2EX2A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
456
structure length
456
Chain Sequence
NVDEYITQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
total genus 146
structure length 456
sequence length 456
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex2A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex2A02
3BLSA 1QMEA 1NRFA 3IXHA 3MXSA 1PYYA 4GDNA 1K56D 3IWIA 1PZPA 2HP5A 3OPPA 5D3OA 5M18A 2WGIA 2EFXA 3BEBA 4XXRA 2J9PA 5FQQA 3DTMA 1KVLA 1K57A 4OQGA 3G31A 3N4IA 4Y0UA 5EVID 4Q8IA 3UNWA 5FSRA 4HBTA 4R4RA 3LY3A 5KSCA 4OKPA 1YLTA 3I7JA 4BD0A 5FAQA 2GDNA 4IEDA 3W4PA 4ZDXA 1KDWA 4BLMA 3OCLA 4OPYA 3UY6A 4KZ5A 3PBNA 3MBZA 1MWUA 4QB8A 2ZQ7A 4EV4A 1PW1A 4EBNA 5CERA 3V39A 1NZUA 1HZOA 3GV9A 1JWVA 3QHYA 3TG9A 3WS1A 4S2PA 4GN2A 1KGGA 4IBRA 4LENA 5TGFA 1CEGA 4XUXA 1IYSA 4X53A 4X56A 1BLHA 4Z9QA 3MXRA 4OP8A 2WGWB 1GA0A 3IT9A 1NXYA 4LV3A 1RCJA 1YLJA 1FR1A 4E6XA 4EWFA 2WUQA 2H0TA 3BRMA 1GCEA 2WADA 5A92A 4FH4A 1K54A 4MEZA 3RXXA 4JXVA 4OPZA 2E8IA 5HFOA 1OMEA 3QNCA 1I5QA 4RVAA 1K4FA 3WS5A 2CC1A 5KZHA 5HARA 1N9BA 5BOHA 1YLYA 5JYPA 1KGFA 3N7WA 5FA7A 4NK3A 1DJCA 1HTZA 4C3QA 3IHBA 4KQQA 4WM9A 1MPLA 2Y2QA 3V50A 5L2FA 3A3EA 4N1HA 4EBLA 3G2YA 1H8ZA 1I2WA 1MWRA 2Y59A 3IF6B 3C4OA 3UPOA 4R3JA 5EVIB 1L0FA 3C5AA 4KZ3A 4D2OA 3UE3A 4OPQA 3ZG0A 1NYMA 3A3IA 2Y2NA 4WMCD 4WBGA 2I72A 3WS4A 3OC2A 4S2JA 1G68A 1ES4A 1ALQA 5FQJA 3HLFA 4B4XA 4E3KA 4K0XA 5CGWA 4OOYA 1H8YA 4RX3A 3BFEA 2Z2MB 4PPRA 1ES3A 2V1ZA 4XUZA 4DKIA 1JWZA 2IWDA 1ERMA 3HLWA 5HX9A 4QHCA 2ZM0A 1M40A 4P0MA 2WKEA 1BUEA 4P87A 3ZNTA 1ERQA 5DF8A 4KG5A 1GHMA 3BYDA 4UA7A 4DE3A 4LV0A 1CI8A 2XDMA 3DW0A 3RXWA 1MBLA 3BFFA 1IEMA 2FFYA 2WZXA 3HLBA 4UA9A 4Y0OA 5CHMA 5CEBA 1W7FA 1MXOA 1XX2A 2EXAA 4JXSA 1ZC2A 1PZOA 2HP6A 1PWDA 1WE4A 4JF6A 2HDQA 3VP4A 2JC7A 1LLBA 3VSLA 4C6YA 3PAGA 1YQSA 2XFSA 5DTTA 3VSKA 1DJBA 1IYQA 1I2SA 1NJ4A 3NCKA 4MLLA 1K4EA 3WRTA 5EE8A 3VFHA 2EX8A 4S2NA 3EQUA 1LI0A 5G18A 5F83A 5HW3A 1GHPA 2G2UA 1SKFA 4DE2A 4ZJ3A 2Y2LA 2HDSA 3ITAA 4LCMA 5AQ9A 5KSHA 2HDRA 2DNSA 5GLBA 4IVIA 3ZVWA 4E3LA 3W4OA 1S0WA 3AGDA 4OP5A 3GRJA 1LHYA 3V5MA 4E6WA 3VP1A 4E3NA 1U60A 4P6BA 4S2OA 2ZQ8A 3ZG9B 3FWLA 5FI6A 2VGJA 4QD4A 2XD5A 3SH7A 3V3SA 4KG6A 5DTKA 4BENA 3ZDJA 3PBRA 3A3DA 3FKVA 3SS5A 1W8YA 3PAEA 4UHUA 1ZG4A 2JCHA 3PBQA 1ONGA 4N9LA 2C6WB 4BL3A 3BM6A 5FAOA 5FQMA 3IXBA 3OCNA 5HAPA 2EXBA 1E3UD 3HLDA 1MWSA 4N92A 1YLZA 3VP0A 4WEKA 1TDLA 1JTDA 3GR2A 4FD8A 3IF6A 2WK0A 3CZDA 3HLEA 4Y7PA 1WYCA 3N8RA 1FSYA 5EVIA 3VOYA 2RL3A 3G2ZA 5J8XA 1LL5A 2ZC5B 4OH0A 3Q07A 3OZHA 5E43A 2WAFA 3Q7ZA 5CGSA 3PBSA 5TR7A 4Y0TA 1J9MA 2FFFB 2R9WA 4S2MA 1S6RA 1W5DA 4PM9A 3UPNA 4GD6A 5TFQA 1PWCA 1CK3A 2XQZA 5FDHA 1M6KA 4WZ5C 1XGIA 2ZQCA 3BFCA 2Y2JA 3ZCZA 4P85A 3B3XA 1FCNA 5FI2A 4LV1A 2JE5A 2P9VA 3O88A 2IWCA 3IQAA 4ZAMA 1FR6A 4DE1A 1Z6FA 2XLNA 3IWOA 4JXGA 4BQMA 4E3JA 3EQVA 4JPMA 1FCMA 5I94A 4GKUA 1TEMA 4K0WA 4E3IA 1Q2QA 3A3FA 4IVKA 4B4ZA 1KE0A 1SHVA 3HVFA 2WAEA 3BFGA 3ISGA 3HUNA 3GVBA 2JBFA 1BZAA 1TDGA 2J8YA 3Q7VA 1JWPA 1FSWA 1IELA 3NBLA 3IWQA 4LCLA 1G6AA 4U0TA 4BD1A 3W4QA 4DDSA 5DF9A 5E2FA 2ZLYA 2QPNA 3HUMA 4ID4A 3AGFA 4QJGA 5CRFA 2OV5A 5AQAA 5E2GA 5EOOA 4RX2A 4KG2A 4DF6A 1O07A 4HBUA 3S22A 1JTGA 1NYYA 5FATA 1BSGA 1LL9A 2PU2A 1O7EA 3N6IA 4QY5A 4M3KA 1FQGA 3UDXA 4L0LA 4KZAA 3NDEA 4R3BA 3UDFA 1RGYA 2PBYA 1XA7A 4MBHA 4JLFA 1W79A 1K55C 2Q9NA 3A3JA 2WKIA 3ZHHA 3OPHA 3NC8A 4ZJ1A 4DRTA 4X68A 2RCXA 3D4FA 3LY4A 3V3RA 2X71A 3IXDA 3G35A 3Q81A 4CJNA 4E3MA 3LCEA 1IKIA 3M6HA 1PI5A 2XK1A 3ZNYA 4GD8A 3VFFA 3HL9A 5KMWA 1FOFA 2Y2IA 3MKEA 3P98A 5GHZA 1YLPA 2B5RA 2H0YA 3VP2A 5FASA 2H5SA 4H8RA 5HAQA 1K6SA 5EVLA 2Q9MA 4X6TA 4HEFA 5FAPA 3GMWA 2X02A 2HP9A 3BFDA 3PBOA 4BJPA 2ZC7A 4KZBA 2IWBA 1QMFA 2XEPA 2ZQDA 1EROA 2WGWA 5AQBA 4KENB 1K57C 3W8KA 1PIOA 3JYIA 4FSFA 3IF5A 2WGVA 1IYOA 1NZOA 1YLWA 4EQIA 4PM7A 1XPBA 2EX2A 1KVMA 1E4DA 3IHAA 3VP3A 2DRWA 3WS2A 2G2WA 2V2FF 3VOZA 1H5XA 1BTLA 2VGKA 1XA1A 2QZ6A 3NIAA 4R1GA 4U0XA 5CECA 1XGJA 3G30A 3Q1FA 1RP5A 4OOLA 3DWZA 2EFUA 4OQHA 4ZBEA 5HL1A 1Q2PA 1PW8A 3TSGA 5A90A 4PMAA 1ESIA 2Y2KA 3LO7A 2XR0A 1Y54A 1YMXA 1K38A 5FQ9A 1ES5A 3PTEA 1K56A 5DTSA 1ZKJA 4R23A 4OLGA 4KZ8A 1BLSA 2Y91A 1AXBA 3WRZA 1K54C 1XKZA 1EWZA 3CJMA 3MKFA 5CHJA 3O87A 3MZDA 4E3OA 2DCFA 3C4PA 3IH9A 3IXGA 3VMAA 2HDUA 2OLUA 4OONA 1CEFA 1RGZA 4R0QA 1E25A 5DVAA 2A3UA 5EECA 2C5WB 1GA9A 4LV2A 5CTMA 4DXCA 3HUOA 1ESUA 1E3UA 5CEDA 1KDSA 2XH9A 4S2KA 3MZEA 3NDGA 4JF4A 1ZG6A 5CXWA 1BULA 4GOGA 2ZQAA 2BLSA 2P74A 1FCOA 1W8QA 1IYPA 2R9XA 1MKIA 1ONHA 3Q82A 4RA7A 3N8SA 5F1GA 4MNRA 3AGEA 3C7UA 1YM1A 1PWGA 2ZJ9A 4DE0A 3WS0A 3ZG7B 4OQ0A 1HVBA 4DDYA 3S4XA 3HLGA 1KGEA 2Y2OA 4A5RA 4C75A 1IKGA 4GZBA 2Y4AA 3BLMA 4ZJ2A 3SH8A 1PI4A 3WWXA 2V20A 3M2KA 2X01A 5CGXA 1MWTA 5M1AA 1CI9A 4BL2A 2Y2MA 4PM6A 5E2EA 5U47A 5FQIA 2H10A 4JKTA 3OPLA 3RJUA 3QNBA 1N4OA 3G4PA 3FZCA 3BECA 2XF3A 3E2KA 4NETA 2J9OA 3UN7A 3FYZA 4K91A 1SDNA 1BLCA 2ZC4B 4MBKA 5JYOA 4MBFA 2OSUA 4ZTKA 3NY4A 3N8LA 4PM5A 3GTCA 4KZ6A 4PM8A 2ZD8A 5GLDA 2ZM2A 4JBFA 4EBPA 3OPRA 3DWKA 2EX6A 5GLAA 5DF7A 4DXBA 1EI5A 3C7VA 5F1FA 4WZ5A 3ZVTA 3O3VA 3ZGAB 2Z2LB 3CG5A 3LEZA 4UA6A 5GHXA 1C3BA 1L2SA 4WZ4A 5CTNA 2WYXA 4YINA 5GL9A 3M2JA 4JF5A 4U3TA 4WMCA 1ES2A 4RYEA 4WYYA 5IHVA 5FI7A 4KZ4A 4HESA 4OPRA 4QU3A 2Y55A 3UO9A 5GHYA 2ZC6B 5F82A 5CHUA 4YFMA 4FCFA 5M19A 1BT5A 3SS4A 1JVJA 1NY0A 3GSGA 3G32A 3G34A 5FQKA 2PU4A 4O7DA 5EUAA 5A91A 4S2IA 1SDEA 1GHIA 4S2LA 4S2NC 2XGNA 3UDIA 2XFTA 1K25A 3ITBA 3NI9A 3TOIA 3MFDA 3PBTA 4UAAA 3HREA 2A49A 4GDBA 2QMIA 4KQRA 2P9VB 2Y2HA 5GLCA 3UPPA 1WYBA 1L0GA 4OVDA 2J7VA 3SS3A 2EX9A 3SH9A 1L0EA 1XP4A 5A93A 4OOMA 3HLCA 2BG1A 4QY6A 4X55A 4JXWA 4EUZA 1MY8A 3S1YA 3MZFA 5AQ7A 4GNUA 3UE1A 2UWXA 4F94A 1YMSA 1KE3A 1TVFA 4CPKA 1DJAA 1VQQA 3SOIA 4R4SA 3Q7VB 2ZC3B 1LI9A 3FKWA 3P09A 3GQZA 1K55A 4GB7A 4KZ9A 5EPHA 2HPBA 3UE0A 1KE4A 5HAIA 3ZG8B 3ZFZA 1DY6A 1K6RA 3O86A 2ZM8A 2ZQ9A 3M6BA 4WELA 4OLDA 4N1XA 4IBXA 4KZ7A 5E2HA 4B88A 4X69A 3ZG5A 2XD1A 2Y2PA 4N9KA 4WEJA 3HBRA 1SCWA 5EOEA 2ZMAA 1HD8A 1XXMA 3IH8A 2WKHA 1YT4A 3IF6C 1L0DA 4KQOA 2WZZA 2OLVA 1BLPA 2Y2GA 1VM1A 3FV7A 3CMZA 5EVIC 4OQIA 4FH2A 3E2LA
chains in the Genus database with same CATH superfamily
