2EX2A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
456
structure length
456
Chain Sequence
NVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 146
structure length 456
sequence length 456
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex2A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex2A02
5A92A 4EV4A 1BUEA 2G2UA 2PU2A 3CZDA 3SH8A 4IVIA 1KDSA 1N9BA 3VSKA 3UPOA 3DWZA 3VP4A 3A3IA 4X53A 1NXYA 3QHYA 1LHYA 3IF5A 3UO9A 3S1YA 1AXBA 1KE3A 3LCEA 3NI9A 5EUAA 3V5MA 5JYPA 4X55A 2RL3A 3FWLA 2WZXA 4MBKA 3GQZA 4WELA 4ID4A 2Y2NA 4QY6A 3VOYA 3UY6A 1GHIA 2ZM0A 1ES3A 1YQSA 1ONHA 1ZC2A 2WADA 2XK1A 4HESA 4X56A 5DF8A 5E43A 3ZDJA 1YLPA 3G4PA 4EBNA 4ZDXA 1ESIA 3S22A 4EBPA 2HDUA 1S6RA 1J9MA 1ZKJA 2WUQA 1H8ZA 3CMZA 3N7WA 1PWGA 1K56A 5GHYA 1I2WA 1IELA 2VGKA 4JF5A 1FCMA 5EVIA 4QD4A 1XA1A 3EQVA 3IXDA 3IWOA 4GD6A 1SDEA 1G6AA 3P09A 4BL3A 1KE0A 5FQJA 1MBLA 1PWDA 3VOZA 3HUNA 3UDIA 4Y0UA 4GNUA 3NDGA 3NDEA 1KGGA 1BLPA 4JPMA 3C4PA 4U0XA 2HPBA 4OONA 3SS5A 4ZBEA 4RX3A 3MZFA 3NC8A 4OQ0A 1K6SA 2Y2JA 1K54A 3PAGA 1RGZA 5CXWA 1MXOA 3TOIA 3UPPA 2ZJ9A 1Q2QA 4K91A 4M3KA 5U47A 3V39A 2J7VA 3OC2A 5EVID 2OLUA 4HEFA 5GLBA 2DRWA 2Y2GA 1NRFA 2HP5A 4DXBA 3IF6A 2WAEA 1LL5A 1U60A 1W7FA 1XA7A 3DW0A 3PTEA 4WYYA 1HD8A 3MXRA 4HBTA 3MXSA 4UA9A 5A91A 5HAIA 3FKVA 4OPZA 2IWBA 4S2NC 4NK3A 2H0TA 5EVIB 4WMCA 3N4IA 1JWZA 3A3JA 3V50A 3ZG5A 3HLEA 3WRZA 5G18A 3OZHA 3O88A 4WBGA 3MBZA 4B88A 1FR1A 1SCWA 4BD0A 4LV1A 3G31A 5CEBA 3C7UA 1TEMA 3O86A 1EWZA 5HW3A 1FR6A 5AQAA 1FCNA 4N1XA 2EFUA 4KZ8A 3ZFZA 1IYQA 4WMCD 4QJGA 3NCKA 3RXWA 4BD1A 1K57A 4H8RA 2J9OA 1ES2A 3AGEA 4LENA 4Y0OA 5KMWA 3G35A 3LY4A 4GZBA 1K38A 2ZM2A 3UN7A 2ZC6B 1IYSA 2V2FF 3UE3A 3QNCA 1XP4A 5KSCA 3UPNA 4GD8A 4A5RA 3TG9A 2H10A 2E8IA 2ZQ7A 1FOFA 3ZVWA 3CJMA 5HAQA 3BYDA 3O87A 4R4RA 4KQRA 1C3BA 3O3VA 4OKPA 1CI9A 1MY8A 3C5AA 4WZ5C 5GL9A 1VM1A 1WYBA 2HP9A 4FCFA 3PAEA 3GR2A 3G30A 5FQ9A 1KVLA 4UA6A 5HL1A 4JXSA 1K55A 3BLMA 1G68A 4PM9A 1ZG6A 2J8YA 1H5XA 3IHBA 4KZ7A 4ZJ1A 4C3QA 1Z6FA 2Y2HA 2P74A 3IQAA 4OOMA 2BG1A 2ZMAA 3UE0A 3V3RA 4S2IA 4IBRA 4QY5A 4B4ZA 3WRTA 1NZOA 1YLYA 3E2LA 2OLVA 3ZG9B 1DJBA 3CG5A 2WAFA 3Q1FA 4KZAA 4LV0A 4PPRA 4ZJ2A 2XFTA 3SS4A 4P6BA 5FASA 3NY4A 3GTCA 1XGJA 3BFCA 1GHPA 2Y2MA 1I5QA 4X6TA 5E2FA 3UNWA 4QHCA 5M1AA 2QMIA 2WYXA 5CTNA 1W5DA 3W4PA 3G32A 3ZVTA 4PM7A 3HLGA 1IYOA 1PI5A 1XPBA 1DJCA 4R0QA 2Q9NA 3VMAA 3VP0A 3BFDA 4JBFA 4MBHA 2WGWA 3MFDA 3P98A 1JTDA 3HBRA 4OPQA 4P0MA 3GV9A 2UWXA 3OPRA 4X68A 2FFYA 5FATA 1PWCA 1W8QA 5HX9A 1SDNA 5DF7A 5FA7A 1S0WA 2JE5A 4F94A 1ES5A 1ERMA 2PU4A 1FSYA 4RX2A 5E2EA 5CERA 1M40A 4LCLA 5FAQA 1RP5A 3A3DA 4GN2A 1XXMA 5F83A 4YINA 1L0FA 2R9WA 3PBNA 4OQHA 3Q7ZA 1WE4A 1YLZA 4CJNA 3ZHHA 2C6WB 2Y2OA 1ONGA 5D3OA 4Y0TA 4JF6A 4DXCA 3SH9A 3GRJA 1PW1A 1BSGA 4JF4A 2JCHA 4Z9QA 4E6WA 5FSRA 3BLSA 1YM1A 1L0DA 1K4EA 1K56D 4KZBA 1E4DA 4DE1A 4GDBA 1TDGA 1I2SA 2XQZA 1LI9A 1JWPA 4DRTA 2EX9A 5M18A 2Y59A 2BLSA 1PZOA 1CK3A 4S2LA 1WYCA 5CHMA 1NYMA 1MKIA 2XEPA 3AGDA 3M6HA 4XUXA 1NJ4A 1ESUA 2ZC5B 4GB7A 2XH9A 4BL2A 3PBRA 3BEBA 1QMEA 4BLMA 2JBFA 2V1ZA 4RA7A 4N9KA 3B3XA 2OV5A 4FH2A 1ES4A 4KG5A 3GMWA 3IH8A 1W79A 5FAOA 5DTKA 4OP5A 5FAPA 2EX8A 3OCLA 1KDWA 1N4OA 2RCXA 4X69A 3VSLA 4XUZA 3ZG8B 3JYIA 2Y91A 4PM5A 4JXVA 2PBYA 4MLLA 1HZOA 4N9LA 1HTZA 4FSFA 2HDSA 2EFXA 2WKEA 1L0GA 4C6YA 4E3LA 5M19A 3WWXA 5GHXA 5HARA 2VGJA 5FI6A 3IF6B 1JWVA 1IEMA 3UE1A 5F1GA 3RJUA 3C4OA 4RYEA 2JC7A 4LV2A 1KE4A 3SS3A 1O07A 3UDXA 3IT9A 4DE3A 4OQIA 3Q7VA 4EUZA 4N1HA 4U3TA 3ZG0A 3HLWA 3GSGA 5HFOA 3UDFA 2ZQ9A 3W4QA 3N8RA 2C5WB 5TGFA 3EQUA 4WEJA 1CEFA 4OLGA 5F1FA 1CI8A 4GDNA 4HBUA 4MEZA 4OPRA 3IWQA 3N8LA 2XR0A 4R23A 5FDHA 1GA0A 4OLDA 4Q8IA 5EE8A 2WKHA 1TVFA 5EVIC 1Y54A 2IWDA 4JXWA 1JVJA 1W8YA 3OPPA 5EPHA 3ITAA 3VP1A 5FQQA 4E3NA 4DDSA 4CPKA 1SKFA 5BOHA 2ZLYA 1KGEA 4OVDA 2V20A 4PMAA 1RGYA 3C7VA 5CTMA 1GCEA 3HLDA 4PM8A 3QNBA 5CGXA 5EOOA 1K54C 2XF3A 2B5RA 3M6BA 1YMXA 4Y7PA 1K4FA 5TR7A 4FD8A 5FI7A 4E6XA 4P85A 2WZZA 3IWIA 4JLFA 5CHUA 4DE2A 4B4XA 3BFEA 3Q81A 3FV7A 3IF6C 1K6RA 1MWTA 3GVBA 3VP3A 3IHAA 2ZQAA 2WGIA 3N8SA 3W4OA 5AQ7A 1YLJA 3VFFA 4XXRA 3DTMA 4S2NA 4GKUA 1XX2A 3ZG7B 1BTLA 3BFGA 3LO7A 1SHVA 4E3IA 2IWCA 2Y55A 3NIAA 4P87A 2HP6A 1PI4A 2DNSA 5GLAA 4KZ6A 5A90A 3Q82A 1H8YA 4N92A 3ISGA 5E2GA 3HLCA 5AQ9A 3TSGA 4YFMA 1BLSA 4OPYA 4IVKA 4EWFA 4OQGA 5FQMA 3HVFA 2ZQ8A 2FFFB 2HDRA 3MZEA 5FQKA 3PBSA 1E25A 1K57C 2CC1A 5EECA 1LLBA 3OCNA 4KG2A 3E2KA 2ZM8A 4S2MA 1LL9A 2QZ6A 1OMEA 1L0EA 3OPLA 1PZPA 2XFSA 3I7JA 4KZ9A 3IH9A 2J9PA 3FYZA 1YT4A 4K0WA 2Y2IA 2GDNA 5IHVA 4S2JA 1HVBA 1E3UA 2EXAA 5FQIA 3D4FA 3WS5A 5E2HA 5AQBA 1CEGA 2WGWB 2G2WA 4BENA 3HUOA 1PW8A 3LEZA 1VQQA 3ITBA 5GLDA 4GOGA 5DTSA 4O7DA 4WZ5A 2EXBA 1BLCA 1NY0A 1PYYA 2H0YA 5HAPA 1ZG4A 3M2KA 5KZHA 1QMFA 3ZNYA 4ZAMA 2Y4AA 1LI0A 1MWRA 4KG6A 1K55C 3ZGAB 3MKFA 4S2OA 5CGSA 4U0TA 5DVAA 5DTTA 4UHUA 1E3UD 3WS2A 4KQQA 4FH4A 3ZCZA 2OSUA 4NETA 1FQGA 5F82A 4DE0A 1NYYA 1RCJA 2P9VA 2Z2MB 3W8KA 5TFQA 2XDMA 4LCMA 1KVMA 1PIOA 2EX6A 4OOLA 4QU3A 3MZDA 3LY3A 2ZC4B 4UAAA 1EROA 4R3BA 4E3MA 2QPNA 4R3JA 3AGFA 1YLWA 1XKZA 3VP2A 4UA7A 3WS4A 2ZQCA 3DWKA 5DF9A 1DY6A 1K25A 4KZ3A 3WS1A 3IXGA 1EI5A 1MPLA 4MNRA 1ERQA 3HREA 5KSHA 5CHJA 3MKEA 5A93A 1MWSA 3A3EA 1BLHA 2X02A 4E3KA 4MBFA 1YMSA 2ZC3B 4IBXA 1L2SA 4RVAA 2XLNA 2A3UA 3BFFA 4L0LA 4KZ5A 4DF6A 2WKIA 4EBLA 2ZD8A 3BECA 2Z2LB 3IXBA 3V3SA 5JYOA 3FKWA 1KGFA 2P9VB 4OP8A 1BZAA 5CECA 2HDQA 1FCOA 4DDYA 2X71A 3HL9A 4EQIA 5CEDA 4R1GA 3Q07A 4R4SA 3PBOA 3PBTA 4OOYA 3PBQA 2EX2A 2ZC7A 3SOIA 4D2OA 1IKIA 2Y2KA 4DKIA 4E3JA 3VFHA 2Y2PA 1MWUA 2A49A 3HUMA 5EOEA 1BT5A 1O7EA 4C75A 5CRFA 5EVLA 1IKGA 1BULA 4KZ4A 4E3OA 1DJAA 1FSWA 2H5SA 5FI2A 3OPHA 4BQMA 3HLFA 2R9XA 3BM6A 3G34A 2DCFA 5GHZA 4JKTA 4KENB 4S2KA 3RXXA 4JXGA 1NZUA 3Q7VB 1ALQA 1IYPA 1M6KA 2WK0A 4BJPA 1YLTA 4WM9A 4K0XA 3IXHA 1JTGA 4WEKA 3HLBA 3WS0A 2Q9MA 1XGIA 4KQOA 2XD5A 3SH7A 2Y2QA 2XD1A 5CGWA 4QB8A 5I94A 1GHMA 3M2JA 3ZNTA 4PM6A 1GA9A 1Q2PA 3NBLA 4IEDA 3A3FA 4ZJ3A 5J8XA 2XGNA 1TDLA 4ZTKA 3G2ZA 4LV3A 4WZ4A 2WGVA 5L2FA 3FZCA 3S4XA 2X01A 5GLCA 3N6IA 3BRMA 4S2PA 3G2YA 2I72A 2Y2LA 4OH0A 2ZQDA
chains in the Genus database with same CATH superfamily
