2EX6A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with ampicillin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
450
structure length
450
Chain Sequence
b'TQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 134
structure length 450
sequence length 450
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex6A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex6A02
2EX6A 1Z6FA 2XEPA 3PBTA 5E43A 1FSWA 1IEMA 5TGFA 1J9MA 2ZC3B 1MKIA 3HUOA 5KZHA 1PZOA 1NY0A 1N9BA 4OPZA 4PPRA 3S4XA 2ZQ7A 2ZQCA 3MKFA 1JTGA 2ZQ9A 3PBRA 3TG9A 5KSCA 4EBLA 3IWOA 5CTMA 5A91A 4XUXA 4BLMA 3SS5A 4DDYA 4OQHA 1CEGA 2HDUA 1FCNA 3UNWA 2WZZA 2ZD8A 3PTEA 3V3SA 1GHMA 4JXVA 4N9LA 2WAEA 3G35A 4LV1A 5CGSA 1NXYA 5FI7A 2WZXA 5HX9A 5CERA 2ZC5B 4E3IA 4RVAA 4E3JA 1HZOA 3IXGA 3PBNA 3O3VA 1PWGA 4OLDA 3SH8A 1RGYA 5EUAA 1CK3A 2CC1A 5FI2A 4OP8A 2IWCA 4JLFA 3SH7A 3QHYA 4P85A 1H5XA 5HFOA 3GVBA 1L2SA 3BECA 4QHCA 1NYYA 3I7JA 1XGJA 5FAQA 4PM5A 1GHPA 1RCJA 2Z2MB 3A3EA 4EV4A 4H8RA 3G31A 5GHXA 1JWVA 4DE2A 4OKPA 1DJAA 1BZAA 3VP0A 4DDSA 1PIOA 4ZTKA 1ZKJA 1HTZA 2OSUA 3WWXA 3Q81A 1Q2QA 3HREA 4N92A 5E2GA 1XXMA 3MZDA 3IF6A 2BG1A 4YFMA 1XGIA 3FKWA 1E3UD 2Y2MA 3HLCA 4BJPA 4NK3A 3WS0A 2OV5A 2H10A 3ZG8B 3IWQA 4E3KA 5IHVA 3OPHA 2Y2LA 5GLBA 4U0TA 1JWPA 3IT9A 3MXSA 3DTMA 1ES4A 3WS4A 5CRFA 4FH4A 1LL9A 3BYDA 4DKIA 3BEBA 2EX2A 5FI6A 4WZ5C 4WELA 1I2WA 4ZAMA 5FDHA 2DCFA 3IXBA 1C3BA 1QMEA 3AGFA 2B5RA 2OLUA 5AQ7A 3ZHHA 4OOMA 4E3NA 4OOLA 4S2JA 3HL9A 1YLPA 4E3LA 1SDEA 4Y0UA 1GA0A 2RCXA 4X53A 1ERMA 5GLCA 4OPQA 5KSHA 4R4SA 1S6RA 1BSGA 2HP5A 5GLAA 1U60A 3VFFA 3VFHA 3W4QA 4DE3A 1PYYA 3UO9A 4S2NC 4DE0A 1FR1A 3WS5A 4PM8A 2WKIA 4GKUA 1ONGA 4QD4A 3ZG0A 4X68A 2ZQ8A 5FSRA 2J7VA 1IKIA 3ITBA 3MZFA 1K25A 3GMWA 3SS4A 4B4XA 1I2SA 3NI9A 1KE4A 2HDRA 4K0XA 3C5AA 4OP5A 5TFQA 1Y54A 1NJ4A 2XK1A 1BULA 2A49A 1K54A 3C7VA 2UWXA 5CXWA 2JE5A 3C4OA 4S2MA 1MWRA 1MWSA 2WGWB 1WYBA 4IVIA 3M2KA 4IBRA 4UHUA 2WKHA 5AQ9A 1GHIA 4EBPA 1H8YA 1M6KA 1OMEA 3N8RA 2A3UA 4WMCD 5E2FA 5EVIB 3V50A 2EFXA 1FCOA 4KENB 1K4EA 2ZLYA 2XD1A 3LEZA 3CZDA 4DXCA 1L0DA 4GDNA 5DF7A 1CEFA 1DJCA 3N8SA 4R3BA 5CHMA 3CG5A 3SH9A 3UPPA 4PMAA 4U0XA 4GB7A 1LLBA 1MY8A 2PBYA 1LHYA 5DTKA 2Y2QA 2EFUA 3VP3A 3EQUA 1IYSA 3OPRA 3VOZA 3NDEA 1EWZA 1K56A 3M6BA 5CECA 4O7DA 2EXAA 3HUMA 3FZCA 5GHYA 2R9XA 5HAQA 4RX2A 1KDSA 2ZC4B 4JF5A 4WZ4A 5I94A 4KZ5A 5A90A 3CMZA 2EXBA 1BLSA 2ZJ9A 3A3IA 4EWFA 1MPLA 4UA7A 3C4PA 4KZ3A 3ZGAB 1RGZA 2HDQA 2XGNA 5A93A 2XF3A 3HUNA 3G32A 4X56A 2BLSA 2Q9MA 1JWZA 2Y2HA 3BM6A 1YMXA 4FD8A 2QMIA 4OLGA 5DTTA 2P74A 4N1XA 3WS2A 1N4OA 3UE1A 2X71A 4S2PA 4QU3A 1K6SA 3DWZA 4Q8IA 1RP5A 5FQKA 3ZDJA 3ZG9B 4BQMA 5J8XA 1TVFA 2WGVA 3EQVA 5CEDA 3NBLA 4HBTA 5HARA 3PAGA 3ZG7B 3V5MA 4KZAA 1FR6A 2WGWA 3B3XA 3SS3A 1W8QA 3BLMA 4P6BA 5FAPA 1YQSA 3GQZA 5FQIA 4BD1A 2IWDA 4MBHA 3LO7A 3V39A 5JYPA 4WMCA 4U3TA 5CHJA 1MXOA 1PI4A 2ZMAA 1W7FA 2EX8A 4R0QA 5EVIA 3VP4A 1KVLA 4R23A 4P0MA 4M3KA 3ZNYA 1I5QA 4RX3A 4Y0TA 4N1HA 1CI8A 5KMWA 4DE1A 1IYOA 2HPBA 3E2KA 5G18A 3MXRA 5DF9A 1LL5A 1K55C 1PWCA 2Q9NA 1YT4A 3Q07A 2G2UA 2ZQAA 5E2HA 4S2OA 2PU4A 2WKEA 4ZJ3A 3WRTA 5D3OA 4D2OA 4LV0A 1HD8A 4N9KA 3UE3A 1FCMA 5M19A 3FV7A 4BL3A 2QPNA 4QY5A 3MZEA 1TDGA 2Y59A 2XD5A 3W4OA 3IXHA 1GCEA 1O7EA 5FA7A 5FAOA 3IWIA 3TOIA 2J9PA 3GTCA 3NCKA 1O07A 3CJMA 4MEZA 3VOYA 1IKGA 3G2YA 3Q7VB 4HBUA 5M18A 2Y2JA 3MBZA 1PW8A 4RYEA 2HP6A 4L0LA 4R1GA 1MWUA 1ES3A 