3ULFA 3IXHA 3MXSA 2HL1A 1K56D 3OPPA 2HP5A 4LRXC 3FPWA 1J3WA 3LR3A 4OQGA 3GECA 3RTYA 3UNWA 5FSRA 3PD5A 3MS6A 2JKRM 5KSCA 2DMWA 3I7JA 3W4PA 4BLMA 4OPYA 3UY6A 2ZQ7A 3F1OB 1TS8A 4EBNA 3V39A 1HZOA 3MSHA 1JWVA 3U4LP 4S2PA 4NXEA 1KGGA 1CEGA 4XUXA 3KSFA 1IYSA 1BLHA 2UV0E 3MXRA 4OP8A 3IT9A 2FH5A 4E6XA 4EWFA 1XJ6A 2H0TA 1GCEA 4MEZA 5DJTA 5HFOA 3QNCA 1H0MA 3WS5A 2CC1A 4RRGA 1YLYA 1JNUA 5FA7A 1VETB 1DJCA 4C3QA 5HZHA 1MPLA 4S0JA 4R70A 1T18A 4MCWA 3C4OA 4OPQA 2LB9A 2Y2NA 2L0WA 3OC2A 5F6AA 4RRMA 4EESA 1ALQA 3DTEA 3OLOA 5CGWA 4OOYA 1ES3A 4XUZA 4DKIA 2IWDA 1ERMA 3HLWA 2B95A 3MQ0A 2ZM0A 5DF8A 1GHMA 4RRBA 3DW0A 2QJ7A 3BFFA 2FFYA 3HLBA 1OTEA 2PR5A 1S67L 1XX2A 2HP6A 4NXFA 4LPZA 4R6LA 2V8CA 2PYPA 4MLLA 1K4EA 3WRTA 3VFHA 5HPFA 2PD7A 1GSXA 3EQUA 3TJZC 5F83A 1GHPA 4DE2A 5IU1A 3B47A 2HDSA 3VOLA 2Y79A 4KUKA 1NLZA 4OP5A 3GRJA 2J3WA 2GJ3A 4E6WA 3VP1A 1U60A 3NULA 2VGJA 2XD5A 3SS5A 1W8YA 2HJ9C 3PBQA 4N9LA 2C6WB 1Y4OA 3IXBA 3KX0X 5HAPA 1E3UD 1GSWA 1JTDA 3GR2A 3IF6A 2WK0A 3HLEA 1STZA 1UWPX 3OZHA 4WLAA 4S2MA 4HI4A 4PM9A 1TC5A 3BFCA 3KSGA 3IS2A 4HY8A 4LV1A 2P9VA 3O88A 2IWCA 2EWWA 1Z6FA 2J3TD 4O0PA 4IUKA 4BQMA 3E4PA 4YOFA 3EQVA 1OT9A 3IX8A 4O01A 4X1LA 1KE0A 1SHVA 3HVFA 1LSWA 3Q7VA 3FG8A 1PNEA 3IWQA 4LCLA 5KIZA 4DDSA 2QWSA 2ZMFA 4LFUA 1J7GA 2JN7A 5E2FA 2QPNA 3HUMA 4QJGA 3MFXA 5TBMA 3LIAA 3UB8A 1O07A 2OKVA 3C30A 1BSGA 4S0KA 4KZAA 3ZYTA 3OPHA 2KLIA 3LY4A 1S66L 2ZOHA 1IKIA 3P98A 4HJ4A 2H0YA 4EEPA 3K3DA 5HAQA 2VGLS 2Q9MA 4X6TA 4BJPA 1IOUA 2ZBBA 1K57C 4PAUA 5HWVA 2KX6A 1YLWA 2EX2A 1KVMA 3VP3A 3IHAA 2GNXA 4BBUA 1H5XA 1BTLA 1XGJA 3Q1FA 3MF0A 2W1TA 1ZTUA 4L9FA 3BJNA 1VETA 1LT0A 1Y54A 4GS9B 1ES5A 3PTEA 1K56A 5DTSA 4EEUA 4OLGA 4PKYA 1K54C 4DN0A 3CJMA 5CHJA 3O87A 3MZDA 2DCFA 3QP2A 1RGZA 2A3UA 5EECA 2C5WB 4LV2A 4F3LB 1D7EA 2PD8A 5G18A 1ACFA 3QP5A 1FCOA 1W8QA 1IYPA 3N8SA 4MNRA 3ZG7B 4ARZB 4JGQA 3HLGA 1KGEA 2Y2OA 4A5RA 3SH8A 2PT7A 5M1AA 4BL2A 5U47A 1T1AA 5HWTA 3FZCA 2XF3A 3E2KA 4UQIM 1H8MA 3NY4A 5TJJA 2V8FA 3E4QA 2EX6A 1GSVA 4DXBA 3T1SA 3ZGAB 4MMNA 4UA6A 1L2SA 4WZ4A 5CX7A 3UB5P 1MC0A 2WYXA 3M2JA 2GX5A 4WUJA 4RYEA 5FL3A 3UO9A 1LL8A 5F82A 4FCFA 3P7NA 3GSGA 3G32A 3G34A 4O7DA 3T4OA 2VGLM 4S2NC 2XFTA 3NI9A 4UAAA 3PBTA 4GDBA 3HCYA 1XJ3A 3UPPA 3SS3A 3SH9A 1L0EA 4OOMA 3MQOA 2BG1A 4EUZA 4JGPA 2HL2A 3A0VA 4F94A 2W3EA 3F1NB 2JHEA 1DJAA 2ZC3B 4KZ9A 3UE0A 3P09A 3GQZA 1K55A 3SZTA 4D60A 3ZFZA 1K6RA 2HL0A 2XSSA 3O86A 2ZQ9A 4IBXA 4KZ7A 3CAXA 5E2HA 4B88A 3ZG5A 4WEJA 5EOEA 1SCWA 1CF0A 4MN6A 3KOCA 2Y2GA 4OQIA 4R3AA 3E2LA 3BW6A 1PYYA 5D3OA 4XXRA 3DTMA 1F98A 1SZVA 3N4IA 4Y0UA 2Y8HA 4R4RA 2O9CA 2VV8A 4HNBA 3PBNA 3MBZA 1OJGA 3CI6A 4QB8A 4MDZA 1PW1A 3H9WA 3GV9A 4GN2A 3FC7A 3KYQA 4X56A 3T4QA 2WGWB 2V0UA 1YLJA 3TRCA 2WUQA 4FH4A 4OPZA 2M1CA 4RVAA 3S7NA 3UB6A 1YSPA 5KZHA 1N9BA 1PFLA 1KGFA 2Y2QA 4RRFA 2ZL1B 4GHIB 3BY8A 3KO4A 4NEED 3G2YA 3IF6B 2JKFA 1L0FA 4S0IA 4KZ3A 1NYMA 4LGWA 4CLCD 4WMCD 2BTFP 3WS4A 3LIFA 4S2JA 4HP9A 4EU0A 1ES4A 3TE8A 4NBJA 3BQAA 2NUPC 4B4XA 2DBOA 1H8YA 4PPRA 4YNRA 4QHCA 3ZQ5A 4YWZA 3ZNTA 1S4RA 2CMNA 4KG5A 4GS9A 4LRYC 2NUTC 1YPRA 3C2WA 2XDMA 4I5SA 2Z6CA 1UGUA 4L9EA 3LIBA 2XROA 5CHMA 1MXOA 2EXAA 1OTDA 1PWDA 4JF6A 2HDQA 3VP4A 2JC7A 2XFSA 3VSKA 1I2SA 5EE8A 3T4JA 5HDDA 1LI0A 4ARZA 5HW3A 2Y2LA 3ITAA 4CLCB 5HD3A 2DNSA 2K31A 1LHYA 4HJ6A 1G5UA 4EQ1A 3KSIA 3ZG9B 3V3SA 4RR7A 3ZDJA 3KO6A 3PBRA 3FKVA 4X1MA 2L4RA 3BM6A 3OCNA 2VEAA 3C8CA 1MWSA 1OTIA 1YLZA 4WEKA 1LSXA 4EXOA 3LMUA 2B18A 3VOYA 2VX8A 2RL3A 2ZC5B 3Q07A 5E43A 2K2NA 5CGSA 3B33A 3PBSA 5TR7A 2FFFB 4GW9A 3LYXA 3UPNA 4GD6A 4B9OA 2EA9A 5TFQA 1PWCA 4Y3IA 1CK3A 3BWLA 5FDHA 1M6KA 1XGIA 4DMZA 4JGOA 2W1TB 3T1RA 2PYRA 5FI2A 3KODA 3DTIA 3IQAA 3LI9A 2HJEA 4ZAMA 1NLYA 1FR6A 4DE1A 4PKYG 2XLNA 3EWKA 3CPTA 1FCMA 4GKUA 4K0WA 4B4ZA 3F1NA 1MKMA 3GVBA 3KO5A 2J8YA 1JWPA 3CITA 3W4QA 3T1QB 2ZLYA 2A2LA 3HJKA 2OV5A 5AQAA 4ETXA 5EOOA 4HHDA 3KSHA 4DF6A 3S22A 4HBUA 5J7EA 4MN7A 3T50A 1JTGA 2XRNA 1LL9A 3EGDC 3S7OA 1TF1A 2A24B 2KOIA 2PBYA 1XA7A 4JLFA 4K08A 2OWHA 4DRTA 2RCXA 1BYWA 3D4FA 3BQ8A 2PAVP 4GCZA 4RRCA 4GLQA 4E3MA 4H6JA 4L9GA 4AFIA 3DBAA 4RRDA 3VE4A 4WF0A 3UE6A 4LRZE 2X02A 1F5MA 2XEPA 2WGWA 5AQBA 4KENB 3W8KA 4FSFA 1IYOA 2V2FF 2VGKA 1XA1A 2QZ6A 4R1GA 5CECA 1LSVA 3NOPC 2PBDP 2EFUA 4OQHA 1PW8A 5A90A 4PMAA 1F9IA 3C38A 4HH3A 2JKTI 2QKPA 1K38A 5FQ9A 2V1BA 2ZL1A 4GHIA 4ESPA 3NOUC 1ZKJA 2W3GA 2Y91A 1EWZA 5DFXA 4O8GA 2HDUA 5DVAA 2G7UA 5CTMA 4DXCA 1ESUA 2K7SA 4S2KA 1D06A 5CXWA 1BULA 4GOGA 1MKIA 2H28A 3C7UA 1YM1A 5L8MA 1HVBA 4DDYA 3EOIA 4CQHA 4C75A 4ZJ2A 3WWXA 2V20A 2X01A 1MWTA 3QP1A 2Y2MA 4ME4A 3G4PA 3MQQA 3IBJA 3T4KA 3PR6A 1BLCA 2ZC4B 4Y13A 3UMDA 3N8LA 4JBFA 2O0YA 3DWKA 3C7VA 4Y5FA 4WZ5A 3ZVTA 4RQ9A 3CG5A 2ACGA 2P7JA 4RRRA 4CLCA 3PXPA 4WMCA 2D01A 3CUEA 4S02A 4KZ4A 4HESA 4OPRA 3NECA 1W63M 4QU3A 2Y55A 2YKHA 5EUAA 1XFQA 3ITBA 4KQDA 3TOIA 4KQRA 1WYBA 5K5BA 5A93A 4II7A 3HLCA 4X55A 3S1YA 3MZFA 4RRKA 2UWXA 3H7WB 1KE3A 4NBIA 4B93A 2J80A 1VQQA 3SOIA 4R4SA 3F1PB 4GB7A 2W0NA 2HPBA 1G6OA 5HDCA 4NKPA 3ZG8B 5DKLA 4OLDA 1K0KA 3LMTA 4X69A 3DTKA 2XD1A 4X25A 3SW1A 1HD8A 5F69A 3IF6C 4KQOA 3B42A 2EWVA 1H3QA 2WKQA 1BLPA 2WZZA 3LFVA 1WA9A 4GDNA 4GJ4A 3BEBA 2EFXA 3LMVA 2Z6DA 1KVLA 4Q8IA 3LY3A 1YLTA 4ZDXA 5FAQA 3IX3A 1KDWA 4KZ5A 1TS6A 4EV4A 1T19A 4MN5A 3TG9A 3WS1A 4IBRA 4P6ZS 5G4YA 5TGFA 2FZ0A 1G28A 4X53A 1UWNX 4Z9QA 1GA0A 1NXYA 2A24A 4NXGA 3BRMA 5A92A 3R4KA 3RXXA 2O9AA 4JXVA 2XA7S 2OAP1 1OMEA 1SKOA 1I5QA 4M4XA 1K4FA 5HARA 1N9NA 3IX4A 5JYPA 3KO3A 5DKKA 3N7WA 3LICA 4NK3A 1NWZA 1HTZA 3IHBA 4ETZA 3QP4A 1TD5A 5EFWA 3MXQA 3V50A 5L2FA 2BASA 1I2WA 1MWRA 3UPOA 4R3JA 3C5AA 3UE3A 3FPVA 3A3IA 4WBGA 4Y2FA 3LIEA 1G68A 5FQJA 4NXBA 4E3KA 4S03A 4K0XA 4RX3A 3BFEA 4FTXA 2V1ZA 2O9BA 5IS1A 4P0MA 4P87A 1ERQA 4RR8A 4DE3A 4HQAA 1MBLA 3CPTB 1IEMA 4Y0OA 4LLOB 5C5KA 1W7FA 2AVXA 3NJAA 1ZC2A 2L1MA 1PZOA 4I3JA 1LLBA 1FIKA 3PAGA 1DJBA 4DJ3A 3PHYA 1XJ2A 2EX8A 3EEHA 2G2UA 2JKTM 4ZJ3A 4LCMA 5AQ9A 5KSHA 2HDRA 2P04A 3W4OA 1S0WA 3AGDA 1W63Q 4E3NA 2ZQ8A 3T12B 4RR9A 5FI6A 4QD4A 3SH7A 4BENA 3QP6A 4UHUA 3NOTC 1ONGA 4P6ZM 5FAOA 4H6JB 5DJUA 4DJ2A 4QWOA 2EXBA 3LI8A 3HLDA 5EVEA 2W3FA 2XA7M 3CZDA 5EVIA 5AVFA 3G2ZA 3UB9A 1LL5A 4OH0A 2WAFA 3Q7ZA 1J9MA 2R9WA 1T1CA 5A8BA 1ODVA 1W5DA 2PRFA 2W27A 1S4SA 2XQZA 3ZCZA 2Y2JA 4P85A 3B3XA 3S7QA 2JE5A 4S0LA 2O99A 4Z1WA 1Q2QA 4IVKA 3H7WA 2WAEA 1D1JA 2JBFA 1BZAA 1TDGA 3F1PA 1TS7A 1PRQA 4BD1A 5DF9A 2HZ5A 1NRJA 1V9YA 4ID4A 3AGFA 4HP4A 5CRFA 2VA0A 1IFQA 5E2GA 4KG2A 5FATA 1O7EA 4QY5A 4M3KA 3UDXA 4EETB 3NDEA 1VEUA 1W79A 1K55C 2WKIA 3ZHHA 3V3RA 2X71A 4JGRA 3Q81A 4FUWA 4CJNA 1HLUP 3LCEA 3T1XA 1PI5A 2XK1A 4GD8A 3VFFA 5KMWA 2Y2IA 3OOVA 5L07A 3MKEA 3H82B 3IBRA 5GHZA 2B5RA 1X0OA 4H8RA 2HGVA 1K6SA 3LIDA 5EVLA 3GMWA 2HP9A 2ZOIA 3BFDA 4KZBA 1PIOA 3IF5A 2WGVA 1P97A 4EQIA 5HWWA 4PM7A 4I38A 3WS2A 3VOZA 3T4SA 4U0XA 3DWZA 4IUHA 5HL1A 2QJ5A 1Q2PA 1ESIA 3LO7A 4R23A 2IA2A 4KZ8A 3U2AA 3HJIA 1AXBA 3WRZA 1XKZA 3MKFA 4E3OA 1L3LA 3C4PA 2OLUA 4OONA 3HUOA 5J4EA 5CEDA 1Y2QA 1KDSA 2XH9A 4BL3A 3MZEA 1XJ4A 2ZQAA 2BLSA 3CHWP 3LGOA 4I39A 1CQAA 2J3TC 1ONHA 2VV6A 1T1BA 4RRLA 1PWGA 2ZJ9A 5HD5A 4OQ0A 1DP8A 1IKGA 2Y4AA 3JVVA 5CGXA 2M7UA 2ZMVA 1CI9A 5E2EA 5FQIA 4JKTA 3OPLA 3QNBA 1FILA 1P9WA 1TS0A 3FYZA 4K91A 1SDNA 4WN5A 4MBKA 4ZTKA 3UB7A 3GTCA 4WL9A 2ZM2A 4BMWA 1V9ZA 5GLAA 4FOFA 5FDSA 2Z2LB 3LEZA 1C3BA 4R38A 3LR5A 4YINA 2P08A 5GL9A 4U3TA 5FI7A 1AWIA 1YAXA 5HSQA 2ZC6B 5CHUA 4YFMA 1BT5A 3G6OA 1P9RA 2VLGA 1JVJA 1NY0A 1SKOB 5A91A 1SDEA 2JKGA 4S2LA 2XGNA 3TW8A 1K25A 3MFDA 3R7WB 2A49A 2QMIA 2Y2HA 5GLCA 1L0GA 3KYZA 2EX9A 3LUQA 1XP4A 5AVEA 2MJ6A 4QY6A 5AQ7A 1ZHHB 4GNUA 3UE1A 2WKPA 2WKRA 4IJGA 1TVFA 3CWFA 4CPKA 2B02A 1LI9A 4E04A 1KE4A 1DY6A 4RRJA 2Y2PA 3HBRA 3L9KA 4Y17A 5IT5A 1YT4A 2OAQ1 1Y28A 2OLVA 3FV7A 3CMZA 4G3WA 4FH2A 3BLSA 1QMEA 3ICYA 1NRFA 3IWIA 1PZPA 2KDKA 5M18A 2WGIA 2J9PA 5FQQA 1K57A 3G31A 5EVID 5G4ZA 2Q0OA 4Q0JA 4HBTA 3D3OA 4OKPA 4BD0A 2GDNA 1YSQA 4IEDA 4QPRA 