1CF0A 4EV4A 4IVIA 3H9WA 3VSKA 4X53A 2M1CA 1KE3A 4I3JA 3PYPA 3K2NA 1LSXA 2WZXA 4WELA 5HPIA 3VOYA 1GHIA 4DE2A 1ES3A 1YQSA 1ONHA 1ZC2A 2XA7M 5HAPA 4EBNA 2HDUA 1S4RA 2VGKA 3SZTA 4QD4A 4BL3A 3EQVA 4GD6A 3QP2A 3IS2B 1G6AA 1Z09A 5FQJA 4RRCA 3EGDC 2JKGA 3HUNA 3UDIA 3NDGA 3TW8A 1BLPA 5HPFA 3TE8A 4U0XA 1OT9A 3UPPA 1Q2QA 5EVID 4DXBA 1LL5A 5HWVA 1W7FA 3PTEA 3G6OA 3MXRA 4UA9A 3GECA 4OPZA 5EVIB 3V50A 3NJAA 4HQAA 3T1SA 5F5YA 5G18A 3OZHA 4WBGA 1STZA 1FR1A 1SCWA 4RRBA 4EERA 1ODVA 3C7UA 1TEMA 2W3GA 4N1XA 3EEAA 4KZ8A 2Z6DA 2V1BA 3G35A 3LY4A 3KNPA 1OJGA 2FZ0A 2V2FF 3QNCA 1XFNA 2E8IA 2ZQ7A 1Y4OA 3F1PB 2JKRM 4OKPA 1CI9A 2VV8A 1BYWA 3PAEA 3G30A 3W2ZA 1VEUB 2IA2A 4UA6A 3E0YA 1K55A 4X25A 2PRFA 2Y2HA 3UE0A 3ZG9B 2OLVA 3CG5A 4LV0A 4PPRA 3NY4A 3GTCA 3BFCA 2Y2MA 3UNWA 1I5QA 2J3TD 5M1AA 4PKYG 2QMIA 4LRZE 5HDCA 3W4PA 4BBUA 4PM7A 5KIZA 3HLGA 1NLYA 1XPBA 4S02A 3P98A 5MC7A 5FATA 4NXFA 4S03A 4M4XA 1ES5A 2PU4A 1FSYA 4RX2A 5L07A 5HSQA 3A3DA 1ONGA 2HKZA 4CLCD 4GHIB 3ZYTA 3LUQA 1K4EA 1I2SA 2ZL1A 5M18A 2W3EA 3C30A 2BLSA 4O0PA 1PZOA 5EVEA 4S2LA 5CHMA 3KYQA 1ESUA 2XH9A 1QMEA 2W3DA 4FOFA 3JVVA 2CMNA 1LT0A 5DTKA 4O01A 2EX8A 3IBJA 4WUJA 3VSLA 4FUWA 3JYIA 2Y91A 4PM5A 4JXVA 1HZOA 4E3LA 5GHXA 1SKOB 3IF6B 1IEMA 1OT6A 4I39A 3SS3A 3S7NA 1O07A 3UDXA 4OQIA 4EUZA 1IOUA 3UB5P 2A24A 3UDFA 5IU1A 3W4QA 4RR8A 5TGFA 1H8MA 4Q0JA 3F1OA 4OLGA 2ZOHA 1CI8A 4R23A 4ARZB 1GA0A 2MJ6A 4OLDA 3L9KA 3CLOA 3HCYA 1W8YA 3C8CA 5FQQA 1DP8A 3T1XA 5BOHA 3T4TA 1RGYA 5CTMA 3D9YA 3QNBA 1P97A 5EOOA 4RRIA 2W1TB 1K54C 2B5RA 1YMXA 4FD8A 4P85A 4Y13A 3BFEA 5DFYA 1DP6A 1MWTA 4G3VA 3N8SA 1YLJA 1S66L 4XXRA 1TS6A 1UGUA 3NIAA 4P87A 4WL9A 2DNSA 5GLAA 3Q82A 1H8YA 3ISGA 5E2GA 5AQ9A 4YFMA 3T1RA 3IS2A 2JKRI 2FFFB 1EW0A 3OCNA 2B95A 2ZM8A 2V8CA 1LL9A 2QZ6A 3T4KA 3IH9A 3DTEA 1YT4A 1F98A 2K2NA 4UQIM 1PRQA 5E2HA 4HIAA 5AQBA 1CEGA 2XROA 1T19A 2QJ7A 3HUOA 5DTSA 4WZ5A 2H0YA 3ZNYA 4EEPA 4S2OA 4U0TA 3KO5A 1E3UD 3WS2A 3K3CA 3ULFA 2P08A 2J80A 4XT2B 1NLZA 1RCJA 4LCMA 3R7WB 2EX6A 4NXGA 1Y28A 4R3BA 2M7VA 4LRXC 2W27A 2PDRA 5DF9A 1EI5A 4X1LA 4MNRA 5L10A 4E3KA 3F1PA 2W3FA 4IHQA 3FPWA 2BTFP 5TJJA 5F69A 1VEUA 3FKWA 2JKTM 3PBOA 4OOYA 2EX2A 1MWUA 5CRFA 1IKGA 1DJAA 3DBAA 5FI2A 2R9XA 3G34A 4KENB 4S2KA 4AFIA 2PHYA 1ALQA 4BJPA 5LBRA 3HLBA 1XGIA 2XD5A 3SH7A 2Y2QA 2XD1A 3S7PA 5I94A 5AVFA 5G4ZA 1GA9A 1Q2PA 4ZJ3A 4ZTKA 3G2ZA 4LV3A 3JVUA 2QWSA 2HL0A 1YPRA 2G2UA 3CZDA 1KDSA 1N9BA 4EEUA 3HJIA 4HH3A 3A3IA 1NXYA 3IF5A 3UO9A 3IBRA 4O8GA 3S1YA 3NI9A 2HJEA 3V5MA 4RR9A 4X55A 1GSVA 3FWLA 4MBKA 4ID4A 3T4OA 3KSGA 4ZJ1A 2W3HA 5DF8A 3UE6A 3A0SA 1YLPA 3EGXC 3G4PA 4MCWA 1ESIA 4EBPA 4GW9A 2WUQA 3CMZA 2JHEA 3LR0A 1I2WA 1IELA 3UMEA 4Y0UA 1KGGA 4JPMA 3SS5A 1ACFA 3ZQ5A 1F9IA 4ZBEA 2HL2A 3OOVA 4OQ0A 1K6SA 5J7EA 3PAGA 5CXWA 1MXOA 1JKEA 4M3KA 5U47A 3V39A 3OC2A 1SKOA 2Y2GA 2V9AA 2HP5A 1W63M 3IF6A 4Y5FA 4QWOA 5A91A 4HBTA 3U2AA 2IWBA 4NK3A 2H0TA 1YSPA 3OLOA 4WMCA 3WRZA 2EWVA 4ARZA 4BD0A 2JN7A 4LV1A 3G31A 3LIBA 1EWZA 4QPRA 5HW3A 3KOBA 1T1AA 2EFUA 3ZFZA 4EXOA 1IYQA 2B02A 2EWWA 2R78A 4KUKA 2J9OA 4LENA 1K38A 2ZM2A 2W1TA 5G4YA 3P7NA 1T1CA 4NBIA 1OTDA 4S0KA 5HAQA 3BYDA 3O87A 5DKLA 3C5AA 1WYBA 4RR7A 2HP9A 4FCFA 1XJ6A 1YAXA 1S1YA 5FQ9A 1KVLA 1IFQA 2GNXA 3MQOA 3BLMA 3L7HA 1G68A 3ICYA 3RTYA 3KNFA 1Z6FA 1MZUA 3V3RA 4IBRA 3LIAA 3TRCA 4MN7A 3LEQA 3Q1FA 3SS4A 4RRAA 1GHPA 4X6TA 2JKTI 3ZVTA 5DFXA 1IYOA 1PI5A 4Y2FA 3BFDA 4MBHA 3B42A 3MFDA 4OPQA 3HBRA 4P0MA 3PD2A 1G28A 3LR3A 4G3KA 5HX9A 1S0WA 3T50A 2JE5A 3CPTA 4GN2A 5F83A 4YINA 2R9WA 4S0JA 3Q7ZA 2P04A 1YLZA 3IX8A 3ZHHA 3R7WA 3K3DA 5D3OA 3UB6A 3SH9A 3GRJA 1PW1A 1BSGA 2JCHA 2EA9A 1S4SA 3BWLA 1L0DA 2ZMVA 4KZBA 1VETB 1CK3A 2W1RA 1MKIA 2XEPA 2XA7S 4BL2A 3PBRA 3BEBA 3IX4A 4RRJA 2JBFA 4FH2A 4KG5A 5FAOA 4OP5A 1JNUA 3B33A 4XUZA 2PBYA 4II7A 3KX0X 4MLLA 3LI8A 5M19A 3WWXA 2HL1A 3EWKA 2PAVP 2VGJA 5FI6A 4RYEA 4LV2A 1Y2QA 3QP1A 1PFLA 4WN5A 5IS1A 3VE4A 4HBUA 4OPRA 2VK3A 4Q8IA 5EE8A 2OWHA 3PR6A 3MQ0A 1Y54A 1ZHHB 2V8FA 3LIEA 4PMAA 3HLDA 4PM8A 2XF3A 3LYXA 4Y7PA 1K4FA 5TR7A 2WZZA 4JLFA 4B4XA 3FV7A 3IHAA 2ZQAA 2WGIA 3W4OA 5AQ7A 3DTMA 4S2NA 3ZG7B 1SHVA 5F68A 2Y55A 2HP6A 1N9LA 4KZ6A 5A90A 3HLCA 3TSGA 4OPYA 3HVFA 2J3WA 2XRNA 1LLBA 4KG2A 4RRHA 2HZ5A 2V1AA 1VHMA 3KO3A 4KZ9A 2XFSA 4NEED 2NUPC 2GDNA 3KYEA 1HVBA 5FQIA 2NUTC 3D4FA 2VA0A 3E4PA 3ITBA 5GLDA 4O7DA 5HZHA 1PYYA 4CLCB 3M2KA 3LMVA 4HJ6A 1K55C 3MKFA 5CGSA 5DTTA 5EM1A 2OSUA 5F82A 3W8KA 5TFQA 4OOLA 3VOLA 3MZDA 3LY3A 4JGRA 3LMTA 2QPNA 1T1BA 3AGFA 1YLWA 5HDDA 4WLAA 2ZQCA 1DY6A 4KZ3A 2O9CA 1MPLA 3NULA 5CHJA 1CQAA 3MKEA 2X02A 4MBFA 3MXQA 4BMWA 2ZC3B 1HLUP 1L2SA 4RVAA 2A3UA 4L0LA 4KZ5A 4EBLA 2ZD8A 5JYOA 3A0VA 2P9VB 1BZAA 4DDYA 1FCOA 3HL9A 4R1GA 3Q07A 4R4SA 3PBTA 3SOIA 4D2OA 1OTEA 4DKIA 5TBMB 3HUMA 1BT5A 5EVLA 4BQMA 3H82A 4JGPA 3RXXA 3E4QA 3Q7VB 1IYPA 1WA9A 1OPXA 4MDZA 4H6JB 3WS0A 2PBDP 2Q9MA 4QB8A 1GHMA 2K31A 3NOPC 4LRYC 2L0WA 2Y8HA 5FL3A 3NBLA 3A3FA 2XGNA 2WGVA 3S4XA 2I72A 5A92A 1BUEA 3SH8A 3DWZA 3VP4A 4ESPA 5J4EA 3FC7A 1LHYA 4RRQA 5JYPA 3LCEA 1N9NA 3C38A 2RL3A 5L09A 5EFWA 2Y2NA 4NXBA 3PD5A 4X1MA 3UY6A 2ZM0A 4X56A 3ZDJA 1VETA 4HESA 4MMNA 4ZDXA 3S22A 3N7WA 5GHYA 4JF5A 5EVIA 1XA1A 1SDEA 4EW7A 3P09A 3KSHA 4I38A 1PWDA 3VOZA 1S1ZA 3E98A 2OAQ1 4GNUA 3MQQA 3C4PA 3TOIA 4E3JA 1RGZA 3PXPA 2ZJ9A 4Y15A 2OLUA 4HEFA 4YOFA 1NRFA 2WAEA 3MFXA 1XA7A 3DW0A 3KO4A 3MXSA 5HAIA 2K7SA 5HL6A 1FILA 2GJ3A 2HV1A 3HLEA 1LSWA 1J3WA 4B88A 3BY9A 4NBJA 3O86A 1FR6A 2VGLS 3T1QB 1FCNA 2HF6A 4ZRRA 4QJGA 1K57A 5KMWA 2OKVA 4GZBA 3DTKA 4GLQA 2ZC6B 3F1NB 1XP4A 1K0KA 3UPNA 4BBTA 4A5RA 3TG9A 3GDIA 4ETXA 4HNBA 3D3OA 1FOFA 2GX5A 3MF0A 2OWJA 4R4RA 3U4LP 1C3BA 3O3VA 4WZ5C 1VM1A 3BW6A 3GR2A 1G5UA 4RRFA 4RR6A 2ZBBA 5HL1A 4JXSA 4PM9A 1ZG6A 2J8YA 3IHBA 4C3QA 3IQAA 4OOMA 2P7JA 4Q0IA 3WRTA 1NZOA 1DJBA 2WAFA 4KZAA 5HD5A 4CLCE 5FASA 1P9RA 4DMZA 2HGVA 5E2FA 3H7WB 2KDKA 3FG8A 4GHIA 3QP6A 2VZWA 2Q9NA 3VMAA 4JBFA 4E04A 3CUEA 3OPRA 2UWXA 4X68A 4CLCA 2B18A 4BWIA 4F94A 5C5KA 3LIFA 1SZVA 5E2EA 5FAQA 1XXMA 1L0FA 3PBNA 4OQHA 1WE4A 4GS9B 4CJNA 2Y2OA 2QJ5A 4Y0TA 4JF6A 4JF4A 4E6WA 5FSRA 3BLSA 1L3LA 1YM1A 1K56D 1E4DA 4DE1A 4GDBA 2XQZA 5FEFA 1JWPA 2PR5A 2Y59A 2A2LA 1WYCA 3AGDA 4XUXA 4GB7A 5DJUA 4JGOA 3B3XA 2XSSA 2OV5A 3IH8A 4CQHA 3OCLA 1KDWA 2RCXA 3ZG8B 2O99A 1HTZA 4FSFA 5TBMA 1DP9A 2EFXA 2HDSA 2O9AA 1L0GA 3E4OA 1XJ3A 2G7UA 5F1GA 3RJUA 2JC7A 2L4RA 1KE4A 4LFUA 3Q7VA 4HOIA 4U3TA 3LGOA 3HLWA 3BQAA 3GSGA 5HFOA 2KX6A 2ZQ9A 3EQUA 4H6JA 4WEJA 5F1FA 4GDNA 3IWQA 3N8LA 2XR0A 4R38A 1N9OA 2BASA 2WKHA 2JKFA 5J61A 4JXWA 3OPPA 5EPHA 2Y79A 4E3NA 4DDSA 3T4LA 4FTXA 2ZLYA 1KGEA 1GCEA 4P6ZS 3M6BA 1GSXA 5L8MA 5FI7A 4E6XA 3IWIA 3IX3A 5CHUA 2W0NA 3B47A 3IF6C 3EEHA 2OAP1 3GVBA 3VP3A 3VFFA 1A0KA 2VV6A 4E3IA 2IWCA 2L1MA 2GZAA 4IVKA 2HDRA 3MZEA 5FQKA 2V0WA 3PBSA 1E25A 4XT2A 3I7JA 2J9PA 3FYZA 4K0WA 2AVXA 1ZTUA 2HJ9C 2Y2IA 3JPUA 1E3UA 3BJNA 2WGWB 2G2WA 4BENA 1KOUA 1PW8A 1VQQA 5FDSA 2VLGA 2EXBA 1BLCA 1NY0A 4LLOB 1QMFA 2Y4AA 4Z1WA 1MWRA 4KG6A 5AJGA 3ZGAB 4DJ2A 5DVAA 3TJZC 2UV0E 1YSQA 4UHUA 3CAXA 2KOIA 4FH4A 4NETA 3ZCZA 1FQGA 4RRGA 4MN6A 1NYYA 2Z2MB 2XDMA 1PIOA 2PD8A 4HJ4A 4IUHA 4QU3A 2VV7A 1EROA 4R3JA 5DKKA 4WF0A 3VP2A 4F3LB 3F1NA 3DWKA 3WS1A 1ERQA 5KSHA 1MWSA 3A3EA 1BLHA 3PD3A 3EOIA 3VE3A 1P0ZA 4DF6A 5I5LA 3BECA 2Z2LB 3IXBA 3BQ8A 4ETZA 4OP8A 5CECA 4HP4A 4Q0HA 2X71A 5CEDA 4ME4A 2Y2KA 3LFVA 3VFHA 5EOEA 4KUOA 4C75A 4UEYA 4E3OA 1FSWA 3OPHA 4EQ1A 3PHYA 3BM6A 5GHZA 4JKTA 4BBVA 2WK0A 4WM9A 3H7WA 2ZMFA 2QHKA 1JTGA 1V9ZA 1G6OA 4NKPA 1NRJA 3CHWP 5CGWA 3M2JA 1TF1A 5J8XA 1TDLA 1F2KA 3NECA 2LB5A 5AVEA 1UWPX 1PNEA 5L2FA 2X01A 5GLCA 4HY8A 3BRMA 2Y2LA 2PU2A 2VJWA 3A0RA 4EESA 3D72A 4MN5A 3UPOA 2E8JA 1OTIA 4B9OA 3QHYA 4GS9A 4RRKA 5J3WA 5F6AA 1AXBA 5DJTA 5EUAA 3GQZA 4QY6A 4PHTA 2XK1A 4R3AA 2WADA 3QP4A 5E43A 1S6RA 1J9MA 1ZKJA 1H8ZA 1PWGA 1YKDA 5HDSA 1K56A 1FCMA 3IWOA 3IXDA 1KE0A 1MBLA 3KO6A 3NDEA 1OTBA 2HPBA 4OONA 1X0OA 3MZFA 4RX3A 3NC8A 2Y2JA 1K54A 3DTIA 4K91A 2J7VA 5GLBA 