3W4O A;  5FEG A;  4ZAM A;  3P7N A;  1E4D A;  4F94 A;  2JCH A;  4S2L A;  4PAU A;  1PI5 A;  1NY0 A;  4HP4 A;  4HIA A;  1XGJ A;  4ID4 A;  4MBH A;  2W0N A;  4IVI A;  3DTI A;  4QD4 A;  4JGR A;  4N1H A;  2J7V A;  4KUO A;  1GHM A;  3T4L A;  3UDF A;  1IYQ A;  3A3I A;  4S0J A;  3TRC A;  1D1J A;  3P09 A;  2K31 A;  4LV1 A;  4DDY A;  3PBT A;  3HLE A;  3IXD A;  5CHJ A;  3IWQ A;  3G31 A;  4EBN A;  3F1N A;  3FZC A;  4MN6 A;  4X1M A;  5TBM B;  2ZLY A;  4RR7 A;  3ZG0 A;  4N1X A;  2A3U A;  3GRJ A;  4EV4 A;  1YPR A;  1A0K A;  1MWS A;  2XA7 M;  4NBI A;  3O86 A;  3IS2 B;  2L1M A;  3FWL A;  4R38 A;  5EVI B;  3SH7 A;  1BT5 A;  1ZC2 A;  3SW1 A;  3EQV A;  1QME A;  4X69 A;  1WYB A;  4OP8 A;  3SS3 A;  4Q0J A;  2GNX A;  3R7W A;  4EUZ A;  1PZO A;  3PD5 A;  1DY6 A;  3DW0 A;  1IKI A;  4R70 A;  1H8Z A;  4S2P A;  3QP2 A;  5J61 A;  4RYE A;  3HBR A;  2CMN A;  3IWI A;  4UHU A;  1NLY A;  4ESP A;  2ZQ8 A;  3OOV A;  4CLC A;  2PHY A;  2W1R A;  5IHV A;  4EXO A;  1DP6 A;  3TG9 A;  3CIT A;  3JVV A;  4WEJ A;  3HUM A;  4RRB A;  3O87 A;  5U47 A;  4EBP A;  3BFC A;  3U4L P;  2PDR A;  3PAG A;  4JXW A;  3CPT A;  2DNS A;  3VP1 A;  4LRY C;  1K57 C;  5EEC A;  3B33 A;  3BY8 A;  2Y2P A;  3FC7 A;  5F69 A;  3V67 A;  1PW8 A;  1EWZ A;  1K4F A;  2OAP 1;  2XGN A;  2ZMA A;  4JF4 A;  2QWS A;  4EEU A;  1QMF A;  1OJG A;  2V0U A;  4NXB A;  4R3A A;  2IWC A;  4IBX A;  3F1O B;  5KZH A;  4HH3 A;  1H8M A;  5FQM A;  3RTY A;  1KVL A;  4S2O A;  1ES3 A;  5M19 A;  1NJ4 A;  4P6B A;  1ODV A;  4B88 A;  5AVF A;  1MWU A;  2WAD A;  3S4X A;  2HDS A;  1TDG A;  5GLD A;  1KE4 A;  2VV7 A;  3UY6 A;  4A5R A;  2J3T C;  2Y8H A;  3DTE A;  2BLS A;  1JTG A;  1W8Q A;  3S1Y A;  4EET B;  4NKP A;  2JE5 A;  3Q07 A;  1TC5 A;  4OLD A;  1IEM A;  4E3L A;  2HDQ A;  4S03 A;  3NOT C;  2A24 B;  1PWG A;  2ZOI A;  3IF6 A;  2HJ9 C;  4PMA A;  1PRQ A;  4HJ6 A;  4HBU A;  4LLO B;  1UWP X;  4RR6 A;  3HCY A;  3B3X A;  1TS0 A;  2H0Y A;  3ISG A;  1GHP A;  1K56 A;  1L0G A;  3WRZ A;  1CF0 A;  1XPB A;  3OBF A;  3IBJ A;  4WUJ A;  1ZG6 A;  1YAX A;  1C3B A;  3PYP A;  1MXO A;  5L10 A;  2JKR I;  1D06 A;  1RGZ A;  2HP6 A;  3VP2 A;  1BZA A;  3NC8 A;  3G4P A;  4GNU A;  3OZH A;  1K38 A;  1IYO A;  3EGX