3OCLA 1MWUA 4CLCE 3BY9A 5AJGA 5CERA 1NZUA 3QHYA 1S1YA 2YKFA 4LENA 3KYEA 5FEFA 3QP8A 4LV3A 1P0ZA 1RCJA 1FR1A 2WADA 2VK3A 1K54A 4BWIA 2E8IA 3PD2A 5LBRA 5BOHA 2HV1A 3MR0A 3H82A 4KQQA 3KNFA 2W3DA 3JVUA 4WM9A 4XT2B 3A3EA 4N1HA 4EBLA 1H8ZA 2Y59A 2HF6A 5EVIB 3CLOA 4D2OA 3ZG0A 3A0SA 3PD4A 2I72A 3E98A 3V67A 2VJWA 3HLFA 4UQIS 4RRQA 2Z2MB 5F5YA 4G3VA 1JWZA 5HX9A 5MC7A 5I5LA 1M40A 2WKEA 1BUEA 3BYDA 4UA7A 3A0RA 4LV0A 1CI8A 3RXWA 2W3HA 2WZXA 4UA9A 5CEBA 3T4LA 4JXSA 1WE4A 3VSLA 4C6YA 1YQSA 5DTTA 4Y15A 1IYQA 1NJ4A 2QHKA 3NCKA 3F1OA 4S2NA 3KO9A 4Q0IA 1SKFA 3K2NA 3UMEA 5GLBA 4IVIA 3ZVWA 4E3LA 5FEGA 3EGXC 3V5MA 4P6BA 5J3WA 4S2OA 2V1AA 1VEUB 3FWLA 2W1RA 4KG6A 5DTKA 3A3DA 3PAEA 4RR6A 1ZG4A 2JCHA 3KOBA 4RRHA 5F68A 5FQMA 3OBFA 2VV7A 1DP9A 2QYBA 2VKSA 4N92A 3VP0A 1TDLA 4FD8A 4Y7PA 2R78A 1WYCA 3N8RA 1FSYA 3VE3A 5J8XA 1OPXA 4Y0TA 3S7PA 5DFYA 1S6RA 2JKRI 1OTAA 4WZ5C 3PYPA 1XFNA 2ZQCA 1FCNA 2LB5A 3R7WA 4UEYA 4CLCC 1DP6A 3CUEC 3IWOA 4JXGA 3D72A 4E3JA 4JPMA 5I94A 1TEMA 4E3IA 3A3FA 5J61A 3BFGA 3ISGA 3HUNA 3RFBA 1FSWA 1IELA 1CJFA 3NBLA 2E8JA 1G6AA 4U0TA 2VZWA 4Q0HA 1VB6A 2PR6A 4EW7A 4RX2A 4I3AA 1NYYA 2PU2A 3N6IA 1FQGA 2OOLA 4KUOA 4L0LA 1OT6A 4R3BA 3UDFA 1RGYA 1EW0A 4MBHA 2Q9NA 3A3JA 3NC8A 4ZJ1A 4X68A 2INWA 1OJ5A 3IXDA 3G35A 1MZUA 3KNPA 1N9OA 3W2ZA 3EEAA 3M6HA 3ZNYA 3HL9A 1FOFA 1YLPA 4BBTA 3VP2A 3LR4A 2H5SA 1A0KA 1F2KA 5FASA 5HDSA 5FAPA 4HEFA 2M7VA 4BBVA 1OTBA 4HIAA 3PBOA 2ZC7A 2IWBA 1QMFA 2ZQDA 1EROA 3JYIA 4G3KA 1NZOA 2V9AA 1Z09A 1XPBA 3E0YA 1E4DA 2DRWA 2G2WA 3NIAA 3G30A 1RP5A 4OOLA 4ZBEA 3GDIA 5L09A 3TSGA 3MMHA 3E4OA 2V0WA 2Y2KA 2XR0A 2D02A 5HPIA 1YMXA 4I3IA 4PHTA 4XT2A 2PDRA 1S1ZA 1BLSA 3IH9A 3IXGA 3VMAA 1CEFA 4R0QA 1E25A 1GA9A 1E3UA 5HL6A 3NDGA 4JF4A 1ZG6A 2P74A 4EUVA 2R9XA 4RA7A 3Q82A 5F1GA 3AGEA 4DE0A 3WS0A 3S4XA 2HKZA 4GZBA 3BLMA 1PI4A 3M2KA 4EERA 4PM6A 3JPUA 2H10A 3RJUA 1N4OA 4NETA 3L7HA 3BECA 3LEQA 4ZRRA 2J9OA 3UN7A 4RRAA 5JYOA 4MBFA 2OSUA 3D9YA 4PM5A 3VV4A 4KZ6A 4PM8A 2ZD8A 5GLDA 4EBPA 3OPRA 3RH8B 1JKEA 5DF7A 1EI5A 5F1FA 3O3VA 5GHXA 5CTNA 3KO7A 4JF5A 3LR0A 2GZAA 1ES2A 4WYYA 5IHVA 1KOUA 3DAVA 5GHYA 4NG2A 5M19A 2PHYA 3SS4A 5FQKA 2PU4A 5L10A 4S2IA 1GHIA 3P01A 4HH2A 5EV0A 3UDIA 3K3CA 3IS2B 1DRMA 3HREA 3MJQA 2OWJA 2P9VB 3T4TA 4OVDA 2J7VA 5EM1A 4JXWA 1MY8A 1N9LA 4HOIA 1VHMA 1YMSA 3O5YA 3NHQA 3PD3A 1YKDA 3Q7VB 4F3LA 3FKWA 5EPHA 5HAIA 2ZM8A 3M6BA 4WELA 5EM0A 4N1XA 4N9KA 2ZMAA 5TBMB 1XXMA 3IH8A 2WKHA 4RRIA 1L0DA 4IHQA 2I9VA 1VM1A 5EVIC 4HJ3A
chains in the Genus database with same CATH topology
3BLSA 1QMEA 1NRFA 3IXHA 3MXSA 1PYYA 4GDNA 2HL1A 1K56D 3IWIA 1PZPA 2HP5A 3OPPA 5D3OA 5M18A 2WGIA 2EFXA 3BEBA 4XXRA 3LMVA 2J9PA 5FQQA 3DTMA 1KVLA 1K57A 4OQGA 3G31A 3N4IA 4Y0UA 5EVID 4Q8IA 3UNWA 5FSRA 3PD5A 4HBTA 4R4RA 3LY3A 5KSCA 4OKPA 1YLTA 3I7JA 4BD0A 5FAQA 2GDNA 4IEDA 3W4PA 4ZDXA 1KDWA 4BLMA 3OCLA 4OPYA 3UY6A 4KZ5A 3PBNA 3MBZA 1MWUA 4QB8A 2ZQ7A 4EV4A 1PW1A 4EBNA 5CERA 3V39A 1NZUA 1HZOA 3GV9A 1JWVA 3QHYA 3TG9A 3WS1A 4S2PA 4GN2A 1KGGA 4IBRA 4LENA 5TGFA 1CEGA 4XUXA 1IYSA 4X53A 4X56A 1BLHA 4Z9QA 3MXRA 4OP8A 2WGWB 1GA0A 3IT9A 1NXYA 4LV3A 1RCJA 1YLJA 1FR1A 4E6XA 4EWFA 2WUQA 2H0TA 3BRMA 1GCEA 2WADA 5A92A 4FH4A 1K54A 4MEZA 3RXXA 4JXVA 4OPZA 2E8IA 5HFOA 1OMEA 3QNCA 1I5QA 4RVAA 1K4FA 3WS5A 2CC1A 5KZHA 3PD2A 4RRGA 5HARA 1N9BA 5BOHA 1YLYA 5JYPA 3KO3A 1KGFA 3N7WA 5FA7A 4NK3A 1DJCA 1HTZA 4C3QA 3IHBA 4KQQA 3KNFA 4WM9A 1MPLA 2Y2QA 4RRFA 4S0JA 3V50A 5L2FA 3A3EA 4N1HA 4EBLA 3KO4A 3G2YA 1H8ZA 1I2WA 1MWRA 2Y59A 3IF6B 3C4OA 3UPOA 4R3JA 5EVIB 1L0FA 3C5AA 4KZ3A 4S0IA 4D2OA 3UE3A 4OPQA 3ZG0A 1NYMA 3PD4A 3A3IA 2Y2NA 4WMCD 4WBGA 2I72A 3WS4A 3OC2A 4RRMA 4S2JA 1G68A 1ES4A 1ALQA 5FQJA 4NBJA 3HLFA 4B4XA 2DBOA 4E3KA 4RRQA 4S03A 4K0XA 5CGWA 4OOYA 1H8YA 4RX3A 3BFEA 2Z2MB 4PPRA 1ES3A 2V1ZA 4XUZA 4DKIA 1JWZA 2IWDA 1ERMA 3HLWA 5HX9A 4QHCA 2ZM0A 1M40A 4P0MA 2WKEA 1BUEA 4P87A 3ZNTA 1ERQA 5DF8A 4KG5A 1GHMA 3BYDA 4UA7A 4RR8A 4RRBA 4DE3A 4LV0A 1CI8A 2XDMA 3DW0A 3RXWA 1MBLA 3BFFA 1IEMA 2FFYA 2WZXA 3HLBA 4UA9A 4Y0OA 5CHMA 5CEBA 1W7FA 1MXOA 1XX2A 2EXAA 4JXSA 1ZC2A 1PZOA 2HP6A 1PWDA 1WE4A 4JF6A 2HDQA 3VP4A 2JC7A 1LLBA 3VSLA 4C6YA 3PAGA 1YQSA 2XFSA 5DTTA 3VSKA 1DJBA 1IYQA 1I2SA 1NJ4A 3NCKA 4MLLA 1K4EA 3WRTA 5EE8A 3VFHA 2EX8A 4S2NA 3EQUA 1LI0A 3KO9A 5G18A 5F83A 5HW3A 1GHPA 2G2UA 1SKFA 4DE2A 4ZJ3A 2Y2LA 2HDSA 3ITAA 4LCMA 5AQ9A 5KSHA 2HDRA 2DNSA 5GLBA 4IVIA 3ZVWA 4E3LA 3W4OA 1S0WA 3AGDA 4OP5A 3GRJA 1LHYA 3V5MA 4E6WA 3VP1A 4E3NA 1U60A 4P6BA 4S2OA 2ZQ8A 3ZG9B 3FWLA 4RR9A 5FI6A 2VGJA 4QD4A 2XD5A 3SH7A 3V3SA 4KG6A 5DTKA 4BENA 4RR7A 3ZDJA 3PBRA 3A3DA 3FKVA 3SS5A 1W8YA 3PAEA 4RR6A 4UHUA 1ZG4A 2JCHA 3PBQA 1ONGA 4N9LA 3KOBA 4RRHA 2C6WB 4BL3A 3BM6A 5FAOA 5FQMA 3IXBA 3OCNA 5HAPA 2EXBA 1E3UD 3HLDA 1MWSA 4N92A 1YLZA 3VP0A 4WEKA 1TDLA 1JTDA 3GR2A 4FD8A 3IF6A 2WK0A 3LMUA 3CZDA 3HLEA 4Y7PA 1WYCA 3N8RA 1FSYA 5EVIA 3VOYA 2RL3A 3G2ZA 5J8XA 1LL5A 2ZC5B 4OH0A 3Q07A 3OZHA 5E43A 2WAFA 3Q7ZA 5CGSA 3PBSA 5TR7A 4Y0TA 1J9MA 2FFFB 2R9WA 4S2MA 1S6RA 1W5DA 4PM9A 3UPNA 4GD6A 1TC5A 5TFQA 1PWCA 1CK3A 2XQZA 5FDHA 1M6KA 4WZ5C 1XGIA 2ZQCA 3BFCA 2Y2JA 3ZCZA 4P85A 3B3XA 1FCNA 5FI2A 3KODA 4LV1A 2JE5A 2P9VA 3O88A 2IWCA 3IQAA 4S0LA 4ZAMA 1FR6A 4DE1A 1Z6FA 2XLNA 3IWOA 4JXGA 4BQMA 4E3JA 3EQVA 4JPMA 1FCMA 5I94A 4GKUA 1TEMA 4K0WA 4E3IA 1Q2QA 3A3FA 4IVKA 4B4ZA 5J61A 1KE0A 1SHVA 3HVFA 2WAEA 3BFGA 3ISGA 3HUNA 3KO5A 3GVBA 2JBFA 1BZAA 1TDGA 2J8YA 3Q7VA 1JWPA 1FSWA 1IELA 3NBLA 3IWQA 4LCLA 1G6AA 4U0TA 4BD1A 3W4QA 4DDSA 5DF9A 1J7GA 5E2FA 2ZLYA 2QPNA 3HUMA 4ID4A 3AGFA 4QJGA 5CRFA 2OV5A 5AQAA 5E2GA 5EOOA 4RX2A 4KG2A 4DF6A 1O07A 4HBUA 3S22A 2OKVA 1JTGA 1NYYA 5FATA 1BSGA 1LL9A 2PU2A 1O7EA 3N6IA 4QY5A 4M3KA 1FQGA 3UDXA 4S0KA 4L0LA 4KZAA 3NDEA 4R3BA 3UDFA 1RGYA 2PBYA 1XA7A 4MBHA 4JLFA 1W79A 1K55C 2Q9NA 3A3JA 2WKIA 3ZHHA 3OPHA 3NC8A 4ZJ1A 4DRTA 4X68A 2RCXA 3D4FA 3LY4A 3V3RA 2X71A 3IXDA 3G35A 3KNPA 3Q81A 4CJNA 4RRCA 4E3MA 3LCEA 1IKIA 3M6HA 1PI5A 2XK1A 3ZNYA 4GD8A 3VFFA 3HL9A 5KMWA 1FOFA 2Y2IA 3MKEA 3P98A 4RRDA 5GHZA 1YLPA 2B5RA 2H0YA 3VP2A 5FASA 2H5SA 4H8RA 5HAQA 1K6SA 5EVLA 2Q9MA 4X6TA 4HEFA 5FAPA 3GMWA 2X02A 2HP9A 3BFDA 3PBOA 4BJPA 2ZC7A 4KZBA 2IWBA 1QMFA 2XEPA 2ZQDA 1EROA 2WGWA 5AQBA 4KENB 1K57C 3W8KA 1PIOA 3JYIA 4FSFA 3IF5A 2WGVA 1IYOA 1NZOA 1YLWA 4EQIA 4PM7A 1XPBA 2EX2A 1KVMA 1E4DA 3IHAA 3VP3A 2DRWA 3WS2A 2G2WA 2V2FF 3VOZA 1H5XA 1BTLA 2VGKA 1XA1A 2QZ6A 3NIAA 4R1GA 4U0XA 5CECA 1XGJA 3G30A 3Q1FA 1RP5A 4OOLA 3DWZA 2EFUA 4OQHA 4ZBEA 5HL1A 1Q2PA 1PW8A 3TSGA 5A90A 4PMAA 1ESIA 2Y2KA 3LO7A 2XR0A 1Y54A 1YMXA 1K38A 5FQ9A 1ES5A 3PTEA 1K56A 5DTSA 1ZKJA 4R23A 4OLGA 4KZ8A 1BLSA 2Y91A 1AXBA 3WRZA 1K54C 1XKZA 1EWZA 3CJMA 3MKFA 5CHJA 3O87A 3MZDA 4E3OA 2DCFA 3C4PA 3IH9A 3IXGA 3VMAA 2HDUA 2OLUA 4OONA 1CEFA 1RGZA 4R0QA 1E25A 5DVAA 2A3UA 5EECA 2C5WB 1GA9A 4LV2A 5CTMA 4DXCA 3HUOA 1ESUA 1E3UA 5CEDA 1Y2QA 1KDSA 2XH9A 4S2KA 3MZEA 3NDGA 4JF4A 1ZG6A 5CXWA 1BULA 4GOGA 2ZQAA 2BLSA 2P74A 1FCOA 1W8QA 1IYPA 2R9XA 1MKIA 1ONHA 3Q82A 4RA7A 4RRLA 3N8SA 5F1GA 4MNRA 3AGEA 3C7UA 1YM1A 1PWGA 2ZJ9A 4DE0A 3WS0A 3ZG7B 4OQ0A 