2EX2A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
456
structure length
456
Chain Sequence
NVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
total genus 146
structure length 456
sequence length 456
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex2A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex2A02
5HW3A 2CC1A 4QY6A 4QHCA 1FQGA 3OPLA 4DE3A 4XUXA 4Z9QA 4EBPA 4X6TA 4KQRA 5E2HA 2V2FF 3SS5A 3GTCA 3C5AA 5EOOA 3UDFA 3C4PA 4DDSA 1K55A 1K25A 1W79A 1BSGA 1K55C 3HVFA 3Q81A 3DWZA 2RL3A 3G4PA 3N8LA 4GDBA 1M40A 1L0GA 1MXOA 1MY8A 3EQVA 2FFFB 3M6HA 4N1HA 5E2EA 4MBKA 4EUZA 3V3RA 3ZNTA 2WADA 4UA9A 3VOZA 3VFHA 3UDIA 2PU4A 3IWIA 5EVIC 3QNCA 1W8YA 4KG5A 2C6WB 3W8KA 4JPMA 3WRZA 2J8YA 5EECA 1XGIA 2I72A 1BTLA 1L0FA 3GSGA 3HLBA 3OCNA 4LV2A 2HDUA 4NETA 3V39A 1ES3A 3C7UA 3UPNA 3VP4A 5HAPA 5HAIA 3BFGA 5CECA 5DTSA 4ZJ3A 2WGIA 4HBTA 4X53A 2HP9A 4QD4A 3MZDA 3N8RA 4GDNA 4HESA 2ZM8A 4EBLA 2OV5A 1KE3A 3HLWA 5GHXA 3OZHA 3BM6A 1YT4A 3VP3A 3HLFA 2XEPA 4N9LA 2ZC5B 4IVIA 3IHBA 5JYPA 4ZAMA 3HUNA 2DCFA 3ITAA 2ZMAA 3E2KA 5EPHA 2Y59A 3GMWA 2WGWB 2IWBA 4RA7A 4QB8A 5FI7A 1GA9A 1DJCA 2EXAA 3AGDA 3BFEA 4L0LA 3OCLA 3IXHA 1IELA 4WZ5C 4LV3A 3TG9A 5GLDA 1XGJA 1PWCA 2HDRA 4OPZA 1XXMA 3QNBA 2H5SA 1KE4A 1Y54A 4JF4A 4OP8A 4OOLA 1ZG6A 1H5XA 4EV4A 5FQMA 1I5QA 3IQAA 4UAAA 4WMCA 3MKEA 2Y2LA 3ZVTA 3DW0A 4LENA 5FQ9A 3PBSA 4HBUA 2DRWA 1W5DA 5FDHA 3N4IA 5GLCA 1N4OA 2HPBA 1TEMA 4O7DA 5A91A 2ZQDA 1XA1A 4OPQA 2RCXA 2H0TA 5A92A 4OOMA 1LHYA 1FCOA 3D4FA 3AGEA 1E4DA 3PAEA 4X55A 3NI9A 4GD6A 1WE4A 3HLCA 4GOGA 5GL9A 2EX6A 4RYEA 4OQ0A 3A3IA 4PM6A 5FQIA 1IYPA 1I2SA 3UNWA 5GLAA 4E3OA 2XF3A 1SCWA 2XLNA 4CJNA 4KZ8A 4WZ5A 5KSCA 1KGFA 2ZM2A 1RGYA 3CMZA 3N8SA 4X56A 3G2ZA 2XD5A 1LI0A 1O7EA 3IWQA 4P85A 3WS1A 1RCJA 4ZBEA 5GHZA 2BLSA 4DE2A 1Q2PA 3FYZA 3QHYA 4BD0A 3GQZA 1PIOA 1FOFA 3WS0A 3ZDJA 4DE1A 4DF6A 3SH7A 1KDWA 3MZEA 3NBLA 2V20A 2UWXA 2WAEA 5TR7A 1BT5A 5CTMA 4KZ9A 1YQSA 3WS2A 4MEZA 1SKFA 4OPRA 1PW1A 1CI9A 5CRFA 2Y2OA 5D3OA 3JYIA 1TDLA 1K4EA 1K57A 4WMCD 1GA0A 4WBGA 5FI2A 2ZQCA 5JYOA 1YM1A 2WGWA 4DXCA 1DY6A 3PBQA 1KVMA 1IEMA 4BL2A 3GRJA 2EFUA 2Y2PA 2ZQ8A 4KZ6A 3FZCA 3WS5A 1ONGA 2HDSA 4C3QA 4R1GA 1JWVA 4QJGA 3BYDA 2ZQ7A 3HREA 3IT9A 3ZCZA 3OPHA 1PYYA 1ZG4A 5HAQA 1ALQA 1K4FA 3A3FA 3BFCA 3UO9A 4N92A 5TFQA 3Q7VB 2WYXA 2H0YA 3G34A 2XD1A 3HLEA 5HFOA 3G30A 4BQMA 4E3NA 4JLFA 3ITBA 4UA6A 4Q8IA 3BECA 5A90A 5F82A 1K6SA 3Q07A 5FATA 5M1AA 3P98A 3O88A 1ES2A 1K54C 1Q2QA 2ZC7A 3IXGA 5EVIB 5CTNA 1K56D 1SDNA 1AXBA 3HL9A 1K54A 3VOYA 1JWZA 4JF6A 4S2IA 4OLDA 4JXWA 3MFDA 3IH9A 2HDQA 3G35A 5CGXA 3BFDA 3ZFZA 1CK3A 1FCNA 2Y2KA 3SS4A 1MWUA 1W7FA 1IKGA 2BG1A 2H10A 3BLMA 3Q1FA 5DTKA 4FSFA 2JE5A 3WRTA 4D2OA 3WWXA 3MXSA 3NY4A 3MBZA 3B3XA 3S22A 1LI9A 1MBLA 4X68A 4KENB 5CHUA 5E2FA 2Y2MA 5CGSA 4KZ5A 4LV0A 4OP5A 4JXGA 3IHAA 3G31A 4NK3A 4EBNA 2Y2GA 2Q9NA 4E6XA 4BD1A 3IF6B 4WZ4A 1LLBA 5KSHA 3ZVWA 2EFXA 4KZ4A 2GDNA 1HZOA 3A3DA 3DWKA 4FH2A 4S2OA 3SH9A 3CJMA 3GV9A 3C7VA 4S2MA 5F1GA 4JKTA 4PM8A 1FSWA 2XDMA 2Z2LB 3UE3A 3ZGAB 1H8YA 1MKIA 4KZ3A 1C3BA 1XP4A 4KG2A 5EOEA 2Y2HA 3M2JA 4RVAA 2QMIA 4A5RA 1YMXA 2G2WA 4WYYA 3MXRA 2B5RA 1GCEA 4JXSA 2R9WA 1ES5A 3IWOA 4WM9A 3A3EA 5DF8A 1NJ4A 3LY3A 1XA7A 4JBFA 1W8QA 2Y91A 4S2KA 4GNUA 5FAOA 5I94A 1E3UD 4GN2A 2ZM0A 2HP6A 4H8RA 1ESIA 4LCMA 1BZAA 1K57C 1HVBA 4KQOA 3HLDA 4S2NA 4U0XA 2WGVA 4K0WA 4MBHA 5CERA 3ZG5A 2ZC6B 4BLMA 2XQZA 3EQUA 3HBRA 5FQJA 5AQ9A 4B88A 1KGGA 2FFYA 4N1XA 4P6BA 5EUAA 4F94A 3NCKA 1Z6FA 1YMSA 1NZUA 4E3IA 1FSYA 5FQKA 1PWDA 3VSKA 4YFMA 2JCHA 2WK0A 5FSRA 3HLGA 3FKWA 5GHYA 3ZNYA 1HD8A 3UPOA 1GHMA 3UN7A 3G2YA 3PBRA 4Y0UA 4M3KA 1ZKJA 1DJAA 2WKIA 4ZJ1A 3MZFA 1I2WA 5FQQA 5DF7A 1QMEA 2EX9A 4LCLA 1PZOA 4MLLA 2EXBA 5FAQA 4R23A 4OH0A 1M6KA 4ID4A 2Y2QA 3IXDA 1EI5A 4DKIA 4R4RA 5U47A 1XPBA 3VP0A 2E8IA 2VGKA 5CEDA 1LL5A 3OPRA 2QZ6A 2XK1A 2X71A 3O86A 3ISGA 2ZC4B 1YLZA 1ES4A 1G6AA 4OQHA 3W4OA 1PI4A 4KZAA 1IYSA 2ZQ9A 4WEKA 1ESUA 2J7VA 1EWZA 3OPPA 4OOYA 3S4XA 1IKIA 2HP5A 5CHJA 3G32A 1YLYA 1ERQA 3V3SA 3RJUA 1K6RA 1XKZA 3IH8A 2EX8A 1ZC2A 3NIAA 4JXVA 3VSLA 2IWCA 4S2JA 5CEBA 1E25A 2WAFA 1YLTA 1KVLA 5F1FA 4GD8A 3PBNA 1K56A 3HUOA 4K91A 4OVDA 4U3TA 5EVLA 3CZDA 2J9PA 1JWPA 2WKEA 5FA7A 1CEGA 1RP5A 4B4ZA 1J9MA 2Y55A 1KDSA 3VP1A 2XFSA 3Q7ZA 4LV1A 3NC8A 1MPLA 4FH4A 1NRFA 2V1ZA 2Y2IA 5DF9A 1U60A 2Y2JA 1JTGA 2QPNA 5AQBA 4EWFA 4ZDXA 1PI5A 4E6WA 3NDGA 2WKHA 3PTEA 5HL1A 2JBFA 1PW8A 2JC7A 3O3VA 4KZ7A 1KGEA 1SDEA 4QY5A 4R0QA 2XFTA 4PMAA 4QU3A 3HUMA 3FWLA 2OSUA 5AQ7A 4Y7PA 4R4SA 1BULA 2G2UA 3IF5A 4DRTA 2P9VB 4OONA 5E43A 5AQAA 4C6YA 4S2LA 1L2SA 1G68A 1SHVA 4KQQA 1DJBA 3BFFA 4P0MA 5KMWA 1OMEA 4S2NC 5GLBA 4E3JA 5CXWA 2OLUA 3PBTA 2WZXA 2P74A 3V50A 4BENA 1GHPA 1YLPA 4IEDA 5EVIA 4OQIA 3M2KA 3SS3A 3MKFA 4XXRA 2ZC3B 1S0WA 4GKUA 1L0DA 3V5MA 3Q82A 5L2FA 4OLGA 3ZG7B 4EQIA 5FI6A 3VP2A 3CG5A 3LY4A 3BEBA 3ZG0A 1MWTA 1BLPA 2XH9A 3O87A 5CHMA 4RX3A 3ZG9B 4OKPA 3TOIA 1BLCA 3W4PA 4PM9A 3W4QA 3N6IA 4UA7A 5M18A 3UPPA 2WUQA 1L0EA 4WEJA 4B4XA 1LL9A 3LO7A 5CGWA 3ZHHA 3N7WA 4ZTKA 3UE1A 3DTMA 5IHVA 1K38A 3LEZA 5FAPA 1QMFA 5F83A 4KZBA 2J9OA 3BLSA 1XX2A 3A3JA 4PPRA 4ZJ2A 2ZQAA 4FD8A 3UY6A 4Y0TA 3I7JA 3TSGA 1IYQA 1BUEA 4UHUA 4IBRA 1S6RA 5M19A 4OPYA 1NYMA 5BOHA 1MWSA 1ERMA 2PBYA 4DE0A 3IF6A 2PU2A 1TVFA 4PM7A 1JTDA 2Q9MA 1PZPA 3BRMA 3VMAA 1JVJA 1WYCA 4S2PA 4GB7A 4Y0OA 5A93A 4GZBA 5KZHA 1TDGA 2IWDA 1BLSA 4PM5A 2Y2NA 1VQQA 2Y4AA 3PAGA 3WS4A 5HARA 3RXWA 1H8ZA 4BJPA 2X01A 4IVKA 5EE8A 3C4OA 3SH8A 1NZOA 1KE0A 3P09A 1CI8A 2P9VA 4DDYA 1RGZA 1IYOA 4OQGA 4KG6A 4E3LA 3PBOA 3SOIA 1EROA 4YINA 1NXYA 5DVAA 2WZZA 2C5WB 3IXBA 2ZD8A 3S1YA 2XR0A 3VFFA 3GVBA 4IBXA 4X69A 4N9KA 5HX9A 3ZG8B 3LCEA 2OLVA 4FCFA 4MNRA 1YLWA 3OC2A 4XUZA 1BLHA 1YLJA 3FKVA 3IF6C 1VM1A 1GHIA 1WYBA 4U0TA 4DXBA 4CPKA 3AGFA 4K0XA 5TGFA 2A3UA 2R9XA 1CEFA 2A49A 1E3UA 1FR1A 1MWRA 5EVID 1NYYA 4WELA 3UDXA 3Q7VA 2VGJA 4E3KA 4HEFA 3FV7A 4R3JA 1FR6A 4R3BA 4RX2A 2ZJ9A 1O07A 5FASA 3M6BA 5E2GA 1HTZA 5G18A 3GR2A 4JF5A 1FCMA 3E2LA 3NDEA 3UE0A 2XGNA 4BL3A 2X02A 1PWGA 5DTTA 4E3MA 2EX2A 1NY0A 4MBFA 5J8XA 1N9BA 3RXXA 4P87A 2DNSA 2ZLYA 4C75A 1ONHA 2Z2MB
chains in the Genus database with same CATH superfamily