C;  5HWV A;  1E25 A;  2ZBB A;  4D2O A;  4BD0 A;  3C7U A;  1NZO A;  3N8S A;  3T12 B;  3PHY A;  1XJ2 A;  1BTL A;  4JGP A;  2XD5 A;  2UWX A;  4WMC A;  5A91 A;  1XFN A;  3DWZ A;  1FSY A;  4X68 A;  3KO3 A;  1YT4 A;  4LEN A;  4DF6 A;  4BMW A;  3VOY A;  4HBT A;  3BFD A;  3T4K A;  4KG2 A;  4WZ4 A;  1NLZ A;  3C5A A;  2A2L A;  3EEA A;  2OAQ 1;  2EWW A;  4X56 A;  4QHC A;  3P98 A;  1KE0 A;  2OLU A;  1F98 A;  2R78 A;  2ZC7 A;  2ZL1 B;  3ZGA B;  2ACG A;  4R4S A;  4E3I A;  2G2U A;  3NHQ A;  4UA9 A;  1KVM A;  5A92 A;  3PD3 A;  2FH5 A;  3L7H A;  1PYY A;  3IS2 A;  3FG8 A;  5EVI A;  2EXB A;  4O7D A;  2VKS A;  4F3L B;  4B93 A;  1IYP A;  3DBA A;  1KGE A;  4R3B A;  4XUZ A;  2O9B A;  5DTS A;  4JKT A;  2VX8 A;  3GV9 A;  2BAS A;  4KZ9 A;  5KSH A;  1VM1 A;  2B18 A;  3HJK A;  3NJA A;  3T1Q B;  1S67 L;  2C6W B;  1BLP A;  5D3O A;  5IS1 A;  1JTD A;  5TGF A;  1HD8 A;  3N7W A;  2O0Y A;  4E6W A;  2HKZ A;  3LO7 A;  2WKI A;  3VOZ A;  1K54 C;  4GB7 A;  2H0T A;  3DTK A;  1HLU P;  5HPI A;  2ZJ9 A;  4UAA A;  4HHD A;  1JKE A;  3FPV A;  1FR1 A;  1BSG A;  4JBF A;  3IXB A;  3FV7 A;  3O5Y A;  1TEM A;  4S02 A;  3CUE C;  1BUE A;  5DKK A;  5FSR A;  5FAQ A;  4S0I A;  3IX8 A;  4LRZ E;  4XT2 B;  1SDN A;  3F1O A;  2GJ3 A;  1P9R A;  3UE0 A;  3R4K A;  4ETX A;  3UPP A;  1ESI A;  2B95 A;  4IUK A;  2WAF A;  2O99 A;  2QPN A;  4QWO A;  1LSX A;  3RXW A;  4NXG A;  4I39 A;  4RVA A;  3WS2 A;  2W1T B;  3GDI A;  3E4Q A;  3OLO A;  3H7W B;  3S7O A;  1OTA A;  5DJU A;  2Y59 A;  3LIF A;  2KX6 A;  4RRM A;  4RA7 A;  3HLC A;  2EWV A;  2H28 A;  3UB5 P;  1I5Q A;  4BJP A;  3F1P A;  1LI0 A;  3LIE A;  5HWW A;  2A24 A;  3I7J A;  1SCW A;  3IT9 A;  4KQQ A;  1VET B;  4HJ3 A;  2Y2M A;  1G28 A;  1W7F A;  1DJB A;  3BQA A;  3MFX A;  4PM9 A;  4S2N C;  3BRM A;  1MKM A;  4UQI M;  3OC2 A;  2PU4 A;  3IQA A;  3VSL A;  4HJ4 A;  3A0S A;  1W63 Q; 
#chains in the Genus database with same CATH homology