2DRWA 1U60A 4WYYA 1HD8A 2VEAA 5HD3A 4I3IA 1XJ4A 3FKVA 3T4QA 4S2NC 4EU0A 3N4IA 1JWZA 3A3JA 3ZG5A 4RRRA 2I9VA 3NOTC 3O88A 3MBZA 1DRMA 4I3AA 4B93A 4YWZA 4L9GA 5CEBA 3LR5A 5AQAA 3T12B 4NG2A 4L9FA 4WMCD 3NCKA 3RXWA 4BD1A 4H8RA 1ES2A 3AGEA 3DAVA 4Y0OA 4EETB 3UN7A 1IYSA 3UE3A 5KSCA 4GD8A 3S7OA 3CITA 4R70A 3LMUA 2YKHA 2H10A 3HJKA 3ZVWA 3CJMA 2PYPA 4KQRA 5IT5A 1MY8A 5GL9A 1UWNX 2PR6A 1TS7A 4IUKA 1H5XA 4KZ7A 5K5BA 3MJQA 2P74A 3MR0A 2BG1A 2ZMAA 4S2IA 4B4ZA 4QY5A 5EV0A 5FEGA 1YLYA 3E2LA 3BY8A 4ZJ2A 2XFTA 3QP5A 4P6BA 4S0IA 1XGJA 4QHCA 2WYXA 5CTNA 1W5DA 4G3WA 3G32A 3LICA 5HWWA 1DJCA 4PKYA 4R0QA 3VP0A 3KODA 2WGWA 3RH8B 1JTDA 1TS8A 3GV9A 1TS0A 2FFYA 1PWCA 1LL8A 1W8QA 1SDNA 2OOLA 5DF7A 5FA7A 1VB6A 3UB7A 1ERMA 1MKMA 1D7EA 5CERA 1M40A 4LCLA 1W63Q 1RP5A 1J7GA 1D06A 2PT7A 1OTAA 1D1JA 1XJ2A 4DN0A 2C6WB 3NHQA 4DXCA 3KYZA 4Z9QA 5A8BA 1TDGA 4F3LA 3C2WA 1LI9A 3UB8A 4DRTA 2EX9A 4RRLA 2V0UA 1TC5A 5HWTA 1NYMA 2VGLM 3M6HA 1NJ4A 2ZC5B 4HH2A 4UQIS 2D02A 4BLMA 3CPTB 1MC0A 2V1ZA 4RA7A 4N9KA 1ES4A 3S7QA 3GMWA 1W79A 5FAPA 1N4OA 1H3QA 4GJ4A 4X69A 4R6LA 3KSFA 1V9YA 2Z6CA 3RFBA 3LIDA 4N9LA 2WKEA 4C6YA 4HHDA 3FPVA 2O9BA 5HARA 3KO9A 1JWVA 3UE1A 3C4OA 2H28A 4JGQA 2PYRA 3IT9A 4DE3A 4N1HA 2YKFA 4LPZA 1H0MA 3ZG0A 4IJGA 3N8RA 2C5WB 1CEFA 3MMHA 2O0YA 4MEZA 5FDHA 4Y17A 2WKQA 1TVFA 2WKPA 5EVIC 2IWDA 1JVJA 3ITAA 3VP1A 2FH5A 4CPKA 1SKFA 3P01A 4OVDA 2V20A 3C7VA 5CGXA 4K08A 4RQ9A 3V67A 2QYBA 2ACGA 3Q81A 4YNRA 1K6RA 3KSIA 3LR4A 4DJ3A 4GKUA 1XX2A 1BTLA 3BFGA 1CJFA 3LI9A 3LO7A 4PAUA 1PI4A 4N92A 1BLSA 4EWFA 1TD5A 4OQGA 5FQMA 2ZQ8A 3CWFA 1K57C 2CC1A 4HP9A 5EECA 3E2KA 4S2MA 3NOUC 2KLIA 4EUVA 2WKRA 1OMEA 1L0EA 3OPLA 1PZPA 2VX8A 3QP8A 1AWIA 2ZOIA 1LSVA 5IHVA 4S2JA 1S67L 2EXAA 3WS5A 3LEZA 4HI4A 4GOGA 3MS6A 2D01A 2DMWA 1ZG4A 4LGWA 5KZHA 4ZAMA 3KO7A 1LI0A 2LB9A 4RRDA 2J3TC 2Q0OA 1FIKA 4KQQA 4DE0A 2P9VA 1KVMA 3VV4A 2ZC4B 4UAAA 4E3MA 1XKZA 4UA7A 3WS4A 1K25A 2ZL1B 3IXGA 3HREA 3R4KA 5A93A 1NWZA 1YMSA 3CUEC 4IBXA 2M7UA 1GSWA 4Y3IA 2XLNA 3BFFA 3MSHA 2WKIA 4CLCC 3UMDA 3V3SA 1XFQA 1KGFA 2DBOA 4P6ZM 2HDQA 2VKSA 3OBFA 4L9EA 3UB9A 4EQIA 3PBQA 3T4JA 2ZC7A 1IKIA 2Y2PA 2A49A 1O7EA 3KOCA 1BULA 4KZ4A 1T18A 4RRMA 2H5SA 4HJ3A 3HLFA 1P9WA 2DCFA 3CI6A 4JXGA 1NZUA 1M6KA 1YLTA 4I5SA 2A24B 2PD7A 4K0XA 3IXHA 4NXEA 4D60A 3SW1A 3T4SA 4S0LA 4WEKA 3F1OB 4KQOA 2QKPA 3ZNTA 4PM6A 4IEDA 1F5MA 2INWA 4GCZA 3O5YA 4WZ4A 5EM0A 3FZCA 4KQDA 3PD4A 1OJ5A 5CX7A 3N6IA 4S2PA 3G2YA 3H82B 4OH0A 2ZQDA
chains in the Genus database with same CATH topology
5A92A 2HL0A 4EV4A 1BUEA 2G2UA 2PU2A 3CZDA 3SH8A 4IVIA 1KDSA 1N9BA 3VSKA 3UPOA 3DWZA 3VP4A 3A3IA 4X53A 1NXYA 3QHYA 1LHYA 4RRKA 3IF5A 3UO9A 4RRQA 3S1YA 1AXBA 1KE3A 3LCEA 3NI9A 5EUAA 3V5MA 5JYPA 4RR9A 4X55A 2RL3A 3FWLA 2WZXA 4MBKA 3GQZA 4WELA 4ID4A 2Y2NA 3PD5A 4QY6A 3VOYA 3UY6A 1GHIA 2ZM0A 1ES3A 1YQSA 1ONHA 1ZC2A 2WADA 2XK1A 4HESA 4X56A 5DF8A 5E43A 3ZDJA 1YLPA 3G4PA 4EBNA 4ZDXA 1ESIA 3S22A 4EBPA 2HDUA 1S6RA 1J9MA 1ZKJA 2WUQA 1H8ZA 3CMZA 3N7WA 1PWGA 1K56A 5GHYA 1I2WA 1IELA 2VGKA 4JF5A 1FCMA 5EVIA 4QD4A 1XA1A 3EQVA 3IXDA 3IWOA 4GD6A 1SDEA 1G6AA 3P09A 4BL3A 1KE0A 5FQJA 1MBLA 1PWDA 3VOZA 4RRCA 3HUNA 3UDIA 4Y0UA 4GNUA 3NDGA 3NDEA 1KGGA 1BLPA 4JPMA 3C4PA 4U0XA 2HPBA 4OONA 3SS5A 4ZBEA 4RX3A 3MZFA 2HL2A 3NC8A 4OQ0A 1K6SA 2Y2JA 1K54A 3PAGA 1RGZA 5CXWA 1MXOA 3TOIA 3UPPA 2ZJ9A 1Q2QA 4K91A 1JKEA 4M3KA 5U47A 3V39A 2J7VA 3OC2A 5EVID 2OLUA 4HEFA 5GLBA 2DRWA 2Y2GA 1NRFA 2HP5A 4DXBA 3IF6A 2WAEA 1LL5A 1U60A 1W7FA 1XA7A 3DW0A 3PTEA 3KO4A 4WYYA 1HD8A 3MXRA 4HBTA 3MXSA 4UA9A 5A91A 5HAIA 3FKVA 4OPZA 2IWBA 4S2NC 4NK3A 2H0TA 5EVIB 4WMCA 3N4IA 1JWZA 3A3JA 3V50A 3ZG5A 4RRRA 3HLEA 3WRZA 5G18A 3OZHA 3O88A 4WBGA 3MBZA 4B88A 1FR1A 1SCWA 4RRBA 4BD0A 4NBJA 4LV1A 3G31A 5CEBA 3C7UA 1TEMA 3O86A 1EWZA 5HW3A 1FR6A 5AQAA 3KOBA 1FCNA 4N1XA 2EFUA 4KZ8A 3ZFZA 1IYQA 4WMCD 4QJGA 3NCKA 3RXWA 4BD1A 1K57A 4H8RA 2J9OA 1ES2A 3AGEA 4LENA 4Y0OA 5KMWA 3G35A 2OKVA 3LY4A 4GZBA 3KNPA 1K38A 2ZM2A 3UN7A 2ZC6B 1IYSA 2V2FF 3UE3A 3QNCA 1XP4A 5KSCA 3UPNA 4GD8A 4A5RA 3TG9A 3LMUA 2H10A 4NBIA 2E8IA 2ZQ7A 1FOFA 3ZVWA 4S0KA 3CJMA 5HAQA 3BYDA 3O87A 4R4RA 4KQRA 1C3BA 3O3VA 4OKPA 1CI9A 1MY8A 3C5AA 4WZ5C 5GL9A 1VM1A 1WYBA 4RR7A 2HP9A 4FCFA 3PAEA 3GR2A 3G30A 4RRFA 4RR6A 5FQ9A 1KVLA 4UA6A 5HL1A 4JXSA 1K55A 3BLMA 1G68A 4PM9A 1ZG6A 2J8YA 1H5XA 3IHBA 4KZ7A 4ZJ1A 3KNFA 4C3QA 1Z6FA 2Y2HA 2P74A 3IQAA 4OOMA 2BG1A 2ZMAA 3UE0A 3V3RA 4S2IA 4IBRA 4QY5A 4B4ZA 3WRTA 1NZOA 1YLYA 3E2LA 2OLVA 3ZG9B 1DJBA 3CG5A 2WAFA 3Q1FA 4KZAA 4LV0A 4PPRA 4ZJ2A 2XFTA 3SS4A 4P6BA 5FASA 3NY4A 3GTCA 4RRAA 4S0IA 1XGJA 3BFCA 1GHPA 2Y2MA 1I5QA 4X6TA 5E2FA 3UNWA 4QHCA 5M1AA 2QMIA 2WYXA 5CTNA 1W5DA 3W4PA 3G32A 3ZVTA 4PM7A 3HLGA 1IYOA 1PI5A 1XPBA 1DJCA 4R0QA 2Q9NA 3VMAA 3VP0A 3BFDA 4JBFA 4MBHA 3KODA 4S02A 2WGWA 3MFDA 3P98A 1JTDA 3HBRA 4OPQA 4P0MA 3GV9A 2UWXA 3OPRA 3PD2A 4X68A 2FFYA 5FATA 1PWCA 1W8QA 5HX9A 1SDNA 5DF7A 4S03A 5FA7A 1S0WA 2JE5A 4F94A 1ES5A 1ERMA 2PU4A 1FSYA 4RX2A 5E2EA 5CERA 1M40A 4LCLA 5FAQA 1RP5A 3A3DA 4GN2A 1XXMA 5F83A 4YINA 1L0FA 1J7GA 2R9WA 4S0JA 3PBNA 4OQHA 3Q7ZA 1WE4A 1YLZA 4CJNA 3ZHHA 2C6WB 2Y2OA 1ONGA 5D3OA 4Y0TA 2HKZA 4JF6A 4DXCA 3SH9A 3GRJA 1PW1A 1BSGA 4JF4A 2JCHA 4Z9QA 4E6WA 5FSRA 3BLSA 1YM1A 1L0DA 1K4EA 1K56D 4KZBA 1E4DA 4DE1A 4GDBA 1TDGA 1I2SA 2XQZA 1LI9A 1JWPA 4DRTA 2EX9A 5M18A 4RRLA 2Y59A 2BLSA 1PZOA 1CK3A 1TC5A 4S2LA 1WYCA 5CHMA 1NYMA 1MKIA 2XEPA 3AGDA 3M6HA 4XUXA 1NJ4A 1ESUA 2ZC5B 4GB7A 2XH9A 4BL2A 3PBRA 3BEBA 1QMEA 4RRJA 4BLMA 2JBFA 2V1ZA 4RA7A 4N9KA 3B3XA 2OV5A 4FH2A 1ES4A 4KG5A 3GMWA 3IH8A 1W79A 5FAOA 5DTKA 4OP5A 5FAPA 2EX8A 3OCLA 1KDWA 1N4OA 2RCXA 4X69A 3VSLA 4XUZA 3ZG8B 3JYIA 2Y91A 4PM5A 4JXVA 2PBYA 4MLLA 1HZOA 4N9LA 1HTZA 4FSFA 2HDSA 2EFXA 2WKEA 1L0GA 4C6YA 4E3LA 5M19A 3WWXA 2HL1A 5GHXA 5HARA 2VGJA 3KO9A 5FI6A 3IF6B 1JWVA 1IEMA 3UE1A 5F1GA 3RJUA 3C4OA 4RYEA 2JC7A 4LV2A 1KE4A 3SS3A 1Y2QA 1O07A 3UDXA 3IT9A 4DE3A 4OQIA 3Q7VA 4EUZA 4N1HA 4U3TA 3ZG0A 3HLWA 3GSGA 5HFOA 3UDFA 2ZQ9A 3W4QA 3N8RA 2C5WB 5TGFA 4RR8A 3EQUA 4WEJA 1CEFA 4OLGA 5F1FA 1CI8A 4GDNA 4HBUA 4MEZA 4OPRA 3IWQA 3N8LA 2XR0A 4R23A 5FDHA 1GA0A 4OLDA 4Q8IA 5EE8A 2WKHA 1TVFA 5EVIC 5J61A 1Y54A 2IWDA 4JXWA 1JVJA 1W8YA 3OPPA 5EPHA 3ITAA 3VP1A 5FQQA 4E3NA 4DDSA 4CPKA 1SKFA 5BOHA 2ZLYA 1KGEA 4OVDA 2V20A 4PMAA 1RGYA 3C7VA 5CTMA 1GCEA 3HLDA 4PM8A 3QNBA 5CGXA 5EOOA 4RRIA 1K54C 2XF3A 2B5RA 3M6BA 1YMXA 4Y7PA 1K4FA 5TR7A 4FD8A 5FI7A 4E6XA 4P85A 2WZZA 3IWIA 4JLFA 5CHUA 4DE2A 4B4XA 3BFEA 3Q81A 3FV7A 3IF6C 1K6RA 1MWTA 3GVBA 3VP3A 3IHAA 2ZQAA 2WGIA 3N8SA 3W4OA 5AQ7A 1YLJA 3VFFA 4XXRA 3DTMA 4S2NA 4GKUA 1XX2A 3ZG7B 1BTLA 3BFGA 3LO7A 1SHVA 4E3IA 2IWCA 2Y55A 3NIAA 4P87A 2HP6A 1PI4A 2DNSA 5GLAA 4KZ6A 5A90A 3Q82A 1H8YA 4N92A 3ISGA 5E2GA 3HLCA 5AQ9A 3TSGA 4YFMA 1BLSA 4OPYA 4IVKA 4EWFA 4OQGA 5FQMA 3HVFA 2ZQ8A 2FFFB 2HDRA 3MZEA 5FQKA 3PBSA 1E25A 1K57C 2CC1A 5EECA 1LLBA 3OCNA 4KG2A 3E2KA 2ZM8A 4S2MA 4RRHA 1LL9A 2QZ6A 1OMEA 3KO3A 1L0EA 3OPLA 1PZPA 2XFSA 3I7JA 4KZ9A 3IH9A 2J9PA 3FYZA 1YT4A 4K0WA 2Y2IA 2GDNA 5IHVA 4S2JA 1HVBA 1E3UA 2EXAA 5FQIA 