2CC1A 1LT0A 4DE3A 3MMHA 4X6TA 5E2HA 3SS5A 3UDFA 3C4PA 1K25A 4II7A 2PD7A 3HVFA 2RL3A 4GDBA 3M6HA 3ZNTA 3VOZA 3T4LA 4JPMA 3LIBA 1BTLA 2GJ3A 4MN5A 2O9BA 1V9YA 3UPNA 3VP4A 4ZJ3A 2HP9A 2W1TB 3N8RA 4EBLA 1SKOA 1XFQA 3HLFA 2OKVA 5G4YA 2ZC5B 5DJTA 2ZL1B 4ZAMA 4JGOA 1XJ3A 2Y59A 4RA7A 5FI7A 2W3FA 2ZMFA 3T50A 2EXAA 3BFEA 4L0LA 1LSVA 3IXHA 3CUEC 3TG9A 1PWCA 3NOUC 2ZOIA 1KOUA 2H5SA 2A24B 4RRFA 4GHIB 3IQAA 4WMCA 3IBRA 2JKGA 3ZVTA 4WL9A 2VV8A 1W5DA 4FOFA 1W63M 5FDHA 1N4OA 2HPBA 4O7DA 1T19A 2ZQDA 2XA7M 4RRGA 4OOMA 4PAUA 2VV6A 1WE4A 4GOGA 4RYEA 4DJ3A 5FQIA 1CF0A 3UNWA 4E3OA 1SCWA 4CJNA 5KSCA 1RGYA 3CMZA 5J7EA 1LI0A 2XD5A 4QWOA 1RCJA 5EM0A 1ACFA 3QHYA 2VKSA 3S7OA 2EWWA 2VLGA 5J61A 4MDZA 1KDWA 3NBLA 2V20A 5TR7A 4UEYA 5CTMA 5MC7A 1TDLA 2ZQCA 2JKTM 1DY6A 2B18A 4MMNA 3S7PA 2ZQ8A 3KNFA 3F1PA 3WS5A 1ONGA 1JWVA 4QJGA 3HREA 2PAVP 2LB5A 4RRAA 3Q7VB 3G34A 4JLFA 3C8CA 3BECA 4Q8IA 3Q07A 5HSQA 2R78A 5M1AA 3O88A 1Q2QA 2M7VA 3CHWP 4DMZA 4S2IA 3C38A 2KOIA 1J7GA 3G35A 5CGXA 3BFDA 5IT5A 3ZFZA 1CK3A 3LGOA 1MWUA 2BG1A 2H10A 3Q1FA 4WN5A 2JE5A 1T18A 3S22A 1N9LA 5CHUA 1OT6A 5CGSA 4KZ5A 3VOLA 5KIZA 4EXOA 4EUVA 3A0RA 1P9RA 4JXGA 5IU1A 2Q9NA 4E6XA 3V67A 2EFXA 4UQIS 4JGRA 3ZGAB 1MKIA 3DBAA 4A5RA 3E4PA 4RRKA 2Z6CA 2B5RA 1NJ4A 3LY3A 4KQDA 5FAOA 1ESIA 1HVBA 2WGVA 5CERA 2XQZA 3HBRA 5FQJA 4RRBA 5EUAA 2PR5A 4E3IA 2W27A 1P9WA 3CI6A 2WK0A 3KO3A 3HLGA 2P04A 3UPOA 1HD8A 4Y0UA 1DJAA 2WKIA 3MQOA 4Q0JA 5FQQA 2OOLA 4MLLA 2EXBA 5F68A 4G3WA 1M6KA 4DKIA 2V8FA 5U47A 2E8IA 3EEAA 1LL5A 2QZ6A 4Y5FA 2ZC4B 1ES4A 2NUTC 4S0JA 1IYSA 1LL8A 1EWZA 4OOYA 3G32A 3K3CA 3RJUA 1XKZA 2ACGA 4JXVA 1AWIA 1E25A 5F1FA 3PBNA 3HUOA 4U3TA 4OVDA 2L4RA 3PD5A 2K2NA 3VP1A 3PD4A 1XJ4A 2JKFA 3BY8A 3PD3A 3TE8A 1U60A 3G6OA 2QKPA 1JTGA 4LLOB 4ZDXA 3A0SA 2PT7A 3O3VA 4QY5A 2XFTA 4PMAA 3FWLA 4Y7PA 2D01A 2G2UA 4JGQA 3MF0A 4OONA 4Q0HA 4HHDA 3KSGA 1L2SA 4KQQA 3MR0A 5HWTA 4GS9B 3F1PB 2P74A 4BENA 4KUOA 3M2KA 1S0WA 1L0DA 2J3TD 4HQAA 4EQIA 1OTAA 3VP2A 3LY4A 2HF6A 4HH2A 1BLPA 3O87A 5CHMA 3KO9A 2BTFP 4OKPA 2PYPA 3W4QA 3N6IA 2QHKA 3UPPA 2WUQA 4WEJA 4EU0A 3ZHHA 3DTMA 3S7NA 3LEZA 5FAPA 3NOPC 1QMFA 5F83A 3BLSA 1D1JA 2ZQAA 3UY6A 5DFXA 3I7JA 3HJIA 1IYQA 5HZHA 3UE6A 1S6RA 3EOIA 3EWKA 4NBJA 3UMEA 2PU2A 3KO5A 2Q9MA 1PZPA 4GB7A 4H6JB 4B9OA 3MXQA 4RRMA 4PKYA 4PM5A 4HJ3A 4RRDA 3PXPA 3FPVA 2VV7A 2QWSA 1NZOA 3KSFA 1CI8A 3P09A 4OQGA 1EROA 4YINA 3VFFA 3S1YA 4X69A 4DN0A 5HX9A 4WF0A 3H7WA 3K2NA 3OC2A 4F3LA 1BLHA 1WYBA 4NXFA 4CPKA 3BJNA 5TGFA 2R9XA 3KNPA 2A49A 1OTBA 5HPIA 4UQIM 3FV7A 1FR6A 4R3BA 1O07A 5FASA 2QYBA 1FCMA 3CITA 2XGNA 4BL3A 3LI8A 5J8XA 3QP8A 4P87A 3IH9A 1H8ZA 4QHCA 1FQGA 3CAXA 3OPLA 4Z9QA 4KQRA 4DDSA 5HDDA 1W79A 1BSGA 2VJWA 1K55C 1EW0A 3DWZA 3IX8A 3N8LA 5IS1A 2FFFB 5L8MA 4N1HA 4MBKA 2WADA 3UDIA 2PU4A 4RRLA 1L0FA 3BQAA 1YPRA 3T1RA 3V39A 1NWZA 3TRCA 5CECA 4HBTA 4IJGA 2GZAA 3MZDA 3UB7A 2ZM8A 5GHXA 3OZHA 3IS2B 4M4XA 5JYPA 1VETA 4NEED 2FH5A 3GMWA 4RRIA 2IWBA 3UB6A 1GA9A 3MQQA 1DJCA 4E04A 3OCLA 3MJQA 4OPZA 4X25A 4EV4A 4UAAA 1Y28A 3MKEA 2Y2LA 3DW0A 1T1CA 2BASA 1FCOA 3D4FA 1E4DA 2W1TA 5K5BA 4PM6A 2XRNA 4KZ8A 2ZM2A 3F1NB 3R7WB 3G2ZA 4RR9A 1O7EA 3IWQA 1IFQA 4ZBEA 4O0PA 2HJ9C 2VK3A 3LMUA 1PIOA 2A24A 1G28A 4DF6A 3MS6A 5AJGA 2GNXA 3MZEA 2UWXA 2WAEA 4KUKA 1YQSA 3WS2A 1Y4OA 1SKFA 2MJ6A 1CI9A 5CRFA 2Y2OA 1F5MA 5D3OA 4WMCD 5FI2A 3LIFA 1YM1A 2QJ7A 1KVMA 4BL2A 3GRJA 1TS0A 3CPTA 3LR4A 4KZ6A 2ZL1A 2GX5A 3IT9A 3ZCZA 3A3FA 5EM1A 2NUPC 2WYXA 5HFOA 2XA7S 1WA9A 1S4SA 1VHMA 2JKRI 5EVIB 2ZC7A 5CTNA 1CJFA 1JWZA 4GS9A 4Z1WA 3MFDA 3T4JA 1FCNA 2HZ5A 5DTKA 1VB6A 3WRTA 3R4KA 4ESPA 3MXSA 3LIEA 5FL3A 4KENB 2Y2MA 1J3WA 3IHAA 3IX3A 1Z09A 4EBNA 2Y2GA 3OOVA 1OTIA 1LLBA 3ZVWA 2GDNA 3DWKA 4FH2A 3C7VA 5F1GA 3QP5A 4PM8A 1FSWA 3UE3A 3QP2A 5EOEA 4YOFA 2QMIA 1S4RA 2AVXA 3MXRA 2JKRM 1YKDA 1NRJA 1ES5A 2QJ5A 3IWOA 3A3EA 5DF8A 5I94A 1TS7A 1E3UD 2ZM0A 4LCMA 4NKPA 1K57C 4KQOA 4S2NA 4Q0IA 4K0WA 4U0XA 3DTEA 1KGGA 2FFYA 3F1OA 4F94A 1Z6FA 4S0KA 3VSKA 3KYEA 1GHMA 3UN7A 4R6LA 3MZFA 1I2WA 2EX9A 4LCLA 3RTYA 1MC0A 4OH0A 4ID4A 2Y2QA 4DJ2A 2PRFA 1SZVA 4R4RA 1XPBA 2VGKA 5CEDA 3OPRA 2XK1A 3OLOA 2X71A 2KLIA 1G6AA 3W4OA 5FQKA 4WEKA 4KZAA 4GJ4A 3OPPA 3DTKA 3S4XA 2HP5A 3DAVA 2E8JA 3BY9A 1ZC2A 3NIAA 3VSLA 2IWCA 2JHEA 5CEBA 1YLTA 4L9FA 4GD8A 1K56A 2J9PA 1JWPA 2WKEA 4B4ZA 1J9MA 2Y55A 2J80A 3P01A 1KDSA 3Q7ZA 4RRHA 3FPWA 1NRFA 2HKZA 2Y2JA 4EWFA 1PI5A 4E6WA 3NDGA 2WKHA 2JBFA 4R3AA 5HDCA 4R0QA 3D9YA 3HUMA 5AQ7A 5HDSA 2W1RA 4R4SA 3NULA 3IF5A 1BYWA 5AVFA 5AQAA 1X0OA 4C6YA 3MQ0A 3LR0A 4S2LA 3QP1A 4P0MA 4E3JA 5CXWA 2OLUA 1YLPA 4IEDA 5EVIA 3SS3A 3CLOA 4X1LA 3V5MA 4CLCD 3KOBA 3Q82A 5EVEA 3ZG7B 3LYXA 3O5YA 5DFYA 3CG5A 3KSIA 1S66L 3ZQ5A 2XH9A 5F6AA 3W4PA 2O9CA 5M18A 5CGWA 3N7WA 3UE1A 4CLCC 1K38A 2PDRA 4I38A 1N9OA 1H3QA 2Y79A 1XJ6A 2V1AA 4RR8A 1XX2A 4Y0TA 1JKEA 2XSSA 1BUEA 4IBRA 4OPYA 1MWSA 1ERMA 4DE0A 1WYCA 4HJ4A 3T4OA 2VX8A 2H28A 3LICA 3HCYA 2V9AA 4XT2A 2IWDA 1VQQA 3WS4A 4CLCA 4IVKA 3C4OA 5DKLA 4K08A 1IYOA 4KG6A 4NXBA 2O99A 3SOIA 2Q0OA 1NXYA 5DVAA 1IOUA 2XR0A 3CUEA 3GVBA 4N9KA 3LCEA 4FCFA 1YLWA 4BWIA 1YLJA 4PHTA 2A3UA 1CEFA 3LMVA 5TJJA 1E3UA 5EVID 4WELA 2WKQA 4R3JA 1HTZA 3NDEA 1PWGA 1TS8A 5TBMB 4E3MA 1NY0A 1MKMA 3KO4A 2ZLYA 1S1ZA 1ONHA 3KSHA 4C75A 2Z2MB 1ZHHB 4S03A 5HW3A 4QY6A 4EBPA 2V2FF 3GTCA 3C5AA 5EOOA 1K55A 2Z6DA 3JVUA 3JVVA 1OTDA 1L0GA 5E2EA 2PBDP 3V3RA 4UA9A 2VGLS 3QNCA 1W8YA 2C6WB 3W8KA 3WRZA 2I72A 3F1NA 3GSGA 3S7QA 4PKYG 3HLBA 3OCNA 4NETA 1ES3A 3C7UA 3BFGA 3MFXA 1S67L 2WGIA 4X53A 2P7JA 4LRZE 4HESA 3GECA 3HLWA 3VP3A 3BM6A 2XEPA 5J4EA 3HUNA 5FDSA 3ITAA 2ZMAA 3B42A 1DP8A 3E2KA 4WLAA 5EPHA 4QB8A 1MZUA 3GDIA 2KDKA 4WZ5C 5GLDA 1XGJA 1FIKA 3C2WA 4YNRA 3QNBA 4LRYC 4OOLA 4OP8A 1H5XA 2HGVA 1LSXA 3ZYTA 4HBUA 2DRWA 1TEMA 5A91A 3JPUA 3T1QB 5A92A 1LHYA 1FILA 3AGEA 3FG8A 4EEUA 3NHQA 3PAEA 4X55A 3NI9A 4GD6A 5GL9A 2EX6A 1IYPA 5I5LA 2XF3A 2XLNA 1NLYA 1PFLA 3E0YA 4WZ5A 3KX0X 4ETXA 4P85A 4DE2A 1Q2PA 2M7UA 3WS0A 3ZDJA 4DE1A 4X1MA 2YKFA 1ODVA 3SZTA 1BT5A 1K4EA 1GA0A 5HPFA 4MCWA 5JYOA 2WGWA 1IEMA 2EFUA 3BWLA 2Y2PA 4B93A 4S0LA 3FZCA 5TBMA 4C3QA 1A0KA 2ZQ7A 4HOIA 5HWVA 5HAQA 1ALQA 3T4TA 4N92A 4CLCB 2H0YA 3KOCA 4UA6A 4BBVA 3NECA 5F5YA 5A90A 5F82A 1K6SA 3P98A 3E4QA 4EETB 1ES2A 1SDNA 1AXBA 1K54A 3LIDA 4OLDA 3L7HA 2EA9A 3T12B 2PYRA 3SS4A 1W7FA 3BLMA 4Y13A 4FSFA 4D2OA 3WWXA 3NY4A 3MBZA 1LI9A 1MBLA 3LR5A 2G7UA 4LV0A 1NLZA 4NK3A 2L1MA 4BD1A 3IF6B 5KSHA 1HZOA 4S2OA 3SH9A 3CJMA 3RH8B 3GV9A 5L10A 1F2KA 4JKTA 3T4SA 3KO6A 1F98A 4KZ3A 1XP4A 3M2JA 4LFUA 1YMXA 2D02A 4WYYA 1GCEA 3QP4A 1XA7A 1L3LA 4JBFA 1W8QA 2Y91A 4BBTA 4GN2A 4H8RA 1BZAA 5AVEA 3HLDA 4BLMA 3E98A 3EQUA 2L0WA 5AQ9A 5FEFA 4P6BA 1ZTUA 3NCKA 1YMSA 2WKPA 2JCHA 5GHYA 3ZNYA 2PHYA 2VGLM 5DF7A 1QMEA 2DBOA 4R23A 4P6ZS 1EI5A 1YSQA 4BBUA 4CQHA 3T1SA 1DP6A 4EW7A 4RRQA 4Y3IA 1PI4A 2ZQ9A 1ESUA 4HP4A 3V3SA 4R70A 1ERQA 1K6RA 3IH8A 2WKRA 2EX8A 4WUJA 2WAFA 3UB9A 1OPXA 3CZDA 5F69A 4ME4A 5FA7A 2XFSA 4HP9A 3NC8A 4RR6A 2V1ZA 3P7NA 2V0UA 3BW6A 4ARZB 1PW8A 2JC7A 4KZ7A 4QU3A 1T1BA 3U4LP 4JGPA 3UB8A 2P9VB 1VEUA 1G68A 1SHVA 1DJBA 5KMWA 3W2ZA 5GLBA 3PBTA 2WZXA 3KO7A 4CLCE 4OQIA 4O8GA 4S02A 3U2AA 3IBJA 2XROA 5FI6A 3B33A 1OJGA 3ICYA 3BEBA 4RX3A 1LSWA 1D7EA 3TOIA 1BLCA 5A8BA 4UA7A 3LI9A 5DKKA 1LL9A 4Y17A 1YSPA 1F9IA 1GSXA 2V0WA 4P6ZM 2JKTI 1VETB 4KZBA 2J9OA 3A3JA 2INWA 1NYMA 5BOHA 2PBYA 3IF6A 3D3OA 1TVFA 4PM7A 4S0IA 3KYZA 4Y0OA 4GLQA 4GZBA 1TDGA 3C30A 4IHQA 5HARA 4BMWA 3RXWA 2B02A 2VZWA 1KE0A 4E3LA 2WZZA 2C5WB 3IXBA 2ZD8A 2Y8HA 3FC7A 1UGUA 3T1XA 4MNRA 2YKHA 2CMNA 3SW1A 3FKVA 3IF6C 1VM1A 1GHIA 4DXBA 1K0KA 2J3WA 4K0XA 2HJEA 3B47A 3Q7VA 2VGJA 4E3KA 4O01A 1T1AA 2ZJ9A 3M6BA 5E2GA 5G18A 3GR2A 4JF5A 1HLUP 3E2LA 3T4QA 2EX2A 2B95A 3PHYA 5HAPA 4I3AA 3H82B 4I39A 4XUXA 2PR6A 4NG2A 3Q81A 4HIAA 4RRCA 3G4PA 4NBIA 1M40A 1MXOA 1MY8A 2K31A 3EQVA 4HH3A 4EUZA 4HY8A 4XT2B 3VFHA 3H9WA 3IWIA 5EVIC 4KG5A 2EWVA 3BQ8A 2J8YA 5EECA 1XGIA 2HV1A 4LV2A 2HDUA 5HAIA 2DMWA 