3NIAA 1E4DA 4GD8A 3RXXA 4LENA 4XXRA 4B88A 3GRJA 1BLCA 2JC7A 3IH8A 3PAEA 3BFEA 2J8YA 2PU2A 3HLWA 1KGFA 5HL1A 3GV9A 1PZPA 3NDGA 4A5RA 2P9VB 2X02A 2Y2GA 4JKTA 1NZOA 2XH9A 1BT5A 4KG2A 2ZQDA 3RXWA 5EE8A 2WADA 1BLHA 3HLGA 1FQGA 3ZG5A 3NC8A 4ID4A 4IEDA 1WYCA 4LCLA 1ESIA 2Z2LB 4X55A 3ISGA 4E3MA 4KZ8A 3ZFZA 1XA1A 1K57A 3Q7ZA 3NY4A 3BFFA 4JF6A 4MBKA 1JTDA 5FATA 1E3UA 1K4FA 4JPMA 4OH0A 4BD0A 4KQOA 1EROA 2Y2OA 3FKVA 4OQGA 1EI5A 4GDBA 3SOIA 4BENA 5BOHA 1SCWA 1LI9A 3HLEA 2GDNA 5DF8A 4KZBA 3C7UA 4GZBA 3WS1A 1YLTA 3DW0A 4BL2A 2DRWA 4C3QA 3IH9A 4JF4A 3GSGA 4OONA 3MFDA 1XKZA 4P87A 3VMAA 2ZC6B 5GLDA 1FSYA 1YLZA 2WGIA 1TEMA 3N7WA 5FASA 2JCHA 1ZG4A 3VSKA 1KDWA 2WYXA 4UAAA 3G34A 1QMFA 4UA6A 2WAFA 1BTLA 1SHVA 4DF6A 2HP9A 1KVMA 1L0FA 4S2NA 4C6YA 1GA9A 4EBNA 1YM1A 3OCLA 5EVIC 1XP4A 4CJNA 4Z9QA 1YLYA 2DNSA 3HLDA 4X69A 5FQQA 2XDMA 3IF5A 1W8YA 3P98A 4Y7PA 5F1FA 1L0EA 3PBOA 5F1GA 2C6WB 2P9VA 4YINA 2X01A 3DWKA 4PM7A 4LV3A 4K91A 3ZVWA 3IF6C 3G4PA 5FQJA 4PM9A 3A3DA 3ITAA 3AGEA 5M1AA 2QZ6A 4IVKA 1L0GA 3S22A 1ONHA 1XA7A 2EX9A 3UDIA 3BFCA 1MBLA 3HLFA 2Y2KA 4DRTA 3UN7A 4IBXA 4WBGA 4R4RA 3ZCZA 5JYOA 4WEJA 3FYZA 4QJGA 2ZM8A 1W5DA 3HBRA 2Y91A 3UDFA 1XPBA 2XFTA 2I72A 1SDNA 2VGJA 4X6TA 3OCNA 3BFDA 1W79A 3M6HA 3A3FA 4HEFA 1YLWA 3PBSA 5CHUA 3UY6A 3QNBA 1NZUA 4KG6A 1VM1A 1KE3A 3W8KA 4KZ4A 3W4PA 1HVBA 4OPRA 1K6RA 2WK0A 1KE0A 1ERQA 1NRFA 4QY6A 4KZ7A 4CPKA 2IWBA 1SKFA 4UA9A 1ES5A 3UPNA 5F82A 3ZVTA 2G2WA 3OPPA 5HAIA 3QNCA 2Y2NA 3WRZA 4E6XA 1H8ZA 3N6IA 1XX2A 3ZNTA 5EOOA 1BLPA 4R3JA 4GN2A 1BUEA 4KQQA 3P09A 4OQIA 3VP1A 2XR0A 3G30A 5CGWA 2XLNA 4WEKA 2Y55A 5DVAA 3TSGA 1K54C 5A92A 1PI5A 5EVLA 4KQRA 2V2FF 5AQAA 3PBQA 1K57C 1S0WA 1YMSA 3IHBA 4WM9A 3UDXA 3OZHA 5CEBA 1VQQA 1G68A 1E25A 1YLJA 1ZC2A 3VSLA 1JVJA 4WYYA 4K0WA 4Y0OA 1M40A 1ALQA 3RJUA 4B4ZA 1ES2A 5TR7A 1NYMA 2C5WB 4QB8A 4S2KA 1AXBA 5E2EA 3BRMA 3AGDA 3O88A 4OVDA 1LI0A 2JBFA 3GR2A 4MLLA 5GHZA 4XUZA 2J9OA 5DTSA 1PW1A 4HESA 5CGXA 4LV2A 2R9WA 1FOFA 2H0YA 3N8LA 1K38A 1K56D 2RL3A 4GOGA 1MWTA 1IYQA 3O86A 3OC2A 3LY4A 1KGEA 2Y4AA 3IXDA 2FFFB 4JXSA 4E6WA 4C75A 3A3JA 4JBFA 4EQIA 1K55A 5CTNA 4GD6A 2VGKA 4GNUA 3M2JA 3LCEA 4S2IA 3FWLA 5FQMA 1ESUA 3OPLA 3Q1FA 3BFGA 4NETA 5L2FA 2ZM0A 4F94A 5F83A 1IYPA 1DJBA 3N4IA 4KZ6A 2H0TA 3IQAA 3BLSA 4WZ5A 3V3RA 1ZG6A 3VP2A 4KZ9A 4OOYA 4PM6A 5GL9A 5HW3A 5EECA 2V1ZA 4MBFA 3Q82A 2HDSA 1CI9A 5AQBA 5HAPA 4OPYA 5EOEA 1G6AA 4JXWA 3S1YA 5U47A 4E3OA 3HVFA 4EUZA 2XQZA 2Y2PA 2ZC7A 1TDLA 4ZDXA 3UPOA 3UE0A 3E2LA 3IHAA 4JXGA 3O87A 2Y2IA 3JYIA 4DXBA 1KGGA 5EVID 4RA7A 1PWDA 1WE4A 5EPHA 3MKEA 3G2ZA 2WUQA 3Q7VA 2FFYA 4FCFA 3LY3A 5FQ9A 3D4FA 4OQ0A 4ZBEA 2XFSA 1DY6A 4FH2A 4MNRA 4KG5A 1Q2PA 3HLBA 3IF6B 2OLVA 1IELA 2V20A 2ZM2A 4S2LA 4FSFA 4ZJ1A 2E8IA 2H5SA 4ZJ2A 4LCMA
chains in the Genus database with same CATH superfamily
2LB5A 2XEPA 1FSWA 1IEMA 3S4XA 2ZQCA 4UQIS 3H82A 4EBLA 3IWOA 3KSGA 4XUXA 3SS5A 3G6OA 1DP9A 1FCNA 3KX0X 3UNWA 3EOIA 2B18A 3EEAA 3G35A 5CERA 2ZC5B 1GSVA 2YKFA 3LR0A 3PBNA 1T18A 4OLDA 5EUAA 5EM1A 3SW1A 4RRJA 2IWCA 4JLFA 3O5YA 4XT2A 1NYYA 3I7JA 3CITA 2W1TB 5GHXA 1JWVA 4GLQA 2OSUA 5L09A 3BWLA 3Q81A 1Q2QA 4KUOA 5HL6A 5HSQA 2I9VA 3HLCA 5HWWA 3IX3A 4E04A 4CLCA 2OV5A 2H10A 2GZAA 3OPHA 4U0TA 1JWPA 3NOUC 3WS4A 4FH4A 4DKIA 3BEBA 4WZ5C 3K2NA 1C3BA 1QMEA 3AGFA 2OLUA 1TS8A 2W3DA 3HL9A 3KSIA 4Y0UA 2RCXA 4OPQA 3A0SA 2PDRA 1OTDA 2HP5A 3VFFA 3VFHA 3S7OA 4PM8A 1VETB 