3D4FA 3WS5A 5E2HA 5AQBA 1CEGA 2WGWB 2G2WA 4BENA 3HUOA 1PW8A 3LEZA 1VQQA 3ITBA 5GLDA 4GOGA 5DTSA 4O7DA 4WZ5A 2EXBA 1BLCA 1NY0A 1PYYA 2H0YA 5HAPA 1ZG4A 3M2KA 5KZHA 1QMFA 3LMVA 3ZNYA 4ZAMA 2Y4AA 3KO7A 1LI0A 1MWRA 4RRDA 4KG6A 1K55C 3ZGAB 3MKFA 4S2OA 5CGSA 4U0TA 5DVAA 5DTTA 3KO5A 4UHUA 1E3UD 3WS2A 4KQQA 4FH4A 3ZCZA 2OSUA 4NETA 1FQGA 5F82A 4RRGA 4DE0A 1NYYA 1RCJA 2P9VA 2Z2MB 3W8KA 5TFQA 2XDMA 4LCMA 1KVMA 1PIOA 2EX6A 4OOLA 4QU3A 3MZDA 3LY3A 2ZC4B 4UAAA 1EROA 4R3BA 3LMTA 4E3MA 2QPNA 4R3JA 3AGFA 1YLWA 1XKZA 3VP2A 4UA7A 3WS4A 2ZQCA 3DWKA 5DF9A 1DY6A 1K25A 4KZ3A 3WS1A 3IXGA 1EI5A 1MPLA 4MNRA 1ERQA 3HREA 5KSHA 5CHJA 3MKEA 5A93A 1MWSA 3A3EA 1BLHA 3PD3A 2X02A 4E3KA 4MBFA 1YMSA 2ZC3B 4IBXA 1L2SA 4RVAA 2XLNA 2A3UA 3BFFA 4L0LA 4KZ5A 4DF6A 2WKIA 4EBLA 2ZD8A 3BECA 2Z2LB 3IXBA 3V3SA 5JYOA 3FKWA 1KGFA 2P9VB 2DBOA 4OP8A 1BZAA 5CECA 2HDQA 1FCOA 4DDYA 2X71A 3HL9A 4EQIA 5CEDA 4R1GA 3Q07A 4R4SA 3PBOA 3PBTA 4OOYA 3PBQA 2EX2A 2ZC7A 3SOIA 4D2OA 1IKIA 2Y2KA 4DKIA 4E3JA 3VFHA 2Y2PA 1MWUA 2A49A 3HUMA 5EOEA 1BT5A 1O7EA 4C75A 3KOCA 5CRFA 5EVLA 1IKGA 1BULA 4KZ4A 4E3OA 1DJAA 1FSWA 4RRMA 2H5SA 5FI2A 3OPHA 4BQMA 3HLFA 2R9XA 3BM6A 3G34A 2DCFA 5GHZA 4JKTA 4KENB 4S2KA 3RXXA 4JXGA 1NZUA 3Q7VB 1ALQA 1IYPA 1M6KA 2WK0A 4BJPA 1YLTA 4WM9A 4K0XA 3IXHA 1JTGA 4S0LA 4WEKA 3HLBA 3WS0A 2Q9MA 1XGIA 4KQOA 2XD5A 3SH7A 2Y2QA 2XD1A 5CGWA 4QB8A 5I94A 1GHMA 3M2JA 3ZNTA 4PM6A 1GA9A 1Q2PA 3NBLA 4IEDA 3A3FA 4ZJ3A 5J8XA 2XGNA 1TDLA 4ZTKA 3G2ZA 4LV3A 4WZ4A 2WGVA 5L2FA 3FZCA 3S4XA 2X01A 3PD4A 5GLCA 3N6IA 3BRMA 4S2PA 3G2YA 2I72A 2Y2LA 4OH0A 2ZQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A92 A;  4EV4 A;  1BUE A;  2G2U A;  2PU2 A;  3CZD A;  3SH8 A;  4IVI A;  1KDS A;  1N9B A;  3VSK A;  3UPO A;  3DWZ A;  3VP4 A;  3A3I A;  4X53 A;  1NXY A;  3QHY A;  1LHY A;  3IF5 A;  3UO9 A;  3S1Y A;  1AXB A;  1KE3 A;  3LCE A;  3NI9 A;  5EUA A;  3V5M A;  5JYP A;  4X55 A;  2RL3 A;  3FWL A;  2WZX A;  4MBK A;  3GQZ A;  4WEL A;  4ID4 A;  2Y2N A;  4QY6 A;  3VOY A;  3UY6 A;  1GHI A;  2ZM0 A;  1ES3 A;  1YQS A;  1ONH A;  1ZC2 A;  2WAD A;  2XK1 A;  4HES A;  4X56 A;  5DF8 A;  5E43 A;  3ZDJ A;  1YLP A;  3G4P A;  4EBN A;  4ZDX A;  1ESI A;  3S22 A;  4EBP A;  2HDU A;  1S6R A;  1J9M A;  1ZKJ A;  2WUQ A;  1H8Z A;  3CMZ A;  3N7W A;  1PWG A;  1K56 A;  5GHY A;  1I2W A;  1IEL A;  2VGK A;  4JF5 A;  1FCM A;  5EVI A;  4QD4 A;  1XA1 A;  3EQV A;  3IXD A;  3IWO A;  4GD6 A;  1SDE A;  1G6A A;  3P09 A;  4BL3 A;  1KE0 A;  5FQJ A;  1MBL A;  1PWD A;  3VOZ A;  3HUN A;  3UDI A;  4Y0U A;  4GNU A;  3NDG A;  3NDE A;  1KGG A;  1BLP A;  4JPM A;  3C4P A;  4U0X A;  2HPB A;  4OON A;  3SS5 A;  4ZBE A;  4RX3 A;  3MZF A;  3NC8 A;  4OQ0 A;  1K6S A;  2Y2J A;  1K54 A;  3PAG A;  1RGZ A;  5CXW A;  1MXO A;  3TOI A;  3UPP A;  2ZJ9 A;  1Q2Q A;  4K91 A;  4M3K A;  5U47 A;  3V39 A;  2J7V A;  3OC2 A;  5EVI D;  2OLU A;  4HEF A;  5GLB A;  2DRW A;  2Y2G A;  1NRF A;  2HP5 A;  4DXB A;  3IF6 A;  2WAE A;  1LL5 A;  1U60 A;  1W7F A;  1XA7 A;  3DW0 A;  3PTE A;  4WYY A;  1HD8 A;  3MXR A;  4HBT A;  3MXS A;  4UA9 A;  5A91 A;  5HAI A;  3FKV A;  4OPZ A;  2IWB A;  4S2N C;  4NK3 A;  2H0T A;  5EVI B;  4WMC A;  3N4I A;  1JWZ A;  3A3J A;  3V50 A;  3ZG5 A;  3HLE A;  3WRZ A;  5G18 A;  3OZH A;  3O88 A;  4WBG A;  3MBZ A;  4B88 A;  1FR1 A;  1SCW A;  4BD0 A;  4LV1 A;  3G31 A;  5CEB A;  3C7U A;  1TEM A;  3O86 A;  1EWZ A;  5HW3 A;  1FR6 A;  5AQA A;  1FCN A;  4N1X A;  2EFU A;  4KZ8 A;  3ZFZ A;  1IYQ A;  4WMC D;  4QJG A;  3NCK A;  3RXW A;  4BD1 A;  1K57 A;  4H8R A;  2J9O A;  1ES2 A;  3AGE A;  4LEN A;  4Y0O A;  5KMW A;  3G35 A;  3LY4 A;  4GZB A;  1K38 A;  2ZM2 A;  3UN7 A;  2ZC6 B;  1IYS A;  2V2F F;  3UE3 A;  3QNC A;  1XP4 A;  5KSC A;  3UPN A;  4GD8 A;  4A5R A;  3TG9 A;  2H10 A;  2E8I A;  2ZQ7 A;  1FOF A;  3ZVW A;  3CJM A;  5HAQ A;  3BYD A;  3O87 A;  4R4R A;  4KQR A;  1C3B A;  3O3V A;  4OKP A;  1CI9 A;  1MY8 A;  3C5A A;  4WZ5 C;  5GL9 A;  1VM1 A;  1WYB A;  2HP9 A;  4FCF A;  3PAE A;  3GR2 A;  3G30 A;  5FQ9 A;  1KVL A;  4UA6 A;  5HL1 A;  4JXS A;  1K55 A;  3BLM A;  1G68 A;  4PM9 A;  1ZG6 A;  2J8Y A;  1H5X A;  3IHB A;  4KZ7 A;  4ZJ1 A;  4C3Q A;  1Z6F A;  2Y2H A;  2P74 A;  3IQA A;  4OOM A;  2BG1 A;  2ZMA A;  3UE0 A;  3V3R A;  4S2I A;  4IBR A;  4QY5 A;  4B4Z A;  3WRT A;  1NZO A;  1YLY A;  3E2L A;  2OLV A;  3ZG9 B;  1DJB A;  3CG5 A;  2WAF A;  3Q1F A;  4KZA A;  4LV0 A;  4PPR A;  4ZJ2 A;  2XFT A;  3SS4 A;  4P6B A;  5FAS A;  3NY4 A;  3GTC A;  1XGJ A;  3BFC A;  1GHP A;  2Y2M A;  1I5Q A;  4X6T A;  5E2F A;  3UNW A;  4QHC A;  5M1A A;  2QMI A;  2WYX A;  5CTN A;  1W5D A;  3W4P A;  3G32 A;  3ZVT A;  4PM7 A;  3HLG A;  1IYO A;  1PI5 A;  1XPB A;  1DJC A;  4R0Q A;  2Q9N A;  3VMA A;  3VP0 A;  3BFD A;  4JBF A;  4MBH A;  2WGW A;  3MFD A;  3P98 A;  1JTD A;  3HBR A;  4OPQ A;  4P0M A;  3GV9 A;  2UWX A;  3OPR A;  4X68 A;  2FFY A;  5FAT A;  1PWC A;  1W8Q A;  5HX9 A;  1SDN A;  5DF7 A;  5FA7 A;  1S0W A;  2JE5 A;  4F94 A;  1ES5 A;  1ERM A;  2PU4 A;  1FSY A;  4RX2 A;  5E2E A;  5CER A;  1M40 A;  4LCL A;  5FAQ A;  1RP5 A;  3A3D A;  4GN2 A;  1XXM A;  5F83 A;  4YIN A;  1L0F A;  2R9W A;  3PBN A;  4OQH A;  3Q7Z A;  1WE4 A;  1YLZ A;  4CJN A;  3ZHH A;  2C6W B;  2Y2O A;  1ONG A;  5D3O A;  4Y0T A;  4JF6 A;  4DXC A;  3SH9 A;  3GRJ A;  1PW1 A;  1BSG A;  4JF4 A;  2JCH A;  4Z9Q A;  4E6W A;  5FSR A;  3BLS A;  1YM1 A;  1L0D A;  1K4E A;  1K56 D;  4KZB A;  1E4D A;  4DE1 A;  4GDB A;  1TDG A;  1I2S A;  2XQZ A;  1LI9 A;  1JWP A;  4DRT A;  2EX9 A;  5M18 A;  2Y59 A;  2BLS A;  1PZO A;  1CK3 A;  4S2L A;  1WYC A;  5CHM A;  1NYM A;  1MKI A;  2XEP A;  3AGD A;  3M6H A;  4XUX A;  1NJ4 A;  1ESU A;  2ZC5 B;  4GB7 A;  2XH9 A;  4BL2 A;  3PBR A;  3BEB A;  1QME A;  4BLM A;  2JBF A;  2V1Z A;  4RA7 A;  4N9K A;  3B3X A;  2OV5 A;  4FH2 A;  1ES4 A;  4KG5 A;  3GMW A;  3IH8 A;  1W79 A;  5FAO A;  5DTK A;  4OP5 A;  5FAP A;  2EX8 A;  3OCL A;  1KDW A;  1N4O A;  2RCX A;  4X69 A;  3VSL A;  4XUZ A;  3ZG8 B;  3JYI A;  2Y91 A;  4PM5 A;  4JXV A;  2PBY A;  4MLL A;  1HZO A;  4N9L A;  1HTZ A;  4FSF A;  2HDS A;  2EFX A;  2WKE A;  1L0G A;  4C6Y A;  4E3L A;  5M19 A;  3WWX A;  5GHX A;  5HAR A;  2VGJ A;  5FI6 A;  3IF6 B;  1JWV A;  1IEM A;  3UE1 A;  5F1G A;  3RJU A;  3C4O A;  4RYE A;  2JC7 A;  4LV2 A;  1KE4 A;  3SS3 A;  1O07 A;  3UDX A;  3IT9 A;  4DE3 A;  4OQI A;  3Q7V A;  4EUZ A;  4N1H A;  4U3T A;  3ZG0 A;  3HLW A;  3GSG A;  5HFO A;  3UDF A;  2ZQ9 A;  3W4Q A;  3N8R A;  2C5W B;  5TGF A;  3EQU A;  4WEJ A;  1CEF A;  4OLG A;  5F1F A;  1CI8 A;  4GDN A;  4HBU A;  4MEZ A;  4OPR A;  3IWQ A;  3N8L A;  2XR0 A;  4R23 A;  5FDH A;  1GA0 A;  4OLD A;  4Q8I A;  5EE8 A;  2WKH A;  1TVF A;  5EVI C;  1Y54 A;  2IWD A;  4JXW A;  1JVJ A;  1W8Y A;  3OPP A;  5EPH A;  3ITA A;  3VP1 A;  5FQQ A;  4E3N A;  4DDS A;  4CPK A;  1SKF A;  5BOH A;  2ZLY A;  1KGE A;  4OVD A;  2V20 A;  4PMA A;  1RGY A;  3C7V A;  5CTM A;  1GCE A;  3HLD A;  4PM8 A;  3QNB A;  5CGX A;  5EOO A;  1K54 C;  2XF3 A;  2B5R A;  3M6B A;  1YMX A;  4Y7P A;  1K4F