3F1OB 4R38A 5DTSA 4EEPA 4QD4A 3NOTC 4GDNA 2OV5A 3LEQA 1KE3A 1YT4A 4N9LA 2DNSA 2V8CA 4IVIA 3IHBA 3NJAA 3LR3A 2DCFA 5CX7A 2J3TC 1TF1A 2WGWB 2HL1A 3AGDA 1IELA 3VV4A 4HI4A 4LV3A 2HDRA 1XXMA 1KE4A 1Y54A 4JF4A 2OWJA 1ZG6A 4EQ1A 1H0MA 5FQMA 1I5QA 3HJKA 3EGDC 1OT9A 3KODA 4LENA 5FQ9A 5J3WA 3PBSA 4H6JA 3N4IA 5GLCA 5L09A 1PNEA 1P97A 3LMTA 1XA1A 1PRQA 4OPQA 2RCXA 2H0TA 4I5SA 3HLCA 4OQ0A 3A3IA 2IA2A 5EV0A 1I2SA 5GLAA 1G5UA 3PR6A 4LPZA 1DRMA 4HJ6A 2VEAA 1KGFA 3N8SA 4X56A 3WS1A 4QPRA 5GHZA 2BLSA 3FYZA 1DP9A 4BD0A 3GQZA 1FOFA 2O0YA 4YWZA 3SH7A 3VE4A 3IX4A 4KZ9A 4MEZA 4OPRA 1PW1A 2FZ0A 3JYIA 1K57A 4WBGA 3E4OA 3H82A 4DXCA 3PBQA 2UV0E 1UWNX 4RR7A 2HDSA 4ZRRA 4R1GA 3BYDA 4LRXC 3CWFA 3OPHA 1PYYA 1ZG4A 4RQ9A 1K4FA 3BFCA 3PYPA 5EFWA 3UO9A 5TFQA 2PD8A 4G3VA 2XD1A 3HLEA 3G30A 4BQMA 4E3NA 3ITBA 2ZBBA 3EGXC 5FATA 5HL6A 1K54C 3IXGA 1K56D 3HL9A 3UB5P 3KYQA 3VOYA 2OAQ1 4JF6A 4JXWA 2HDQA 2Y2KA 4FTXA 1IKGA 1VEUB 3MSHA 3B3XA 4D60A 3A0VA 5E2FA 4X68A 1OTEA 4OP5A 3G31A 1XFNA 4WZ4A 4EERA 4KZ4A 3A3DA 4S2MA 1S1YA 1G6OA 2XDMA 2Z2LB 1H8YA 1GSWA 1C3BA 4KG2A 2Y2HA 4RVAA 2G2WA 2A2LA 3H7WB 4JXSA 2R9WA 4WM9A 2ZMVA 4S2KA 1TD5A 2JN7A 4GNUA 3R7WA 2HP6A 1SKOB 3ZG5A 4MBHA 3LUQA 4EESA 2ZC6B 3UMDA 3T4KA 4B88A 4G3KA 1OJ5A 4N1XA 5L07A 1NZUA 5HD3A 2K7SA 1FSYA 1PWDA 4YFMA 5FSRA 4FUWA 3FKWA 3ULFA 3G2YA 3PBRA 4ZJ1A 4M3KA 1ZKJA 1XJ2A 1PZOA 1D06A 5FAQA 3IXDA 1TS6A 4GHIA 2P08A 3LIAA 3VP0A 3O86A 4MN7A 3ISGA 2W0NA 1YLZA 4Y15A 4LGWA 4IUKA 4OQHA 5FEGA 2J7VA 4IUHA 1IKIA 5CHJA 1YLYA 2ZOHA 4S2JA 1KVLA 3D72A 4K91A 5EVLA 3IS2A 1CEGA 1RP5A 4L9GA 4LV1A 1MPLA 3L9KA 4FH4A 2Y2IA 2OAP1 5DF9A 2QPNA 4NXEA 5AQBA 4F3LB 1W63Q 3PTEA 5HL1A 1KGEA 1SDEA 3QP6A 4ETZA 2OSUA 4I3JA 2W3DA 3RFBA 1BULA 4DRTA 3EEHA 5E43A 5DJUA 2W3EA 3BFFA 1OMEA 4S2NC 3V50A 4ARZA 1GHPA 3MKFA 4XXRA 2ZC3B 4GKUA 3VE3A 4RRJA 5L2FA 1P0ZA 4OLGA 5HD5A 1TC5A 3ZG0A 3TW8A 1MWTA 3DTIA 1UWPX 3ZG9B 1STZA 2HL0A 2I9VA 4PM9A 1L0EA 4B4XA 3LO7A 4ZTKA 3TJZC 1GSVA 5IHVA 3LFVA 4L9EA 4HNBA 5C5KA 3K3DA 4PPRA 4ZJ2A 4FD8A 3TSGA 2KX6A 4UHUA 1JNUA 5M19A 2HL2A 2M1CA 4NXGA 1JTDA 3VMAA 2W3GA 3BRMA 1JVJA 4S2PA 1N9NA 5A93A 2W3HA 5KZHA 1BLSA 2Y2NA 2Y4AA 3PAGA 1Y2QA 4BJPA 1CQAA 4Y2FA 5EE8A 2X01A 3SH8A 4I3IA 5HWWA 2P9VA 5G4ZA 1V9ZA 4DDYA 2O9AA 1RGZA 2V1BA 3PBOA 2LB9A 4IBXA 4GCZA 3ZG8B 4MN6A 4AFIA 2OLVA 4XUZA 2OWHA 4GW9A 4U0TA 1YAXA 3AGFA 3OBFA 5LBRA 1FR1A 1MWRA 1NYYA 3UDXA 4HEFA 4RX2A 3UE0A 4RRRA 2X02A 3PD2A 5DTTA 4MBFA 1N9BA 2VA0A 3RXXA 1H8MA 3CPTB
chains in the Genus database with same CATH topology
5HW3A 2CC1A 4QY6A 4QHCA 1FQGA 3OPLA 4DE3A 4XUXA 4Z9QA 4EBPA 4X6TA 4KQRA 5E2HA 2V2FF 3SS5A 3GTCA 3C5AA 5EOOA 3UDFA 3C4PA 4DDSA 1K55A 1K25A 1W79A 1BSGA 1K55C 3HVFA 3Q81A 3DWZA 4RRCA 2RL3A 3G4PA 4NBIA 3N8LA 4GDBA 1M40A 1L0GA 1MXOA 1MY8A 3EQVA 2FFFB 3M6HA 4N1HA 5E2EA 4MBKA 4EUZA 3V3RA 3ZNTA 2WADA 4UA9A 3VOZA 3VFHA 3UDIA 2PU4A 3IWIA 5EVIC 3QNCA 1W8YA 4KG5A 2C6WB 3W8KA 4JPMA 3WRZA 2J8YA 5EECA 1XGIA 2I72A 1BTLA 1L0FA 4RRLA 3GSGA 3HLBA 3OCNA 4LV2A 2HDUA 4NETA 3V39A 1ES3A 3C7UA 3UPNA 3VP4A 5HAPA 5HAIA 3BFGA 5CECA 5DTSA 4ZJ3A 2WGIA 4HBTA 4X53A 2HP9A 4QD4A 3MZDA 3N8RA 4GDNA 4HESA 2ZM8A 4EBLA 2OV5A 1KE3A 3HLWA 5GHXA 3OZHA 3BM6A 1YT4A 3VP3A 3HLFA 2XEPA 2OKVA 4N9LA 2ZC5B 4IVIA 3IHBA 5JYPA 4ZAMA 3HUNA 2DCFA 3ITAA 2ZMAA 3E2KA 5EPHA 2Y59A 3GMWA 2WGWB 4RRIA 2IWBA 4RA7A 4QB8A 5FI7A 2HL1A 1GA9A 1DJCA 2EXAA 3AGDA 3BFEA 4L0LA 3OCLA 3IXHA 1IELA 4WZ5C 4LV3A 3TG9A 5GLDA 1XGJA 1PWCA 2HDRA 4OPZA 1XXMA 3QNBA 2H5SA 1KE4A 1Y54A 4JF4A 4OP8A 4OOLA 4RRFA 1ZG6A 1H5XA 4EV4A 5FQMA 1I5QA 3IQAA 4UAAA 4WMCA 3MKEA 2Y2LA 3ZVTA 3KODA 3DW0A 4LENA 5FQ9A 3PBSA 4HBUA 2DRWA 1W5DA 5FDHA 3N4IA 5GLCA 1N4OA 2HPBA 1TEMA 4O7DA 5A91A 2ZQDA 3LMTA 1XA1A 4OPQA 2RCXA 2H0TA 5A92A 4RRGA 4OOMA 1LHYA 1FCOA 3D4FA 3AGEA 1E4DA 3PAEA 4X55A 3NI9A 4GD6A 1WE4A 3HLCA 4GOGA 5GL9A 2EX6A 4RYEA 4OQ0A 3A3IA 4PM6A 5FQIA 1IYPA 1I2SA 3UNWA 5GLAA 4E3OA 2XF3A 1SCWA 2XLNA 4CJNA 4KZ8A 4WZ5A 5KSCA 1KGFA 2ZM2A 1RGYA 3CMZA 3N8SA 4X56A 3G2ZA 2XD5A 1LI0A 1O7EA 3IWQA 4P85A 4RR9A 3WS1A 1RCJA 4ZBEA 5GHZA 2BLSA 4DE2A 1Q2PA 3FYZA 3QHYA 3LMUA 4BD0A 3GQZA 1PIOA 1FOFA 3WS0A 5J61A 3ZDJA 4DE1A 4DF6A 3SH7A 1KDWA 3MZEA 3NBLA 2V20A 2UWXA 2WAEA 5TR7A 1BT5A 5CTMA 4KZ9A 1YQSA 3WS2A 4MEZA 1SKFA 4OPRA 1PW1A 1CI9A 5CRFA 2Y2OA 5D3OA 3JYIA 1TDLA 1K4EA 1K57A 4WMCD 1GA0A 4WBGA 5FI2A 2ZQCA 5JYOA 1YM1A 2WGWA 4DXCA 1DY6A 3PBQA 1KVMA 1IEMA 4BL2A 3GRJA 2EFUA 2Y2PA 2ZQ8A 4KZ6A 3FZCA 4S0LA 3KNFA 3WS5A 4RR7A 1ONGA 2HDSA 4C3QA 4R1GA 1JWVA 4QJGA 3BYDA 2ZQ7A 3HREA 3IT9A 3ZCZA 3OPHA 1PYYA 1ZG4A 5HAQA 1ALQA 1K4FA 3A3FA 3BFCA 3UO9A 4N92A 5TFQA 4RRAA 3Q7VB 2WYXA 2H0YA 3G34A 2XD1A 3HLEA 5HFOA 3KOCA 3G30A 4BQMA 4E3NA 4JLFA 3ITBA 4UA6A 4Q8IA 3BECA 5A90A 5F82A 1K6SA 3Q07A 5FATA 5M1AA 3P98A 3O88A 1ES2A 1K54C 1Q2QA 2ZC7A 3IXGA 5EVIB 5CTNA 1K56D 1SDNA 1AXBA 3HL9A 1K54A 3VOYA 1JWZA 4JF6A 4S2IA 4OLDA 4JXWA 3MFDA 1J7GA 3IH9A 2HDQA 3G35A 5CGXA 3BFDA 3ZFZA 1CK3A 1FCNA 2Y2KA 3SS4A 1MWUA 1W7FA 1IKGA 2BG1A 2H10A 3BLMA 3Q1FA 5DTKA 4FSFA 2JE5A 3WRTA 4D2OA 3WWXA 3MXSA 3NY4A 3MBZA 3B3XA 3S22A 1LI9A 1MBLA 4X68A 4KENB 5CHUA 5E2FA 2Y2MA 5CGSA 4KZ5A 4LV0A 4OP5A 4JXGA 3IHAA 3G31A 4NK3A 4EBNA 2Y2GA 2Q9NA 4E6XA 4BD1A 3IF6B 4WZ4A 1LLBA 5KSHA 3ZVWA 2EFXA 4KZ4A 2GDNA 1HZOA 3A3DA 3DWKA 4FH2A 4S2OA 3SH9A 3CJMA 3GV9A 3C7VA 4S2MA 5F1GA 4JKTA 4PM8A 1FSWA 2XDMA 2Z2LB 3UE3A 3ZGAB 1H8YA 1MKIA 4KZ3A 1C3BA 1XP4A 4KG2A 5EOEA 2Y2HA 3M2JA 4RVAA 2QMIA 4A5RA 1YMXA 2G2WA 4RRKA 4WYYA 3MXRA 2B5RA 1GCEA 4JXSA 2R9WA 1ES5A 3IWOA 4WM9A 3A3EA 5DF8A 1NJ4A 3LY3A 1XA7A 4JBFA 1W8QA 2Y91A 4S2KA 4GNUA 5FAOA 5I94A 1E3UD 4GN2A 2ZM0A 2HP6A 4H8RA 1ESIA 4LCMA 1BZAA 1K57C 1HVBA 4KQOA 3HLDA 4S2NA 4U0XA 2WGVA 4K0WA 4MBHA 5CERA 3ZG5A 2ZC6B 4BLMA 2XQZA 3EQUA 3HBRA 5FQJA 5AQ9A 4B88A 4RRBA 1KGGA 2FFYA 4N1XA 4P6BA 5EUAA 4F94A 3NCKA 1Z6FA 1YMSA 1NZUA 4E3IA 1FSYA 5FQKA 4S0KA 1PWDA 3VSKA 4YFMA 2JCHA 2WK0A 5FSRA 3HLGA 3KO3A 3FKWA 5GHYA 3ZNYA 1HD8A 3UPOA 1GHMA 3UN7A 3G2YA 3PBRA 4Y0UA 4M3KA 1ZKJA 1DJAA 2WKIA 4ZJ1A 3MZFA 1I2WA 5FQQA 5DF7A 1QMEA 2EX9A 4LCLA 1PZOA 4MLLA 2EXBA 2DBOA 5FAQA 4R23A 4OH0A 1M6KA 4ID4A 2Y2QA 3IXDA 1EI5A 4DKIA 4R4RA 5U47A 1XPBA 3VP0A 2E8IA 2VGKA 5CEDA 1LL5A 3OPRA 2QZ6A 2XK1A 2X71A 3O86A 3ISGA 2ZC4B 1YLZA 1ES4A 4RRQA 1G6AA 4OQHA 3W4OA 4S0JA 1PI4A 4KZAA 1IYSA 2ZQ9A 4WEKA 1ESUA 2J7VA 1EWZA 3OPPA 4OOYA 3S4XA 1IKIA 2HP5A 5CHJA 3G32A 1YLYA 1ERQA 3V3SA 3RJUA 1K6RA 1XKZA 3IH8A 2EX8A 1ZC2A 3NIAA 4JXVA 3VSLA 2IWCA 4S2JA 5CEBA 1E25A 2WAFA 1YLTA 1KVLA 5F1FA 4GD8A 3PBNA 1K56A 3HUOA 4K91A 4OVDA 4U3TA 5EVLA 3CZDA 2J9PA 1JWPA 3PD5A 2WKEA 5FA7A 1CEGA 1RP5A 4B4ZA 1J9MA 2Y55A 1KDSA 3VP1A 2XFSA 3Q7ZA 4LV1A 3NC8A 4RRHA 1MPLA 3PD4A 4RR6A 4FH4A 1NRFA 3PD3A 2V1ZA 2Y2IA 2HKZA 5DF9A 1U60A 2Y2JA 1JTGA 2QPNA 5AQBA 4EWFA 4ZDXA 1PI5A 4E6WA 3NDGA 2WKHA 3PTEA 5HL1A 2JBFA 1PW8A 2JC7A 3O3VA 4KZ7A 1KGEA 1SDEA 4QY5A 4R0QA 2XFTA 4PMAA 4QU3A 3HUMA 3FWLA 2OSUA 5AQ7A 4Y7PA 4R4SA 1BULA 2G2UA 3IF5A 4DRTA 2P9VB 4OONA 5E43A 5AQAA 4C6YA 4S2LA 1L2SA 1G68A 1SHVA 4KQQA 1DJBA 3BFFA 4P0MA 5KMWA 1OMEA 4S2NC 5GLBA 