1HVBA 4DDYA 3S4XA 3HLGA 2HKZA 1KGEA 2Y2OA 4A5RA 4C75A 1IKGA 4GZBA 2Y4AA 3BLMA 4ZJ2A 3SH8A 1PI4A 3WWXA 2V20A 3M2KA 2X01A 5CGXA 1MWTA 5M1AA 1CI9A 4BL2A 2Y2MA 4PM6A 5E2EA 5U47A 5FQIA 2H10A 4JKTA 3OPLA 3RJUA 3QNBA 1N4OA 3G4PA 3FZCA 3BECA 2XF3A 3E2KA 4NETA 2J9OA 3UN7A 3FYZA 4K91A 1SDNA 1BLCA 4RRAA 2ZC4B 4MBKA 5JYOA 4MBFA 2OSUA 4ZTKA 3NY4A 3N8LA 4PM5A 3GTCA 4KZ6A 4PM8A 2ZD8A 5GLDA 2ZM2A 4JBFA 4EBPA 3OPRA 3DWKA 1JKEA 2EX6A 5GLAA 5DF7A 4DXBA 1EI5A 3C7VA 5F1FA 4WZ5A 3ZVTA 3O3VA 3ZGAB 2Z2LB 3CG5A 3LEZA 4UA6A 5GHXA 1C3BA 1L2SA 4WZ4A 5CTNA 4RRRA 2WYXA 4YINA 3KO7A 5GL9A 3M2JA 4JF5A 4U3TA 4WMCA 1ES2A 4RYEA 4WYYA 5IHVA 5FI7A 4S02A 4KZ4A 4HESA 4OPRA 4QU3A 2Y55A 3UO9A 5GHYA 2ZC6B 5F82A 5CHUA 4YFMA 4FCFA 5M19A 1BT5A 3SS4A 1JVJA 1NY0A 3GSGA 3G32A 3G34A 5FQKA 2PU4A 4O7DA 5EUAA 5A91A 4S2IA 1SDEA 1GHIA 4S2LA 4S2NC 2XGNA 3UDIA 2XFTA 1K25A 3ITBA 3NI9A 3TOIA 3MFDA 3PBTA 4UAAA 3HREA 2A49A 4GDBA 2QMIA 4KQRA 2P9VB 2Y2HA 5GLCA 3UPPA 1WYBA 1L0GA 4OVDA 2J7VA 3SS3A 2EX9A 3SH9A 1L0EA 1XP4A 5A93A 4OOMA 3HLCA 2BG1A 4QY6A 4X55A 4JXWA 4EUZA 1MY8A 3S1YA 3MZFA 5AQ7A 4RRKA 2HL2A 4GNUA 3UE1A 2UWXA 4F94A 1YMSA 1KE3A 1TVFA 4NBIA 4CPKA 1DJAA 3PD3A 1VQQA 3SOIA 4R4SA 3Q7VB 2ZC3B 1LI9A 3FKWA 3P09A 3GQZA 1K55A 4GB7A 4KZ9A 5EPHA 2HPBA 3UE0A 1KE4A 5HAIA 3ZG8B 2HL0A 3ZFZA 1DY6A 1K6RA 3O86A 2ZM8A 2ZQ9A 3M6BA 4WELA 4OLDA 4N1XA 4IBXA 4KZ7A 5E2HA 3LMTA 4RRJA 4B88A 4X69A 3ZG5A 2XD1A 2Y2PA 4N9KA 4WEJA 3HBRA 1SCWA 5EOEA 2ZMAA 1HD8A 1XXMA 3IH8A 2WKHA 1YT4A 3IF6C 4RRIA 1L0DA 4KQOA 2WZZA 2OLVA 1BLPA 3KOCA 2Y2GA 1VM1A 3FV7A 3CMZA 5EVIC 4OQIA 4FH2A 3E2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLS A;  1QME A;  1NRF A;  3IXH A;  3MXS A;  1PYY A;  4GDN A;  1K56 D;  3IWI A;  1PZP A;  2HP5 A;  3OPP A;  5D3O A;  5M18 A;  2WGI A;  2EFX A;  3BEB A;  4XXR A;  2J9P A;  5FQQ A;  3DTM A;  1KVL A;  1K57 A;  4OQG A;  3G31 A;  3N4I A;  4Y0U A;  5EVI D;  4Q8I A;  3UNW A;  5FSR A;  4HBT A;  4R4R A;  3LY3 A;  5KSC A;  4OKP A;  1YLT A;  3I7J A;  4BD0 A;  5FAQ A;  2GDN A;  4IED A;  3W4P A;  4ZDX A;  1KDW A;  4BLM A;  3OCL A;  4OPY A;  3UY6 A;  4KZ5 A;  3PBN A;  3MBZ A;  1MWU A;  4QB8 A;  2ZQ7 A;  4EV4 A;  1PW1 A;  4EBN A;  5CER A;  3V39 A;  1NZU A;  1HZO A;  3GV9 A;  1JWV A;  3QHY A;  3TG9 A;  3WS1 A;  4S2P A;  4GN2 A;  1KGG A;  4IBR A;  4LEN A;  5TGF A;  1CEG A;  4XUX A;  1IYS A;  4X53 A;  4X56 A;  1BLH A;  4Z9Q A;  3MXR A;  4OP8 A;  2WGW B;  1GA0 A;  3IT9 A;  1NXY A;  4LV3 A;  1RCJ A;  1YLJ A;  1FR1 A;  4E6X A;  4EWF A;  2WUQ A;  2H0T A;  3BRM A;  1GCE A;  2WAD A;  5A92 A;  4FH4 A;  1K54 A;  4MEZ A;  3RXX A;  4JXV A;  4OPZ A;  2E8I A;  5HFO A;  1OME A;  3QNC A;  1I5Q A;  4RVA A;  1K4F A;  3WS5 A;  2CC1 A;  5KZH A;  5HAR A;  1N9B A;  5BOH A;  1YLY A;  5JYP A;  1KGF A;  3N7W A;  5FA7 A;  4NK3 A;  1DJC A;  1HTZ A;  4C3Q A;  3IHB A;  4KQQ A;  4WM9 A;  1MPL A;  2Y2Q A;  3V50 A;  5L2F A;  3A3E A;  4N1H A;  4EBL A;  3G2Y A;  1H8Z A;  1I2W A;  1MWR A;  2Y59 A;  3IF6 B;  3C4O A;  3UPO A;  4R3J A;  5EVI B;  1L0F A;  3C5A A;  4KZ3 A;  4D2O A;  3UE3 A;  4OPQ A;  3ZG0 A;  1NYM A;  3A3I A;  2Y2N A;  4WMC D;  4WBG A;  2I72 A;  3WS4 A;  3OC2 A;  4S2J A;  1G68 A;  1ES4 A;  1ALQ A;  5FQJ A;  3HLF A;  4B4X A;  4E3K A;  4K0X A;  5CGW A;  4OOY A;  1H8Y A;  4RX3 A;  3BFE A;  2Z2M B;  4PPR A;  1ES3 A;  2V1Z A;  4XUZ A;  4DKI A;  1JWZ A;  2IWD A;  1ERM A;  3HLW A;  5HX9 A;  4QHC A;  2ZM0 A;  1M40 A;  4P0M A;  2WKE A;  1BUE A;  4P87 A;  3ZNT A;  1ERQ A;  5DF8 A;  4KG5 A;  1GHM A;  3BYD A;  4UA7 A;  4DE3 A;  4LV0 A;  1CI8 A;  2XDM A;  3DW0 A;  3RXW A;  1MBL A;  3BFF A;  1IEM A;  2FFY A;  2WZX A;  3HLB A;  4UA9 A;  4Y0O A;  5CHM A;  5CEB A;  1W7F A;  1MXO A;  1XX2 A;  2EXA A;  4JXS A;  1ZC2 A;  1PZO A;  2HP6 A;  1PWD A;  1WE4 A;  4JF6 A;  2HDQ A;  3VP4 A;  2JC7 A;  1LLB A;  3VSL A;  4C6Y A;  3PAG A;  1YQS A;  2XFS A;  5DTT A;  3VSK A;  1DJB A;  1IYQ A;  1I2S A;  1NJ4 A;  3NCK A;  4MLL A;  1K4E A;  3WRT A;  5EE8 A;  3VFH A;  2EX8 A;  4S2N A;  3EQU A;  1LI0 A;  5G18 A;  5F83 A;  5HW3 A;  1GHP A;  2G2U A;  1SKF A;  4DE2 A;  4ZJ3 A;  2Y2L A;  2HDS A;  3ITA A;  4LCM A;  5AQ9 A;  5KSH A;  2HDR A;  2DNS A;  5GLB A;  4IVI A;  3ZVW A;  4E3L A;  3W4O A;  1S0W A;  3AGD A;  4OP5 A;  3GRJ A;  1LHY A;  3V5M A;  4E6W A;  3VP1 A;  4E3N A;  1U60 A;  4P6B A;  4S2O A;  2ZQ8 A;  3ZG9 B;  3FWL A;  5FI6 A;  2VGJ A;  4QD4 A;  2XD5 A;  3SH7 A;  3V3S A;  4KG6 A;  5DTK A;  4BEN A;  3ZDJ A;  3PBR A;  3A3D A;  3FKV A;  3SS5 A;  1W8Y A;  3PAE A;  4UHU A;  1ZG4 A;  2JCH A;  3PBQ A;  1ONG A;  4N9L A;  2C6W B;  4BL3 A;  3BM6 A;  5FAO A;  5FQM A;  3IXB A;  3OCN A;  5HAP A;  2EXB A;  1E3U D;  3HLD A;  1MWS A;  4N92 A;  1YLZ A;  3VP0 A;  4WEK A;  1TDL A;  1JTD A;  3GR2 A;  4FD8 A;  3IF6 A;  2WK0 A;  3CZD A;  3HLE A;  4Y7P A;  1WYC A;  3N8R A;  1FSY A;  5EVI A;  3VOY A;  2RL3 A;  3G2Z A;  5J8X A;  1LL5 A;  2ZC5 B;  4OH0 A;  3Q07 A;  3OZH A;  5E43 A;  2WAF A;  3Q7Z A;  5CGS A;  3PBS A;  5TR7 A;  4Y0T A;  1J9M A;  2FFF B;  2R9W A;  4S2M A;  1S6R A;  1W5D A;  4PM9 A;  3UPN A;  4GD6 A;  5TFQ A;  1PWC A;  1CK3 A;  2XQZ A;  5FDH A;  1M6K A;  4WZ5 C;  1XGI A;  2ZQC A;  3BFC A;  2Y2J A;  3ZCZ A;  4P85 A;  3B3X A;  1FCN A;  5FI2 A;  4LV1 A;  2JE5 A;  2P9V A;  3O88 A;  2IWC A;  3IQA A;  4ZAM A;  1FR6 A;  4DE1 A;  1Z6F A;  2XLN A;  3IWO A;  4JXG A;  4BQM A;  4E3J A;  3EQV A;  4JPM A;  1FCM A;  5I94 A;  4GKU A;  1TEM A;  4K0W A;  4E3I A;  1Q2Q A;  3A3F A;  4IVK A;  4B4Z A;  1KE0 A;  1SHV A;  3HVF A;  2WAE A;  3BFG A;  3ISG A;  3HUN A;  3GVB A;  2JBF A;  1BZA A;  1TDG A;  2J8Y A;  3Q7V A;  1JWP A;  1FSW A;  1IEL A;  3NBL A;  3IWQ A;  4LCL A;  1G6A A;  4U0T A;  4BD1 A;  3W4Q A;  4DDS A;  5DF9 A;  5E2F A;  2ZLY A;  2QPN A;  3HUM A;  4ID4 A;  3AGF A;  4QJG A;  5CRF A;  2OV5 A;  5AQA A;  5E2G A;  5EOO A;  4RX2 A;  4KG2 A;  4DF6 A;  1O07 A;  4HBU A;  3S22 A;  1JTG A;  1NYY A;  5FAT A;  1BSG A;  1LL9 A;  2PU2 A;  1O7E A;  3N6I A;  4QY5 A;  4M3K A;  1FQG A;  3UDX A;  4L0L A;  4KZA A;  3NDE A;  4R3B A;  3UDF A;  1RGY A;  2PBY A;  1XA7 A;  4MBH A;  4JLF A;  1W79 A;  1K55 C;  2Q9N A;  3A3J A;  2WKI A;  3ZHH A;  3OPH A;  3NC8 A;  4ZJ1 A;  4DRT A;  4X68 A;  2RCX A;  3D4F A;  3LY4 A;  3V3R A;  2X71 A;  3IXD A;  3G35 A;  3Q81 A;  4CJN A;  4E3M A;  3LCE A;  1IKI A;  3M6H A;  1PI5 A;  2XK1 A;  3ZNY A;  4GD8 A;  3VFF A;  3HL9 A;  5KMW A;  1FOF A;  2Y2I A;  3MKE A;  3P98 A;  5GHZ A;  1YLP A;  2B5R A;  2H0Y A;  3VP2 A;  5FAS A;  2H5S A;  4H8R A;  5HAQ A;  1K6S A;  5EVL A;  2Q9M A;  4X6T A;  4HEF A;  5FAP A;  3GMW A;  2X02 A;  2HP9 A;  3BFD A;  3PBO A;  4BJP A;  2ZC7 A;  4KZB A;  2IWB A;  1QMF A;  2XEP A;  2ZQD A;  1ERO A;  2WGW A;  5AQB A;  4KEN B;  1K57 C;  3W8K A;  1PIO A;  3JYI A;  4FSF A;  3IF5 A;  2WGV A;  1IYO A;  1NZO A;  1YLW A;  4EQI A;  4PM7 A;  1XPB A;  2EX2 A;  1KVM A;  1E4D A;  3IHA A;  3VP3 A;  2DRW A;  3WS2 A;  2G2W A;  2V2F F;  3VOZ A;  1H5X A;  1BTL A;  2VGK A;  1XA1 A;  2QZ6 A;  3NIA