 2QZ6 A;  3O3V A;  2P74 A;  5GHZ A;  4YIN A;  5EE8 A;  4ZJ1 A;  1FR6 A;  4WM9 A;  5CHJ A;  3RJU A;  1GA0 A;  1KDW A;  3IWQ A;  1N4O A;  5FI6 A;  2HP5 A;  2V2F F;  3NY4 A;  3G31 A;  1YLT A;  1HTZ A;  1L0E A;  2WZZ A;  2X71 A;  1ZKJ A;  2RCX A;  4Y0O A;  3FZC A;  3ZNT A;  4EBN A;  4KZB A;  3JYI A;  2ZLY A;  3VP4 A;  4RR7 A;  3VSK A;  4Y7P A;  4MEZ A;  3KOB A;  1PW1 A;  2XF3 A;  5CEC A;  3ZG0 A;  4N1X A;  2A3U A;  4P0M A;  2WKH A;  2ZC5 B;  2BG1 A;  1FQG A;  1HVB A;  3RXX A;  3GRJ A;  4EV4 A;  4U0T A;  1G68 A;  3QHY A;  2HP9 A;  3ZVT A;  3Q7V B;  2ZC6 B;  1K55 A;  1JWP A;  1SDE A;  4DE2 A;  3GVB A;  5CED A;  1MWS A;  4MLL A;  5J8X A;  4NBI A;  3SOI A;  2DCF A;  3O86 A;  3FWL A;  3KO4 A;  1GCE A;  5CTM A;  5CGX A;  5FQQ A;  5EVI B;  4HEF A;  4Y0U A;  3SH7 A;  4WYY A;  5A93 A;  5FQI A;  1BT5 A;  1YLY A;  4LV2 A;  1ZC2 A;  3ZFZ A;  4RRQ A;  2XFS A;  5GLC A;  4WEL A;  2FFY A;  3EQV A;  1XA1 A;  1QME A;  4X69 A;  4E3M A;  2V20 A;  1WYB A;  4GOG A;  4OP8 A;  1I2S A;  2B5R A;  4C3Q A;  3N8L A;  4Q8I A;  3UO9 A;  3SS3 A;  1K56 D;  4OPQ A;  1MPL A;  1K55 C;  4DE0 A;  1PZP A;  4LCL A;  1ESU A;  1KGG A;  1YLZ A;  4EUZ A;  3LY3 A;  4X55 A;  2C5W B;  1PZO A;  5CHU A;  3PD5 A;  1DY6 A;  3DW0 A;  3W4Q A;  1IKI A;  5F1F A;  1ERM A;  1H8Z A;  1Z6F A;  4JF5 A;  4S2P A;  1DJC A;  3UNW A;  2HL2 A;  5CXW A;  5J61 A;  2ZM0 A;  4IBR A;  4XUX A;  4RYE A;  3HBR A;  2WKE A;  1GHI A;  1K6S A;  3IWI A;  4RRA A;  4UHU A;  5FAT A;  3HLF A;  2ZQ8 A;  3GMW A;  5I94 A;  1S6R A;  4RRJ A;  5F1G A;  4OQH A;  4KZ8 A;  4OOY A;  4QU3 A;  3BEB A;  2XDM A;  4S2J A;  1K57 A;  2Y2L A;  3Q1F A;  5IHV A;  3MBZ A;  3BFG A;  3TG9 A;  3GR2 A;  4JPM A;  4WEJ A;  3NI9 A;  5DF9 A;  1ALQ A;  4DKI A;  4ZDX A;  3HUM A;  4WMC D;  4RRB A;  3O87 A;  5U47 A;  4FD8 A;  4KEN B;  3CZD A;  3ITB A;  4R3J A;  3BFC A;  4EBP A;  3PAG A;  4KG5 A;  3UDI A;  1YMX A;  4JXW A;  3G35 A;  3V3R A;  1YMS A;  2WGW A;  2DNS A;  4PM7 A;  3SS5 A;  5EOE A;  4GZB A;  3NDE A;  1GA9 A;  3M2J A;  4IVK A;  1M6K A;  4S0L A;  1NXY A;  1XP4 A;  5FI7 A;  3VP1 A;  3PBO A;  1U60 A;  4PM8 A;  2DBO A;  2Y2H A;  1ZG4 A;  3VMA A;  1K57 C;  4BEN A;  1EI5 A;  5EEC A;  4M3K A;  4RX3 A;  2OSU A;  3AGE A;  2OLV A;  2Y2P A;  4KZ6 A;  4GD6 A;  2XFT A;  5HAP A;  2Y2J A;  3V5M A;  3UE3 A;  1CEF A;  2Y2G A;  1WE4 A;  3D4F A;  3UE1 A;  4H8R A;  4UA6 A;  3MXR A;  3N8R A;  4QY5 A;  1CK3 A;  1ONH A;  2XR0 A;  5CTN A;  1PW8 A;  3KOC A;  1EWZ A;  2GDN