4E3JA 5CXWA 2OLUA 3PBTA 2WZXA 2P74A 3V50A 4BENA 1GHPA 1YLPA 3KO7A 4IEDA 5EVIA 4OQIA 3M2KA 3SS3A 3MKFA 4XXRA 2ZC3B 1S0WA 4GKUA 4S02A 1L0DA 3V5MA 4RRJA 3KOBA 3Q82A 5L2FA 4OLGA 3ZG7B 4EQIA 5FI6A 1TC5A 3VP2A 3CG5A 3LY4A 3BEBA 3ZG0A 1MWTA 1BLPA 2XH9A 3O87A 5CHMA 3KO9A 4RX3A 3ZG9B 4OKPA 3TOIA 1BLCA 3W4PA 2HL0A 4PM9A 3W4QA 3N6IA 4UA7A 5M18A 3UPPA 2WUQA 1L0EA 4WEJA 4B4XA 1LL9A 3LO7A 5CGWA 3ZHHA 3N7WA 4ZTKA 3UE1A 3DTMA 5IHVA 1K38A 3LEZA 5FAPA 1QMFA 5F83A 4KZBA 2J9OA 3BLSA 4RR8A 1XX2A 3A3JA 4PPRA 4ZJ2A 2ZQAA 4FD8A 3UY6A 4Y0TA 3I7JA 1JKEA 3TSGA 1IYQA 1BUEA 4UHUA 4IBRA 1S6RA 5M19A 4OPYA 1NYMA 5BOHA 1MWSA 2HL2A 1ERMA 4NBJA 2PBYA 4DE0A 3IF6A 2PU2A 3KO5A 1TVFA 4PM7A 1JTDA 2Q9MA 1PZPA 3BRMA 3VMAA 1JVJA 4S0IA 1WYCA 4S2PA 4GB7A 4Y0OA 5A93A 4GZBA 5KZHA 4RRMA 1TDGA 2IWDA 1BLSA 4PM5A 2Y2NA 1VQQA 2Y4AA 3PAGA 3WS4A 5HARA 1Y2QA 4RRDA 3RXWA 1H8ZA 4BJPA 2X01A 4IVKA 5EE8A 3C4OA 3SH8A 1NZOA 1KE0A 3P09A 1CI8A 2P9VA 4DDYA 1RGZA 1IYOA 4OQGA 4KG6A 4E3LA 3PBOA 3SOIA 1EROA 4YINA 1NXYA 5DVAA 2WZZA 2C5WB 3IXBA 2ZD8A 3S1YA 2XR0A 3VFFA 3GVBA 4IBXA 4X69A 4S03A 4N9KA 5HX9A 3ZG8B 3LCEA 2OLVA 4FCFA 4MNRA 1YLWA 3OC2A 4XUZA 1BLHA 1YLJA 3FKVA 3IF6C 1VM1A 1GHIA 1WYBA 4U0TA 4DXBA 4CPKA 3AGFA 4K0XA 5TGFA 2A3UA 2R9XA 1CEFA 3KNPA 2A49A 3LMVA 1E3UA 1FR1A 1MWRA 5EVID 1NYYA 4WELA 3UDXA 3Q7VA 2VGJA 4E3KA 4HEFA 3FV7A 4R3JA 1FR6A 4R3BA 4RX2A 2ZJ9A 1O07A 5FASA 3M6BA 5E2GA 1HTZA 5G18A 3GR2A 4JF5A 1FCMA 3E2LA 3NDEA 3UE0A 4RRRA 2XGNA 4BL3A 2X02A 1PWGA 3PD2A 5DTTA 4E3MA 2EX2A 1NY0A 4MBFA 5J8XA 1N9BA 3RXXA 4P87A 3KO4A 2DNSA 2ZLYA 4C75A 1ONHA 2Z2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW3 A;  2CC1 A;  4QY6 A;  4QHC A;  1FQG A;  3OPL A;  4DE3 A;  4XUX A;  4Z9Q A;  4EBP A;  4X6T A;  4KQR A;  5E2H A;  2V2F F;  3SS5 A;  3GTC A;  3C5A A;  5EOO A;  3UDF A;  3C4P A;  4DDS A;  1K55 A;  1K25 A;  1W79 A;  1BSG A;  1K55 C;  3HVF A;  3Q81 A;  3DWZ A;  2RL3 A;  3G4P A;  3N8L A;  4GDB A;  1M40 A;  1L0G A;  1MXO A;  1MY8 A;  3EQV A;  2FFF B;  3M6H A;  4N1H A;  5E2E A;  4MBK A;  4EUZ A;  3V3R A;  3ZNT A;  2WAD A;  4UA9 A;  3VOZ A;  3VFH A;  3UDI A;  2PU4 A;  3IWI A;  5EVI C;  3QNC A;  1W8Y A;  4KG5 A;  2C6W B;  3W8K A;  4JPM A;  3WRZ A;  2J8Y A;  5EEC A;  1XGI A;  2I72 A;  1BTL A;  1L0F A;  3GSG A;  3HLB A;  3OCN A;  4LV2 A;  2HDU A;  4NET A;  3V39 A;  1ES3 A;  3C7U A;  3UPN A;  3VP4 A;  5HAP A;  5HAI A;  3BFG A;  5CEC A;  5DTS A;  4ZJ3 A;  2WGI A;  4HBT A;  4X53 A;  2HP9 A;  4QD4 A;  3MZD A;  3N8R A;  4GDN A;  4HES A;  2ZM8 A;  4EBL A;  2OV5 A;  1KE3 A;  3HLW A;  5GHX A;  3OZH A;  3BM6 A;  1YT4 A;  3VP3 A;  3HLF A;  2XEP A;  4N9L A;  2ZC5 B;  4IVI A;  3IHB A;  5JYP A;  4ZAM A;  3HUN A;  2DCF A;  3ITA A;  2ZMA A;  3E2K A;  5EPH A;  2Y59 A;  3GMW A;  2WGW B;  2IWB A;  4RA7 A;  4QB8 A;  5FI7 A;  1GA9 A;  1DJC A;  2EXA A;  3AGD A;  3BFE A;  4L0L A;  3OCL A;  3IXH A;  1IEL A;  4WZ5 C;  4LV3 A;  3TG9 A;  5GLD A;  1XGJ A;  1PWC A;  2HDR A;  4OPZ A;  1XXM A;  3QNB A;  2H5S A;  1KE4 A;  1Y54 A;  4JF4 A;  4OP8 A;  4OOL A;  1ZG6 A;  1H5X A;  4EV4 A;  5FQM A;  1I5Q A;  3IQA A;  4UAA A;  4WMC A;  3MKE A;  2Y2L A;  3ZVT A;  3DW0 A;  4LEN A;  5FQ9 A;  3PBS A;  4HBU A;  2DRW A;  1W5D A;  5FDH A;  3N4I A;  5GLC A;  1N4O A;  2HPB A;  1TEM A;  4O7D A;  5A91 A;  2ZQD A;  1XA1 A;  4OPQ A;  2RCX A;  2H0T A;  5A92 A;  4OOM A;  1LHY A;  1FCO A;  3D4F A;  3AGE A;  1E4D A;  3PAE A;  4X55 A;  3NI9 A;  4GD6 A;  1WE4 A;  3HLC A;  4GOG A;  5GL9 A;  2EX6 A;  4RYE A;  4OQ0 A;  3A3I A;  4PM6 A;  5FQI A;  1IYP A;  1I2S A;  3UNW A;  5GLA A;  4E3O A;  2XF3 A;  1SCW A;  2XLN A;  4CJN A;  4KZ8 A;  4WZ5 A;  5KSC A;  1KGF A;  2ZM2 A;  1RGY A;  3CMZ A;  3N8S A;  4X56 A;  3G2Z A;  2XD5 A;  1LI0 A;  1O7E A;  3IWQ A;  4P85 A;  3WS1 A;  1RCJ A;  4ZBE A;  5GHZ A;  2BLS A;  4DE2 A;  1Q2P A;  3FYZ A;  3QHY A;  4BD0 A;  3GQZ A;  1PIO A;  1FOF A;  3WS0 A;  3ZDJ A;  4DE1 A;  4DF6 A;  3SH7 A;  1KDW A;  3MZE A;  3NBL A;  2V20 A;  2UWX A;  2WAE A;  5TR7 A;  1BT5 A;  5CTM A;  4KZ9 A;  1YQS A;  3WS2 A;  4MEZ A;  1SKF A;  4OPR A;  1PW1 A;  1CI9 A;  5CRF A;  2Y2O A;  5D3O A;  3JYI A;  1TDL A;  1K4E A;  1K57 A;  4WMC D;  1GA0 A;  4WBG A;  5FI2 A;  2ZQC A;  5JYO A;  1YM1 A;  2WGW A;  4DXC A;  1DY6 A;  3PBQ A;  1KVM A;  1IEM A;  4BL2 A;  3GRJ A;  2EFU A;  2Y2P A;  2ZQ8 A;  4KZ6 A;  3FZC A;  3WS5 A;  1ONG A;  2HDS A;  4C3Q A;  4R1G A;  1JWV A;  4QJG A;  3BYD A;  2ZQ7 A;  3HRE A;  3IT9 A;  3ZCZ A;  3OPH A;  1PYY A;  1ZG4 A;  5HAQ A;  1ALQ A;  1K4F A;  3A3F A;  3BFC A;  3UO9 A;  4N92 A;  5TFQ A;  3Q7V B;  2WYX A;  2H0Y A;  3G34 A;  2XD1 A;  3HLE A;  5HFO A;  3G30 A;  4BQM A;  4E3N A;  4JLF A;  3ITB A;  4UA6 A;  4Q8I A;  3BEC A;  5A90 A;  5F82 A;  1K6S A;  3Q07 A;  5FAT A;  5M1A A;  3P98 A;  3O88 A;  1ES2 A;  1K54 C;  1Q2Q A;  2ZC7 A;  3IXG A;  5EVI B;  5CTN A;  1K56 D;  1SDN A;  1AXB A;  3HL9 A;  1K54 A;  3VOY A;  1JWZ A;  4JF6 A;  4S2I A;  4OLD A;  4JXW A;  3MFD A;  3IH9 A;  2HDQ A;  3G35 A;  5CGX A;  3BFD A;  3ZFZ A;  1CK3 A;  1FCN A;  2Y2K A;  3SS4 A;  1MWU A;  1W7F A;  1IKG A;  2BG1 A;  2H10 A;  3BLM A;  3Q1F A;  5DTK A;  4FSF A;  2JE5 A;  3WRT A;  4D2O A;  3WWX A;  3MXS A;  3NY4 A;  3MBZ A;  3B3X A;  3S22 A;  1LI9 A;  1MBL A;  4X68 A;  4KEN B;  5CHU A;  5E2F A;  2Y2M A;  5CGS A;  4KZ5 A;  4LV0 A;  4OP5 A;  4JXG A;  3IHA A;  3G31 A;  4NK3 A;  4EBN A;  2Y2G A;  2Q9N A;  4E6X A;  4BD1 A;  3IF6 B;  4WZ4 A;  1LLB A;  5KSH A;  3ZVW A;  2EFX A;  4KZ4 A;  2GDN A;  1HZO A;  3A3D A;  3DWK A;  4FH2 A;  4S2O A;  3SH9 A;  3CJM A;  3GV9 A;  3C7V A;  4S2M A;  5F1G A;  4JKT A;  4PM8 A;  1FSW A;  2XDM A;  2Z2L B;  3UE3 A;  3ZGA B;  1H8Y A;  1MKI A;  4KZ3 A;  1C3B A;  1XP4 A;  4KG2 A;  5EOE A;  2Y2H A;  3M2J A;  4RVA A;  2QMI A;  4A5R A;  1YMX A;  2G2W A;  4WYY A;  3MXR A;  2B5R A;  1GCE A;  4JXS A;  2R9W A;  1ES5 A;  3IWO A;  4WM9 A;  3A3E A;  5DF8 A;  1NJ4 A;  3LY3 A;  1XA7 A;  4JBF A;  1W8Q A;  2Y91 A;  4S2K A;  4GNU A;  5FAO A;  5I94 A;  1E3U D;  4GN2 A;  2ZM0 A;  2HP6 A;  4H8R A;  1ESI A;  4LCM A;  1BZA A;  1K57 C;  1HVB A;  4KQO A;  3HLD A;  4S2N A;  4U0X A;  2WGV A;  4K0W A;  4MBH A;  5CER A;  3ZG5 A;  2ZC6 B;  4BLM A;  2XQZ A;  3EQU A;  3HBR A;  5FQJ A;  5AQ9 A;  4B88 A;  1KGG A;  2FFY A;  4N1X A;  4P6B A;  5EUA A;  4F94 A;  3NCK A;  1Z6F A;  1YMS A;  1NZU A;  4E3I A;  1FSY A;  5FQK A;  1PWD A;  3VSK A;  4YFM A;  2JCH A;  2WK0 A;  5FSR A;  3HLG A;  3FKW A;  5GHY A;  3ZNY A;  1HD8 A;  3UPO A;  1GHM A;  3UN7 A;  3G2Y A;  3PBR A;  4Y0U A;  4M3K A;  1ZKJ A;  1DJA A;  2WKI A;  4ZJ1 A;  3MZF A;  1I2W A;  5FQQ A;  5DF7 A;  1QME A;  2EX9 A;  4LCL A;  1PZO A;  4MLL A;  2EXB A;  5FAQ A;  4R23 A;  4OH0 A;  1M6K A;  4ID4 A;  2Y2Q A;  3IXD A;  1EI5 A;  4DKI A;  4R4R A;  5U47 A;  1XPB A;  3VP0 A;  2E8I A;  2VGK A;  5CED A;  1LL5 A;  3OPR A;  2QZ6 A;  2XK1 A;  2X71 A;  3O86 A;  3ISG A;  2ZC4 B;  1YLZ A;  1ES4 A;  1G6A A;  4OQH A;  3W4O A;  1PI4 A;  4KZA A;  1IYS A;  2ZQ9 A;  4WEK A;  