4B9OA 4GKUA 4G3VA 3VOLA 3ZG0A 2ZQ8A 5FSRA 1IKIA 3C5AA 2XK1A 1K54A 2UV0E 4ESPA 4II7A 4S2MA 2HL2A 4UHUA 5AQ9A 1H8YA 1M6KA 4M4XA 2KOIA 3HJIA 3NOPC 3LEZA 2XA7M 2CMNA 3LIFA 3N8SA 5CHMA 3CG5A 3SH9A 1S67L 2W3EA 5DTKA 1S1YA 3E0YA 3BY9A 1K56A 2JN7A 4RX2A 3CWFA 4KZ5A 3TRCA 4S02A 1KOUA 1MPLA 4UA7A 5TBMA 3ZGAB 4RRHA 2BLSA 2Q9MA 4I5SA 4EERA 3T4TA 2QMIA 3ZQ5A 3WS2A 1P0ZA 2R78A 3UE1A 2X71A 4HNBA 3DWZA 4Q8IA 5FQKA 5F6AA 3EQVA 5HDDA 2W1RA 4EEUA 4HBTA 4P6ZM 3V5MA 3B3XA 1J7GA 4ETXA 1YQSA 5FQIA 3LO7A 5JYPA 4NXFA 1MXOA 3VP4A 4R0QA 1KVLA 3UB6A 1I5QA 3UB9A 4RX3A 4Y0TA 1CI8A 4LGWA 3D72A 1LL5A 1YT4A 2G2UA 2OAQ1 3LYXA 2PU4A 5HPIA 1HD8A 4N9KA 5M19A 4BL3A 5FAOA 4QWOA 1IKGA 4AFIA 3RXXA 3GRJA 1D7EA 2JC7A 2PU2A 3QP2A 3GV9A 4HY8A 2ZL1B 2P9VB 2Y2GA 1NZOA 1BT5A 2FZ0A 2WADA 5EE8A 3LGOA 4R38A 4HIAA 3OLOA 4RRDA 4UQIM 4GJ4A 4KZ8A 3Q7ZA 1K57A 1XFNA 4DMZA 5FATA 1E3UA 1K4FA 3KOBA 4YWZA 4Y2FA 2Y2OA 1LI9A 2GDNA 1YLTA 4C3QA 3VE4A 3P7NA 3MFDA 5F69A 4R70A 1FSYA 2WGIA 3N7WA 4Q0JA 2WYXA 2A24B 1YSPA 1BTLA 3KO7A 4EBNA 3BW6A 1YPRA 3OCLA 2Y8HA 3HLDA 4HHDA 2ACGA 1W8YA 4Y7PA 5F1FA 1L0EA 3DWKA 4PM7A 4EXOA 4K91A 3G4PA 4S0JA 4PM9A 5DJUA 4CLCC 1CQAA 1L0GA 1OJ5A 1ONHA 2W3HA 3UDIA 3F1NB 1UGUA 4UEYA 4BBUA 3UN7A 3CAXA 4L9FA 4IBXA 4R4RA 3ZCZA 5JYOA 3FYZA 4QJGA 3DAVA 2Y91A 1V9YA 2XFTA 4RR9A 1TS6A 1W79A 3MQQA 4HEFA 5A8BA 4WF0A 1KE3A 2VGLS 2WK0A 1ERQA 1NRFA 4KZ7A 4PKYA 4RRCA 5F82A 1XFQA 2HL1A 2VZWA 5HAIA 2Y2NA 4E6XA 3N6IA 4RRIA 5EOOA 4LFUA 1BLPA 1BYWA 4R3JA 1P9WA 1BUEA 3IBJA 4NEED 3VP1A 4NBJA 5DVAA 2XR0A 3G30A 5CGWA 3TSGA 1K54C 5EVLA 1V9ZA 1P9RA 3PBQA 1S0WA 3UDXA 4RR6A 3OZHA 1VQQA 1ZC2A 3PD3A 4WYYA 4K0WA 4Y0OA 1WA9A 1ES2A 1NWZA 3R7WB 4QB8A 3O88A 2H0YA 2V8CA 3KNPA 4BWIA 2RL3A 4GOGA 1MWTA 3O86A 3OC2A 3LY4A 2Y4AA 2FFFB 4E6WA 1N9OA 3UB5P 4GD6A 2VGKA 3KO9A 2B95A 3LCEA 1UWNX 1ESUA 2JKTM 3BFGA 4NETA 3N4IA 1DJBA 4WZ5A 3VP2A 1TC5A 5HW3A 4Z1WA 2V1BA 4RR7A 1CI9A 4IUKA 5EOEA 4JXWA 3W2ZA 5U47A 4Y13A 2P04A 3UPOA 3UE0A 3IHAA 3O87A 1KGGA 2W27A 1PNEA 1PWDA 1WE4A 2Y79A 3L9KA 2JHEA 2V1AA 2WUQA 3LMVA 3T4JA 3LY3A 2PHYA 5FQ9A 4MN5A 1TS7A 4MNRA 4CLCE 4KG5A 1DP8A 4S2LA 4FOFA 4ZJ1A 3LMTA 2VK3A 1EW0A 4ZJ2A 2EX6A 1J9MA 5KZHA 5DKLA 2ZMVA 4GS9A 3T4LA 5CTMA 3C2WA 4BLMA 2HDUA 2WAEA 5FI7A 4PAUA 3BY8A 1GSXA 3O3VA 1PWGA 2CC1A 5FI2A 4OP8A 1YSQA 1H5XA 5HFOA 4PM5A 4QHCA 2Z2MB 1RCJA 3A0VA 3QP5A 4DDSA 3WWXA 4R3AA 4N92A 1IOUA 4HJ6A 1XXMA 3MZDA 3IF6A 4YFMA 4IHQA 1XGIA 3FKWA 2Y2MA 2H28A 2P7JA 2O0YA 4RRLA 3IWQA 5HWTA 4E3KA 5IHVA 3IT9A 1ES4A 1LL9A 3BYDA 3MJQA 4ZAMA 5FDHA 3ZHHA 5AQ7A 2B5RA 3MFXA 3DTEA 2V9AA 1XJ2A 4NKPA 5KSHA 4PKYG 1S6RA 1OT9A 1H3QA 1U60A 3W4QA 2JKFA 1PYYA 3WS5A 2XRNA 4QD4A 2O9AA 3ITBA 3MZFA 3SS4A 1DP6A 4B4XA 2V0WA 3IX4A 2HDRA 2W1TA 2ZOHA 3F1PA 1NJ4A 2OAP1 3DTKA 2WGWB 4S0IA 3M2KA 2WKHA 3OBFA 1GHIA 2QJ7A 5EV0A 5E2FA 3V50A 2J3WA 2EFXA 4KENB 3KO3A 2XD1A 3CZDA 5DF7A 4WN5A 3ULFA 2VA0A 3MXQA 4PMAA 4U0XA 2PBYA 2EWWA 3LIAA 4HP9A 3IX8A 3HUMA 4JGRA 2R9XA 1KDSA 2ZC4B 4I3AA 4JF5A 3FPWA 3CMZA 3A3IA 1BLSA 4X25A 4KZ3A 1FILA 1RGZA 2XF3A 3CI6A 2Y2HA 3BM6A 2KDKA 1VETA 4EW7A 1JNUA 1FIKA 2PAVP 4S2PA 1RP5A 5J61A 4ETZA 3LMUA 5CEDA 2NUPC 5HARA 2Z6DA 3PAGA 4KZAA 1FR6A 3CLOA 4BD1A 2KX6A 5CHJA 4U3TA 1PI4A 2EX8A 4FTXA 4R23A 4F3LB 3ZNYA 4EEPA 4N1HA 4RRQA 5HD5A 4DE1A 3E2KA 3PD4A 3MXRA 5DF9A 1AWIA 1NLYA 2ZQAA 2WKEA 3K3CA 3WRTA 4D2OA 1T1BA 3T4QA 3UE3A 4RRFA 1FCMA 3MZEA 1TDGA 2Y59A 3W4OA 2VV7A 