A;  4R1G A;  4U0X A;  5CEC A;  1XGJ A;  3G30 A;  3Q1F A;  1RP5 A;  4OOL A;  3DWZ A;  2EFU A;  4OQH A;  4ZBE A;  5HL1 A;  1Q2P A;  1PW8 A;  3TSG A;  5A90 A;  4PMA A;  1ESI A;  2Y2K A;  3LO7 A;  2XR0 A;  1Y54 A;  1YMX A;  1K38 A;  5FQ9 A;  1ES5 A;  3PTE A;  1K56 A;  5DTS A;  1ZKJ A;  4R23 A;  4OLG A;  4KZ8 A;  1BLS A;  2Y91 A;  1AXB A;  3WRZ A;  1K54 C;  1XKZ A;  1EWZ A;  3CJM A;  3MKF A;  5CHJ A;  3O87 A;  3MZD A;  4E3O A;  2DCF A;  3C4P A;  3IH9 A;  3IXG A;  3VMA A;  2HDU A;  2OLU A;  4OON A;  1CEF A;  1RGZ A;  4R0Q A;  1E25 A;  5DVA A;  2A3U A;  5EEC A;  2C5W B;  1GA9 A;  4LV2 A;  5CTM A;  4DXC A;  3HUO A;  1ESU A;  1E3U A;  5CED A;  1KDS A;  2XH9 A;  4S2K A;  3MZE A;  3NDG A;  4JF4 A;  1ZG6 A;  5CXW A;  1BUL A;  4GOG A;  2ZQA A;  2BLS A;  2P74 A;  1FCO A;  1W8Q A;  1IYP A;  2R9X A;  1MKI A;  1ONH A;  3Q82 A;  4RA7 A;  3N8S A;  5F1G A;  4MNR A;  3AGE A;  3C7U A;  1YM1 A;  1PWG A;  2ZJ9 A;  4DE0 A;  3WS0 A;  3ZG7 B;  4OQ0 A;  1HVB A;  4DDY A;  3S4X A;  3HLG A;  1KGE A;  2Y2O A;  4A5R A;  4C75 A;  1IKG A;  4GZB A;  2Y4A A;  3BLM A;  4ZJ2 A;  3SH8 A;  1PI4 A;  3WWX A;  2V20 A;  3M2K A;  2X01 A;  5CGX A;  1MWT A;  5M1A A;  1CI9 A;  4BL2 A;  2Y2M A;  4PM6 A;  5E2E A;  5U47 A;  5FQI A;  2H10 A;  4JKT A;  3OPL A;  3RJU A;  3QNB A;  1N4O A;  3G4P A;  3FZC A;  3BEC A;  2XF3 A;  3E2K A;  4NET A;  2J9O A;  3UN7 A;  3FYZ A;  4K91 A;  1SDN A;  1BLC A;  2ZC4 B;  4MBK A;  5JYO A;  4MBF A;  2OSU A;  4ZTK A;  3NY4 A;  3N8L A;  4PM5 A;  3GTC A;  4KZ6 A;  4PM8 A;  2ZD8 A;  5GLD A;  2ZM2 A;  4JBF A;  4EBP A;  3OPR A;  3DWK A;  2EX6 A;  5GLA A;  5DF7 A;  4DXB A;  1EI5 A;  3C7V A;  5F1F A;  4WZ5 A;  3ZVT A;  3O3V A;  3ZGA B;  2Z2L B;  3CG5 A;  3LEZ A;  4UA6 A;  5GHX A;  1C3B A;  1L2S A;  4WZ4 A;  5CTN A;  2WYX A;  4YIN A;  5GL9 A;  3M2J A;  4JF5 A;  4U3T A;  4WMC A;  1ES2 A;  4RYE A;  4WYY A;  5IHV A;  5FI7 A;  4KZ4 A;  4HES A;  4OPR A;  4QU3 A;  2Y55 A;  3UO9 A;  5GHY A;  2ZC6 B;  5F82 A;  5CHU A;  4YFM A;  4FCF A;  5M19 A;  1BT5 A;  3SS4 A;  1JVJ A;  1NY0 A;  3GSG A;  3G32 A;  3G34 A;  5FQK A;  2PU4 A;  4O7D A;  5EUA A;  5A91 A;  4S2I A;  1SDE A;  1GHI A;  4S2L A;  4S2N C;  2XGN A;  3UDI A;  2XFT A;  1K25 A;  3ITB A;  3NI9 A;  3TOI A;  3MFD A;  3PBT A;  4UAA A;  3HRE A;  2A49 A;  4GDB A;  2QMI A;  4KQR A;  2P9V B;  2Y2H A;  5GLC A;  3UPP A;  1WYB A;  1L0G A;  4OVD A;  2J7V A;  3SS3 A;  2EX9 A;  3SH9 A;  1L0E A;  1XP4 A;  5A93 A;  4OOM A;  3HLC A;  2BG1 A;  4QY6 A;  4X55 A;  4JXW A;  4EUZ A;  1MY8 A;  3S1Y A;  3MZF A;  5AQ7 A;  4GNU A;  3UE1 A;  2UWX A;  4F94 A;  1YMS A;  1KE3 A;  1TVF A;  4CPK A;  1DJA A;  1VQQ A;  3SOI A;  4R4S A;  3Q7V B;  2ZC3 B;  1LI9 A;  3FKW A;  3P09 A;  3GQZ A;  1K55 A;  4GB7 A;  4KZ9 A;  5EPH A;  2HPB A;  3UE0 A;  1KE4 A;  5HAI A;  3ZG8 B;  3ZFZ A;  1DY6 A;  1K6R A;  3O86 A;  2ZM8 A;  2ZQ9 A;  3M6B A;  4WEL A;  4OLD A;  4N1X A;  4IBX A;  4KZ7 A;  5E2H A;  4B88 A;  4X69 A;  3ZG5 A;  2XD1 A;  2Y2P A;  4N9K A;  4WEJ A;  3HBR A;  1SCW A;  5EOE A;  2ZMA A;  1HD8 A;  1XXM A;  3IH8 A;  2WKH A;  1YT4 A;  3IF6 C;  1L0D A;  4KQO A;  2WZZ A;  2OLV A;  1BLP A;  2Y2G A;  1VM1 A;  3FV7 A;  3CMZ A;  5EVI C;  4OQI A;  4FH2 A;  3E2L A; 
#chains in the Genus database with same CATH topology
 3ULF A;  3IXH A;  3MXS A;  2HL1 A;  1K56 D;  3OPP A;  2HP5 A;  4LRX C;  3FPW A;  1J3W A;  3LR3 A;  4OQG A;  3GEC A;  3RTY A;  3UNW A;  5FSR A;  3PD5 A;  3MS6 A;  2JKR M;  5KSC A;  2DMW A;  3I7J A;  3W4P A;  4BLM A;  4OPY A;  3UY6 A;  2ZQ7 A;  3F1O B;  1TS8 A;  4EBN A;  3V39 A;  1HZO A;  3MSH A;  1JWV A;  3U4L P;  4S2P A;  4NXE A;  1KGG A;  1CEG A;  4XUX A;  3KSF A;  1IYS A;  1BLH A;  2UV0 E;  3MXR A;  4OP8 A;  3IT9 A;  2FH5 A;  4E6X A;  4EWF A;  1XJ6 A;  2H0T A;  1GCE A;  4MEZ A;  5DJT A;  5HFO A;  3QNC A;  1H0M A;  3WS5 A;  2CC1 A;  4RRG A;  1YLY A;  1JNU A;  5FA7 A;  1VET B;  1DJC A;  4C3Q A;  5HZH A;  1MPL A;  4S0J A;  4R70 A;  1T18 A;  4MCW A;  3C4O A;  4OPQ A;  2LB9 A;  2Y2N A;  2L0W A;  3OC2 A;  5F6A A;  4RRM A;  4EES A;  1ALQ A;  3DTE A;  3OLO A;  5CGW A;  4OOY A;  1ES3 A;  4XUZ A;  4DKI A;  2IWD A;  1ERM A;  3HLW A;  2B95 A;  3MQ0 A;  2ZM0 A;  5DF8 A;  1GHM A;  4RRB A;  3DW0 A;  2QJ7 A;  3BFF A;  2FFY A;  3HLB A;  1OTE A;  2PR5 A;  1S67 L;  1XX2 A;  2HP6 A;  4NXF A;  4LPZ A;  4R6L A;  2V8C A;  2PYP A;  4MLL A;  1K4E A;  3WRT A;  3VFH A;  5HPF A;  2PD7 A;  1GSX A;  3EQU A;  3TJZ C;  5F83 A;  1GHP A;  4DE2 A;  5IU1 A;  3B47 A;  2HDS A;  3VOL A;  2Y79 A;  4KUK A;  1NLZ A;  4OP5 A;  3GRJ A;  2J3W A;  2GJ3 A;  4E6W A;  3VP1 A;  1U60 A;  3NUL A;  2VGJ A;  2XD5 A;  3SS5 A;  1W8Y A;  2HJ9 C;  3PBQ A;  4N9L A;  2C6W B;  1Y4O A;  3IXB A;  3KX0 X;  5HAP A;  1E3U D;  1GSW A;  1JTD A;  3GR2 A;  3IF6 A;  2WK0 A;  3HLE A;  1STZ A;  1UWP X;  3OZH A;  4WLA A;  4S2M A;  4HI4 A;  4PM9 A;  1TC5 A;  3BFC A;  3KSG A;  3IS2 A;  4HY8 A;  4LV1 A;  2P9V A;  3O88 A;  2IWC A;  2EWW A;  1Z6F A;  2J3T D;  4O0P A;  4IUK A;  4BQM A;  3E4P A;  4YOF A;  3EQV A;  1OT9 A;  3IX8 A;  4O01 A;  4X1L A;  1KE0 A;  1SHV A;  3HVF A;  1LSW A;  3Q7V A;  3FG8 A;  1PNE A;  3IWQ A;  4LCL A;  5KIZ A;  4DDS A;  2QWS A;  2ZMF A;  4LFU A;  1J7G A;  2JN7 A;  5E2F A;  2QPN A;  3HUM A;  4QJG A;  3MFX A;  5TBM A;  3LIA A;  3UB8 A;  1O07 A;  2OKV A;  3C30 A;  1BSG A;  4S0K A;  4KZA A;  3ZYT A;  3OPH A;  2KLI A;  3LY4 A;  1S66 L;  2ZOH A;  1IKI A;  3P98 A;  4HJ4 A;  2H0Y A;  4EEP A;  3K3D A;  5HAQ A;  2VGL S;  2Q9M A;  4X6T A;  4BJP A;  1IOU A;  2ZBB A;  1K57 C;  4PAU A;  5HWV A;  2KX6 A;  1YLW A;  2EX2 A;  1KVM A;  3VP3 A;  3IHA A;  2GNX A;  4BBU A;  1H5X A;  1BTL A;  1XGJ A;  3Q1F A;  3MF0 A;  2W1T A;  1ZTU A;  4L9F A;  3BJN A;  1VET A;  1LT0 A;  1Y54 A;  4GS9 B;  1ES5 A;  3PTE A;  1K56 A;  5DTS A;  4EEU A;  4OLG A;  4PKY A;  1K54 C;  4DN0 A;  3CJM A;  5CHJ A;  3O87 A;  3MZD A;  2DCF A;  3QP2 A;  1RGZ A;  2A3U A;  5EEC A;  2C5W B;  4LV2 A;  4F3L B;  1D7E A;  2PD8 A;  5G18 A;  1ACF A;  3QP5 A;  1FCO A;  1W8Q A;  1IYP A;  3N8S A;  4MNR A;  3ZG7 B;  4ARZ B;  4JGQ A;  3HLG A;  1KGE A;  2Y2O A;  4A5R A;  3SH8 A;  2PT7 A;  5M1A A;  4BL2 A;  5U47 A;  1T1A A;  5HWT A;  3FZC A;  2XF3 A;  3E2K A;  4UQI M;  1H8M A;  3NY4 A;  5TJJ A;  2V8F A;  3E4Q A;  2EX6 A;  1GSV A;  4DXB A;  3T1S A;  3ZGA B;  4MMN A;  4UA6 A;  1L2S A;  4WZ4 A;  5CX7 A;  3UB5 P;  1MC0 A;  2WYX A;  3M2J A;  2GX5 A;  4WUJ A;  4RYE A;  5FL3 A;  3UO9 A;  1LL8 A;  5F82 A;  4FCF A;  3P7N A;  3GSG A;  3G32 A;  3G34 A;  4O7D A;  3T4O A;  2VGL M;  4S2N C;  2XFT A;  3NI9 A;  4UAA A;  3PBT A;  4GDB A;  3HCY A;  1XJ3 A;  3UPP A;  3SS3 A;  3SH9 A;  1L0E A;  4OOM A;  3MQO A;  2BG1 A;  4EUZ A;  4JGP A;  2HL2 A;  3A0V A;  4F94 A;  2W3E A;  3F1N B;  2JHE A;  1DJA A;  2ZC3 B;  4KZ9 A;  3UE0 A;  3P09 A;  3GQZ A;  1K55 A;  3SZT A;  4D60 A;  3ZFZ A;  1K6R A;  2HL0 A;  2XSS A;  3O86 A;  2ZQ9 A;  4IBX A;  4KZ7 A;  3CAX A;  5E2H A;  4B88 A;  3ZG5 A;  4WEJ A;  5EOE A;  1SCW A;  