1ESU A;  2J7V A;  1EWZ A;  3OPP A;  4OOY A;  3S4X A;  1IKI A;  2HP5 A;  5CHJ A;  3G32 A;  1YLY A;  1ERQ A;  3V3S A;  3RJU A;  1K6R A;  1XKZ A;  3IH8 A;  2EX8 A;  1ZC2 A;  3NIA A;  4JXV A;  3VSL A;  2IWC A;  4S2J A;  5CEB A;  1E25 A;  2WAF A;  1YLT A;  1KVL A;  5F1F A;  4GD8 A;  3PBN A;  1K56 A;  3HUO A;  4K91 A;  4OVD A;  4U3T A;  5EVL A;  3CZD A;  2J9P A;  1JWP A;  2WKE A;  5FA7 A;  1CEG A;  1RP5 A;  4B4Z A;  1J9M A;  2Y55 A;  1KDS A;  3VP1 A;  2XFS A;  3Q7Z A;  4LV1 A;  3NC8 A;  1MPL A;  4FH4 A;  1NRF A;  2V1Z A;  2Y2I A;  5DF9 A;  1U60 A;  2Y2J A;  1JTG A;  2QPN A;  5AQB A;  4EWF A;  4ZDX A;  1PI5 A;  4E6W A;  3NDG A;  2WKH A;  3PTE A;  5HL1 A;  2JBF A;  1PW8 A;  2JC7 A;  3O3V A;  4KZ7 A;  1KGE A;  1SDE A;  4QY5 A;  4R0Q A;  2XFT A;  4PMA A;  4QU3 A;  3HUM A;  3FWL A;  2OSU A;  5AQ7 A;  4Y7P A;  4R4S A;  1BUL A;  2G2U A;  3IF5 A;  4DRT A;  2P9V B;  4OON A;  5E43 A;  5AQA A;  4C6Y A;  4S2L A;  1L2S A;  1G68 A;  1SHV A;  4KQQ A;  1DJB A;  3BFF A;  4P0M A;  5KMW A;  1OME A;  4S2N C;  5GLB A;  4E3J A;  5CXW A;  2OLU A;  3PBT A;  2WZX A;  2P74 A;  3V50 A;  4BEN A;  1GHP A;  1YLP A;  4IED A;  5EVI A;  4OQI A;  3M2K A;  3SS3 A;  3MKF A;  4XXR A;  2ZC3 B;  1S0W A;  4GKU A;  1L0D A;  3V5M A;  3Q82 A;  5L2F A;  4OLG A;  3ZG7 B;  4EQI A;  5FI6 A;  3VP2 A;  3CG5 A;  3LY4 A;  3BEB A;  3ZG0 A;  1MWT A;  1BLP A;  2XH9 A;  3O87 A;  5CHM A;  4RX3 A;  3ZG9 B;  4OKP A;  3TOI A;  1BLC A;  3W4P A;  4PM9 A;  3W4Q A;  3N6I A;  4UA7 A;  5M18 A;  3UPP A;  2WUQ A;  1L0E A;  4WEJ A;  4B4X A;  1LL9 A;  3LO7 A;  5CGW A;  3ZHH A;  3N7W A;  4ZTK A;  3UE1 A;  3DTM A;  5IHV A;  1K38 A;  3LEZ A;  5FAP A;  1QMF A;  5F83 A;  4KZB A;  2J9O A;  3BLS A;  1XX2 A;  3A3J A;  4PPR A;  4ZJ2 A;  2ZQA A;  4FD8 A;  3UY6 A;  4Y0T A;  3I7J A;  3TSG A;  1IYQ A;  1BUE A;  4UHU A;  4IBR A;  1S6R A;  5M19 A;  4OPY A;  1NYM A;  5BOH A;  1MWS A;  1ERM A;  2PBY A;  4DE0 A;  3IF6 A;  2PU2 A;  1TVF A;  4PM7 A;  1JTD A;  2Q9M A;  1PZP A;  3BRM A;  3VMA A;  1JVJ A;  1WYC A;  4S2P A;  4GB7 A;  4Y0O A;  5A93 A;  4GZB A;  5KZH A;  1TDG A;  2IWD A;  1BLS A;  4PM5 A;  2Y2N A;  1VQQ A;  2Y4A A;  3PAG A;  3WS4 A;  5HAR A;  3RXW A;  1H8Z A;  4BJP A;  2X01 A;  4IVK A;  5EE8 A;  3C4O A;  3SH8 A;  1NZO A;  1KE0 A;  3P09 A;  1CI8 A;  2P9V A;  4DDY A;  1RGZ A;  1IYO A;  4OQG A;  4KG6 A;  4E3L A;  3PBO A;  3SOI A;  1ERO A;  4YIN A;  1NXY A;  5DVA A;  2WZZ A;  2C5W B;  3IXB A;  2ZD8 A;  3S1Y A;  2XR0 A;  3VFF A;  3GVB A;  4IBX A;  4X69 A;  4N9K A;  5HX9 A;  3ZG8 B;  3LCE A;  2OLV A;  4FCF A;  4MNR A;  1YLW A;  3OC2 A;  4XUZ A;  1BLH A;  1YLJ A;  3FKV A;  3IF6 C;  1VM1 A;  1GHI A;  1WYB A;  4U0T A;  4DXB A;  4CPK A;  3AGF A;  4K0X A;  5TGF A;  2A3U A;  2R9X A;  1CEF A;  2A49 A;  1E3U A;  1FR1 A;  1MWR A;  5EVI D;  1NYY A;  4WEL A;  3UDX A;  3Q7V A;  2VGJ A;  4E3K A;  4HEF A;  3FV7 A;  4R3J A;  1FR6 A;  4R3B A;  4RX2 A;  2ZJ9 A;  1O07 A;  5FAS A;  3M6B A;  5E2G A;  1HTZ A;  5G18 A;  3GR2 A;  4JF5 A;  1FCM A;  3E2L A;  3NDE A;  3UE0 A;  2XGN A;  4BL3 A;  2X02 A;  1PWG A;  5DTT A;  4E3M A;  2EX2 A;  1NY0 A;  4MBF A;  5J8X A;  1N9B A;  3RXX A;  4P87 A;  2DNS A;  2ZLY A;  4C75 A;  1ONH A;  2Z2M B; 
#chains in the Genus database with same CATH topology
 2CC1 A;  1LT0 A;  4DE3 A;  3MMH A;  4X6T A;  5E2H A;  3SS5 A;  3UDF A;  3C4P A;  1K25 A;  4II7 A;  2PD7 A;  3HVF A;  2RL3 A;  4GDB A;  3M6H A;  3ZNT A;  3VOZ A;  3T4L A;  4JPM A;  3LIB A;  1BTL A;  2GJ3 A;  4MN5 A;  2O9B A;  1V9Y A;  3UPN A;  3VP4 A;  4ZJ3 A;  2HP9 A;  2W1T B;  3N8R A;  4EBL A;  1SKO A;  1XFQ A;  3HLF A;  2OKV A;  5G4Y A;  2ZC5 B;  5DJT A;  2ZL1 B;  4ZAM A;  4JGO A;  1XJ3 A;  2Y59 A;  4RA7 A;  5FI7 A;  2W3F A;  2ZMF A;  3T50 A;  2EXA A;  3BFE A;  4L0L A;  1LSV A;  3IXH A;  3CUE C;  3TG9 A;  1PWC A;  3NOU C;  2ZOI A;  1KOU A;  2H5S A;  2A24 B;  4RRF A;  4GHI B;  3IQA A;  4WMC A;  3IBR A;  2JKG A;  3ZVT A;  4WL9 A;  2VV8 A;  1W5D A;  4FOF A;  1W63 M;  5FDH A;  1N4O A;  2HPB A;  4O7D A;  1T19 A;  2ZQD A;  2XA7 M;  4RRG A;  4OOM A;  4PAU A;  2VV6 A;  1WE4 A;  4GOG A;  4RYE A;  4DJ3 A;  5FQI A;  1CF0 A;  3UNW A;  4E3O A;  1SCW A;  4CJN A;  5KSC A;  1RGY A;  3CMZ A;  5J7E A;  1LI0 A;  2XD5 A;  4QWO A;  1RCJ A;  5EM0 A;  1ACF A;  3QHY A;  2VKS A;  3S7O A;  2EWW A;  2VLG A;  5J61 A;  4MDZ A;  1KDW A;  3NBL A;  2V20 A;  5TR7 A;  4UEY A;  5CTM A;  5MC7 A;  1TDL A;  2ZQC A;  2JKT M;  1DY6 A;  2B18 A;  4MMN A;  3S7P A;  2ZQ8 A;  3KNF A;  3F1P A;  3WS5 A;  1ONG A;  1JWV A;  4QJG A;  3HRE A;  2PAV P;  2LB5 A;  4RRA A;  3Q7V B;  3G34 A;  4JLF A;  3C8C A;  3BEC A;  4Q8I A;  3Q07 A;  5HSQ A;  2R78 A;  5M1A A;  3O88 A;  1Q2Q A;  2M7V A;  3CHW P;  4DMZ A;  4S2I A;  3C38 A;  2KOI A;  1J7G A;  3G35 A;  5CGX A;  3BFD A;  5IT5 A;  3ZFZ A;  1CK3 A;  3LGO A;  1MWU A;  2BG1 A;  2H10 A;  3Q1F A;  4WN5 A;  2JE5 A;  1T18 A;  3S22 A;  1N9L A;  5CHU A;  1OT6 A;  5CGS A;  4KZ5 A;  3VOL A;  5KIZ A;  4EXO A;  4EUV A;  3A0R A;  1P9R A;  4JXG A;  5IU1 A;  2Q9N A;  4E6X A;  3V67 A;  2EFX A;  4UQI S;  4JGR A;  3ZGA B;  1MKI A;  3DBA A;  4A5R A;  3E4P A;  4RRK A;  2Z6C A;  2B5R A;  1NJ4 A;  3LY3 A;  4KQD A;  5FAO A;  1ESI A;  1HVB A;  2WGV A;  5CER A;  2XQZ A;  3HBR A;  5FQJ A;  4RRB A;  5EUA A;  2PR5 A;  4E3I A;  2W27 A;  1P9W A;  3CI6 A;  2WK0 A;  3KO3 A;  3HLG A;  2P04 A;  3UPO A;  1HD8 A;  4Y0U A;  1DJA A;  2WKI A;  3MQO A;  4Q0J A;  5FQQ A;  2OOL A;  4MLL A;  2EXB A;  5F68 A;  4G3W A;  1M6K A;  4DKI A;  2V8F A;  5U47 A;  2E8I A;  3EEA A;  1LL5 A;  2QZ6 A;  4Y5F A;  2ZC4 B;  1ES4 A;  2NUT C;  4S0J A;  1IYS A;  1LL8 A;  1EWZ A;  4OOY A;  3G32 A;  3K3C A;  3RJU A;  1XKZ A;  2ACG A;  4JXV A;  1AWI A;  1E25 A;  5F1F A;  3PBN A;  3HUO A;  4U3T A;  4OVD A;  2L4R A;  3PD5 A;  2K2N A;  3VP1 A;  3PD4 A;  1XJ4 A;  2JKF A;  3BY8 A;  3PD3 A;  3TE8 A;  1U60 A;  3G6O A;  2QKP A;  1JTG A;  4LLO B;  4ZDX A;  3A0S A;  2PT7 A;  3O3V A;  4QY5 A;  2XFT A;  4PMA A;  3FWL A;  4Y7P A;  2D01 A;  2G2U A;  4JGQ A;  3MF0 A;  4OON A;  4Q0H A;  4HHD A;  3KSG A;  1L2S A;  4KQQ A;  3MR0 A;  5HWT A;  4GS9 B;  3F1P B;  2P74 A;  4BEN A;  4KUO A;  3M2K A;  1S0W A;  1L0D A;  2J3T D;  4HQA A;  4EQI A;  1OTA A;  3VP2 A;  3LY4 A;  2HF6 A;  4HH2 A;  1BLP A;  3O87 A;  5CHM A;  3KO9 A;  2BTF P;  4OKP A;  2PYP A;  3W4Q A;  3N6I A;  2QHK A;  3UPP A;  2WUQ A;  4WEJ A;  4EU0 A;  3ZHH A;  3DTM A;  3S7N A;  3LEZ A;  5FAP A;  3NOP C;  1QMF A;  5F83 A;  3BLS A;  1D1J A;  2ZQA A;  3UY6 A;  5DFX A;  3I7J A;  3HJI A;  1IYQ A;  5HZH A;  3UE6 A;  1S6R A;  3EOI A;  3EWK A;  4NBJ A;  3UME A;  2PU2 A;  3KO5 A;  2Q9M A;  1PZP A;  4GB7 A;  4H6J B;  4B9O A;  3MXQ A;  4RRM A;  4PKY A;  4PM5 A;  4HJ3 A;  4RRD A;  3PXP A;  3FPV A;  2VV7 A;  2QWS A;  1NZO A;  3KSF A;  1CI8 A;  3P09 A;  4OQG A;  1ERO A;  4YIN A;  3VFF A;  3S1Y A;  4X69 A;  4DN0 A;  5HX9 A;  4WF0 A;  3H7W A;  3K2N A;  3OC2 A;  4F3L A;  1BLH A;  1WYB A;  4NXF A;  4CPK A;  3BJN A;  5TGF