4LRXC 3IWIA 3TOIA 3NCKA 1O07A 4MEZA 3Q7VB 5M18A 4RYEA 2HP6A 4PHTA 4R1GA 3B47A 4NXGA 1ES3A 4XXRA 4B88A 2HGVA 2Q0OA 3PAEA 3BFEA 3HLWA 3KO4A 5HL1A 4A5RA 2X02A 2M7UA 3RXWA 2HF6A 3HLGA 3MS6A 4E3MA 4MBKA 4I3JA 4JPMA 1W63M 4OH0A 1EROA 4R6LA 3JVUA 4GDBA 3SOIA 2DBOA 2INWA 5AVFA 5DF8A 4KZBA 3C7UA 4RRMA 3WS1A 2WKPA 2K31A 4JF4A 3GSGA 4P87A 5DJTA 5GLDA 2JCHA 3VSKA 4WL9A 4YNRA 2EA9A 5HD3A 4S2NA 4LRZE 1YKDA 2DNSA 3KYQA 2ZL1A 2P9VA 4YINA 3IF6C 3CPTB 4IJGA 3A3DA 3ITAA 3AGEA 4S03A 3S22A 2PYPA 2EX9A 5DFYA 3TE8A 4WBGA 5G4ZA 4WEJA 3E4QA 3HBRA 1XPBA 5L10A 3PR6A 2VGJA 3OCNA 3BFDA 3PXPA 5CHUA 1YLWA 3PBSA 3QNBA 4HJ3A 2QHKA 5FEGA 1NZUA 1F9IA 1VM1A 4KZ4A 3HCYA 4QY6A 1Y4OA 1ES5A 3U4LP 3UPNA 2G2WA 2A24A 3QNCA 4Y3IA 4OQIA 1CF0A 4ARZA 5A92A 2ZBBA 5AQAA 3IHBA 1F2KA 1E25A 3BQ8A 5TR7A 4S2KA 3F1NA 4KQDA 3GR2A 2J9OA 1PW1A 2R9WA 1FOFA 3MF0A 2HKZA 1X0OA 1KGEA 3S7QA 1LSWA 5FQMA 2K7SA 2WKRA 3MR0A 5L2FA 4F94A 5F83A 4KZ6A 2H0TA 2A2LA 1VHMA 1S1ZA 4PM6A 2V1ZA 4MBFA 3Q82A 2HDSA 5AQBA 5HAPA 1G6AA 3S1YA 2V8FA 4ZDXA 3E2LA 2Y2IA 3JYIA 4RRKA 5EVID 4JGOA 5HWVA 3MKEA 2FFYA 3RH8B 3R4KA 3PHYA 4ZBEA 2XFSA 4FH2A 3H9WA 5L07A 3HLBA 3NULA 1IELA 3LR4A 4FSFA 2ZOIA 3PBTA 1LSXA 3HUOA 4PPRA 2ZQ9A 3EWKA 3PBRA 3TG9A 5DFXA 5A91A 4G3KA 3UMDA 1CEGA 1OTBA 4RRGA 2O99A 3PTEA 3V3SA 1GHMA 4N9LA 4LV1A 5CGSA 5HX9A 4E3IA 4RVAA 1HZOA 4RRAA 3IXGA 1RGYA 4O8GA 4WUJA 5HPFA 3SH7A 3KODA 3EEHA 4P85A 3GVBA 1A0KA 3BECA 2HZ5A 4FUWA 1XGJA 4H8RA 3G31A 4G3WA 3LR3A 4DE2A 4OKPA 1DJAA 5AJGA 1BZAA 1ZKJA 2VJWA 5E2GA 3HREA 4QPRA 2BG1A 3L7HA 1K0KA 4BJPA 4NK3A 3IS2B 4KUKA 3ZG8B 2Y2LA 5GLBA 3DBAA 3DTMA 4WELA 3JVVA 1XJ6A 2DCFA 3GDIA 2VX8A 4E3NA 4OOLA 4S2JA 2PR6A 4X53A 1ERMA 1LL8A 3H7WB 4R4SA 4DE3A 5LBRA 1CJFA 3UO9A 4L9EA 2PD7A 4S2NC 4DE0A 3UE6A 1FR1A 2OKVA 1OT6A 2WKIA 1ONGA 3D3OA 3LI8A 4X68A 2J7VA 4H6JA 4HOIA 3T4OA 1K25A 3CUEA 3RTYA 1I2SA 1PFLA 1KE4A 4K0XA 1VEUB 1Y54A 2M1CA 1BULA 4HQAA 3C4OA 1MWRA 4IVIA 4IBRA 2W3FA 4I3IA 4EBPA 5J3WA 4WMCD 5EVIB 1FCOA 4I39A 1K4EA 2VEAA 1L0DA 4GDNA 2G7UA 1DJCA 1G28A 4R3BA 3UPPA 3KNFA 1MY8A 1SKOA 2JKGA 2Y2QA 5J4EA 2EFUA 1N9LA 3EQUA 3M6BA 5CECA 3LIDA 2VLGA 4WZ4A 3PYPA 4Y17A 3K3DA 3KYZA 2PR5A 1L3LA 2XSSA 2HDQA 5A93A 4X56A 3G32A 4EU0A 1JWZA 1YMXA 4OLGA 3U2AA 2P74A 4N1XA 5IU1A 4QU3A 1K6SA 3ZDJA 3ZG9B 4BQMA 2M7VA 1TVFA 2WGVA 4GHIB 3NBLA 1T1CA 2Z6CA 2WGWA 1W8QA 3BLMA 2JKRI 4P6BA 5FAPA 3RFBA 1MKMA 3V39A 4WMCA 2B02A 1OTEA 2XA7S 3GECA 2PT7A 3SZTA 2D01A 4NXBA 3QP6A 5G18A 4JGQA 1PWCA 2Q9NA 3Q07A 4S2OA 2QKPA 4Q0IA 5D3OA 2DMWA 1OPXA 4EUVA 4MN6A 3FV7A 3KOCA 3E98A 4QY5A 2XD5A 1J3WA 5FA7A 2OOLA 3LIEA 4RRBA 3CJMA 3VOYA 4HBUA 2Y2JA 3MBZA 3OOVA 1NRJA 1PW8A 4IUHA 3MMHA 4L0LA 4HH3A 3NIAA 2ZMFA 4BBTA 3IH8A 4P6ZS 1OTIA 3NDGA 1Y28A 4JKTA 2ZQDA 3UB8A 1BLHA 3QP1A 5G4YA 2BASA 1FQGA 3ZG5A 1IFQA 4F3LA 4X55A 3ISGA 3NY4A 1W63Q 3BFFA 3FG8A 4JF6A 2PRFA 1S4SA 1JTDA 4KQOA 4OQGA 1EI5A 4BENA 1F98A 4RRRA 3NHQA 3HLEA 4GZBA 3DW0A 2DRWA 4MN7A 2KLIA 3NECA 2VGLM 3MQ0A 4OONA 2J3TD 1XKZA 1YLZA 1TEMA 5FASA 1ZG4A 5AVEA 1QMFA 2XROA 4UA6A 1SHVA 2HP9A 1L0FA 3UMEA 2WKQA 5EVIC 4CJNA 4Z9QA 1YLYA 4X69A 5FQQA 2XDMA 4CLCD 3P98A 3KO6A 3PBOA 5F1GA 2C6WB 2L0WA 2X01A 4NBIA 3HJKA 1XA7A 3NOTC 2JKRM 5L8MA 1MBLA 3HLFA 2Y2KA 4DJ2A 4DRTA 5F68A 3T4KA 3FPVA 5TJJA 3QP4A 2ZM8A 3UDFA 3VV4A 2I72A 1SDNA 1G6OA 3M6HA 3UY6A 2IA2A 4OPRA 5FL3A 2GNXA 1T1AA 5DKKA 1ZHHB 3MSHA 3ZVTA 3F1OB 3CHWP 3OPPA 2OWJA 2LB9A 3F1PB 