A;  2ZC4 B;  1K4F A;  2ZQC A;  4GD8 A;  2E8I A;  2XGN A;  2ZMA A;  4JF4 A;  3PBS A;  2ZM2 A;  1QMF A;  1CI8 A;  1JWV A;  5AQA A;  5KSC A;  4UA7 A;  4RRK A;  4OPZ A;  5HX9 A;  1LHY A;  1NYY A;  5DTT A;  2IWC A;  5HAQ A;  5M18 A;  2DRW A;  4IBX A;  2CC1 A;  5KZH A;  4Z9Q A;  4DRT A;  3FKV A;  3ZG8 B;  4GN2 A;  1YLJ A;  3HLW A;  2HL1 A;  5FQM A;  3AGF A;  1KVL A;  4S2O A;  4JXS A;  5EVI D;  4E3K A;  1ES3 A;  3G34 A;  4KZ4 A;  3KO9 A;  2Z2L B;  2XQZ A;  4OLG A;  1W79 A;  3W4P A;  1NJ4 A;  2Y91 A;  4P6B A;  5M19 A;  2WAE A;  2QMI A;  2VGJ A;  2EX9 A;  4OPR A;  4GDN A;  4B88 A;  1ES4 A;  1O7E A;  2P9V A;  1XXM A;  3MKF A;  1NZU A;  2WGV A;  1MWU A;  1YM1 A;  2Q9N A;  2WAD A;  3OPH A;  3DTM A;  2HDS A;  1TDG A;  2ZQA A;  4OON A;  5GLD A;  4ZJ3 A;  4BL2 A;  3DWK A;  3TSG A;  1FOF A;  1KE4 A;  4OPY A;  3UY6 A;  4A5R A;  2BLS A;  2Y2Q A;  1JTG A;  3HVF A;  3MFD A;  1TDL A;  1W8Q A;  3S1Y A;  4C6Y A;  1J9M A;  4RRR A;  1M40 A;  3IF5 A;  2JE5 A;  4ZJ2 A;  4BD1 A;  1MY8 A;  4KG6 A;  3Q07 A;  1TC5 A;  1SHV A;  4OLD A;  1IEM A;  4WEK A;  4E3L A;  2HDQ A;  4S03 A;  3AGD A;  2WK0 A;  3Q7Z A;  3PBR A;  4RRD A;  1CEG A;  3S4X A;  1WYC A;  1PWG A;  3NCK A;  4RR8 A;  4FSF A;  5AQB A;  3BM6 A;  3IF6 A;  3WWX A;  4PMA A;  5DTK A;  4OQI A;  3BLS A;  1LLB A;  1XA7 A;  4PPR A;  4RRG A;  3LCE A;  4HBU A;  5FQK A;  4E6X A;  3IXH A;  2EFU A;  4RR9 A;  4L0L A;  4RR6 A;  3N6I A;  4RRF A;  1ES5 A;  2JC7 A;  3B3X A;  2H0Y A;  5CEB A;  4S2I A;  3WS1 A;  1IYS A;  3ISG A;  3OPR A;  1CI9 A;  1GHP A;  1K56 A;  3IH8 A;  4JLF A;  5E2F A;  1L0G A;  5DF7 A;  2R9X A;  2J9O A;  4N9K A;  3WRZ A;  1HZO A;  1XPB A;  1MWT A;  3BFF A;  3GSG A;  3IF6 C;  4NET A;  1ZG6 A;  4EQI A;  4JXG A;  4KZA A;  3HL9 A;  3VFH A;  3LY4 A;  4RRH A;  1Y2Q A;  3UN7 A;  1C3B A;  1MXO A;  5HW3 A;  1RGZ A;  2HP6 A;  3VP2 A;  1BZA A;  3ZG9 B;  2H10 A;  1K6R A;  2Q9M A;  2Y4A A;  2ZQD A;  5L2F A;  3NC8 A;  4X6T A;  2H5S A;  3G4P A;  2R9W A;  4GNU A;  4KZ3 A;  2ZQ9 A;  4WZ5 C;  3OZH A;  2IWB A;  4BL3 A;  1K38 A;  1IYO A;  4S0K A;  3OCN A;  1E25 A;  2XH9 A;  3VFF A;  3CMZ A;  4D2O A;  2I72 A;  2Y2N A;  4XXR A;  4MBK A;  4BD0 A;  3C7U A;  4K0X A;  3M2K