A;  2R9X A;  3KNP A;  2A49 A;  1OTB A;  5HPI A;  4UQI M;  3FV7 A;  1FR6 A;  4R3B A;  1O07 A;  5FAS A;  2QYB A;  1FCM A;  3CIT A;  2XGN A;  4BL3 A;  3LI8 A;  5J8X A;  3QP8 A;  4P87 A;  3IH9 A;  1H8Z A;  4QHC A;  1FQG A;  3CAX A;  3OPL A;  4Z9Q A;  4KQR A;  4DDS A;  5HDD A;  1W79 A;  1BSG A;  2VJW A;  1K55 C;  1EW0 A;  3DWZ A;  3IX8 A;  3N8L A;  5IS1 A;  2FFF B;  5L8M A;  4N1H A;  4MBK A;  2WAD A;  3UDI A;  2PU4 A;  4RRL A;  1L0F A;  3BQA A;  1YPR A;  3T1R A;  3V39 A;  1NWZ A;  3TRC A;  5CEC A;  4HBT A;  4IJG A;  2GZA A;  3MZD A;  3UB7 A;  2ZM8 A;  5GHX A;  3OZH A;  3IS2 B;  4M4X A;  5JYP A;  1VET A;  4NEE D;  2FH5 A;  3GMW A;  4RRI A;  2IWB A;  3UB6 A;  1GA9 A;  3MQQ A;  1DJC A;  4E04 A;  3OCL A;  3MJQ A;  4OPZ A;  4X25 A;  4EV4 A;  4UAA A;  1Y28 A;  3MKE A;  2Y2L A;  3DW0 A;  1T1C A;  2BAS A;  1FCO A;  3D4F A;  1E4D A;  2W1T A;  5K5B A;  4PM6 A;  2XRN A;  4KZ8 A;  2ZM2 A;  3F1N B;  3R7W B;  3G2Z A;  4RR9 A;  1O7E A;  3IWQ A;  1IFQ A;  4ZBE A;  4O0P A;  2HJ9 C;  2VK3 A;  3LMU A;  1PIO A;  2A24 A;  1G28 A;  4DF6 A;  3MS6 A;  5AJG A;  2GNX A;  3MZE A;  2UWX A;  2WAE A;  4KUK A;  1YQS A;  3WS2 A;  1Y4O A;  1SKF A;  2MJ6 A;  1CI9 A;  5CRF A;  2Y2O A;  1F5M A;  5D3O A;  4WMC D;  5FI2 A;  3LIF A;  1YM1 A;  2QJ7 A;  1KVM A;  4BL2 A;  3GRJ A;  1TS0 A;  3CPT A;  3LR4 A;  4KZ6 A;  2ZL1 A;  2GX5 A;  3IT9 A;  3ZCZ A;  3A3F A;  5EM1 A;  2NUP C;  2WYX A;  5HFO A;  2XA7 S;  1WA9 A;  1S4S A;  1VHM A;  2JKR I;  5EVI B;  2ZC7 A;  5CTN A;  1CJF A;  1JWZ A;  4GS9 A;  4Z1W A;  3MFD A;  3T4J A;  1FCN A;  2HZ5 A;  5DTK A;  1VB6 A;  3WRT A;  3R4K A;  4ESP A;  3MXS A;  3LIE A;  5FL3 A;  4KEN B;  2Y2M A;  1J3W A;  3IHA A;  3IX3 A;  1Z09 A;  4EBN A;  2Y2G A;  3OOV A;  1OTI A;  1LLB A;  3ZVW A;  2GDN A;  3DWK A;  4FH2 A;  3C7V A;  5F1G A;  3QP5 A;  4PM8 A;  1FSW A;  3UE3 A;  3QP2 A;  5EOE A;  4YOF A;  2QMI A;  1S4R A;  2AVX A;  3MXR A;  2JKR M;  1YKD A;  1NRJ A;  1ES5 A;  2QJ5 A;  3IWO A;  3A3E A;  5DF8 A;  5I94 A;  1TS7 A;  1E3U D;  2ZM0 A;  4LCM A;  4NKP A;  1K57 C;  4KQO A;  4S2N A;  4Q0I A;  4K0W A;  4U0X A;  3DTE A;  1KGG A;  2FFY A;  3F1O A;  4F94 A;  1Z6F A;  4S0K A;  3VSK A;  3KYE A;  1GHM A;  3UN7 A;  4R6L A;  3MZF A;  1I2W A;  2EX9 A;  4LCL A;  3RTY A;  1MC0 A;  4OH0 A;  4ID4 A;  2Y2Q A;  4DJ2 A;  2PRF A;  1SZV A;  4R4R A;  1XPB A;  2VGK A;  5CED A;  3OPR A;  2XK1 A;  3OLO A;  2X71 A;  2KLI A;  1G6A A;  3W4O A;  5FQK A;  4WEK A;  4KZA A;  4GJ4 A;  3OPP A;  3DTK A;  3S4X A;  2HP5 A;  3DAV A;  2E8J A;  3BY9 A;  1ZC2 A;  3NIA A;  3VSL A;  2IWC A;  2JHE A;  5CEB A;  1YLT A;  4L9F A;  4GD8 A;  1K56 A;  2J9P A;  1JWP A;  2WKE A;  4B4Z A;  1J9M A;  2Y55 A;  2J80 A;  3P01 A;  1KDS A;  3Q7Z A;  4RRH A;  3FPW A;  1NRF A;  2HKZ A;  2Y2J A;  4EWF A;  1PI5 A;  4E6W A;  3NDG A;  2WKH A;  2JBF A;  4R3A A;  5HDC A;  4R0Q A;  3D9Y A;  3HUM A;  5AQ7 A;  5HDS A;  2W1R A;  4R4S A;  3NUL A;  3IF5 A;  1BYW A;  5AVF A;  5AQA A;  1X0O A;  4C6Y A;  3MQ0 A;  3LR0 A;  4S2L A;  3QP1 A;  4P0M A;  4E3J A;  5CXW A;  2OLU A;  1YLP A;  4IED A;  5EVI A;  3SS3 A;  3CLO A;  4X1L A;  3V5M A;  4CLC D;  3KOB A;  3Q82 A;  5EVE A;  3ZG7 B;  3LYX A;  3O5Y A;  5DFY A;  3CG5 A;  3KSI A;  1S66 L;  3ZQ5 A;  2XH9 A;  5F6A A;  3W4P A;  2O9C A;  5M18 A;  5CGW A;  3N7W A;  3UE1 A;  4CLC C;  1K38 A;  2PDR A;  4I38 A;  1N9O A;  1H3Q A;  2Y79 A;  1XJ6 A;  2V1A A;  4RR8 A;  1XX2 A;  4Y0T A;  1JKE A;  2XSS A;  1BUE A;  4IBR A;  4OPY A;  1MWS A;  1ERM A;  4DE0 A;  1WYC A;  4HJ4 A;  3T4O A;  2VX8 A;  2H28 A;  3LIC A;  3HCY A;  2V9A A;  4XT2 A;  2IWD A;  1VQQ A;  3WS4 A;  4CLC A;  4IVK A;  3C4O A;  5DKL A;  4K08 A;  1IYO A;  4KG6 A;  4NXB A;  2O99 A;  3SOI A;  2Q0O A;  1NXY A;  5DVA A;  1IOU A;  2XR0 A;  3CUE A;  3GVB A;  4N9K A;  3LCE A;  4FCF A;  1YLW A;  4BWI A;  1YLJ A;  4PHT A;  2A3U A;  1CEF A;  3LMV A;  5TJJ A;  1E3U A;  5EVI D;  4WEL A;  2WKQ A;  4R3J A;  1HTZ A;  3NDE A;  1PWG A;  1TS8 A;  5TBM B;  4E3M A;  1NY0 A;  1MKM A;  3KO4 A;  2ZLY A;  1S1Z A;  1ONH A;  3KSH A;  4C75 A;  2Z2M B;  1ZHH B;  4S03 A;  5HW3 A;  4QY6 A;  4EBP A;  2V2F F;  3GTC A;  3C5A A;  5EOO A;  1K55 A;  2Z6D A;  3JVU A;  3JVV A;  1OTD A;  1L0G A;  5E2E A;  2PBD P;  3V3R A;  4UA9 A;  2VGL S;  3QNC A;  1W8Y A;  2C6W B;  3W8K A;  3WRZ A;  2I72 A;  3F1N A;  3GSG A;  3S7Q A;  4PKY G;  3HLB A;  3OCN A;  4NET A;  1ES3 A;  3C7U A;  3BFG A;  3MFX A;  1S67 L;  2WGI A;  4X53 A;  2P7J A;  4LRZ E;  4HES A;  3GEC A;  3HLW A;  3VP3 A;  3BM6 A;  2XEP A;  5J4E A;  3HUN A;  5FDS A;  3ITA A;  2ZMA A;  3B42 A;  1DP8 A;  3E2K A;  4WLA A;  5EPH A;  4QB8 A;  1MZU A;  3GDI A;  2KDK A;  4WZ5 C;  5GLD A;  1XGJ A;  1FIK A;  3C2W A;  4YNR A;  3QNB A;  4LRY C;  4OOL A;  4OP8 A;  1H5X A;  2HGV A;  1LSX A;  3ZYT A;  4HBU A;  2DRW A;  1TEM A;  5A91 A;  3JPU A;  3T1Q B;  5A92 A;  1LHY A;  1FIL A;  3AGE A;  3FG8 A;  4EEU A;  3NHQ A;  3PAE A;  4X55 A;  3NI9 A;  4GD6 A;  5GL9 A;  2EX6 A;  1IYP A;  5I5L A;  2XF3 A;  2XLN A;  1NLY A;  1PFL A;  3E0Y A;  4WZ5 A;  3KX0 X;  4ETX A;  4P85 A;  4DE2 A;  1Q2P A;  2M7U A;  3WS0 A;  3ZDJ A;  4DE1 A;  4X1M A;  2YKF A;  1ODV A;  3SZT A;  1BT5 A;  1K4E A;  1GA0 A;  5HPF A;  4MCW A;  5JYO A;  2WGW A;  1IEM A;  2EFU A;  3BWL A;  2Y2P A;  4B93 A;  4S0L A;  3FZC A;  5TBM A;  4C3Q A;  1A0K A;  2ZQ7 A;  4HOI A;  5HWV A;  5HAQ A;  1ALQ A;  3T4T A;  4N92 A;  4CLC B;  2H0Y A;  3KOC A;  4UA6 A;  4BBV A;  3NEC A;  5F5Y A;  5A90 A;  5F82 A;  1K6S A;  3P98 A;  3E4Q A;  4EET B;  1ES2 A;  1SDN A;  1AXB A;  1K54 A;  3LID A;  4OLD A;  3L7H A;  2EA9 A;  3T12 B;  2PYR A;  3SS4 A;  1W7F A;  3BLM A;  4Y13 A;  4FSF A;  4D2O A;  3WWX A;  3NY4 A;  3MBZ A;  1LI9 A;  1MBL A;  3LR5 A;  2G7U A;  4LV0 A;  1NLZ A;  4NK3 A;  2L1M A;  4BD1 A;  3IF6 B;  5KSH A;  1HZO A;  4S2O A;  3SH9 A;  3CJM A;  3RH8 B;  3GV9 A;  5L10 A;  1F2K A;  4JKT A;  3T4S A;  3KO6 A;  1F98 A;  4KZ3 A;  1XP4 A;  3M2J A;  4LFU A;  1YMX A;  2D02 A;  4WYY A;  1GCE A;  3QP4 A;  1XA7 A;  1L3L A;  4JBF A;  1W8Q A;  2Y91 A;  4BBT A;  4GN2 A;  4H8R A;  1BZA A;  5AVE A;  3HLD A;  4BLM A;  3E98 A;  3EQU A;  2L0W A;  5AQ9 A;  5FEF A;  4P6B A;  1ZTU A;  3NCK A;  1YMS A;  2WKP A;  2JCH A;  5GHY A;  3ZNY A;  2PHY A;  2VGL M;  5DF7 A;  1QME A;  2DBO A;  4R23 A;  4P6Z S;  1EI5 A;  1YSQ A;  4BBU A;  4CQH A;  3T1S A;  1DP6 A;  4EW7 A;  4RRQ A;  4Y3I A;  1PI4 A;  2ZQ9 A;  1ESU A;  4HP4 A;  3V3S A;  4R70 A;  1ERQ A;  1K6R A;  3IH8 A;  2WKR A;  2EX8 A;  4WUJ A;  2WAF A;  3UB9 A;  1OPX A;  3CZD A;  5F69 A;  4ME4 A;  5FA7 A;  2XFS A;  4HP9 A;  3NC8 A;  4RR6 A;  2V1Z A;  3P7N A;  2V0U A;  3BW6 A;  4ARZ B;  1PW8 A;  2JC7 A;  4KZ7 A;  4QU3 A;  1T1B A;  3U4L P;  4JGP A;  3UB8 A;  2P9V B;  1VEU A;  1G68 A;  1SHV A;  1DJB A;  5KMW A;  3W2Z A;  5GLB A;  3PBT A;  2WZX A;  3KO7 A;  4CLC E;  4OQI A;  4O8G A;  4S02 A;  3U2A A;  3IBJ A;  2XRO A;  5FI6 A;  3B33 A;  1OJG A;  3ICY A;  3BEB A;  4RX3 A;  1LSW A;  1D7E A;  3TOI A;  