3WRZA 2L4RA 1H8ZA 3CUEC 3ZNTA 4GN2A 5C5KA 3P09A 2BTFP 4WEKA 2Y55A 4KQRA 2V2FF 5CEBA 2W0NA 1G68A 1YLJA 4GW9A 1JVJA 3CPTA 2NUTC 5MC7A 2C5WB 5E2EA 3BRMA 1LSVA 3AGDA 4OVDA 1LI0A 5GHZA 3LFVA 4XUZA 4GCZA 5CGXA 1K56D 1IYQA 4MMNA 5CX7A 4JXSA 4C75A 4L9GA 3H82B 4EQIA 1K55A 1T19A 3M2JA 5J7EA 2P08A 4KZ9A 5GL9A 5EECA 1S66L 4OPYA 2O9BA 4EUZA 4E3OA 2XQZA 2Y2PA 2ZC7A 1TDLA 4XT2B 1F5MA 4RA7A 2PBDP 3G2ZA 4FCFA 3S7PA 3D4FA 1DY6A 2QYBA 1Q2PA 2OLVA 2V20A 2W3GA 4Y15A 3UB7A 4CLCB 2H5SA 4LCMA 4HH2A 1Z6FA 2O9CA 5E43A 5TGFA 2ZC3B 1MKIA 3C8CA 1PZOA 1NY0A 1N9BA 4OPZA 2ZQ7A 3MKFA 4O0PA 1JTGA 5KSCA 1P97A 4DDYA 4OQHA 2VV8A 2WZZA 2ZD8A 4JXVA 1NXYA 4RQ9A 2WZXA 4E3JA 1JKEA 4JGPA 3SH8A 1CK3A 3LICA 2E8JA 3QHYA 4DN0A 1L2SA 5FAQA 1GHPA 3A3EA 4D60A 4EV4A 5F5YA 2PD8A 1OTAA 4LPZA 4B93A 3VP0A 1PIOA 4ZRRA 4ZTKA 1HTZA 3JPUA 3EGXC 1E3UD 3E4PA 3WS0A 4X1MA 4HJ4A 2GJ3A 3MXSA 5CRFA 1OJGA 2EX2A 5FI6A 1I2WA 3IXBA 4X1LA 1S4RA 4OOMA 3BQAA 4E3LA 1YLPA 1SDEA 1GA0A 4ME4A 5GLCA 1DRMA 3T50A 1NLZA 3QP8A 4S0LA 1BSGA 5TBMB 5GLAA 2QWSA 3LI9A 5EM0A 3D9YA 4NXEA 3GMWA 2FH5A 3T12B 4DJ3A 3NI9A 1VB6A 4CQHA 4OP5A 5TFQA 2K2NA 2A49A 3C7VA 5CXWA 2UWXA 5KIZA 2JE5A 1MWSA 1WYBA 2GX5A 1OMEA 3N8RA 5EVEA 2A3UA 3IS2A 2ZLYA 2JKTI 4DXCA 5IT5A 1N9NA 1CEFA 3EGDC 3C38A 3R7WA 5FEFA 3V67A 4GB7A 1LLBA 1LHYA 3E4OA 1H8MA 3VP3A 1IYSA 2MJ6A 3OPRA 3NDEA 1EWZA 3VOZA 4O7DA 2EXAA 2J3TC 3FZCA 5GHYA 5HAQA 1G5UA 5I94A 5A90A 3H7WA 2EXBA 2ZJ9A 4EWFA 5HZHA 3C4PA 3T1SA 1PRQA 2XGNA 4ARZB 2EWVA 3LIBA 3HUNA 1TF1A 4HI4A 3T4SA 4FD8A 5DTTA 1N4OA 3T1RA 5J8XA 1XJ4A 4MDZA 1VEUA 3ZG7B 3SS3A 3GQZA 2IWDA 4MBHA 3LR5A 5EVIA 2ZMAA 1W7FA 1UWPX 2L1MA 4P0MA 4M3KA 3ICYA 5KMWA 3T1QB 1IYOA 2HPBA 1K55C 5E2HA 4EETB 4ZJ3A 4LV0A 3KSFA 3T1XA 2PYRA 1LT0A 1Z09A 2QPNA 1YAXA 4Q0HA 3IXHA 1GCEA 1O7EA 4I38A 2J9PA 3GTCA 1MZUA 3G2YA 3PD2A 1MWUA 1E4DA 4GD8A 4LENA 1BLCA 5I5LA 2J8YA 4GHIA 1KGFA 1PZPA 4LLOB 1Y2QA 2XH9A 4KG2A 3NC8A 1ZTUA 4ID4A 4IEDA 1WYCA 4LCLA 1ESIA 2Z2LB 1GSWA 3ZFZA 1XA1A 4BD0A 3KYEA 3LEQA 3FKVA 4EQ1A 1STZA 5BOHA 1SCWA 3VE3A 1ACFA 2OWHA 3KO5A 4BL2A 1SZVA 3IH9A 3VMAA 2HJ9C 2ZC6B 1KDWA 4RR8A 4UAAA 3G34A 5HDCA 3BJNA 2WAFA 4K08A 4DF6A 1KVMA 4C6YA 1GA9A 1YM1A 1XP4A 1HLUP 3IF5A 3C30A 2HV1A 4LV3A 1XJ3A 3ZVWA 5FQJA 3PD5A 3B42A 2AVXA 2QZ6A 4IVKA 5M1AA 3BFCA 3S7NA 4YOFA 3LUQA 1W5DA 4X6TA 3A3FA 1D06A 3TJZC 4KG6A 1ODVA 3W8KA 4EESA 3A0RA 3W4PA 1HVBA 1TS0A 1K6RA 4H6JB 1KE0A 2HJEA 4CPKA 2IWBA 1SKFA 2VKSA 4UA9A 3DTIA 4BBVA 1XX2A 1D1JA 3TW8A 4KQQA 2XLNA 3IBRA 5HDSA 1PI5A 4HP4A 4LRYC 2HL0A 1K57C 2J80A 1YMSA 4WM9A 3VSLA 3ZYTA 1H0MA 1M40A 1ALQA 3RJUA 4B4ZA 2D02A 1NYMA 5K5BA 1AXBA 5IS1A 1SKOB 3NJAA 2JBFA 4MLLA 4BMWA 2VV6A 5DTSA 4HESA 4LV2A 4MCWA 3N8LA 1K38A 3IXDA 3A3JA 5FDSA 4JBFA 4GS9B 1MC0A 5CTNA 4GNUA 4S2IA 3FWLA 3P01A 3OPLA 3Q1FA 2QJ5A 3FC7A 2ZM0A 4WLAA 1IYPA 3IQAA 4O01A 3BLSA 2YKHA 3V3RA 1ZG6A 4OOYA 3F1OA 5EFWA 3HVFA 4Y5FA 4JXGA 4DXBA 5EPHA 3Q7VA 1TD5A 4S0KA 4OQ0A 4NG2A 3IF6B 3KSHA 2ZM2A 2V0UA 3B33A 2E8IA 3MQOA
chains in the Genus database with same CATH topology