A;  5TR7 A;  4FD8 A;  5FI7 A;  4E6X A;  4P85 A;  2WZZ A;  3IWI A;  4JLF A;  5CHU A;  4DE2 A;  4B4X A;  3BFE A;  3Q81 A;  3FV7 A;  3IF6 C;  1K6R A;  1MWT A;  3GVB A;  3VP3 A;  3IHA A;  2ZQA A;  2WGI A;  3N8S A;  3W4O A;  5AQ7 A;  1YLJ A;  3VFF A;  4XXR A;  3DTM A;  4S2N A;  4GKU A;  1XX2 A;  3ZG7 B;  1BTL A;  3BFG A;  3LO7 A;  1SHV A;  4E3I A;  2IWC A;  2Y55 A;  3NIA A;  4P87 A;  2HP6 A;  1PI4 A;  2DNS A;  5GLA A;  4KZ6 A;  5A90 A;  3Q82 A;  1H8Y A;  4N92 A;  3ISG A;  5E2G A;  3HLC A;  5AQ9 A;  3TSG A;  4YFM A;  1BLS A;  4OPY A;  4IVK A;  4EWF A;  4OQG A;  5FQM A;  3HVF A;  2ZQ8 A;  2FFF B;  2HDR A;  3MZE A;  5FQK A;  3PBS A;  1E25 A;  1K57 C;  2CC1 A;  5EEC A;  1LLB A;  3OCN A;  4KG2 A;  3E2K A;  2ZM8 A;  4S2M A;  1LL9 A;  2QZ6 A;  1OME A;  1L0E A;  3OPL A;  1PZP A;  2XFS A;  3I7J A;  4KZ9 A;  3IH9 A;  2J9P A;  3FYZ A;  1YT4 A;  4K0W A;  2Y2I A;  2GDN A;  5IHV A;  4S2J A;  1HVB A;  1E3U A;  2EXA A;  5FQI A;  3D4F A;  3WS5 A;  5E2H A;  5AQB A;  1CEG A;  2WGW B;  2G2W A;  4BEN A;  3HUO A;  1PW8 A;  3LEZ A;  1VQQ A;  3ITB A;  5GLD A;  4GOG A;  5DTS A;  4O7D A;  4WZ5 A;  2EXB A;  1BLC A;  1NY0 A;  1PYY A;  2H0Y A;  5HAP A;  1ZG4 A;  3M2K A;  5KZH A;  1QMF A;  3ZNY A;  4ZAM A;  2Y4A A;  1LI0 A;  1MWR A;  4KG6 A;  1K55 C;  3ZGA B;  3MKF A;  4S2O A;  5CGS A;  4U0T A;  5DVA A;  5DTT A;  4UHU A;  1E3U D;  3WS2 A;  4KQQ A;  4FH4 A;  3ZCZ A;  2OSU A;  4NET A;  1FQG A;  5F82 A;  4DE0 A;  1NYY A;  1RCJ A;  2P9V A;  2Z2M B;  3W8K A;  5TFQ A;  2XDM A;  4LCM A;  1KVM A;  1PIO A;  2EX6 A;  4OOL A;  4QU3 A;  3MZD A;  3LY3 A;  2ZC4 B;  4UAA A;  1ERO A;  4R3B A;  4E3M A;  2QPN A;  4R3J A;  3AGF A;  1YLW A;  1XKZ A;  3VP2 A;  4UA7 A;  3WS4 A;  2ZQC A;  3DWK A;  5DF9 A;  1DY6 A;  1K25 A;  4KZ3 A;  3WS1 A;  3IXG A;  1EI5 A;  1MPL A;  4MNR A;  1ERQ A;  3HRE A;  5KSH A;  5CHJ A;  3MKE A;  5A93 A;  1MWS A;  3A3E A;  1BLH A;  2X02 A;  4E3K A;  4MBF A;  1YMS A;  2ZC3 B;  4IBX A;  1L2S A;  4RVA A;  2XLN A;  2A3U A;  3BFF A;  4L0L A;  4KZ5 A;  4DF6 A;  2WKI A;  4EBL A;  2ZD8 A;  3BEC A;  2Z2L B;  3IXB A;  3V3S A;  5JYO A;  3FKW A;  1KGF A;  2P9V B;  4OP8 A;  1BZA A;  5CEC A;  2HDQ A;  1FCO A;  4DDY A;  2X71 A;  3HL9 A;  4EQI A;  5CED A;  4R1G A;  3Q07 A;  4R4S A;  3PBO A;  3PBT A;  4OOY A;  3PBQ A;  2EX2 A;  2ZC7 A;  3SOI A;  4D2O A;  1IKI A;  2Y2K A;  4DKI A;  4E3J A;  3VFH A;  2Y2P A;  1MWU A;  2A49 A;  3HUM A;  5EOE A;  1BT5 A;  1O7E A;  4C75 A;  5CRF A;  5EVL A;  1IKG A;  1BUL A;  4KZ4 A;  4E3O A;  1DJA A;  1FSW A;  2H5S A;  5FI2 A;  3OPH A;  4BQM A;  3HLF A;  2R9X A;  3BM6 A;  3G34 A;  2DCF A;  5GHZ A;  4JKT A;  4KEN B;  4S2K A;  3RXX A;  4JXG A;  1NZU A;  3Q7V B;  1ALQ A;  1IYP A;  1M6K A;  2WK0 A;  4BJP A;  1YLT A;  4WM9 A;  4K0X A;  3IXH A;  1JTG A;  4WEK A;  3HLB A;  3WS0 A;  2Q9M A;  1XGI A;  4KQO A;  2XD5 A;  3SH7 A;  2Y2Q A;  2XD1 A;  5CGW A;  4QB8 A;  5I94 A;  1GHM A;  3M2J A;  3ZNT A;  4PM6 A;  1GA9 A;  1Q2P A;  3NBL A;  4IED A;  3A3F A;  4ZJ3 A;  5J8X A;  2XGN A;  1TDL A;  4ZTK A;  3G2Z A;  4LV3 A;  4WZ4 A;  2WGV A;  5L2F A;  3FZC A;  3S4X A;  2X01 A;  5GLC A;  3N6I A;  3BRM A;  4S2P A;  3G2Y A;  2I72 A;  2Y2L A;  4OH0 A;  2ZQD A; 
#chains in the Genus database with same CATH topology
 1CF0 A;  4EV4 A;  4IVI A;  3H9W A;  3VSK A;  4X53 A;  2M1C A;  1KE3 A;  4I3J A;  3PYP A;  3K2N A;  1LSX A;  2WZX A;  4WEL A;  5HPI A;  3VOY A;  1GHI A;  4DE2 A;  1ES3 A;  1YQS A;  1ONH A;  1ZC2 A;  2XA7 M;  5HAP A;  4EBN A;  2HDU A;  1S4R A;  2VGK A;  3SZT A;  4QD4 A;  4BL3 A;  3EQV A;  4GD6 A;  3QP2 A;  3IS2 B;  1G6A A;  1Z09 A;  5FQJ A;  4RRC A;  3EGD C;  2JKG A;  3HUN A;  3UDI A;  3NDG A;  3TW8 A;  1BLP A;  5HPF A;  3TE8 A;  4U0X A;  1OT9 A;  3UPP A;  1Q2Q A;  5EVI D;  4DXB A;  1LL5 A;  5HWV A;  1W7F A;  3PTE A;  3G6O A;  3MXR A;  4UA9 A;  3GEC A;  4OPZ A;  5EVI B;  3V50 A;  3NJA A;  4HQA A;  3T1S A;  5F5Y A;  5G18 A;  3OZH A;  4WBG A;  1STZ A;  1FR1 A;  1SCW A;  4RRB A;  4EER A;  1ODV A;  3C7U A;  1TEM A;  2W3G A;  4N1X A;  3EEA A;  4KZ8 A;  2Z6D A;  2V1B A;  3G35 A;  3LY4 A;  3KNP A;  1OJG A;  2FZ0 A;  2V2F F;  3QNC A;  1XFN A;  2E8I A;  2ZQ7 A;  1Y4O A;  3F1P B;  2JKR M;  4OKP A;  1CI9 A;  2VV8 A;  1BYW A;  3PAE A;  3G30 A;  3W2Z A;  1VEU B;  2IA2 A;  4UA6 A;  3E0Y A;  1K55 A;  4X25 A;  2PRF A;  2Y2H A;  3UE0 A;  3ZG9 B;  2OLV A;  3CG5 A;  4LV0 A;  4PPR A;  3NY4 A;  3GTC A;  3BFC A;  2Y2M A;  3UNW A;  1I5Q A;  2J3T D;  5M1A A;  4PKY G;  2QMI A;  4LRZ E;  5HDC A;  3W4P A;  4BBU A;  4PM7 A;  5KIZ A;  3HLG A;  1NLY A;  1XPB A;  4S02 A;  3P98 A;  5MC7 A;  5FAT A;  4NXF A;  4S03 A;  4M4X A;  1ES5 A;  2PU4 A;  1FSY A;  4RX2 A;  5L07 A;  5HSQ A;  3A3D A;  1ONG A;  2HKZ A;  4CLC D;  4GHI B;  3ZYT A;  3LUQ A;  1K4E A;  1I2S A;  2ZL1 A;  5M18 A;  2W3E A;  3C30 A;  2BLS A;  4O0P A;  1PZO A;  5EVE A;  4S2L A;  5CHM A;  3KYQ A;  1ESU A;  2XH9 A;  1QME A;  2W3D A;  4FOF A;  3JVV A;  2CMN A;  1LT0 A;  5DTK A;  4O01 A;  2EX8 A;  3IBJ A;  4WUJ A;  3VSL A;  4FUW A;  3JYI A;  2Y91 A;  4PM5 A;  4JXV A;  1HZO A;  4E3L A;  5GHX A;  1SKO B;  3IF6 B;  1IEM A;  1OT6 A;  4I39 A;  3SS3 A;  3S7N A;  1O07 A;  3UDX A;  4OQI A;  4EUZ A;  1IOU A;  3UB5 P;  2A24 A;  3UDF A;  5IU1 A;  3W4Q A;  4RR8 A;  5TGF A;  1H8M A;  4Q0J A;  3F1O A;  4OLG A;  2ZOH A;  1CI8 A;  4R23 A;  4ARZ B;  1GA0 A;  2MJ6 A;  4OLD A;  3L9K A;  3CLO A;  3HCY A;  1W8Y A;  3C8C A;  5FQQ A;  1DP8 A;  3T1X A;  5BOH A;  3T4T A;  1RGY A;  5CTM A;  3D9Y A;  3QNB A;  1P97 A;  5EOO A;  4RRI A;  2W1T B;  1K54 C;  2B5R A;  1YMX A;  4FD8 A;  4P85 A;  4Y13 A;  3BFE A;  5DFY A;  1DP6 A;  1MWT A;  4G3V A;  3N8S A;  1YLJ A;  1S66 L;  4XXR A;  1TS6 A;  1UGU A;  3NIA A;  4P87 A;  4WL9 A;  2DNS A;  5GLA A;  3Q82 A;  1H8Y A;  3ISG A;  5E2G A;  5AQ9 A;  4YFM A;  3T1R A;  3IS2 A;  2JKR I;  2FFF B;  1EW0 A;  3OCN A;  2B95 A;  2ZM8 A;  2V8C A;  1LL9 A;  2QZ6 A;  3T4K A;  3IH9 A;  3DTE A;  1YT4 A;  1F98 A;  2K2N A;  4UQI M;  1PRQ A;  5E2H A;  4HIA A;  5AQB A;  1CEG A;  2XRO A;  1T19 A;  2QJ7 A;  3HUO A;  5DTS A;  4WZ5 A;  2H0Y A;  3ZNY A;  4EEP A;  4S2O A;  4U0T A;  3KO5 A;  1E3U D;  3WS2 A;  3K3C A;  3ULF A;  2P08 A;  2J80 A;  4XT2 B;  1NLZ A;  1RCJ A;  4LCM A;  3R7W B;  2EX6 A;  4NXG A;  1Y28 A;  4R3B A;  2M7V A;  4LRX C;  2W27 A;  2PDR A;  5DF9 A;  1EI5 A;  4X1L A;  4MNR A;  5L10 A;  4E3K A;  3F1P A;  2W3F A;  4IHQ A;  3FPW A;  2BTF P;  5TJJ A;  5F69 A;  1VEU A;  3FKW A;  2JKT M;  3PBO A;  4OOY A;  2EX2 A;  1MWU A;  5CRF A;  1IKG A;  1DJA A;  3DBA A;  5FI2 A;  2R9X A;  3G34 A;  4KEN B;  4S2K A;  4AFI A;  2PHY A;  1ALQ A;  4BJP A;  5LBR A;  3HLB A;  1XGI A;  2XD5 A;  3SH7 A;  2Y2Q A;  2XD1 A;  3S7P A;  5I94 A;  5AVF A;  5G4Z A;  1GA9 A;  1Q2P A;  4ZJ3 A;  4ZTK A;  3G2Z A;  4LV3 A;  3JVU A;  2QWS A;  2HL0 A;  1YPR A;  2G2U A;  3CZD A;  1KDS A;  1N9B A;  4EEU A;  3HJI A;  4HH3 A;  3A3I A;  1NXY A;  3IF5 A;  3UO9 A;  3IBR A;  4O8G A;  3S1Y A;  3NI9 A;  