1CF0 A;  4MN6 A;  3KOC A;  2Y2G A;  4OQI A;  4R3A A;  3E2L A;  3BW6 A;  1PYY A;  5D3O A;  4XXR A;  3DTM A;  1F98 A;  1SZV A;  3N4I A;  4Y0U A;  2Y8H A;  4R4R A;  2O9C A;  2VV8 A;  4HNB A;  3PBN A;  3MBZ A;  1OJG A;  3CI6 A;  4QB8 A;  4MDZ A;  1PW1 A;  3H9W A;  3GV9 A;  4GN2 A;  3FC7 A;  3KYQ A;  4X56 A;  3T4Q A;  2WGW B;  2V0U A;  1YLJ A;  3TRC A;  2WUQ A;  4FH4 A;  4OPZ A;  2M1C A;  4RVA A;  3S7N A;  3UB6 A;  1YSP A;  5KZH A;  1N9B A;  1PFL A;  1KGF A;  2Y2Q A;  4RRF A;  2ZL1 B;  4GHI B;  3BY8 A;  3KO4 A;  4NEE D;  3G2Y A;  3IF6 B;  2JKF A;  1L0F A;  4S0I A;  4KZ3 A;  1NYM A;  4LGW A;  4CLC D;  4WMC D;  2BTF P;  3WS4 A;  3LIF A;  4S2J A;  4HP9 A;  4EU0 A;  1ES4 A;  3TE8 A;  4NBJ A;  3BQA A;  2NUP C;  4B4X A;  2DBO A;  1H8Y A;  4PPR A;  4YNR A;  4QHC A;  3ZQ5 A;  4YWZ A;  3ZNT A;  1S4R A;  2CMN A;  4KG5 A;  4GS9 A;  4LRY C;  2NUT C;  1YPR A;  3C2W A;  2XDM A;  4I5S A;  2Z6C A;  1UGU A;  4L9E A;  3LIB A;  2XRO A;  5CHM A;  1MXO A;  2EXA A;  1OTD A;  1PWD A;  4JF6 A;  2HDQ A;  3VP4 A;  2JC7 A;  2XFS A;  3VSK A;  1I2S A;  5EE8 A;  3T4J A;  5HDD A;  1LI0 A;  4ARZ A;  5HW3 A;  2Y2L A;  3ITA A;  4CLC B;  5HD3 A;  2DNS A;  2K31 A;  1LHY A;  4HJ6 A;  1G5U A;  4EQ1 A;  3KSI A;  3ZG9 B;  3V3S A;  4RR7 A;  3ZDJ A;  3KO6 A;  3PBR A;  3FKV A;  4X1M A;  2L4R A;  3BM6 A;  3OCN A;  2VEA A;  3C8C A;  1MWS A;  1OTI A;  1YLZ A;  4WEK A;  1LSX A;  4EXO A;  3LMU A;  2B18 A;  3VOY A;  2VX8 A;  2RL3 A;  2ZC5 B;  3Q07 A;  5E43 A;  2K2N A;  5CGS A;  3B33 A;  3PBS A;  5TR7 A;  2FFF B;  4GW9 A;  3LYX A;  3UPN A;  4GD6 A;  4B9O A;  2EA9 A;  5TFQ A;  1PWC A;  4Y3I A;  1CK3 A;  3BWL A;  5FDH A;  1M6K A;  1XGI A;  4DMZ A;  4JGO A;  2W1T B;  3T1R A;  2PYR A;  5FI2 A;  3KOD A;  3DTI A;  3IQA A;  3LI9 A;  2HJE A;  4ZAM A;  1NLY A;  1FR6 A;  4DE1 A;  4PKY G;  2XLN A;  3EWK A;  3CPT A;  1FCM A;  4GKU A;  4K0W A;  4B4Z A;  3F1N A;  1MKM A;  3GVB A;  3KO5 A;  2J8Y A;  1JWP A;  3CIT A;  3W4Q A;  3T1Q B;  2ZLY A;  2A2L A;  3HJK A;  2OV5 A;  5AQA A;  4ETX A;  5EOO A;  4HHD A;  3KSH A;  4DF6 A;  3S22 A;  4HBU A;  5J7E A;  4MN7 A;  3T50 A;  1JTG A;  2XRN A;  1LL9 A;  3EGD C;  3S7O A;  1TF1 A;  2A24 B;  2KOI A;  2PBY A;  1XA7 A;  4JLF A;  4K08 A;  2OWH A;  4DRT A;  2RCX A;  1BYW A;  3D4F A;  3BQ8 A;  2PAV P;  4GCZ A;  4RRC A;  4GLQ A;  4E3M A;  4H6J A;  4L9G A;  4AFI A;  3DBA A;  4RRD A;  3VE4 A;  4WF0 A;  3UE6 A;  4LRZ E;  2X02 A;  1F5M A;  2XEP A;  2WGW A;  5AQB A;  4KEN B;  3W8K A;  4FSF A;  1IYO A;  2V2F F;  2VGK A;  1XA1 A;  2QZ6 A;  4R1G A;  5CEC A;  1LSV A;  3NOP C;  2PBD P;  2EFU A;  4OQH A;  1PW8 A;  5A90 A;  4PMA A;  1F9I A;  3C38 A;  4HH3 A;  2JKT I;  2QKP A;  1K38 A;  5FQ9 A;  2V1B A;  2ZL1 A;  4GHI A;  4ESP A;  3NOU C;  1ZKJ A;  2W3G A;  2Y91 A;  1EWZ A;  5DFX A;  4O8G A;  2HDU A;  5DVA A;  2G7U A;  5CTM A;  4DXC A;  1ESU A;  2K7S A;  4S2K A;  1D06 A;  5CXW A;  1BUL A;  4GOG A;  1MKI A;  2H28 A;  3C7U A;  1YM1 A;  5L8M A;  1HVB A;  4DDY A;  3EOI A;  4CQH A;  4C75 A;  4ZJ2 A;  3WWX A;  2V20 A;  2X01 A;  1MWT A;  3QP1 A;  2Y2M A;  4ME4 A;  3G4P A;  3MQQ A;  3IBJ A;  3T4K A;  3PR6 A;  1BLC A;  2ZC4 B;  4Y13 A;  3UMD A;  3N8L A;  4JBF A;  2O0Y A;  3DWK A;  3C7V A;  4Y5F A;  4WZ5 A;  3ZVT A;  4RQ9 A;  3CG5 A;  2ACG A;  2P7J A;  4RRR A;  4CLC A;  3PXP A;  4WMC A;  2D01 A;  3CUE A;  4S02 A;  4KZ4 A;  4HES A;  4OPR A;  3NEC A;  1W63 M;  4QU3 A;  2Y55 A;  2YKH A;  5EUA A;  1XFQ A;  3ITB A;  4KQD A;  3TOI A;  4KQR A;  1WYB A;  5K5B A;  5A93 A;  4II7 A;  3HLC A;  4X55 A;  3S1Y A;  3MZF A;  4RRK A;  2UWX A;  3H7W B;  1KE3 A;  4NBI A;  4B93 A;  2J80 A;  1VQQ A;  3SOI A;  4R4S A;  3F1P B;  4GB7 A;  2W0N A;  2HPB A;  1G6O A;  5HDC A;  4NKP A;  3ZG8 B;  5DKL A;  4OLD A;  1K0K A;  3LMT A;  4X69 A;  3DTK A;  2XD1 A;  4X25 A;  3SW1 A;  1HD8 A;  5F69 A;  3IF6 C;  4KQO A;  3B42 A;  2EWV A;  1H3Q A;  2WKQ A;  1BLP A;  2WZZ A;  3LFV A;  1WA9 A;  4GDN A;  4GJ4 A;  3BEB A;  2EFX A;  3LMV A;  2Z6D A;  1KVL A;  4Q8I A;  3LY3 A;  1YLT A;  4ZDX A;  5FAQ A;  3IX3 A;  1KDW A;  4KZ5 A;  1TS6 A;  4EV4 A;  1T19 A;  4MN5 A;  3TG9 A;  3WS1 A;  4IBR A;  4P6Z S;  5G4Y A;  5TGF A;  2FZ0 A;  1G28 A;  4X53 A;  1UWN X;  4Z9Q A;  1GA0 A;  1NXY A;  2A24 A;  4NXG A;  3BRM A;  5A92 A;  3R4K A;  3RXX A;  2O9A A;  4JXV A;  2XA7 S;  2OAP 1;  1OME A;  1SKO A;  1I5Q A;  4M4X A;  1K4F A;  5HAR A;  1N9N A;  3IX4 A;  5JYP A;  3KO3 A;  5DKK A;  3N7W A;  3LIC A;  4NK3 A;  1NWZ A;  1HTZ A;  3IHB A;  4ETZ A;  3QP4 A;  1TD5 A;  5EFW A;  3MXQ A;  3V50 A;  5L2F A;  2BAS A;  1I2W A;  1MWR A;  3UPO A;  4R3J A;  3C5A A;  3UE3 A;  3FPV A;  3A3I A;  4WBG A;  4Y2F A;  3LIE A;  1G68 A;  5FQJ A;  4NXB A;  4E3K A;  4S03 A;  4K0X A;  4RX3 A;  3BFE A;  4FTX A;  2V1Z A;  2O9B A;  5IS1 A;  4P0M A;  4P87 A;  1ERQ A;  4RR8 A;  4DE3 A;  4HQA A;  1MBL A;  3CPT B;  1IEM A;  4Y0O A;  4LLO B;  5C5K A;  1W7F A;  2AVX A;  3NJA A;  1ZC2 A;  2L1M A;  1PZO A;  4I3J A;  1LLB A;  1FIK A;  3PAG A;  1DJB A;  4DJ3 A;  3PHY A;  1XJ2 A;  2EX8 A;  3EEH A;  2G2U A;  2JKT M;  4ZJ3 A;  4LCM A;  5AQ9 A;  5KSH A;  2HDR A;  2P04 A;  3W4O A;  1S0W A;  3AGD A;  1W63 Q;  4E3N A;  2ZQ8 A;  3T12 B;  4RR9 A;  5FI6 A;  4QD4 A;  3SH7 A;  4BEN A;  3QP6 A;  4UHU A;  3NOT C;  1ONG A;  4P6Z M;  5FAO A;  4H6J B;  5DJU A;  4DJ2 A;  4QWO A;  2EXB A;  3LI8 A;  3HLD A;  5EVE A;  2W3F A;  2XA7 M;  3CZD A;  5EVI A;  5AVF A;  3G2Z A;  3UB9 A;  1LL5 A;  4OH0 A;  2WAF A;  3Q7Z A;  1J9M A;  2R9W A;  1T1C A;  5A8B A;  1ODV A;  1W5D A;  2PRF A;  2W27 A;  1S4S A;  2XQZ A;  3ZCZ A;  2Y2J A;  4P85 A;  3B3X A;  3S7Q A;  2JE5 A;  4S0L A;  2O99 A;  4Z1W A;  1Q2Q A;  4IVK A;  3H7W A;  2WAE A;  1D1J A;  2JBF A;  1BZA A;  1TDG A;  3F1P A;  1TS7 A;  1PRQ A;  4BD1 A;  5DF9 A;  2HZ5 A;  1NRJ A;  1V9Y A;  4ID4 A;  3AGF A;  4HP4 A;  5CRF A;  2VA0 A;  1IFQ A;  5E2G A;  4KG2 A;  5FAT A;  1O7E A;  4QY5 A;  4M3K A;  3UDX A;  4EET B;  3NDE A;  1VEU A;  1W79 A;  1K55 C;  2WKI A;  3ZHH A;  3V3R A;  2X71 A;  4JGR A;  3Q81 A;  4FUW A;  4CJN A;  1HLU P;  3LCE A;  3T1X A;  1PI5 A;  2XK1 A;  4GD8 A;  3VFF A;  5KMW A;  2Y2I A;  3OOV A;  5L07 A;  3MKE A;  3H82 B;  3IBR A;  5GHZ A;  2B5R A;  1X0O A;  4H8R A;  2HGV A;  1K6S A;  3LID A;  5EVL A;  3GMW A;  2HP9 A;  2ZOI A;  3BFD A;  4KZB A;  1PIO A;  3IF5 A;  2WGV A;  1P97 A;  4EQI A;  5HWW A;  4PM7 A;  4I38 A;  3WS2 A;  3VOZ A;  3T4S A;  4U0X A;  3DWZ A;  4IUH A;  5HL1 A;  2QJ5 A;  1Q2P A;  1ESI A;  3LO7 A;  4R23 A;  2IA2 A;  4KZ8 A;  3U2A A;  3HJI A;  1AXB A;  3WRZ A;  1XKZ A;  3MKF A;  4E3O A;  1L3L A;  3C4P A;  2OLU A;  4OON A;  3HUO A;  5J4E A;  5CED A;  1Y2Q A;  1KDS A;  2XH9 A;  4BL3 A;  3MZE A;  1XJ4 A;  2ZQA A;  2BLS A;  3CHW P;  3LGO A;  4I39 A;  1CQA A;  2J3T C;  1ONH A;  2VV6 A;  1T1B A;  4RRL A;  1PWG A;  2ZJ9 A;  5HD5 A;  4OQ0 A;  1DP8 A;  1IKG A;  2Y4A A;  3JVV A;  5CGX A;  2M7U A;  2ZMV A;  1CI9 A;  5E2E A;  5FQI A;  4JKT A;  3OPL A;  3QNB A;  1FIL A;  1P9W