2EX6A 1Z6FA 2XEPA 3PBTA 5E43A 1FSWA 1IEMA 5TGFA 1J9MA 2ZC3B 1MKIA 3HUOA 5KZHA 1PZOA 1NY0A 1N9BA 4OPZA 4PPRA 3S4XA 2ZQ7A 2ZQCA 3MKFA 1JTGA 2ZQ9A 3PBRA 3TG9A 5KSCA 4EBLA 3IWOA 5CTMA 5A91A 4XUXA 4BLMA 3SS5A 4DDYA 4OQHA 1CEGA 2HDUA 1FCNA 3UNWA 4RRGA 2WZZA 2ZD8A 3PTEA 3V3SA 1GHMA 4JXVA 4N9LA 2WAEA 3G35A 4LV1A 5CGSA 1NXYA 5FI7A 2WZXA 5HX9A 5CERA 2ZC5B 4E3IA 4RVAA 4E3JA 1HZOA 4RRAA 3IXGA 3PBNA 3O3VA 1JKEA 1PWGA 4OLDA 3SH8A 1RGYA 5EUAA 1CK3A 2CC1A 5FI2A 4OP8A 2IWCA 4RRJA 4JLFA 3SH7A 3QHYA 3KODA 4P85A 1H5XA 5HFOA 3GVBA 1L2SA 3BECA 4QHCA 1NYYA 3I7JA 1XGJA 5FAQA 4PM5A 1GHPA 1RCJA 2Z2MB 3A3EA 4EV4A 4H8RA 3G31A 5GHXA 1JWVA 4DE2A 4OKPA 1DJAA 1BZAA 3VP0A 4DDSA 1PIOA 4ZTKA 1ZKJA 1HTZA 2OSUA 3WWXA 3Q81A 1Q2QA 3HREA 4N92A 5E2GA 1XXMA 3MZDA 3IF6A 2BG1A 4YFMA 1XGIA 3FKWA 1E3UD 2Y2MA 3HLCA 4BJPA 4NK3A 3WS0A 2OV5A 2H10A 3ZG8B 3IWQA 4RRLA 4E3KA 5IHVA 3OPHA 2Y2LA 5GLBA 4U0TA 1JWPA 3IT9A 3MXSA 3DTMA 1ES4A 3WS4A 5CRFA 4FH4A 1LL9A 3BYDA 4DKIA 3BEBA 2EX2A 5FI6A 4WZ5C 4WELA 1I2WA 4ZAMA 5FDHA 2DCFA 3IXBA 1C3BA 1QMEA 3AGFA 2B5RA 2OLUA 5AQ7A 3ZHHA 4OOMA 4E3NA 4OOLA 4S2JA 3HL9A 1YLPA 4E3LA 1SDEA 4Y0UA 1GA0A 2RCXA 4X53A 1ERMA 5GLCA 4OPQA 5KSHA 4R4SA 1S6RA 4S0LA 1BSGA 2HP5A 5GLAA 1U60A 3VFFA 3VFHA 3W4QA 4DE3A 1PYYA 3UO9A 4S2NC 4DE0A 1FR1A 3WS5A 2OKVA 4PM8A 2WKIA 4GKUA 1ONGA 4QD4A 3ZG0A 4X68A 2ZQ8A 5FSRA 2J7VA 1IKIA 3ITBA 3MZFA 1K25A 3GMWA 3SS4A 4B4XA 1I2SA 3NI9A 1KE4A 2HDRA 4K0XA 3C5AA 4OP5A 5TFQA 1Y54A 1NJ4A 2XK1A 1BULA 2A49A 1K54A 3C7VA 2UWXA 5CXWA 2JE5A 3C4OA 4S2MA 1MWRA 1MWSA 2WGWB 2HL2A 1WYBA 4IVIA 4S0IA 3M2KA 4IBRA 4UHUA 2WKHA 5AQ9A 1GHIA 4EBPA 1H8YA 1M6KA 1OMEA 3N8RA 2A3UA 4WMCD 5E2FA 5EVIB 3V50A 2EFXA 1FCOA 4KENB 3KO3A 1K4EA 2ZLYA 2XD1A 3LEZA 3CZDA 4DXCA 1L0DA 4GDNA 5DF7A 1CEFA 1DJCA 3N8SA 4R3BA 5CHMA 3CG5A 3SH9A 3UPPA 3KNFA 4PMAA 4U0XA 4GB7A 1LLBA 1MY8A 2PBYA 1LHYA 5DTKA 2Y2QA 2EFUA 3VP3A 3EQUA 1IYSA 3OPRA 3VOZA 3NDEA 1EWZA 1K56A 3M6BA 5CECA 4O7DA 2EXAA 3HUMA 3FZCA 5GHYA 2R9XA 5HAQA 4RX2A 1KDSA 2ZC4B 4JF5A 4WZ4A 5I94A 4KZ5A 5A90A 3CMZA 2EXBA 1BLSA 2ZJ9A 3A3IA 4EWFA 1MPLA 4S02A 4UA7A 3C4PA 4KZ3A 3ZGAB 1RGZA 2HDQA 2XGNA 4RRHA 5A93A 2XF3A 3HUNA 3G32A 4X56A 2BLSA 2Q9MA 1JWZA 2Y2HA 3BM6A 1YMXA 4FD8A 2QMIA 4OLGA 5DTTA 2P74A 4N1XA 3WS2A 1N4OA 3UE1A 2X71A 4S2PA 4QU3A 1K6SA 3DWZA 4Q8IA 1RP5A 5FQKA 3ZDJA 3ZG9B 4BQMA 5J8XA 5J61A 1TVFA 3LMUA 2WGVA 3EQVA 5CEDA 3NBLA 4HBTA 5HARA 3PAGA 3ZG7B 3V5MA 4KZAA 1FR6A 2WGWA 3B3XA 3SS3A 1W8QA 3BLMA 4P6BA 5FAPA 1J7GA 1YQSA 3GQZA 5FQIA 4BD1A 2IWDA 4MBHA 3LO7A 3V39A 5JYPA 4WMCA 4U3TA 5CHJA 1MXOA 1PI4A 2ZMAA 1W7FA 2EX8A 4R0QA 5EVIA 3VP4A 1KVLA 4R23A 4P0MA 4M3KA 3ZNYA 1I5QA 4RX3A 4Y0TA 4N1HA 1CI8A 4RRQA 5KMWA 4DE1A 1IYOA 2HPBA 3E2KA 5G18A 3PD4A 3MXRA 5DF9A 1LL5A 1K55C 1PWCA 2Q9NA 1YT4A 3Q07A 2G2UA 2ZQAA 5E2HA 4S2OA 2PU4A 2WKEA 4ZJ3A 3WRTA 5D3OA 4D2OA 4LV0A 1HD8A 4N9KA 3UE3A 4RRFA 1FCMA 5M19A 3FV7A 4BL3A 3KOCA 2QPNA 4QY5A 3MZEA 1TDGA 2Y59A 2XD5A 3W4OA 3IXHA 1GCEA 1O7EA 5FA7A 5FAOA 3IWIA 3TOIA 2J9PA 3GTCA 3NCKA 1O07A 4RRBA 3CJMA 4MEZA 3VOYA 1IKGA 3G2YA 3Q7VB 4HBUA 5M18A 2Y2JA 3MBZA 1PW8A 4RYEA 2HP6A 4L0LA 4R1GA 3PD2A 1MWUA 1ES3A 3NIAA 1E4DA 4GD8A 3RXXA 4LENA 4XXRA 4B88A 3GRJA 1BLCA 2JC7A 3IH8A 3PAEA 3BFEA 2J8YA 2PU2A 3HLWA 1KGFA 3KO4A 5HL1A 3GV9A 1PZPA 3NDGA 4A5RA 2P9VB 2X02A 2Y2GA 4JKTA 1Y2QA 1NZOA 2XH9A 1BT5A 4KG2A 2ZQDA 3RXWA 5EE8A 2WADA 1BLHA 3HLGA 1FQGA 3ZG5A 3NC8A 4ID4A 4IEDA 1WYCA 4RRDA 4LCLA 1ESIA 2Z2LB 4X55A 3ISGA 4E3MA 4KZ8A 3ZFZA 1XA1A 1K57A 3Q7ZA 3NY4A 3BFFA 4JF6A 4MBKA 1JTDA 5FATA 1E3UA 1K4FA 4JPMA 4OH0A 4BD0A 3KOBA 4KQOA 1EROA 2Y2OA 3FKVA 4OQGA 1EI5A 4GDBA 3SOIA 2DBOA 4BENA 5BOHA 1SCWA 4RRRA 1LI9A 3HLEA 2GDNA 5DF8A 4KZBA 3C7UA 4GZBA 4RRMA 3WS1A 1YLTA 3KO5A 3DW0A 4BL2A 2DRWA 4C3QA 3IH9A 4JF4A 3GSGA 