2HJE A;  3V5M A;  4RR9 A;  4X55 A;  1GSV A;  3FWL A;  4MBK A;  4ID4 A;  3T4O A;  3KSG A;  4ZJ1 A;  2W3H A;  5DF8 A;  3UE6 A;  3A0S A;  1YLP A;  3EGX C;  3G4P A;  4MCW A;  1ESI A;  4EBP A;  4GW9 A;  2WUQ A;  3CMZ A;  2JHE A;  3LR0 A;  1I2W A;  1IEL A;  3UME A;  4Y0U A;  1KGG A;  4JPM A;  3SS5 A;  1ACF A;  3ZQ5 A;  1F9I A;  4ZBE A;  2HL2 A;  3OOV A;  4OQ0 A;  1K6S A;  5J7E A;  3PAG A;  5CXW A;  1MXO A;  1JKE A;  4M3K A;  5U47 A;  3V39 A;  3OC2 A;  1SKO A;  2Y2G A;  2V9A A;  2HP5 A;  1W63 M;  3IF6 A;  4Y5F A;  4QWO A;  5A91 A;  4HBT A;  3U2A A;  2IWB A;  4NK3 A;  2H0T A;  1YSP A;  3OLO A;  4WMC A;  3WRZ A;  2EWV A;  4ARZ A;  4BD0 A;  2JN7 A;  4LV1 A;  3G31 A;  3LIB A;  1EWZ A;  4QPR A;  5HW3 A;  3KOB A;  1T1A A;  2EFU A;  3ZFZ A;  4EXO A;  1IYQ A;  2B02 A;  2EWW A;  2R78 A;  4KUK A;  2J9O A;  4LEN A;  1K38 A;  2ZM2 A;  2W1T A;  5G4Y A;  3P7N A;  1T1C A;  4NBI A;  1OTD A;  4S0K A;  5HAQ A;  3BYD A;  3O87 A;  5DKL A;  3C5A A;  1WYB A;  4RR7 A;  2HP9 A;  4FCF A;  1XJ6 A;  1YAX A;  1S1Y A;  5FQ9 A;  1KVL A;  1IFQ A;  2GNX A;  3MQO A;  3BLM A;  3L7H A;  1G68 A;  3ICY A;  3RTY A;  3KNF A;  1Z6F A;  1MZU A;  3V3R A;  4IBR A;  3LIA A;  3TRC A;  4MN7 A;  3LEQ A;  3Q1F A;  3SS4 A;  4RRA A;  1GHP A;  4X6T A;  2JKT I;  3ZVT A;  5DFX A;  1IYO A;  1PI5 A;  4Y2F A;  3BFD A;  4MBH A;  3B42 A;  3MFD A;  4OPQ A;  3HBR A;  4P0M A;  3PD2 A;  1G28 A;  3LR3 A;  4G3K A;  5HX9 A;  1S0W A;  3T50 A;  2JE5 A;  3CPT A;  4GN2 A;  5F83 A;  4YIN A;  2R9W A;  4S0J A;  3Q7Z A;  2P04 A;  1YLZ A;  3IX8 A;  3ZHH A;  3R7W A;  3K3D A;  5D3O A;  3UB6 A;  3SH9 A;  3GRJ A;  1PW1 A;  1BSG A;  2JCH A;  2EA9 A;  1S4S A;  3BWL A;  1L0D A;  2ZMV A;  4KZB A;  1VET B;  1CK3 A;  2W1R A;  1MKI A;  2XEP A;  2XA7 S;  4BL2 A;  3PBR A;  3BEB A;  3IX4 A;  4RRJ A;  2JBF A;  4FH2 A;  4KG5 A;  5FAO A;  4OP5 A;  1JNU A;  3B33 A;  4XUZ A;  2PBY A;  4II7 A;  3KX0 X;  4MLL A;  3LI8 A;  5M19 A;  3WWX A;  2HL1 A;  3EWK A;  2PAV P;  2VGJ A;  5FI6 A;  4RYE A;  4LV2 A;  1Y2Q A;  3QP1 A;  1PFL A;  4WN5 A;  5IS1 A;  3VE4 A;  4HBU A;  4OPR A;  2VK3 A;  4Q8I A;  5EE8 A;  2OWH A;  3PR6 A;  3MQ0 A;  1Y54 A;  1ZHH B;  2V8F A;  3LIE A;  4PMA A;  3HLD A;  4PM8 A;  2XF3 A;  3LYX A;  4Y7P A;  1K4F A;  5TR7 A;  2WZZ A;  4JLF A;  4B4X A;  3FV7 A;  3IHA A;  2ZQA A;  2WGI A;  3W4O A;  5AQ7 A;  3DTM A;  4S2N A;  3ZG7 B;  1SHV A;  5F68 A;  2Y55 A;  2HP6 A;  1N9L A;  4KZ6 A;  5A90 A;  3HLC A;  3TSG A;  4OPY A;  3HVF A;  2J3W A;  2XRN A;  1LLB A;  4KG2 A;  4RRH A;  2HZ5 A;  2V1A A;  1VHM A;  3KO3 A;  4KZ9 A;  2XFS A;  4NEE D;  2NUP C;  2GDN A;  3KYE A;  1HVB A;  5FQI A;  2NUT C;  3D4F A;  2VA0 A;  3E4P A;  3ITB A;  5GLD A;  4O7D A;  5HZH A;  1PYY A;  4CLC B;  3M2K A;  3LMV A;  4HJ6 A;  1K55 C;  3MKF A;  5CGS A;  5DTT A;  5EM1 A;  2OSU A;  5F82 A;  3W8K A;  5TFQ A;  4OOL A;  3VOL A;  3MZD A;  3LY3 A;  4JGR A;  3LMT A;  2QPN A;  1T1B A;  3AGF A;  1YLW A;  5HDD A;  4WLA A;  2ZQC A;  1DY6 A;  4KZ3 A;  2O9C A;  1MPL A;  3NUL A;  5CHJ A;  1CQA A;  3MKE A;  2X02 A;  4MBF A;  3MXQ A;  4BMW A;  2ZC3 B;  1HLU P;  1L2S A;  4RVA A;  2A3U A;  4L0L A;  4KZ5 A;  4EBL A;  2ZD8 A;  5JYO A;  3A0V A;  2P9V B;  1BZA A;  4DDY A;  1FCO A;  3HL9 A;  4R1G A;  3Q07 A;  4R4S A;  3PBT A;  3SOI A;  4D2O A;  1OTE A;  4DKI A;  5TBM B;  3HUM A;  1BT5 A;  5EVL A;  4BQM A;  3H82 A;  4JGP A;  3RXX A;  3E4Q A;  3Q7V B;  1IYP A;  1WA9 A;  1OPX A;  4MDZ A;  4H6J B;  3WS0 A;  2PBD P;  2Q9M A;  4QB8 A;  1GHM A;  2K31 A;  3NOP C;  4LRY C;  2L0W A;  2Y8H A;  5FL3 A;  3NBL A;  3A3F A;  2XGN A;  2WGV A;  3S4X A;  2I72 A;  5A92 A;  1BUE A;  3SH8 A;  3DWZ A;  3VP4 A;  4ESP A;  5J4E A;  3FC7 A;  1LHY A;  4RRQ A;  5JYP A;  3LCE A;  1N9N A;  3C38 A;  2RL3 A;  5L09 A;  5EFW A;  2Y2N A;  4NXB A;  3PD5 A;  4X1M A;  3UY6 A;  2ZM0 A;  4X56 A;  3ZDJ A;  1VET A;  4HES A;  4MMN A;  4ZDX A;  3S22 A;  3N7W A;  5GHY A;  4JF5 A;  5EVI A;  1XA1 A;  1SDE A;  4EW7 A;  3P09 A;  3KSH A;  4I38 A;  1PWD A;  3VOZ A;  1S1Z A;  3E98 A;  2OAQ 1;  4GNU A;  3MQQ A;  3C4P A;  3TOI A;  4E3J A;  1RGZ A;  3PXP A;  2ZJ9 A;  4Y15 A;  2OLU A;  4HEF A;  4YOF A;  1NRF A;  2WAE A;  3MFX A;  1XA7 A;  3DW0 A;  3KO4 A;  3MXS A;  5HAI A;  2K7S A;  5HL6 A;  1FIL A;  2GJ3 A;  2HV1 A;  3HLE A;  1LSW A;  1J3W A;  4B88 A;  3BY9 A;  4NBJ A;  3O86 A;  1FR6 A;  2VGL S;  3T1Q B;  1FCN A;  2HF6 A;  4ZRR A;  4QJG A;  1K57 A;  5KMW A;  2OKV A;  4GZB A;  3DTK A;  4GLQ A;  2ZC6 B;  3F1N B;  1XP4 A;  1K0K A;  3UPN A;  4BBT A;  4A5R A;  3TG9 A;  3GDI A;  4ETX A;  4HNB A;  3D3O A;  1FOF A;  2GX5 A;  3MF0 A;  2OWJ A;  4R4R A;  3U4L P;  1C3B A;  3O3V A;  4WZ5 C;  1VM1 A;  3BW6 A;  3GR2 A;  1G5U A;  4RRF A;  4RR6 A;  2ZBB A;  5HL1 A;  4JXS A;  4PM9 A;  1ZG6 A;  2J8Y A;  3IHB A;  4C3Q A;  3IQA A;  4OOM A;  2P7J A;  4Q0I A;  3WRT A;  1NZO A;  1DJB A;  2WAF A;  4KZA A;  5HD5 A;  4CLC E;  5FAS A;  1P9R A;  4DMZ A;  2HGV A;  5E2F A;  3H7W B;  2KDK A;  3FG8 A;  4GHI A;  3QP6 A;  2VZW A;  2Q9N A;  3VMA A;  4JBF A;  4E04 A;  3CUE A;  3OPR A;  2UWX A;  4X68 A;  4CLC A;  2B18 A;  4BWI A;  4F94 A;  5C5K A;  3LIF A;  1SZV A;  5E2E A;  5FAQ A;  1XXM A;  1L0F A;  3PBN A;  4OQH A;  1WE4 A;  4GS9 B;  4CJN A;  2Y2O A;  2QJ5 A;  4Y0T A;  4JF6 A;  4JF4 A;  4E6W A;  5FSR A;  3BLS A;  1L3L A;  1YM1 A;  1K56 D;  1E4D A;  4DE1 A;  4GDB A;  2XQZ A;  5FEF A;  1JWP A;  2PR5 A;  2Y59 A;  2A2L A;  1WYC A;  3AGD A;  4XUX A;  4GB7 A;  5DJU A;  4JGO A;  3B3X A;  2XSS A;  2OV5 A;  3IH8 A;  4CQH A;  3OCL A;  1KDW A;  2RCX A;  3ZG8 B;  2O99 A;  1HTZ A;  4FSF A;  5TBM A;  1DP9 A;  2EFX A;  2HDS A;  2O9A A;  1L0G A;  3E4O A;  1XJ3 A;  2G7U A;  5F1G A;  3RJU A;  2JC7 A;  2L4R A;  1KE4 A;  4LFU A;  3Q7V A;  4HOI A;  4U3T A;  3LGO A;  3HLW A;  3BQA A;  3GSG A;  5HFO A;  2KX6 A;  2ZQ9 A;  3EQU A;  4H6J A;  4WEJ A;  5F1F A;  4GDN A;  3IWQ A;  3N8L A;  2XR0 A;  4R38 A;  1N9O A;  2BAS A;  2WKH A;  2JKF A;  5J61 A;  4JXW A;  3OPP A;  5EPH A;  2Y79 A;  4E3N A;  4DDS A;  3T4L A;  4FTX A;  2ZLY A;  1KGE A;  1GCE A;  4P6Z S;  3M6B A;  1GSX A;  5L8M A;  5FI7 A;  4E6X A;  3IWI A;  3IX3 A;  5CHU A;  2W0N A;  3B47 A;  3IF6 C;  3EEH A;  2OAP 1;  3GVB A;  3VP3 A;  3VFF A;  1A0K A;  2VV6 A;  4E3I A;  2IWC A;  2L1M A;  2GZA A;  4IVK A;  2HDR A;  3MZE A;  5FQK A;  2V0W A;  3PBS A;  1E25 A;  4XT2 A;  3I7J A;  2J9P A;  3FYZ A;  4K0W A;  2AVX A;  1ZTU A;  2HJ9 C;  2Y2I A;  3JPU A;  1E3U A;  3BJN A;  2WGW B;  2G2W A;  4BEN A;  1KOU A;  1PW8 A;  1VQQ A;  5FDS A;  2VLG A;  2EXB A;  1BLC A;  1NY0 A;  4LLO B;  1QMF A;  2Y4A A;  4Z1W A;  1MWR A;  4KG6 A;  5AJG A;  3ZGA B;  4DJ2 A;  5DVA A;  3TJZ C;  2UV0 E;  1YSQ A;  4UHU A;  3CAX A;  2KOI A;  4FH4 A;  4NET A;  3ZCZ A;  1FQG A;  4RRG A;  4MN6 A;  1NYY A;  2Z2M B;  2XDM A;  1PIO A;  2PD8 A;  4HJ4 A;  4IUH A;  4QU3 A;  2VV7 A;  1ERO A;  4R3J A;  5DKK A;  4WF0 A;  3VP2 A;  4F3L B;  3F1N A;  3DWK A;  3WS1 A;  1ERQ A;  5KSH A;  1MWS A;  3A3E A;  