A;  1TS0 A;  3FYZ A;  4K91 A;  1SDN A;  4WN5 A;  4MBK A;  4ZTK A;  3UB7 A;  3GTC A;  4WL9 A;  2ZM2 A;  4BMW A;  1V9Z A;  5GLA A;  4FOF A;  5FDS A;  2Z2L B;  3LEZ A;  1C3B A;  4R38 A;  3LR5 A;  4YIN A;  2P08 A;  5GL9 A;  4U3T A;  5FI7 A;  1AWI A;  1YAX A;  5HSQ A;  2ZC6 B;  5CHU A;  4YFM A;  1BT5 A;  3G6O A;  1P9R A;  2VLG A;  1JVJ A;  1NY0 A;  1SKO B;  5A91 A;  1SDE A;  2JKG A;  4S2L A;  2XGN A;  3TW8 A;  1K25 A;  3MFD A;  3R7W B;  2A49 A;  2QMI A;  2Y2H A;  5GLC A;  1L0G A;  3KYZ A;  2EX9 A;  3LUQ A;  1XP4 A;  5AVE A;  2MJ6 A;  4QY6 A;  5AQ7 A;  1ZHH B;  4GNU A;  3UE1 A;  2WKP A;  2WKR A;  4IJG A;  1TVF A;  3CWF A;  4CPK A;  2B02 A;  1LI9 A;  4E04 A;  1KE4 A;  1DY6 A;  4RRJ A;  2Y2P A;  3HBR A;  3L9K A;  4Y17 A;  5IT5 A;  1YT4 A;  2OAQ 1;  1Y28 A;  2OLV A;  3FV7 A;  3CMZ A;  4G3W A;  4FH2 A;  3BLS A;  1QME A;  3ICY A;  1NRF A;  3IWI A;  1PZP A;  2KDK A;  5M18 A;  2WGI A;  2J9P A;  5FQQ A;  1K57 A;  3G31 A;  5EVI D;  5G4Z A;  2Q0O A;  4Q0J A;  4HBT A;  3D3O A;  4OKP A;  4BD0 A;  2GDN A;  1YSQ A;  4IED A;  4QPR A;  3OCL A;  1MWU A;  4CLC E;  3BY9 A;  5AJG A;  5CER A;  1NZU A;  3QHY A;  1S1Y A;  2YKF A;  4LEN A;  3KYE A;  5FEF A;  3QP8 A;  4LV3 A;  1P0Z A;  1RCJ A;  1FR1 A;  2WAD A;  2VK3 A;  1K54 A;  4BWI A;  2E8I A;  3PD2 A;  5LBR A;  5BOH A;  2HV1 A;  3MR0 A;  3H82 A;  4KQQ A;  3KNF A;  2W3D A;  3JVU A;  4WM9 A;  4XT2 B;  3A3E A;  4N1H A;  4EBL A;  1H8Z A;  2Y59 A;  2HF6 A;  5EVI B;  3CLO A;  4D2O A;  3ZG0 A;  3A0S A;  3PD4 A;  2I72 A;  3E98 A;  3V67 A;  2VJW A;  3HLF A;  4UQI S;  4RRQ A;  2Z2M B;  5F5Y A;  4G3V A;  1JWZ A;  5HX9 A;  5MC7 A;  5I5L A;  1M40 A;  2WKE A;  1BUE A;  3BYD A;  4UA7 A;  3A0R A;  4LV0 A;  1CI8 A;  3RXW A;  2W3H A;  2WZX A;  4UA9 A;  5CEB A;  3T4L A;  4JXS A;  1WE4 A;  3VSL A;  4C6Y A;  1YQS A;  5DTT A;  4Y15 A;  1IYQ A;  1NJ4 A;  2QHK A;  3NCK A;  3F1O A;  4S2N A;  3KO9 A;  4Q0I A;  1SKF A;  3K2N A;  3UME A;  5GLB A;  4IVI A;  3ZVW A;  4E3L A;  5FEG A;  3EGX C;  3V5M A;  4P6B A;  5J3W A;  4S2O A;  2V1A A;  1VEU B;  3FWL A;  2W1R A;  4KG6 A;  5DTK A;  3A3D A;  3PAE A;  4RR6 A;  1ZG4 A;  2JCH A;  3KOB A;  4RRH A;  5F68 A;  5FQM A;  3OBF A;  2VV7 A;  1DP9 A;  2QYB A;  2VKS A;  4N92 A;  3VP0 A;  1TDL A;  4FD8 A;  4Y7P A;  2R78 A;  1WYC A;  3N8R A;  1FSY A;  3VE3 A;  5J8X A;  1OPX A;  4Y0T A;  3S7P A;  5DFY A;  1S6R A;  2JKR I;  1OTA A;  4WZ5 C;  3PYP A;  1XFN A;  2ZQC A;  1FCN A;  2LB5 A;  3R7W A;  4UEY A;  4CLC C;  1DP6 A;  3CUE C;  3IWO A;  4JXG A;  3D72 A;  4E3J A;  4JPM A;  5I94 A;  1TEM A;  4E3I A;  3A3F A;  5J61 A;  3BFG A;  3ISG A;  3HUN A;  3RFB A;  1FSW A;  1IEL A;  1CJF A;  3NBL A;  2E8J A;  1G6A A;  4U0T A;  2VZW A;  4Q0H A;  1VB6 A;  2PR6 A;  4EW7 A;  4RX2 A;  4I3A A;  1NYY A;  2PU2 A;  3N6I A;  1FQG A;  2OOL A;  4KUO A;  4L0L A;  1OT6 A;  4R3B A;  3UDF A;  1RGY A;  1EW0 A;  4MBH A;  2Q9N A;  3A3J A;  3NC8 A;  4ZJ1 A;  4X68 A;  2INW A;  1OJ5 A;  3IXD A;  3G35 A;  1MZU A;  3KNP A;  1N9O A;  3W2Z A;  3EEA A;  3M6H A;  3ZNY A;  3HL9 A;  1FOF A;  1YLP A;  4BBT A;  3VP2 A;  3LR4 A;  2H5S A;  1A0K A;  1F2K A;  5FAS A;  5HDS A;  5FAP A;  4HEF A;  2M7V A;  4BBV A;  1OTB A;  4HIA A;  3PBO A;  2ZC7 A;  2IWB A;  1QMF A;  2ZQD A;  1ERO A;  3JYI A;  4G3K A;  1NZO A;  2V9A A;  1Z09 A;  1XPB A;  3E0Y A;  1E4D A;  2DRW A;  2G2W A;  3NIA A;  3G30 A;  1RP5 A;  4OOL A;  4ZBE A;  3GDI A;  5L09 A;  3TSG A;  3MMH A;  3E4O A;  2V0W A;  2Y2K A;  2XR0 A;  2D02 A;  5HPI A;  1YMX A;  4I3I A;  4PHT A;  4XT2 A;  2PDR A;  1S1Z A;  1BLS A;  3IH9 A;  3IXG A;  3VMA A;  1CEF A;  4R0Q A;  1E25 A;  1GA9 A;  1E3U A;  5HL6 A;  3NDG A;  4JF4 A;  1ZG6 A;  2P74 A;  4EUV A;  2R9X A;  4RA7 A;  3Q82 A;  5F1G A;  3AGE A;  4DE0 A;  3WS0 A;  3S4X A;  2HKZ A;  4GZB A;  3BLM A;  1PI4 A;  3M2K A;  4EER A;  4PM6 A;  3JPU A;  2H10 A;  3RJU A;  1N4O A;  4NET A;  3L7H A;  3BEC A;  3LEQ A;  4ZRR A;  2J9O A;  3UN7 A;  4RRA A;  5JYO A;  4MBF A;  2OSU A;  3D9Y A;  4PM5 A;  3VV4 A;  4KZ6 A;  4PM8 A;  2ZD8 A;  5GLD A;  4EBP A;  3OPR A;  3RH8 B;  1JKE A;  5DF7 A;  1EI5 A;  5F1F A;  3O3V A;  5GHX A;  5CTN A;  3KO7 A;  4JF5 A;  3LR0 A;  2GZA A;  1ES2 A;  4WYY A;  5IHV A;  1KOU A;  3DAV A;  5GHY A;  4NG2 A;  5M19 A;  2PHY A;  3SS4 A;  5FQK A;  2PU4 A;  5L10 A;  4S2I A;  1GHI A;  3P01 A;  4HH2 A;  5EV0 A;  3UDI A;  3K3C A;  3IS2 B;  1DRM A;  3HRE A;  3MJQ A;  2OWJ A;  2P9V B;  3T4T A;  4OVD A;  2J7V A;  5EM1 A;  4JXW A;  1MY8 A;  1N9L A;  4HOI A;  1VHM A;  1YMS A;  3O5Y A;  3NHQ A;  3PD3 A;  1YKD A;  3Q7V B;  4F3L A;  3FKW A;  5EPH A;  5HAI A;  2ZM8 A;  3M6B A;  4WEL A;  5EM0 A;  4N1X A;  4N9K A;  2ZMA A;  5TBM B;  1XXM A;  3IH8 A;  2WKH A;  4RRI A;  1L0D A;  4IHQ A;  2I9V A;  1VM1 A;  5EVI C;  4HJ3 A; 
#chains in the Genus database with same CATH homology
 3BLS A;  1QME A;  1NRF A;  3IXH A;  3MXS A;  1PYY A;  4GDN A;  2HL1 A;  1K56 D;  3IWI A;  1PZP A;  2HP5 A;  3OPP A;  5D3O A;  5M18 A;  2WGI A;  2EFX A;  3BEB A;  4XXR A;  3LMV A;  2J9P A;  5FQQ A;  3DTM A;  1KVL A;  1K57 A;  4OQG A;  3G31 A;  3N4I A;  4Y0U A;  5EVI D;  4Q8I A;  3UNW A;  5FSR A;  3PD5 A;  4HBT A;  4R4R A;  3LY3 A;  5KSC A;  4OKP A;  1YLT A;  3I7J A;  4BD0 A;  5FAQ A;  2GDN A;  4IED A;  3W4P A;  4ZDX A;  1KDW A;  4BLM A;  3OCL A;  4OPY A;  3UY6 A;  4KZ5 A;  3PBN A;  3MBZ A;  1MWU A;  4QB8 A;  2ZQ7 A;  4EV4 A;  1PW1 A;  4EBN A;  5CER A;  3V39 A;  1NZU A;  1HZO A;  3GV9 A;  1JWV A;  3QHY A;  3TG9 A;  3WS1 A;  4S2P A;  4GN2 A;  1KGG A;  4IBR A;  4LEN A;  5TGF A;  1CEG A;  4XUX A;  1IYS A;  4X53 A;  4X56 A;  1BLH A;  4Z9Q A;  3MXR A;  4OP8 A;  2WGW B;  1GA0 A;  3IT9 A;  1NXY A;  4LV3 A;  1RCJ A;  1YLJ A;  1FR1 A;  4E6X A;  4EWF A;  2WUQ A;  2H0T A;  3BRM A;  1GCE A;  2WAD A;  5A92 A;  4FH4 A;  1K54 A;  4MEZ A;  3RXX A;  4JXV A;  4OPZ A;  2E8I A;  5HFO A;  1OME A;  3QNC A;  1I5Q A;  4RVA A;  1K4F A;  3WS5 A;  2CC1 A;  5KZH A;  3PD2 A;  4RRG A;  5HAR A;  1N9B A;  5BOH A;  1YLY A;  5JYP A;  3KO3 A;  1KGF A;  3N7W A;  5FA7 A;  4NK3 A;  1DJC A;  1HTZ A;  4C3Q A;  3IHB A;  4KQQ A;  3KNF A;  4WM9 A;  1MPL A;  2Y2Q A;  4RRF A;  4S0J A;  3V50 A;  5L2F A;  3A3E A;  4N1H A;  4EBL A;  3KO4 A;  3G2Y A;  1H8Z A;  1I2W A;  1MWR A;  2Y59 A;  3IF6 B;  3C4O A;  3UPO A;  4R3J A;  5EVI B;  1L0F A;  3C5A A;  4KZ3 A;  4S0I A;  4D2O A;  3UE3 A;  4OPQ A;  3ZG0 A;  1NYM A;  3PD4 A;  3A3I A;  2Y2N A;  4WMC D;  4WBG A;  2I72 A;  3WS4 A;  3OC2 A;  4RRM A;  4S2J A;  1G68 A;  1ES4 A;  1ALQ A;  5FQJ A;  4NBJ A;  3HLF A;  4B4X A;  2DBO A;  4E3K A;  4RRQ A;  4S03 A;  4K0X A;  5CGW A;  4OOY A;  1H8Y A;  4RX3 A;  3BFE A;  2Z2M B;  4PPR A;  1ES3 A;  2V1Z A;  4XUZ A;  4DKI A;  1JWZ A;  2IWD A;  1ERM A;  3HLW A;  5HX9 A;  4QHC A;  2ZM0 A;  1M40 A;  4P0M A;  2WKE A;  1BUE A;  4P87 A;  3ZNT A;  1ERQ A;  5DF8 A;  4KG5 A;  1GHM A;  3BYD A;  4UA7 A;  4RR8 A;  4RRB A;  4DE3 A;  4LV0 A;  1CI8 A;  2XDM A;  3DW0 A;  3RXW A;  1MBL A;  3BFF A;  1IEM A;  