4OONA 3MFDA 1XKZA 4P87A 3VMAA 2ZC6B 5GLDA 1FSYA 1YLZA 2WGIA 1TEMA 3N7WA 5FASA 2JCHA 1ZG4A 3VSKA 1KDWA 2WYXA 4RR8A 4UAAA 3G34A 1QMFA 4UA6A 2WAFA 1BTLA 1SHVA 4DF6A 2HP9A 1KVMA 1L0FA 4S2NA 3KO7A 4C6YA 1GA9A 4EBNA 1YM1A 3OCLA 5EVIC 1XP4A 4CJNA 4Z9QA 1YLYA 2DNSA 3HLDA 4X69A 5FQQA 2XDMA 3IF5A 1W8YA 3P98A 4Y7PA 5F1FA 1L0EA 3PBOA 5F1GA 2C6WB 2P9VA 4YINA 2X01A 3DWKA 4PM7A 4LV3A 4K91A 3ZVWA 3IF6C 4NBIA 3G4PA 5FQJA 4S0JA 4PM9A 3A3DA 3PD5A 3ITAA 3AGEA 5M1AA 2QZ6A 4IVKA 1L0GA 3S22A 4S03A 1ONHA 1XA7A 2EX9A 3UDIA 3BFCA 1MBLA 3HLFA 2Y2KA 4DRTA 3UN7A 4IBXA 4WBGA 4R4RA 3ZCZA 5JYOA 4WEJA 3FYZA 4QJGA 2ZM8A 1W5DA 3HBRA 2Y91A 3UDFA 1XPBA 2XFTA 2I72A 1SDNA 2VGJA 4X6TA 4RR9A 3OCNA 3BFDA 1W79A 3M6HA 3A3FA 4HEFA 1YLWA 3PBSA 5CHUA 3UY6A 3QNBA 1NZUA 4KG6A 1VM1A 1KE3A 3W8KA 4KZ4A 3W4PA 1HVBA 4OPRA 1K6RA 2WK0A 1KE0A 1ERQA 1NRFA 4QY6A 4KZ7A 4CPKA 2IWBA 1SKFA 4UA9A 4RRCA 1ES5A 3UPNA 5F82A 3ZVTA 2HL1A 2G2WA 3OPPA 5HAIA 3QNCA 2Y2NA 3WRZA 4E6XA 1H8ZA 3N6IA 1XX2A 3ZNTA 5EOOA 4RRIA 1BLPA 4R3JA 4GN2A 1BUEA 4KQQA 3P09A 4OQIA 3VP1A 4NBJA 2XR0A 3G30A 5CGWA 2XLNA 4WEKA 2Y55A 5DVAA 3TSGA 1K54C 5A92A 1PI5A 5EVLA 4KQRA 2V2FF 2HL0A 5AQAA 3PBQA 1K57C 1S0WA 1YMSA 3IHBA 4WM9A 3UDXA 3OZHA 5CEBA 4RR6A 1VQQA 1G68A 1E25A 1YLJA 1ZC2A 3VSLA 1JVJA 4WYYA 3PD3A 4K0WA 4Y0OA 1M40A 1ALQA 3RJUA 4B4ZA 1ES2A 5TR7A 1NYMA 2C5WB 4QB8A 4S2KA 1AXBA 5E2EA 3BRMA 3AGDA 3O88A 4OVDA 1LI0A 2JBFA 3GR2A 4MLLA 5GHZA 4XUZA 2J9OA 5DTSA 1PW1A 4HESA 5CGXA 4LV2A 2R9WA 1FOFA 2H0YA 3N8LA 1K38A 1K56D 2HKZA 3KNPA 2RL3A 4GOGA 1MWTA 1IYQA 3O86A 3OC2A 3LY4A 1KGEA 2Y4AA 3IXDA 2FFFB 4JXSA 4E6WA 4C75A 3A3JA 4JBFA 4EQIA 1K55A 5CTNA 4GD6A 2VGKA 4GNUA 3KO9A 3M2JA 3LCEA 4S2IA 3FWLA 5FQMA 1ESUA 3OPLA 3Q1FA 3BFGA 4NETA 5L2FA 2ZM0A 4F94A 5F83A 1IYPA 1DJBA 3N4IA 4KZ6A 2H0TA 3IQAA 3BLSA 4WZ5A 3V3RA 1ZG6A 3VP2A 4KZ9A 4OOYA 4PM6A 5GL9A 1TC5A 5HW3A 5EECA 2V1ZA 4MBFA 3Q82A 4RR7A 2HDSA 1CI9A 5AQBA 5HAPA 4OPYA 5EOEA 1G6AA 4JXWA 3S1YA 5U47A 4E3OA 3HVFA 4EUZA 2XQZA 2Y2PA 2ZC7A 1TDLA 4ZDXA 3UPOA 3UE0A 3E2LA 3IHAA 4JXGA 3O87A 2Y2IA 3JYIA 4DXBA 1KGGA 4RRKA 5EVID 4RA7A 1PWDA 1WE4A 5EPHA 3MKEA 3G2ZA 2WUQA 3Q7VA 2FFYA 4FCFA 3LMVA 3LY3A 4S0KA 5FQ9A 3D4FA 4OQ0A 4ZBEA 2XFSA 1DY6A 4FH2A 4MNRA 4KG5A 1Q2PA 3HLBA 3IF6B 2OLVA 1IELA 2V20A 2ZM2A 4S2LA 4FSFA 4ZJ1A 3LMTA 2E8IA 2H5SA 4ZJ2A 4LCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EX6 A;  1Z6F A;  2XEP A;  3PBT A;  5E43 A;  1FSW A;  1IEM A;  5TGF A;  1J9M A;  2ZC3 B;  1MKI A;  3HUO A;  5KZH A;  1PZO A;  1NY0 A;  1N9B A;  4OPZ A;  4PPR A;  3S4X A;  2ZQ7 A;  2ZQC A;  3MKF A;  1JTG A;  2ZQ9 A;  3PBR A;  3TG9 A;  5KSC A;  4EBL A;  3IWO A;  5CTM A;  5A91 A;  4XUX A;  4BLM A;  3SS5 A;  4DDY A;  4OQH A;  1CEG A;  2HDU A;  1FCN A;  3UNW A;  2WZZ A;  2ZD8 A;  3PTE A;  3V3S A;  1GHM A;  4JXV A;  4N9L A;  2WAE A;  3G35 A;  4LV1 A;  5CGS A;  1NXY A;  5FI7 A;  2WZX A;  5HX9 A;  5CER A;  2ZC5 B;  4E3I A;  4RVA A;  4E3J A;  1HZO A;  3IXG A;  3PBN A;  3O3V A;  1PWG A;  4OLD A;  3SH8 A;  1RGY A;  5EUA A;  1CK3 A;  2CC1 A;  5FI2 A;  4OP8 A;  2IWC A;  4JLF A;  3SH7 A;  3QHY A;  4P85 A;  1H5X A;  5HFO A;  3GVB A;  1L2S A;  3BEC A;  4QHC A;  1NYY A;  3I7J A;  1XGJ A;  5FAQ A;  4PM5 A;  1GHP A;  1RCJ A;  2Z2M B;  3A3E A;  4EV4 A;  4H8R A;  3G31 A;  5GHX A;  1JWV A;  4DE2 A;  4OKP A;  1DJA A;  1BZA A;  3VP0 A;  4DDS A;  1PIO A;  4ZTK A;  1ZKJ A;  1HTZ A;  