A;  4ZBE A;  1NZO A;  3N8S A;  2HL0 A;  3MKE A;  3ZCZ A;  1KGF A;  1BTL A;  3KO5 A;  1E3U D;  1L0D A;  2XD5 A;  4B4X A;  1MKI A;  2HDU A;  5E2G A;  3PBN A;  2UWX A;  3ZG7 B;  3C7V A;  4WMC A;  5FA7 A;  5FDH A;  4KQR A;  3G2Y A;  1MWR A;  5A91 A;  1E3U A;  4LV0 A;  4RX2 A;  2EX8 A;  4DXB A;  3LMU A;  5KMW A;  3A3E A;  1W8Y A;  5AQ9 A;  3E2K A;  3KO7 A;  3VP0 A;  3GQZ A;  4LCM A;  1O07 A;  3DWZ A;  1FSY A;  4X68 A;  2G2W A;  4YFM A;  3G32 A;  3KO3 A;  1DJA A;  1XX2 A;  1YT4 A;  4S2M A;  1FCO A;  3Q81 A;  4LEN A;  2EXA A;  3WRT A;  4GDB A;  3LMT A;  4DF6 A;  1BLC A;  1BLS A;  2V1Z A;  2FFF B;  2ZD8 A;  3M6H A;  1VQQ A;  1Y54 A;  3VOY A;  4RRI A;  4HBT A;  4OOM A;  1BUL A;  1YQS A;  5GHY A;  2OV5 A;  3BFD A;  1ERQ A;  3HLG A;  1G6A A;  4OQG A;  2HPB A;  5FQJ A;  5EOO A;  2XD1 A;  4KG2 A;  3G30 A;  5EPH A;  2X01 A;  4WZ4 A;  3SH9 A;  4OH0 A;  3C5A A;  3W8K A;  4R0Q A;  4RRC A;  2WUQ A;  3V39 A;  3HUN A;  1SKF A;  2Y2I A;  3SS4 A;  4X56 A;  5TFQ A;  4QHC A;  3P98 A;  1KE0 A;  2OLU A;  1FCM A;  3IHA A;  4X53 A;  4N9L A;  4DDS A;  1RCJ A;  1TVF A;  1N9B A;  2ZC7 A;  4JF6 A;  4R1G A;  5TR7 A;  3S22 A;  3VP3 A;  3KOD A;  3V50 A;  4K0W A;  3ZGA B;  2WYX A;  3Q7V A;  2Z2M B;  4R4S A;  4E3I A;  2G2U A;  4UA9 A;  5A92 A;  1KVM A;  3QNC A;  5E2H A;  3PD3 A;  4DE1 A;  4OQ0 A;  1K25 A;  3PTE A;  1PYY A;  4OVD A;  4HES A;  1YLP A;  3A3F A;  2J9P A;  4MNR A;  5EVI A;  5FAP A;  3OCL A;  2EXB A;  2HDR A;  4O7D A;  1LL5 A;  1PWD A;  5CGW A;  4GKU A;  4P85 A;  4R4R A;  3ZHH A;  3BYD A;  2XEP A;  3OPP A;  2WGW B;  1RGY A;  3EQU A;  3V3S A;  1IKG A;  4NBJ A;  2PU2 A;  4QB8 A;  1L2S A;  5HFO A;  3Q82 A;  3KNP A;  3CJM A;  5CRF A;  3UDX A;  1RP5 A;  2EX2 A;  1IYP A;  3IHB A;  4CJN A;  3TOI A;  2Y55 A;  5JYP A;  3HUO A;  2J8Y A;  3WS0 A;  3ZVW A;  4E3O A;  2EX6 A;  3BLM A;  2PBY A;  1IEL A;  5HAI A;  4E3J A;  3M6B A;  1KGE A;  1AXB A;  4R3B A;  5FAS A;  5EVI C;  4XUZ A;  3A3J A;  5CGS A;  1KE3 A;  5DTS A;  1OME A;  5HL1 A;  4JKT A;  5KSH A;  3GV9 A;  4KZ9 A;  1VM1 A;  5E2E A;  3G2Z A;  4BQM A;  5E43 A;  3PBT A;  3MZE A;  3C4P A;  4MBF A;  2JBF A;  4PM6 A;  5DVA A;  1K54 A;  4Y0T A;  1JVJ A;  3PD2 A;  