1BLH A;  3PD3 A;  3EOI A;  3VE3 A;  1P0Z A;  4DF6 A;  5I5L A;  3BEC A;  2Z2L B;  3IXB A;  3BQ8 A;  4ETZ A;  4OP8 A;  5CEC A;  4HP4 A;  4Q0H A;  2X71 A;  5CED A;  4ME4 A;  2Y2K A;  3LFV A;  3VFH A;  5EOE A;  4KUO A;  4C75 A;  4UEY A;  4E3O A;  1FSW A;  3OPH A;  4EQ1 A;  3PHY A;  3BM6 A;  5GHZ A;  4JKT A;  4BBV A;  2WK0 A;  4WM9 A;  3H7W A;  2ZMF A;  2QHK A;  1JTG A;  1V9Z A;  1G6O A;  4NKP A;  1NRJ A;  3CHW P;  5CGW A;  3M2J A;  1TF1 A;  5J8X A;  1TDL A;  1F2K A;  3NEC A;  2LB5 A;  5AVE A;  1UWP X;  1PNE A;  5L2F A;  2X01 A;  5GLC A;  4HY8 A;  3BRM A;  2Y2L A;  2PU2 A;  2VJW A;  3A0R A;  4EES A;  3D72 A;  4MN5 A;  3UPO A;  2E8J A;  1OTI A;  4B9O A;  3QHY A;  4GS9 A;  4RRK A;  5J3W A;  5F6A A;  1AXB A;  5DJT A;  5EUA A;  3GQZ A;  4QY6 A;  4PHT A;  2XK1 A;  4R3A A;  2WAD A;  3QP4 A;  5E43 A;  1S6R A;  1J9M A;  1ZKJ A;  1H8Z A;  1PWG A;  1YKD A;  5HDS A;  1K56 A;  1FCM A;  3IWO A;  3IXD A;  1KE0 A;  1MBL A;  3KO6 A;  3NDE A;  1OTB A;  2HPB A;  4OON A;  1X0O A;  3MZF A;  4RX3 A;  3NC8 A;  2Y2J A;  1K54 A;  3DTI A;  4K91 A;  2J7V A;  5GLB A;  2DRW A;  1U60 A;  4WYY A;  1HD8 A;  2VEA A;  5HD3 A;  4I3I A;  1XJ4 A;  3FKV A;  3T4Q A;  4S2N C;  4EU0 A;  3N4I A;  1JWZ A;  3A3J A;  3ZG5 A;  4RRR A;  2I9V A;  3NOT C;  3O88 A;  3MBZ A;  1DRM A;  4I3A A;  4B93 A;  4YWZ A;  4L9G A;  5CEB A;  3LR5 A;  5AQA A;  3T12 B;  4NG2 A;  4L9F A;  4WMC D;  3NCK A;  3RXW A;  4BD1 A;  4H8R A;  1ES2 A;  3AGE A;  3DAV A;  4Y0O A;  4EET B;  3UN7 A;  1IYS A;  3UE3 A;  5KSC A;  4GD8 A;  3S7O A;  3CIT A;  4R70 A;  3LMU A;  2YKH A;  2H10 A;  3HJK A;  3ZVW A;  3CJM A;  2PYP A;  4KQR A;  5IT5 A;  1MY8 A;  5GL9 A;  1UWN X;  2PR6 A;  1TS7 A;  4IUK A;  1H5X A;  4KZ7 A;  5K5B A;  3MJQ A;  2P74 A;  3MR0 A;  2BG1 A;  2ZMA A;  4S2I A;  4B4Z A;  4QY5 A;  5EV0 A;  5FEG A;  1YLY A;  3E2L A;  3BY8 A;  4ZJ2 A;  2XFT A;  3QP5 A;  4P6B A;  4S0I A;  1XGJ A;  4QHC A;  2WYX A;  5CTN A;  1W5D A;  4G3W A;  3G32 A;  3LIC A;  5HWW A;  1DJC A;  4PKY A;  4R0Q A;  3VP0 A;  3KOD A;  2WGW A;  3RH8 B;  1JTD A;  1TS8 A;  3GV9 A;  1TS0 A;  2FFY A;  1PWC A;  1LL8 A;  1W8Q A;  1SDN A;  2OOL A;  5DF7 A;  5FA7 A;  1VB6 A;  3UB7 A;  1ERM A;  1MKM A;  1D7E A;  5CER A;  1M40 A;  4LCL A;  1W63 Q;  1RP5 A;  1J7G A;  1D06 A;  2PT7 A;  1OTA A;  1D1J A;  1XJ2 A;  4DN0 A;  2C6W B;  3NHQ A;  4DXC A;  3KYZ A;  4Z9Q A;  5A8B A;  1TDG A;  4F3L A;  3C2W A;  1LI9 A;  3UB8 A;  4DRT A;  2EX9 A;  4RRL A;  2V0U A;  1TC5 A;  5HWT A;  1NYM A;  2VGL M;  3M6H A;  1NJ4 A;  2ZC5 B;  4HH2 A;  4UQI S;  2D02 A;  4BLM A;  3CPT B;  1MC0 A;  2V1Z A;  4RA7 A;  4N9K A;  1ES4 A;  3S7Q A;  3GMW A;  1W79 A;  5FAP A;  1N4O A;  1H3Q A;  4GJ4 A;  4X69 A;  4R6L A;  3KSF A;  1V9Y A;  2Z6C A;  3RFB A;  3LID A;  4N9L A;  2WKE A;  4C6Y A;  4HHD A;  3FPV A;  2O9B A;  5HAR A;  3KO9 A;  1JWV A;  3UE1 A;  3C4O A;  2H28 A;  4JGQ A;  2PYR A;  3IT9 A;  4DE3 A;  4N1H A;  2YKF A;  4LPZ A;  1H0M A;  3ZG0 A;  4IJG A;  3N8R A;  2C5W B;  1CEF A;  3MMH A;  2O0Y A;  4MEZ A;  5FDH A;  4Y17 A;  2WKQ A;  1TVF A;  2WKP A;  5EVI C;  2IWD A;  1JVJ A;  3ITA A;  3VP1 A;  2FH5 A;  4CPK A;  1SKF A;  3P01 A;  4OVD A;  2V20 A;  3C7V A;  5CGX A;  4K08 A;  4RQ9 A;  3V67 A;  2QYB A;  2ACG A;  3Q81 A;  4YNR A;  1K6R A;  3KSI A;  3LR4 A;  4DJ3 A;  4GKU A;  1XX2 A;  1BTL A;  3BFG A;  1CJF A;  3LI9 A;  3LO7 A;  4PAU A;  1PI4 A;  4N92 A;  1BLS A;  4EWF A;  1TD5 A;  4OQG A;  5FQM A;  2ZQ8 A;  3CWF A;  1K57 C;  2CC1 A;  4HP9 A;  5EEC A;  3E2K A;  4S2M A;  3NOU C;  2KLI A;  4EUV A;  2WKR A;  1OME A;  1L0E A;  3OPL A;  1PZP A;  2VX8 A;  3QP8 A;  1AWI A;  2ZOI A;  1LSV A;  5IHV A;  4S2J A;  1S67 L;  2EXA A;  3WS5 A;  3LEZ A;  4HI4 A;  4GOG A;  3MS6 A;  2D01 A;  2DMW A;  1ZG4 A;  4LGW A;  5KZH A;  4ZAM A;  3KO7 A;  1LI0 A;  2LB9 A;  4RRD A;  2J3T C;  2Q0O A;  1FIK A;  4KQQ A;  4DE0 A;  2P9V A;  1KVM A;  3VV4 A;  2ZC4 B;  4UAA A;  4E3M A;  1XKZ A;  4UA7 A;  3WS4 A;  1K25 A;  2ZL1 B;  3IXG A;  3HRE A;  3R4K A;  5A93 A;  1NWZ A;  1YMS A;  3CUE C;  4IBX A;  2M7U A;  1GSW A;  4Y3I A;  2XLN A;  3BFF A;  3MSH A;  2WKI A;  4CLC C;  3UMD A;  3V3S A;  1XFQ A;  1KGF A;  2DBO A;  4P6Z M;  2HDQ A;  2VKS A;  3OBF A;  4L9E A;  3UB9 A;  4EQI A;  3PBQ A;  3T4J A;  2ZC7 A;  1IKI A;  2Y2P A;  2A49 A;  1O7E A;  3KOC A;  1BUL A;  4KZ4 A;  1T18 A;  4RRM A;  2H5S A;  4HJ3 A;  3HLF A;  1P9W A;  2DCF A;  3CI6 A;  4JXG A;  1NZU A;  1M6K A;  1YLT A;  4I5S A;  2A24 B;  2PD7 A;  4K0X A;  3IXH A;  4NXE A;  4D60 A;  3SW1 A;  3T4S A;  4S0L A;  4WEK A;  3F1O B;  4KQO A;  2QKP A;  3ZNT A;  4PM6 A;  4IED A;  1F5M A;  2INW A;  4GCZ A;  3O5Y A;  4WZ4 A;  5EM0 A;  3FZC A;  4KQD A;  3PD4 A;  1OJ5 A;  5CX7 A;  3N6I A;  4S2P A;  3G2Y A;  3H82 B;  4OH0 A;  2ZQD A; 
#chains in the Genus database with same CATH homology
 5A92 A;  2HL0 A;  4EV4 A;  1BUE A;  2G2U A;  2PU2 A;  3CZD A;  3SH8 A;  4IVI A;  1KDS A;  1N9B A;  3VSK A;  3UPO A;  3DWZ A;  3VP4 A;  3A3I A;  4X53 A;  1NXY A;  3QHY A;  1LHY A;  4RRK A;  3IF5 A;  3UO9 A;  4RRQ A;  3S1Y A;  1AXB A;  1KE3 A;  3LCE A;  3NI9 A;  5EUA A;  3V5M A;  5JYP A;  4RR9 A;  4X55 A;  2RL3 A;  3FWL A;  2WZX A;  4MBK A;  3GQZ A;  4WEL A;  4ID4 A;  2Y2N A;  3PD5 A;  4QY6 A;  3VOY A;  3UY6 A;  1GHI A;  2ZM0 A;  1ES3 A;  1YQS A;  1ONH A;  1ZC2 A;  2WAD A;  2XK1 A;  4HES A;  4X56 A;  5DF8 A;  5E43 A;  3ZDJ A;  1YLP A;  3G4P A;  4EBN A;  4ZDX A;  1ESI A;  3S22 A;  4EBP A;  2HDU A;  1S6R A;  1J9M A;  1ZKJ A;  2WUQ A;  1H8Z A;  3CMZ A;  3N7W A;  1PWG A;  1K56 A;  5GHY A;  1I2W A;  1IEL A;  2VGK A;  4JF5 A;  1FCM A;  5EVI A;  4QD4 A;  1XA1 A;  3EQV A;  3IXD A;  3IWO A;  4GD6 A;  1SDE A;  1G6A A;  3P09 A;  4BL3 A;  1KE0 A;  5FQJ A;  1MBL A;  1PWD A;  3VOZ A;  4RRC A;  3HUN A;  3UDI A;  4Y0U A;  4GNU A;  3NDG A;  3NDE A;  1KGG A;  1BLP A;  4JPM A;  3C4P A;  4U0X A;  2HPB A;  4OON A;  3SS5 A;  4ZBE A;  4RX3 A;  3MZF A;  2HL2 A;  3NC8 A;  4OQ0 A;  1K6S A;  2Y2J A;  1K54 A;  3PAG A;  1RGZ A;  5CXW A;  1MXO A;  3TOI A;  3UPP A;  2ZJ9 A;  1Q2Q A;  4K91 A;  1JKE A;  4M3K A;  5U47 A;  3V39 A;  2J7V A;  3OC2 A;  5EVI D;  2OLU A;  4HEF A;  5GLB A;  2DRW A;  2Y2G A;  1NRF A;  2HP5 A;  4DXB A;  3IF6 A;  2WAE A;  1LL5 A;  1U60 A;  1W7F A;  1XA7 A;  3DW0 A;  3PTE A;  3KO4 A;  4WYY A;  1HD8 A;  3MXR A;  4HBT A;  3MXS A;  4UA9 A;  5A91 A;  5HAI A;  3FKV A;  4OPZ A;  2IWB A;  4S2N C;  4NK3 A;  2H0T A;  5EVI B;  4WMC A;  3N4I A;  1JWZ A;  3A3J A;  3V50 A;  3ZG5 A;  4RRR A;  3HLE A;  3WRZ A;  5G18 A;  3OZH A;  3O88 A;  4WBG A;  3MBZ A;  4B88 A;  1FR1 A;  1SCW A;  4RRB A;  4BD0 A;  4NBJ A;  4LV1 A;  3G31 A;  5CEB A;  3C7U A;  1TEM A;  3O86 A;  1EWZ A;  5HW3 A;  1FR6 A;  5AQA A;  3KOB A;  1FCN A;  4N1X A;  2EFU A;  4KZ8 A;  3ZFZ A;  1IYQ A;  4WMC D;  4QJG A;  3NCK A;  3RXW A;  4BD1 A;  1K57 A;  4H8R A;  2J9O A;  1ES2 A;  3AGE A;  4LEN A;  4Y0O A;  5KMW A;  3G35 A;  2OKV A;  3LY4 A;  4GZB A;  3KNP A;  1K38 A;  2ZM2 A;  3UN7 A;  