1BLC A;  5A8B A;  4UA7 A;  3LI9 A;  5DKK A;  1LL9 A;  4Y17 A;  1YSP A;  1F9I A;  1GSX A;  2V0W A;  4P6Z M;  2JKT I;  1VET B;  4KZB A;  2J9O A;  3A3J A;  2INW A;  1NYM A;  5BOH A;  2PBY A;  3IF6 A;  3D3O A;  1TVF A;  4PM7 A;  4S0I A;  3KYZ A;  4Y0O A;  4GLQ A;  4GZB A;  1TDG A;  3C30 A;  4IHQ A;  5HAR A;  4BMW A;  3RXW A;  2B02 A;  2VZW A;  1KE0 A;  4E3L A;  2WZZ A;  2C5W B;  3IXB A;  2ZD8 A;  2Y8H A;  3FC7 A;  1UGU A;  3T1X A;  4MNR A;  2YKH A;  2CMN A;  3SW1 A;  3FKV A;  3IF6 C;  1VM1 A;  1GHI A;  4DXB A;  1K0K A;  2J3W A;  4K0X A;  2HJE A;  3B47 A;  3Q7V A;  2VGJ A;  4E3K A;  4O01 A;  1T1A A;  2ZJ9 A;  3M6B A;  5E2G A;  5G18 A;  3GR2 A;  4JF5 A;  1HLU P;  3E2L A;  3T4Q A;  2EX2 A;  2B95 A;  3PHY A;  5HAP A;  4I3A A;  3H82 B;  4I39 A;  4XUX A;  2PR6 A;  4NG2 A;  3Q81 A;  4HIA A;  4RRC A;  3G4P A;  4NBI A;  1M40 A;  1MXO A;  1MY8 A;  2K31 A;  3EQV A;  4HH3 A;  4EUZ A;  4HY8 A;  4XT2 B;  3VFH A;  3H9W A;  3IWI A;  5EVI C;  4KG5 A;  2EWV A;  3BQ8 A;  2J8Y A;  5EEC A;  1XGI A;  2HV1 A;  4LV2 A;  2HDU A;  5HAI A;  2DMW A;  3F1O B;  4R38 A;  5DTS A;  4EEP A;  4QD4 A;  3NOT C;  4GDN A;  2OV5 A;  3LEQ A;  1KE3 A;  1YT4 A;  4N9L A;  2DNS A;  2V8C A;  4IVI A;  3IHB A;  3NJA A;  3LR3 A;  2DCF A;  5CX7 A;  2J3T C;  1TF1 A;  2WGW B;  2HL1 A;  3AGD A;  1IEL A;  3VV4 A;  4HI4 A;  4LV3 A;  2HDR A;  1XXM A;  1KE4 A;  1Y54 A;  4JF4 A;  2OWJ A;  1ZG6 A;  4EQ1 A;  1H0M A;  5FQM A;  1I5Q A;  3HJK A;  3EGD C;  1OT9 A;  3KOD A;  4LEN A;  5FQ9 A;  5J3W A;  3PBS A;  4H6J A;  3N4I A;  5GLC A;  5L09 A;  1PNE A;  1P97 A;  3LMT A;  1XA1 A;  1PRQ A;  4OPQ A;  2RCX A;  2H0T A;  4I5S A;  3HLC A;  4OQ0 A;  3A3I A;  2IA2 A;  5EV0 A;  1I2S A;  5GLA A;  1G5U A;  3PR6 A;  4LPZ A;  1DRM A;  4HJ6 A;  2VEA A;  1KGF A;  3N8S A;  4X56 A;  3WS1 A;  4QPR A;  5GHZ A;  2BLS A;  3FYZ A;  1DP9 A;  4BD0 A;  3GQZ A;  1FOF A;  2O0Y A;  4YWZ A;  3SH7 A;  3VE4 A;  3IX4 A;  4KZ9 A;  4MEZ A;  4OPR A;  1PW1 A;  2FZ0 A;  3JYI A;  1K57 A;  4WBG A;  3E4O A;  3H82 A;  4DXC A;  3PBQ A;  2UV0 E;  1UWN X;  4RR7 A;  2HDS A;  4ZRR A;  4R1G A;  3BYD A;  4LRX C;  3CWF A;  3OPH A;  1PYY A;  1ZG4 A;  4RQ9 A;  1K4F A;  3BFC A;  3PYP A;  5EFW A;  3UO9 A;  5TFQ A;  2PD8 A;  4G3V A;  2XD1 A;  3HLE A;  3G30 A;  4BQM A;  4E3N A;  3ITB A;  2ZBB A;  3EGX C;  5FAT A;  5HL6 A;  1K54 C;  3IXG A;  1K56 D;  3HL9 A;  3UB5 P;  3KYQ A;  3VOY A;  2OAQ 1;  4JF6 A;  4JXW A;  2HDQ A;  2Y2K A;  4FTX A;  1IKG A;  1VEU B;  3MSH A;  3B3X A;  4D60 A;  3A0V A;  5E2F A;  4X68 A;  1OTE A;  4OP5 A;  3G31 A;  1XFN A;  4WZ4 A;  4EER A;  4KZ4 A;  3A3D A;  4S2M A;  1S1Y A;  1G6O A;  2XDM A;  2Z2L B;  1H8Y A;  1GSW A;  1C3B A;  4KG2 A;  2Y2H A;  4RVA A;  2G2W A;  2A2L A;  3H7W B;  4JXS A;  2R9W A;  4WM9 A;  2ZMV A;  4S2K A;  1TD5 A;  2JN7 A;  4GNU A;  3R7W A;  2HP6 A;  1SKO B;  3ZG5 A;  4MBH A;  3LUQ A;  4EES A;  2ZC6 B;  3UMD A;  3T4K A;  4B88 A;  4G3K A;  1OJ5 A;  4N1X A;  5L07 A;  1NZU A;  5HD3 A;  2K7S A;  1FSY A;  1PWD A;  4YFM A;  5FSR A;  4FUW A;  3FKW A;  3ULF A;  3G2Y A;  3PBR A;  4ZJ1 A;  4M3K A;  1ZKJ A;  1XJ2 A;  1PZO A;  1D06 A;  5FAQ A;  3IXD A;  1TS6 A;  4GHI A;  2P08 A;  3LIA A;  3VP0 A;  3O86 A;  4MN7 A;  3ISG A;  2W0N A;  1YLZ A;  4Y15 A;  4LGW A;  4IUK A;  4OQH A;  5FEG A;  2J7V A;  4IUH A;  1IKI A;  5CHJ A;  1YLY A;  2ZOH A;  4S2J A;  1KVL A;  3D72 A;  4K91 A;  5EVL A;  3IS2 A;  1CEG A;  1RP5 A;  4L9G A;  4LV1 A;  1MPL A;  3L9K A;  4FH4 A;  2Y2I A;  2OAP 1;  5DF9 A;  2QPN A;  4NXE A;  5AQB A;  4F3L B;  1W63 Q;  3PTE A;  5HL1 A;  1KGE A;  1SDE A;  3QP6 A;  4ETZ A;  2OSU A;  4I3J A;  2W3D A;  3RFB A;  1BUL A;  4DRT A;  3EEH A;  5E43 A;  5DJU A;  2W3E A;  3BFF A;  1OME A;  4S2N C;  3V50 A;  4ARZ A;  1GHP A;  3MKF A;  4XXR A;  2ZC3 B;  4GKU A;  3VE3 A;  4RRJ A;  5L2F A;  1P0Z A;  4OLG A;  5HD5 A;  1TC5 A;  3ZG0 A;  3TW8 A;  1MWT A;  3DTI A;  1UWP X;  3ZG9 B;  1STZ A;  2HL0 A;  2I9V A;  4PM9 A;  1L0E A;  4B4X A;  3LO7 A;  4ZTK A;  3TJZ C;  1GSV A;  5IHV A;  3LFV A;  4L9E A;  4HNB A;  5C5K A;  3K3D A;  4PPR A;  4ZJ2 A;  4FD8 A;  3TSG A;  2KX6 A;  4UHU A;  1JNU A;  5M19 A;  2HL2 A;  2M1C A;  4NXG A;  1JTD A;  3VMA A;  2W3G A;  3BRM A;  1JVJ A;  4S2P A;  1N9N A;  5A93 A;  2W3H A;  5KZH A;  1BLS A;  2Y2N A;  2Y4A A;  3PAG A;  1Y2Q A;  4BJP A;  1CQA A;  4Y2F A;  5EE8 A;  2X01 A;  3SH8 A;  4I3I A;  5HWW A;  2P9V A;  5G4Z A;  1V9Z A;  4DDY A;  2O9A A;  1RGZ A;  2V1B A;  3PBO A;  2LB9 A;  4IBX A;  4GCZ A;  3ZG8 B;  4MN6 A;  4AFI A;  2OLV A;  4XUZ A;  2OWH A;  4GW9 A;  4U0T A;  1YAX A;  3AGF A;  3OBF A;  5LBR A;  1FR1 A;  1MWR A;  1NYY A;  3UDX A;  4HEF A;  4RX2 A;  3UE0 A;  4RRR A;  2X02 A;  3PD2 A;  5DTT A;  4MBF A;  1N9B A;  2VA0 A;  3RXX A;  1H8M A;  3CPT B; 
#chains in the Genus database with same CATH homology
 5HW3 A;  2CC1 A;  4QY6 A;  4QHC A;  1FQG A;  3OPL A;  4DE3 A;  4XUX A;  4Z9Q A;  4EBP A;  4X6T A;  4KQR A;  5E2H A;  2V2F F;  3SS5 A;  3GTC A;  3C5A A;  5EOO A;  3UDF A;  3C4P A;  4DDS A;  1K55 A;  1K25 A;  1W79 A;  1BSG A;  1K55 C;  3HVF A;  3Q81 A;  3DWZ A;  4RRC A;  2RL3 A;  3G4P A;  4NBI A;  3N8L A;  4GDB A;  1M40 A;  1L0G A;  1MXO A;  1MY8 A;  3EQV A;  2FFF B;  3M6H A;  4N1H A;  5E2E A;  4MBK A;  4EUZ A;  3V3R A;  3ZNT A;  2WAD A;  4UA9 A;  3VOZ A;  3VFH A;  3UDI A;  2PU4 A;  3IWI A;  5EVI C;  3QNC A;  1W8Y A;  4KG5 A;  2C6W B;  3W8K A;  4JPM A;  3WRZ A;  2J8Y A;  5EEC A;  1XGI A;  2I72 A;  1BTL A;  1L0F A;  4RRL A;  3GSG A;  3HLB A;  3OCN A;  4LV2 A;  2HDU A;  4NET A;  3V39 A;  1ES3 A;  3C7U A;  3UPN A;  3VP4 A;  5HAP A;  5HAI A;  3BFG A;  5CEC A;  5DTS A;  4ZJ3 A;  2WGI A;  4HBT A;  4X53 A;  2HP9 A;  4QD4 A;  3MZD A;  3N8R A;  4GDN A;  4HES A;  2ZM8 A;  4EBL A;  2OV5 A;  1KE3 A;  3HLW A;  5GHX A;  3OZH A;  3BM6 A;  1YT4 A;  3VP3 A;  3HLF A;  2XEP A;  2OKV A;  4N9L A;  2ZC5 B;  4IVI A;  3IHB A;  5JYP A;  4ZAM A;  3HUN A;  2DCF A;  3ITA A;  2ZMA A;  3E2K A;  5EPH A;  2Y59 A;  3GMW A;  2WGW B;  4RRI A;  2IWB A;  4RA7 A;  4QB8 A;  5FI7 A;  2HL1 A;  1GA9 A;  1DJC A;  2EXA A;  3AGD A;  3BFE A;  4L0L A;  3OCL A;  3IXH A;  1IEL A;  4WZ5 C;  4LV3 A;  3TG9 A;  5GLD A;  1XGJ A;  1PWC A;  2HDR A;  4OPZ A;  1XXM A;  3QNB A;  2H5S A;  1KE4 A;  1Y54 A;  4JF4 A;  4OP8 A;  4OOL A;  4RRF A;  1ZG6 A;  1H5X A;  4EV4 A;  5FQM A;  1I5Q A;  3IQA A;  4UAA A;  4WMC A;  3MKE A;  2Y2L A;  3ZVT A;  3KOD A;  3DW0 A;  4LEN A;  5FQ9 A;  3PBS A;  4HBU A;  2DRW A;  1W5D A;  5FDH A;  3N4I A;  5GLC A;  1N4O A;  2HPB A;  1TEM A;  4O7D A;  5A91 A;  2ZQD A;  3LMT A;  1XA1 A;  4OPQ A;  2RCX A;  2H0T A;  5A92 A;  4RRG A;  4OOM A;  1LHY A;  1FCO A;  3D4F A;  3AGE A;  1E4D A;  3PAE A;  4X55 A;  3NI9 A;  4GD6 A;  1WE4 A;  3HLC A;  4GOG A;  5GL9 A;  2EX6 A;  4RYE A;  4OQ0 A;  3A3I A;  4PM6 A;  5FQI A;  1IYP A;  1I2S A;  3UNW A;  5GLA A;  4E3O A;  2XF3 A;  1SCW A;  2XLN A;  4CJN A;  4KZ8 A;  4WZ5 A;  5KSC A;  1KGF A;  2ZM2 A;  1RGY A;  3CMZ A;  3N8S A;  