2FFY A;  2WZX A;  3HLB A;  4UA9 A;  4Y0O A;  5CHM A;  5CEB A;  1W7F A;  1MXO A;  1XX2 A;  2EXA A;  4JXS A;  1ZC2 A;  1PZO A;  2HP6 A;  1PWD A;  1WE4 A;  4JF6 A;  2HDQ A;  3VP4 A;  2JC7 A;  1LLB A;  3VSL A;  4C6Y A;  3PAG A;  1YQS A;  2XFS A;  5DTT A;  3VSK A;  1DJB A;  1IYQ A;  1I2S A;  1NJ4 A;  3NCK A;  4MLL A;  1K4E A;  3WRT A;  5EE8 A;  3VFH A;  2EX8 A;  4S2N A;  3EQU A;  1LI0 A;  3KO9 A;  5G18 A;  5F83 A;  5HW3 A;  1GHP A;  2G2U A;  1SKF A;  4DE2 A;  4ZJ3 A;  2Y2L A;  2HDS A;  3ITA A;  4LCM A;  5AQ9 A;  5KSH A;  2HDR A;  2DNS A;  5GLB A;  4IVI A;  3ZVW A;  4E3L A;  3W4O A;  1S0W A;  3AGD A;  4OP5 A;  3GRJ A;  1LHY A;  3V5M A;  4E6W A;  3VP1 A;  4E3N A;  1U60 A;  4P6B A;  4S2O A;  2ZQ8 A;  3ZG9 B;  3FWL A;  4RR9 A;  5FI6 A;  2VGJ A;  4QD4 A;  2XD5 A;  3SH7 A;  3V3S A;  4KG6 A;  5DTK A;  4BEN A;  4RR7 A;  3ZDJ A;  3PBR A;  3A3D A;  3FKV A;  3SS5 A;  1W8Y A;  3PAE A;  4RR6 A;  4UHU A;  1ZG4 A;  2JCH A;  3PBQ A;  1ONG A;  4N9L A;  3KOB A;  4RRH A;  2C6W B;  4BL3 A;  3BM6 A;  5FAO A;  5FQM A;  3IXB A;  3OCN A;  5HAP A;  2EXB A;  1E3U D;  3HLD A;  1MWS A;  4N92 A;  1YLZ A;  3VP0 A;  4WEK A;  1TDL A;  1JTD A;  3GR2 A;  4FD8 A;  3IF6 A;  2WK0 A;  3LMU A;  3CZD A;  3HLE A;  4Y7P A;  1WYC A;  3N8R A;  1FSY A;  5EVI A;  3VOY A;  2RL3 A;  3G2Z A;  5J8X A;  1LL5 A;  2ZC5 B;  4OH0 A;  3Q07 A;  3OZH A;  5E43 A;  2WAF A;  3Q7Z A;  5CGS A;  3PBS A;  5TR7 A;  4Y0T A;  1J9M A;  2FFF B;  2R9W A;  4S2M A;  1S6R A;  1W5D A;  4PM9 A;  3UPN A;  4GD6 A;  1TC5 A;  5TFQ A;  1PWC A;  1CK3 A;  2XQZ A;  5FDH A;  1M6K A;  4WZ5 C;  1XGI A;  2ZQC A;  3BFC A;  2Y2J A;  3ZCZ A;  4P85 A;  3B3X A;  1FCN A;  5FI2 A;  3KOD A;  4LV1 A;  2JE5 A;  2P9V A;  3O88 A;  2IWC A;  3IQA A;  4S0L A;  4ZAM A;  1FR6 A;  4DE1 A;  1Z6F A;  2XLN A;  3IWO A;  4JXG A;  4BQM A;  4E3J A;  3EQV A;  4JPM A;  1FCM A;  5I94 A;  4GKU A;  1TEM A;  4K0W A;  4E3I A;  1Q2Q A;  3A3F A;  4IVK A;  4B4Z A;  5J61 A;  1KE0 A;  1SHV A;  3HVF A;  2WAE A;  3BFG A;  3ISG A;  3HUN A;  3KO5 A;  3GVB A;  2JBF A;  1BZA A;  1TDG A;  2J8Y A;  3Q7V A;  1JWP A;  1FSW A;  1IEL A;  3NBL A;  3IWQ A;  4LCL A;  1G6A A;  4U0T A;  4BD1 A;  3W4Q A;  4DDS A;  5DF9 A;  1J7G A;  5E2F A;  2ZLY A;  2QPN A;  3HUM A;  4ID4 A;  3AGF A;  4QJG A;  5CRF A;  2OV5 A;  5AQA A;  5E2G A;  5EOO A;  4RX2 A;  4KG2 A;  4DF6 A;  1O07 A;  4HBU A;  3S22 A;  2OKV A;  1JTG A;  1NYY A;  5FAT A;  1BSG A;  1LL9 A;  2PU2 A;  1O7E A;  3N6I A;  4QY5 A;  4M3K A;  1FQG A;  3UDX A;  4S0K A;  4L0L A;  4KZA A;  3NDE A;  4R3B A;  3UDF A;  1RGY A;  2PBY A;  1XA7 A;  4MBH A;  4JLF A;  1W79 A;  1K55 C;  2Q9N A;  3A3J A;  2WKI A;  3ZHH A;  3OPH A;  3NC8 A;  4ZJ1 A;  4DRT A;  4X68 A;  2RCX A;  3D4F A;  3LY4 A;  3V3R A;  2X71 A;  3IXD A;  3G35 A;  3KNP A;  3Q81 A;  4CJN A;  4RRC A;  4E3M A;  3LCE A;  1IKI A;  3M6H A;  1PI5 A;  2XK1 A;  3ZNY A;  4GD8 A;  3VFF A;  3HL9 A;  5KMW A;  1FOF A;  2Y2I A;  3MKE A;  3P98 A;  4RRD A;  5GHZ A;  1YLP A;  2B5R A;  2H0Y A;  3VP2 A;  5FAS A;  2H5S A;  4H8R A;  5HAQ A;  1K6S A;  5EVL A;  2Q9M A;  4X6T A;  4HEF A;  5FAP A;  3GMW A;  2X02 A;  2HP9 A;  3BFD A;  3PBO A;  4BJP A;  2ZC7 A;  4KZB A;  2IWB A;  1QMF A;  2XEP A;  2ZQD A;  1ERO A;  2WGW A;  5AQB A;  4KEN B;  1K57 C;  3W8K A;  1PIO A;  3JYI A;  4FSF A;  3IF5 A;  2WGV A;  1IYO A;  1NZO A;  1YLW A;  4EQI A;  4PM7 A;  1XPB A;  2EX2 A;  1KVM A;  1E4D A;  3IHA A;  3VP3 A;  2DRW A;  3WS2 A;  2G2W A;  2V2F F;  3VOZ A;  1H5X A;  1BTL A;  2VGK A;  1XA1 A;  2QZ6 A;  3NIA A;  4R1G A;  4U0X A;  5CEC A;  1XGJ A;  3G30 A;  3Q1F A;  1RP5 A;  4OOL A;  3DWZ A;  2EFU A;  4OQH A;  4ZBE A;  5HL1 A;  1Q2P A;  1PW8 A;  3TSG A;  5A90 A;  4PMA A;  1ESI A;  2Y2K A;  3LO7 A;  2XR0 A;  1Y54 A;  1YMX A;  1K38 A;  5FQ9 A;  1ES5 A;  3PTE A;  1K56 A;  5DTS A;  1ZKJ A;  4R23 A;  4OLG A;  4KZ8 A;  1BLS A;  2Y91 A;  1AXB A;  3WRZ A;  1K54 C;  1XKZ A;  1EWZ A;  3CJM A;  3MKF A;  5CHJ A;  3O87 A;  3MZD A;  4E3O A;  2DCF A;  3C4P A;  3IH9 A;  3IXG A;  3VMA A;  2HDU A;  2OLU A;  4OON A;  1CEF A;  1RGZ A;  4R0Q A;  1E25 A;  5DVA A;  2A3U A;  5EEC A;  2C5W B;  1GA9 A;  4LV2 A;  5CTM A;  4DXC A;  3HUO A;  1ESU A;  1E3U A;  5CED A;  1Y2Q A;  1KDS A;  2XH9 A;  4S2K A;  3MZE A;  3NDG A;  4JF4 A;  1ZG6 A;  5CXW A;  1BUL A;  4GOG A;  2ZQA A;  2BLS A;  2P74 A;  1FCO A;  1W8Q A;  1IYP A;  2R9X A;  1MKI A;  1ONH A;  3Q82 A;  4RA7 A;  4RRL A;  3N8S A;  5F1G A;  4MNR A;  3AGE A;  3C7U A;  1YM1 A;  1PWG A;  2ZJ9 A;  4DE0 A;  3WS0 A;  3ZG7 B;  4OQ0 A;  1HVB A;  4DDY A;  3S4X A;  3HLG A;  2HKZ A;  1KGE A;  2Y2O A;  4A5R A;  4C75 A;  1IKG A;  4GZB A;  2Y4A A;  3BLM A;  4ZJ2 A;  3SH8 A;  1PI4 A;  3WWX A;  2V20 A;  3M2K A;  2X01 A;  5CGX A;  1MWT A;  5M1A A;  1CI9 A;  4BL2 A;  2Y2M A;  4PM6 A;  5E2E A;  5U47 A;  5FQI A;  2H10 A;  4JKT A;  3OPL A;  3RJU A;  3QNB A;  1N4O A;  3G4P A;  3FZC A;  3BEC A;  2XF3 A;  3E2K A;  4NET A;  2J9O A;  3UN7 A;  3FYZ A;  4K91 A;  1SDN A;  1BLC A;  4RRA A;  2ZC4 B;  4MBK A;  5JYO A;  4MBF A;  2OSU A;  4ZTK A;  3NY4 A;  3N8L A;  4PM5 A;  3GTC A;  4KZ6 A;  4PM8 A;  2ZD8 A;  5GLD A;  2ZM2 A;  4JBF A;  4EBP A;  3OPR A;  3DWK A;  1JKE A;  2EX6 A;  5GLA A;  5DF7 A;  4DXB A;  1EI5 A;  3C7V A;  5F1F A;  4WZ5 A;  3ZVT A;  3O3V A;  3ZGA B;  2Z2L B;  3CG5 A;  3LEZ A;  4UA6 A;  5GHX A;  1C3B A;  1L2S A;  4WZ4 A;  5CTN A;  4RRR A;  2WYX A;  4YIN A;  3KO7 A;  5GL9 A;  3M2J A;  4JF5 A;  4U3T A;  4WMC A;  1ES2 A;  4RYE A;  4WYY A;  5IHV A;  5FI7 A;  4S02 A;  4KZ4 A;  4HES A;  4OPR A;  4QU3 A;  2Y55 A;  3UO9 A;  5GHY A;  2ZC6 B;  5F82 A;  5CHU A;  4YFM A;  4FCF A;  5M19 A;  1BT5 A;  3SS4 A;  1JVJ A;  1NY0 A;  3GSG A;  3G32 A;  3G34 A;  5FQK A;  2PU4 A;  4O7D A;  5EUA A;  5A91 A;  4S2I A;  1SDE A;  1GHI A;  4S2L A;  4S2N C;  2XGN A;  3UDI A;  2XFT A;  1K25 A;  3ITB A;  3NI9 A;  3TOI A;  3MFD A;  3PBT A;  4UAA A;  3HRE A;  2A49 A;  4GDB A;  2QMI A;  4KQR A;  2P9V B;  2Y2H A;  5GLC A;  3UPP A;  1WYB A;  1L0G A;  4OVD A;  2J7V A;  3SS3 A;  2EX9 A;  3SH9 A;  1L0E A;  1XP4 A;  5A93 A;  4OOM A;  3HLC A;  2BG1 A;  4QY6 A;  4X55 A;  4JXW A;  4EUZ A;  1MY8 A;  3S1Y A;  3MZF A;  5AQ7 A;  4RRK A;  2HL2 A;  4GNU A;  3UE1 A;  2UWX A;  4F94 A;  1YMS A;  1KE3 A;  1TVF A;  4NBI A;  4CPK A;  1DJA A;  3PD3 A;  1VQQ A;  3SOI A;  4R4S A;  3Q7V B;  2ZC3 B;  1LI9 A;  3FKW A;  3P09 A;  3GQZ A;  1K55 A;  4GB7 A;  4KZ9 A;  5EPH A;  2HPB A;  3UE0 A;  1KE4 A;  5HAI A;  3ZG8 B;  2HL0 A;  3ZFZ A;  1DY6 A;  1K6R A;  3O86 A;  2ZM8 A;  2ZQ9 A;  3M6B A;  4WEL A;  4OLD A;  4N1X A;  4IBX A;  4KZ7 A;  5E2H A;  3LMT A;  4RRJ A;  4B88 A;  4X69 A;  3ZG5 A;  2XD1 A;  2Y2P A;  4N9K A;  4WEJ A;  3HBR A;  1SCW A;  5EOE A;  2ZMA A;  1HD8 A;  1XXM A;  3IH8 A;  2WKH A;  1YT4 A;  3IF6 C;  4RRI A;  1L0D A;  4KQO A;  2WZZ A;  2OLV A;  1BLP A;  3KOC A;  2Y2G A;  1VM1 A;  3FV7 A;  3CMZ A;  5EVI C;  4OQI A;  4FH2 A;  3E2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...