3GTC A;  4P87 A;  1NRF A;  3UPO A;  1FCN A;  1JWZ A;  3PD4 A;  3NBL A;  1PIO A;  2C6W B;  4LV3 A;  4WZ5 A;  4CPK A;  4N92 A;  5M1A A;  2ZC3 B;  1I2W A;  1MBL A;  4QY6 A;  3BEC A;  5CHM A;  1BLP A;  2OKV A;  3O88 A;  5D3O A;  4FCF A;  3MXS A;  1JTD A;  5TGF A;  1HD8 A;  2IWD A;  3N7W A;  2P9V B;  4K91 A;  4U3T A;  1LL9 A;  4E6W A;  2HKZ A;  3LO7 A;  2WKI A;  3VOZ A;  4KQO A;  1K54 C;  5GLA A;  4B4Z A;  4OKP A;  3FYZ A;  3IWO A;  4GB7 A;  5GL9 A;  4E3N A;  3N4I A;  2H0T A;  3QNB A;  2RL3 A;  3ZDJ A;  1PWC A;  2ZJ9 A;  4IED A;  4UAA A;  3WS5 A;  3HLB A;  4EBL A;  4OOL A;  1JKE A;  1BLH A;  3FKW A;  1FR1 A;  3KNF A;  3ITA A;  1BSG A;  1PI4 A;  4JBF A;  5EVL A;  4NK3 A;  3UPN A;  3IXG A;  3E2L A;  3IXB A;  4PM5 A;  3FV7 A;  2ZM8 A;  1TEM A;  4S02 A;  3SH8 A;  1BUE A;  2WGI A;  5AQ7 A;  5FSR A;  4KZ5 A;  5F83 A;  3NDG A;  4DDY A;  5FAQ A;  3IF6 B;  3ZG5 A;  3CG5 A;  4S0I A;  4WBG A;  1ES2 A;  1SDN A;  3BFE A;  5F82 A;  5EUA A;  1H5X A;  3WS4 A;  5FQ9 A;  3UE0 A;  4KZ7 A;  1XKZ A;  1FSW A;  2WZX A;  3UPP A;  4FH4 A;  1ESI A;  1L0F A;  3NIA A;  2Y2O A;  5JYO A;  4JXV A;  2VGK A;  1W5D A;  1Q2Q A;  2WAF A;  3HRE A;  1ONG A;  5CER A;  2XLN A;  3ZNY A;  2QPN A;  4QJG A;  3MZD A;  3RXW A;  3PAE A;  5BOH A;  5FAO A;  4RVA A;  3WS2 A;  1LI9 A;  3W4O A;  1YLW A;  1K4E A;  2X02 A;  3LEZ A;  4ZAM A;  4DE3 A;  1E4D A;  4F94 A;  2JCH A;  3IH9 A;  4R23 A;  4S2L A;  4C75 A;  1PI5 A;  1ERO A;  1NY0 A;  2Y59 A;  4U0X A;  4RRM A;  2ZQ7 A;  4RA7 A;  4S2K A;  3HLC A;  1J7G A;  4DXC A;  5A90 A;  1I5Q A;  1S0W A;  4S2N A;  1XGJ A;  4ID4 A;  4BJP A;  1LI0 A;  4MBH A;  4IVI A;  3LMV A;  4QD4 A;  3A3D A;  3MZF A;  1H8Y A;  3HLD A;  3I7J A;  5G18 A;  5DF8 A;  1SCW A;  3C4O A;  4N1H A;  4RRL A;  3IT9 A;  2A49 A;  3OPL A;  2EFX A;  4KQQ A;  4EWF A;  4OP5 A;  1Q2P A;  2J7V A;  3PBQ A;  2Y2M A;  5GHX A;  1GHM A;  3UDF A;  4BLM A;  1W7F A;  1DJB A;  1KDS A;  4FH2 A;  1IYQ A;  1NYM A;  2XK1 A;  3A3I A;  5FI2 A;  5GLB A;  4S0J A;  4PM9 A;  4S2N C;  3BRM A;  3P09 A;  4ZTK A;  3OC2 A;  2PU4 A;  1XGI A;  5HAR A;  3IQA A;  3VSL A;  4LV1 A;  2Y2K A;  3IXD A;  3HLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...