4X56 A;  3G2Z A;  2XD5 A;  1LI0 A;  1O7E A;  3IWQ A;  4P85 A;  4RR9 A;  3WS1 A;  1RCJ A;  4ZBE A;  5GHZ A;  2BLS A;  4DE2 A;  1Q2P A;  3FYZ A;  3QHY A;  3LMU A;  4BD0 A;  3GQZ A;  1PIO A;  1FOF A;  3WS0 A;  5J61 A;  3ZDJ A;  4DE1 A;  4DF6 A;  3SH7 A;  1KDW A;  3MZE A;  3NBL A;  2V20 A;  2UWX A;  2WAE A;  5TR7 A;  1BT5 A;  5CTM A;  4KZ9 A;  1YQS A;  3WS2 A;  4MEZ A;  1SKF A;  4OPR A;  1PW1 A;  1CI9 A;  5CRF A;  2Y2O A;  5D3O A;  3JYI A;  1TDL A;  1K4E A;  1K57 A;  4WMC D;  1GA0 A;  4WBG A;  5FI2 A;  2ZQC A;  5JYO A;  1YM1 A;  2WGW A;  4DXC A;  1DY6 A;  3PBQ A;  1KVM A;  1IEM A;  4BL2 A;  3GRJ A;  2EFU A;  2Y2P A;  2ZQ8 A;  4KZ6 A;  3FZC A;  4S0L A;  3KNF A;  3WS5 A;  4RR7 A;  1ONG A;  2HDS A;  4C3Q A;  4R1G A;  1JWV A;  4QJG A;  3BYD A;  2ZQ7 A;  3HRE A;  3IT9 A;  3ZCZ A;  3OPH A;  1PYY A;  1ZG4 A;  5HAQ A;  1ALQ A;  1K4F A;  3A3F A;  3BFC A;  3UO9 A;  4N92 A;  5TFQ A;  4RRA A;  3Q7V B;  2WYX A;  2H0Y A;  3G34 A;  2XD1 A;  3HLE A;  5HFO A;  3KOC A;  3G30 A;  4BQM A;  4E3N A;  4JLF A;  3ITB A;  4UA6 A;  4Q8I A;  3BEC A;  5A90 A;  5F82 A;  1K6S A;  3Q07 A;  5FAT A;  5M1A A;  3P98 A;  3O88 A;  1ES2 A;  1K54 C;  1Q2Q A;  2ZC7 A;  3IXG A;  5EVI B;  5CTN A;  1K56 D;  1SDN A;  1AXB A;  3HL9 A;  1K54 A;  3VOY A;  1JWZ A;  4JF6 A;  4S2I A;  4OLD A;  4JXW A;  3MFD A;  1J7G A;  3IH9 A;  2HDQ A;  3G35 A;  5CGX A;  3BFD A;  3ZFZ A;  1CK3 A;  1FCN A;  2Y2K A;  3SS4 A;  1MWU A;  1W7F A;  1IKG A;  2BG1 A;  2H10 A;  3BLM A;  3Q1F A;  5DTK A;  4FSF A;  2JE5 A;  3WRT A;  4D2O A;  3WWX A;  3MXS A;  3NY4 A;  3MBZ A;  3B3X A;  3S22 A;  1LI9 A;  1MBL A;  4X68 A;  4KEN B;  5CHU A;  5E2F A;  2Y2M A;  5CGS A;  4KZ5 A;  4LV0 A;  4OP5 A;  4JXG A;  3IHA A;  3G31 A;  4NK3 A;  4EBN A;  2Y2G A;  2Q9N A;  4E6X A;  4BD1 A;  3IF6 B;  4WZ4 A;  1LLB A;  5KSH A;  3ZVW A;  2EFX A;  4KZ4 A;  2GDN A;  1HZO A;  3A3D A;  3DWK A;  4FH2 A;  4S2O A;  3SH9 A;  3CJM A;  3GV9 A;  3C7V A;  4S2M A;  5F1G A;  4JKT A;  4PM8 A;  1FSW A;  2XDM A;  2Z2L B;  3UE3 A;  3ZGA B;  1H8Y A;  1MKI A;  4KZ3 A;  1C3B A;  1XP4 A;  4KG2 A;  5EOE A;  2Y2H A;  3M2J A;  4RVA A;  2QMI A;  4A5R A;  1YMX A;  2G2W A;  4RRK A;  4WYY A;  3MXR A;  2B5R A;  1GCE A;  4JXS A;  2R9W A;  1ES5 A;  3IWO A;  4WM9 A;  3A3E A;  5DF8 A;  1NJ4 A;  3LY3 A;  1XA7 A;  4JBF A;  1W8Q A;  2Y91 A;  4S2K A;  4GNU A;  5FAO A;  5I94 A;  1E3U D;  4GN2 A;  2ZM0 A;  2HP6 A;  4H8R A;  1ESI A;  4LCM A;  1BZA A;  1K57 C;  1HVB A;  4KQO A;  3HLD A;  4S2N A;  4U0X A;  2WGV A;  4K0W A;  4MBH A;  5CER A;  3ZG5 A;  2ZC6 B;  4BLM A;  2XQZ A;  3EQU A;  3HBR A;  5FQJ A;  5AQ9 A;  4B88 A;  4RRB A;  1KGG A;  2FFY A;  4N1X A;  4P6B A;  5EUA A;  4F94 A;  3NCK A;  1Z6F A;  1YMS A;  1NZU A;  4E3I A;  1FSY A;  5FQK A;  4S0K A;  1PWD A;  3VSK A;  4YFM A;  2JCH A;  2WK0 A;  5FSR A;  3HLG A;  3KO3 A;  3FKW A;  5GHY A;  3ZNY A;  1HD8 A;  3UPO A;  1GHM A;  3UN7 A;  3G2Y A;  3PBR A;  4Y0U A;  4M3K A;  1ZKJ A;  1DJA A;  2WKI A;  4ZJ1 A;  3MZF A;  1I2W A;  5FQQ A;  5DF7 A;  1QME A;  2EX9 A;  4LCL A;  1PZO A;  4MLL A;  2EXB A;  2DBO A;  5FAQ A;  4R23 A;  4OH0 A;  1M6K A;  4ID4 A;  2Y2Q A;  3IXD A;  1EI5 A;  4DKI A;  4R4R A;  5U47 A;  1XPB A;  3VP0 A;  2E8I A;  2VGK A;  5CED A;  1LL5 A;  3OPR A;  2QZ6 A;  2XK1 A;  2X71 A;  3O86 A;  3ISG A;  2ZC4 B;  1YLZ A;  1ES4 A;  4RRQ A;  1G6A A;  4OQH A;  3W4O A;  4S0J A;  1PI4 A;  4KZA A;  1IYS A;  2ZQ9 A;  4WEK A;  1ESU A;  2J7V A;  1EWZ A;  3OPP A;  4OOY A;  3S4X A;  1IKI A;  2HP5 A;  5CHJ A;  3G32 A;  1YLY A;  1ERQ A;  3V3S A;  3RJU A;  1K6R A;  1XKZ A;  3IH8 A;  2EX8 A;  1ZC2 A;  3NIA A;  4JXV A;  3VSL A;  2IWC A;  4S2J A;  5CEB A;  1E25 A;  2WAF A;  1YLT A;  1KVL A;  5F1F A;  4GD8 A;  3PBN A;  1K56 A;  3HUO A;  4K91 A;  4OVD A;  4U3T A;  5EVL A;  3CZD A;  2J9P A;  1JWP A;  3PD5 A;  2WKE A;  5FA7 A;  1CEG A;  1RP5 A;  4B4Z A;  1J9M A;  2Y55 A;  1KDS A;  3VP1 A;  2XFS A;  3Q7Z A;  4LV1 A;  3NC8 A;  4RRH A;  1MPL A;  3PD4 A;  4RR6 A;  4FH4 A;  1NRF A;  3PD3 A;  2V1Z A;  2Y2I A;  2HKZ A;  5DF9 A;  1U60 A;  2Y2J A;  1JTG A;  2QPN A;  5AQB A;  4EWF A;  4ZDX A;  1PI5 A;  4E6W A;  3NDG A;  2WKH A;  3PTE A;  5HL1 A;  2JBF A;  1PW8 A;  2JC7 A;  3O3V A;  4KZ7 A;  1KGE A;  1SDE A;  4QY5 A;  4R0Q A;  2XFT A;  4PMA A;  4QU3 A;  3HUM A;  3FWL A;  2OSU A;  5AQ7 A;  4Y7P A;  4R4S A;  1BUL A;  2G2U A;  3IF5 A;  4DRT A;  2P9V B;  4OON A;  5E43 A;  5AQA A;  4C6Y A;  4S2L A;  1L2S A;  1G68 A;  1SHV A;  4KQQ A;  1DJB A;  3BFF A;  4P0M A;  5KMW A;  1OME A;  4S2N C;  5GLB A;  4E3J A;  5CXW A;  2OLU A;  3PBT A;  2WZX A;  2P74 A;  3V50 A;  4BEN A;  1GHP A;  1YLP A;  3KO7 A;  4IED A;  5EVI A;  4OQI A;  3M2K A;  3SS3 A;  3MKF A;  4XXR A;  2ZC3 B;  1S0W A;  4GKU A;  4S02 A;  1L0D A;  3V5M A;  4RRJ A;  3KOB A;  3Q82 A;  5L2F A;  4OLG A;  3ZG7 B;  4EQI A;  5FI6 A;  1TC5 A;  3VP2 A;  3CG5 A;  3LY4 A;  3BEB A;  3ZG0 A;  1MWT A;  1BLP A;  2XH9 A;  3O87 A;  5CHM A;  3KO9 A;  4RX3 A;  3ZG9 B;  4OKP A;  3TOI A;  1BLC A;  3W4P A;  2HL0 A;  4PM9 A;  3W4Q A;  3N6I A;  4UA7 A;  5M18 A;  3UPP A;  2WUQ A;  1L0E A;  4WEJ A;  4B4X A;  1LL9 A;  3LO7 A;  5CGW A;  3ZHH A;  3N7W A;  4ZTK A;  3UE1 A;  3DTM A;  5IHV A;  1K38 A;  3LEZ A;  5FAP A;  1QMF A;  5F83 A;  4KZB A;  2J9O A;  3BLS A;  4RR8 A;  1XX2 A;  3A3J A;  4PPR A;  4ZJ2 A;  2ZQA A;  4FD8 A;  3UY6 A;  4Y0T A;  3I7J A;  1JKE A;  3TSG A;  1IYQ A;  1BUE A;  4UHU A;  4IBR A;  1S6R A;  5M19 A;  4OPY A;  1NYM A;  5BOH A;  1MWS A;  2HL2 A;  1ERM A;  4NBJ A;  2PBY A;  4DE0 A;  3IF6 A;  2PU2 A;  3KO5 A;  1TVF A;  4PM7 A;  1JTD A;  2Q9M A;  1PZP A;  3BRM A;  3VMA A;  1JVJ A;  4S0I A;  1WYC A;  4S2P A;  4GB7 A;  4Y0O A;  5A93 A;  4GZB A;  5KZH A;  4RRM A;  1TDG A;  2IWD A;  1BLS A;  4PM5 A;  2Y2N A;  1VQQ A;  2Y4A A;  3PAG A;  3WS4 A;  5HAR A;  1Y2Q A;  4RRD A;  3RXW A;  1H8Z A;  4BJP A;  2X01 A;  4IVK A;  5EE8 A;  3C4O A;  3SH8 A;  1NZO A;  1KE0 A;  3P09 A;  1CI8 A;  2P9V A;  4DDY A;  1RGZ A;  1IYO A;  4OQG A;  4KG6 A;  4E3L A;  3PBO A;  3SOI A;  1ERO A;  4YIN A;  1NXY A;  5DVA A;  2WZZ A;  2C5W B;  3IXB A;  2ZD8 A;  3S1Y A;  2XR0 A;  3VFF A;  3GVB A;  4IBX A;  4X69 A;  4S03 A;  4N9K A;  5HX9 A;  3ZG8 B;  3LCE A;  2OLV A;  4FCF A;  4MNR A;  1YLW A;  3OC2 A;  4XUZ A;  1BLH A;  1YLJ A;  3FKV A;  3IF6 C;  1VM1 A;  1GHI A;  1WYB A;  4U0T A;  4DXB A;  4CPK A;  3AGF A;  4K0X A;  5TGF A;  2A3U A;  2R9X A;  1CEF A;  3KNP A;  2A49 A;  3LMV A;  1E3U A;  1FR1 A;  1MWR A;  5EVI D;  1NYY A;  4WEL A;  3UDX A;  3Q7V A;  2VGJ A;  4E3K A;  4HEF A;  3FV7 A;  4R3J A;  1FR6 A;  4R3B A;  4RX2 A;  2ZJ9 A;  1O07 A;  5FAS A;  3M6B A;  5E2G A;  1HTZ A;  5G18 A;  3GR2 A;  4JF5 A;  1FCM A;  3E2L A;  3NDE A;  3UE0 A;  4RRR A;  2XGN A;  4BL3 A;  2X02 A;  1PWG A;  3PD2 A;  5DTT A;  4E3M A;  2EX2 A;  1NY0 A;  4MBF A;  5J8X A;  1N9B A;  3RXX A;  4P87 A;  3KO4 A;  2DNS A;  2ZLY A;  4C75 A;  1ONH A;  2Z2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...