2ZC6 B;  1IYS A;  2V2F F;  3UE3 A;  3QNC A;  1XP4 A;  5KSC A;  3UPN A;  4GD8 A;  4A5R A;  3TG9 A;  3LMU A;  2H10 A;  4NBI A;  2E8I A;  2ZQ7 A;  1FOF A;  3ZVW A;  4S0K A;  3CJM A;  5HAQ A;  3BYD A;  3O87 A;  4R4R A;  4KQR A;  1C3B A;  3O3V A;  4OKP A;  1CI9 A;  1MY8 A;  3C5A A;  4WZ5 C;  5GL9 A;  1VM1 A;  1WYB A;  4RR7 A;  2HP9 A;  4FCF A;  3PAE A;  3GR2 A;  3G30 A;  4RRF A;  4RR6 A;  5FQ9 A;  1KVL A;  4UA6 A;  5HL1 A;  4JXS A;  1K55 A;  3BLM A;  1G68 A;  4PM9 A;  1ZG6 A;  2J8Y A;  1H5X A;  3IHB A;  4KZ7 A;  4ZJ1 A;  3KNF A;  4C3Q A;  1Z6F A;  2Y2H A;  2P74 A;  3IQA A;  4OOM A;  2BG1 A;  2ZMA A;  3UE0 A;  3V3R A;  4S2I A;  4IBR A;  4QY5 A;  4B4Z A;  3WRT A;  1NZO A;  1YLY A;  3E2L A;  2OLV A;  3ZG9 B;  1DJB A;  3CG5 A;  2WAF A;  3Q1F A;  4KZA A;  4LV0 A;  4PPR A;  4ZJ2 A;  2XFT A;  3SS4 A;  4P6B A;  5FAS A;  3NY4 A;  3GTC A;  4RRA A;  4S0I A;  1XGJ A;  3BFC A;  1GHP A;  2Y2M A;  1I5Q A;  4X6T A;  5E2F A;  3UNW A;  4QHC A;  5M1A A;  2QMI A;  2WYX A;  5CTN A;  1W5D A;  3W4P A;  3G32 A;  3ZVT A;  4PM7 A;  3HLG A;  1IYO A;  1PI5 A;  1XPB A;  1DJC A;  4R0Q A;  2Q9N A;  3VMA A;  3VP0 A;  3BFD A;  4JBF A;  4MBH A;  3KOD A;  4S02 A;  2WGW A;  3MFD A;  3P98 A;  1JTD A;  3HBR A;  4OPQ A;  4P0M A;  3GV9 A;  2UWX A;  3OPR A;  3PD2 A;  4X68 A;  2FFY A;  5FAT A;  1PWC A;  1W8Q A;  5HX9 A;  1SDN A;  5DF7 A;  4S03 A;  5FA7 A;  1S0W A;  2JE5 A;  4F94 A;  1ES5 A;  1ERM A;  2PU4 A;  1FSY A;  4RX2 A;  5E2E A;  5CER A;  1M40 A;  4LCL A;  5FAQ A;  1RP5 A;  3A3D A;  4GN2 A;  1XXM A;  5F83 A;  4YIN A;  1L0F A;  1J7G A;  2R9W A;  4S0J A;  3PBN A;  4OQH A;  3Q7Z A;  1WE4 A;  1YLZ A;  4CJN A;  3ZHH A;  2C6W B;  2Y2O A;  1ONG A;  5D3O A;  4Y0T A;  2HKZ A;  4JF6 A;  4DXC A;  3SH9 A;  3GRJ A;  1PW1 A;  1BSG A;  4JF4 A;  2JCH A;  4Z9Q A;  4E6W A;  5FSR A;  3BLS A;  1YM1 A;  1L0D A;  1K4E A;  1K56 D;  4KZB A;  1E4D A;  4DE1 A;  4GDB A;  1TDG A;  1I2S A;  2XQZ A;  1LI9 A;  1JWP A;  4DRT A;  2EX9 A;  5M18 A;  4RRL A;  2Y59 A;  2BLS A;  1PZO A;  1CK3 A;  1TC5 A;  4S2L A;  1WYC A;  5CHM A;  1NYM A;  1MKI A;  2XEP A;  3AGD A;  3M6H A;  4XUX A;  1NJ4 A;  1ESU A;  2ZC5 B;  4GB7 A;  2XH9 A;  4BL2 A;  3PBR A;  3BEB A;  1QME A;  4RRJ A;  4BLM A;  2JBF A;  2V1Z A;  4RA7 A;  4N9K A;  3B3X A;  2OV5 A;  4FH2 A;  1ES4 A;  4KG5 A;  3GMW A;  3IH8 A;  1W79 A;  5FAO A;  5DTK A;  4OP5 A;  5FAP A;  2EX8 A;  3OCL A;  1KDW A;  1N4O A;  2RCX A;  4X69 A;  3VSL A;  4XUZ A;  3ZG8 B;  3JYI A;  2Y91 A;  4PM5 A;  4JXV A;  2PBY A;  4MLL A;  1HZO A;  4N9L A;  1HTZ A;  4FSF A;  2HDS A;  2EFX A;  2WKE A;  1L0G A;  4C6Y A;  4E3L A;  5M19 A;  3WWX A;  2HL1 A;  5GHX A;  5HAR A;  2VGJ A;  3KO9 A;  5FI6 A;  3IF6 B;  1JWV A;  1IEM A;  3UE1 A;  5F1G A;  3RJU A;  3C4O A;  4RYE A;  2JC7 A;  4LV2 A;  1KE4 A;  3SS3 A;  1Y2Q A;  1O07 A;  3UDX A;  3IT9 A;  4DE3 A;  4OQI A;  3Q7V A;  4EUZ A;  4N1H A;  4U3T A;  3ZG0 A;  3HLW A;  3GSG A;  5HFO A;  3UDF A;  2ZQ9 A;  3W4Q A;  3N8R A;  2C5W B;  5TGF A;  4RR8 A;  3EQU A;  4WEJ A;  1CEF A;  4OLG A;  5F1F A;  1CI8 A;  4GDN A;  4HBU A;  4MEZ A;  4OPR A;  3IWQ A;  3N8L A;  2XR0 A;  4R23 A;  5FDH A;  1GA0 A;  4OLD A;  4Q8I A;  5EE8 A;  2WKH A;  1TVF A;  5EVI C;  5J61 A;  1Y54 A;  2IWD A;  4JXW A;  1JVJ A;  1W8Y A;  3OPP A;  5EPH A;  3ITA A;  3VP1 A;  5FQQ A;  4E3N A;  4DDS A;  4CPK A;  1SKF A;  5BOH A;  2ZLY A;  1KGE A;  4OVD A;  2V20 A;  4PMA A;  1RGY A;  3C7V A;  5CTM A;  1GCE A;  3HLD A;  4PM8 A;  3QNB A;  5CGX A;  5EOO A;  4RRI A;  1K54 C;  2XF3 A;  2B5R A;  3M6B A;  1YMX A;  4Y7P A;  1K4F A;  5TR7 A;  4FD8 A;  5FI7 A;  4E6X A;  4P85 A;  2WZZ A;  3IWI A;  4JLF A;  5CHU A;  4DE2 A;  4B4X A;  3BFE A;  3Q81 A;  3FV7 A;  3IF6 C;  1K6R A;  1MWT A;  3GVB A;  3VP3 A;  3IHA A;  2ZQA A;  2WGI A;  3N8S A;  3W4O A;  5AQ7 A;  1YLJ A;  3VFF A;  4XXR A;  3DTM A;  4S2N A;  4GKU A;  1XX2 A;  3ZG7 B;  1BTL A;  3BFG A;  3LO7 A;  1SHV A;  4E3I A;  2IWC A;  2Y55 A;  3NIA A;  4P87 A;  2HP6 A;  1PI4 A;  2DNS A;  5GLA A;  4KZ6 A;  5A90 A;  3Q82 A;  1H8Y A;  4N92 A;  3ISG A;  5E2G A;  3HLC A;  5AQ9 A;  3TSG A;  4YFM A;  1BLS A;  4OPY A;  4IVK A;  4EWF A;  4OQG A;  5FQM A;  3HVF A;  2ZQ8 A;  2FFF B;  2HDR A;  3MZE A;  5FQK A;  3PBS A;  1E25 A;  1K57 C;  2CC1 A;  5EEC A;  1LLB A;  3OCN A;  4KG2 A;  3E2K A;  2ZM8 A;  4S2M A;  4RRH A;  1LL9 A;  2QZ6 A;  1OME A;  3KO3 A;  1L0E A;  3OPL A;  1PZP A;  2XFS A;  3I7J A;  4KZ9 A;  3IH9 A;  2J9P A;  3FYZ A;  1YT4 A;  4K0W A;  2Y2I A;  2GDN A;  5IHV A;  4S2J A;  1HVB A;  1E3U A;  2EXA A;  5FQI A;  3D4F A;  3WS5 A;  5E2H A;  5AQB A;  1CEG A;  2WGW B;  2G2W A;  4BEN A;  3HUO A;  1PW8 A;  3LEZ A;  1VQQ A;  3ITB A;  5GLD A;  4GOG A;  5DTS A;  4O7D A;  4WZ5 A;  2EXB A;  1BLC A;  1NY0 A;  1PYY A;  2H0Y A;  5HAP A;  1ZG4 A;  3M2K A;  5KZH A;  1QMF A;  3LMV A;  3ZNY A;  4ZAM A;  2Y4A A;  3KO7 A;  1LI0 A;  1MWR A;  4RRD A;  4KG6 A;  1K55 C;  3ZGA B;  3MKF A;  4S2O A;  5CGS A;  4U0T A;  5DVA A;  5DTT A;  3KO5 A;  4UHU A;  1E3U D;  3WS2 A;  4KQQ A;  4FH4 A;  3ZCZ A;  2OSU A;  4NET A;  1FQG A;  5F82 A;  4RRG A;  4DE0 A;  1NYY A;  1RCJ A;  2P9V A;  2Z2M B;  3W8K A;  5TFQ A;  2XDM A;  4LCM A;  1KVM A;  1PIO A;  2EX6 A;  4OOL A;  4QU3 A;  3MZD A;  3LY3 A;  2ZC4 B;  4UAA A;  1ERO A;  4R3B A;  3LMT A;  4E3M A;  2QPN A;  4R3J A;  3AGF A;  1YLW A;  1XKZ A;  3VP2 A;  4UA7 A;  3WS4 A;  2ZQC A;  3DWK A;  5DF9 A;  1DY6 A;  1K25 A;  4KZ3 A;  3WS1 A;  3IXG A;  1EI5 A;  1MPL A;  4MNR A;  1ERQ A;  3HRE A;  5KSH A;  5CHJ A;  3MKE A;  5A93 A;  1MWS A;  3A3E A;  1BLH A;  3PD3 A;  2X02 A;  4E3K A;  4MBF A;  1YMS A;  2ZC3 B;  4IBX A;  1L2S A;  4RVA A;  2XLN A;  2A3U A;  3BFF A;  4L0L A;  4KZ5 A;  4DF6 A;  2WKI A;  4EBL A;  2ZD8 A;  3BEC A;  2Z2L B;  3IXB A;  3V3S A;  5JYO A;  3FKW A;  1KGF A;  2P9V B;  2DBO A;  4OP8 A;  1BZA A;  5CEC A;  2HDQ A;  1FCO A;  4DDY A;  2X71 A;  3HL9 A;  4EQI A;  5CED A;  4R1G A;  3Q07 A;  4R4S A;  3PBO A;  3PBT A;  4OOY A;  3PBQ A;  2EX2 A;  2ZC7 A;  3SOI A;  4D2O A;  1IKI A;  2Y2K A;  4DKI A;  4E3J A;  3VFH A;  2Y2P A;  1MWU A;  2A49 A;  3HUM A;  5EOE A;  1BT5 A;  1O7E A;  4C75 A;  3KOC A;  5CRF A;  5EVL A;  1IKG A;  1BUL A;  4KZ4 A;  4E3O A;  1DJA A;  1FSW A;  4RRM A;  2H5S A;  5FI2 A;  3OPH A;  4BQM A;  3HLF A;  2R9X A;  3BM6 A;  3G34 A;  2DCF A;  5GHZ A;  4JKT A;  4KEN B;  4S2K A;  3RXX A;  4JXG A;  1NZU A;  3Q7V B;  1ALQ A;  1IYP A;  1M6K A;  2WK0 A;  4BJP A;  1YLT A;  4WM9 A;  4K0X A;  3IXH A;  1JTG A;  4S0L A;  4WEK A;  3HLB A;  3WS0 A;  2Q9M A;  1XGI A;  4KQO A;  2XD5 A;  3SH7 A;  2Y2Q A;  2XD1 A;  5CGW A;  4QB8 A;  5I94 A;  1GHM A;  3M2J A;  3ZNT A;  4PM6 A;  1GA9 A;  1Q2P A;  3NBL A;  4IED A;  3A3F A;  4ZJ3 A;  5J8X A;  2XGN A;  1TDL A;  4ZTK A;  3G2Z A;  4LV3 A;  4WZ4 A;  2WGV A;  5L2F A;  3FZC A;  3S4X A;  2X01 A;  3PD4 A;  5GLC A;  3N6I A;  3BRM A;  4S2P A;  3G2Y A;  2I72 A;  2Y2L A;  4OH0 A;  2ZQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...