2OSU A;  3WWX A;  3Q81 A;  1Q2Q A;  3HRE A;  4N92 A;  5E2G A;  1XXM A;  3MZD A;  3IF6 A;  2BG1 A;  4YFM A;  1XGI A;  3FKW A;  1E3U D;  2Y2M A;  3HLC A;  4BJP A;  4NK3 A;  3WS0 A;  2OV5 A;  2H10 A;  3ZG8 B;  3IWQ A;  4E3K A;  5IHV A;  3OPH A;  2Y2L A;  5GLB A;  4U0T A;  1JWP A;  3IT9 A;  3MXS A;  3DTM A;  1ES4 A;  3WS4 A;  5CRF A;  4FH4 A;  1LL9 A;  3BYD A;  4DKI A;  3BEB A;  2EX2 A;  5FI6 A;  4WZ5 C;  4WEL A;  1I2W A;  4ZAM A;  5FDH A;  2DCF A;  3IXB A;  1C3B A;  1QME A;  3AGF A;  2B5R A;  2OLU A;  5AQ7 A;  3ZHH A;  4OOM A;  4E3N A;  4OOL A;  4S2J A;  3HL9 A;  1YLP A;  4E3L A;  1SDE A;  4Y0U A;  1GA0 A;  2RCX A;  4X53 A;  1ERM A;  5GLC A;  4OPQ A;  5KSH A;  4R4S A;  1S6R A;  1BSG A;  2HP5 A;  5GLA A;  1U60 A;  3VFF A;  3VFH A;  3W4Q A;  4DE3 A;  1PYY A;  3UO9 A;  4S2N C;  4DE0 A;  1FR1 A;  3WS5 A;  4PM8 A;  2WKI A;  4GKU A;  1ONG A;  4QD4 A;  3ZG0 A;  4X68 A;  2ZQ8 A;  5FSR A;  2J7V A;  1IKI A;  3ITB A;  3MZF A;  1K25 A;  3GMW A;  3SS4 A;  4B4X A;  1I2S A;  3NI9 A;  1KE4 A;  2HDR A;  4K0X A;  3C5A A;  4OP5 A;  5TFQ A;  1Y54 A;  1NJ4 A;  2XK1 A;  1BUL A;  2A49 A;  1K54 A;  3C7V A;  2UWX A;  5CXW A;  2JE5 A;  3C4O A;  4S2M A;  1MWR A;  1MWS A;  2WGW B;  1WYB A;  4IVI A;  3M2K A;  4IBR A;  4UHU A;  2WKH A;  5AQ9 A;  1GHI A;  4EBP A;  1H8Y A;  1M6K A;  1OME A;  3N8R A;  2A3U A;  4WMC D;  5E2F A;  5EVI B;  3V50 A;  2EFX A;  1FCO A;  4KEN B;  1K4E A;  2ZLY A;  2XD1 A;  3LEZ A;  3CZD A;  4DXC A;  1L0D A;  4GDN A;  5DF7 A;  1CEF A;  1DJC A;  3N8S A;  4R3B A;  5CHM A;  3CG5 A;  3SH9 A;  3UPP A;  4PMA A;  4U0X A;  4GB7 A;  1LLB A;  1MY8 A;  2PBY A;  1LHY A;  5DTK A;  2Y2Q A;  2EFU A;  3VP3 A;  3EQU A;  1IYS A;  3OPR A;  3VOZ A;  3NDE A;  1EWZ A;  1K56 A;  3M6B A;  5CEC A;  4O7D A;  2EXA A;  3HUM A;  3FZC A;  5GHY A;  2R9X A;  5HAQ A;  4RX2 A;  1KDS A;  2ZC4 B;  4JF5 A;  4WZ4 A;  5I94 A;  4KZ5 A;  5A90 A;  3CMZ A;  2EXB A;  1BLS A;  2ZJ9 A;  3A3I A;  4EWF A;  1MPL A;  4UA7 A;  3C4P A;  4KZ3 A;  3ZGA B;  1RGZ A;  2HDQ A;  2XGN A;  5A93 A;  2XF3 A;  3HUN A;  3G32 A;  4X56 A;  2BLS A;  2Q9M A;  1JWZ A;  2Y2H A;  3BM6 A;  1YMX A;  4FD8 A;  2QMI A;  4OLG A;  5DTT A;  2P74 A;  4N1X A;  3WS2 A;  1N4O A;  3UE1 A;  2X71 A;  4S2P A;  4QU3 A;  1K6S A;  3DWZ A;  4Q8I A;  1RP5 A;  5FQK A;  3ZDJ A;  3ZG9 B;  4BQM A;  5J8X A;  1TVF A;  2WGV A;  3EQV A;  5CED A;  3NBL A;  4HBT A;  5HAR A;  3PAG A;  3ZG7 B;  3V5M A;  4KZA A;  1FR6 A;  2WGW A;  3B3X A;  3SS3 A;  1W8Q A;  3BLM A;  4P6B A;  5FAP A;  1YQS A;  3GQZ A;  5FQI A;  4BD1 A;  2IWD A;  4MBH A;  3LO7 A;  3V39 A;  5JYP A;  4WMC A;  4U3T A;  5CHJ A;  1MXO A;  1PI4 A;  2ZMA A;  1W7F A;  2EX8 A;  4R0Q A;  5EVI A;  3VP4 A;  1KVL A;  4R23 A;  4P0M A;  4M3K A;  3ZNY A;  1I5Q A;  4RX3 A;  4Y0T A;  4N1H A;  1CI8 A;  5KMW A;  4DE1 A;  1IYO A;  2HPB A;  3E2K A;  5G18 A;  3MXR A;  5DF9 A;  1LL5 A;  1K55 C;  1PWC A;  2Q9N A;  1YT4 A;  3Q07 A;  2G2U A;  2ZQA A;  5E2H A;  4S2O A;  2PU4 A;  2WKE A;  4ZJ3 A;  3WRT A;  5D3O A;  4D2O A;  4LV0 A;  1HD8 A;  4N9K A;  3UE3 A;  1FCM A;  5M19 A;  3FV7 A;  4BL3 A;  2QPN A;  4QY5 A;  3MZE A;  1TDG A;  2Y59 A;  2XD5 A;  3W4O A;  3IXH A;  1GCE A;  1O7E A;  5FA7 A;  5FAO A;  3IWI A;  3TOI A;  2J9P A;  3GTC A;  3NCK A;  1O07 A;  3CJM A;  4MEZ A;  3VOY A;  1IKG A;  3G2Y A;  3Q7V B;  4HBU A;  5M18 A;  2Y2J A;  3MBZ A;  1PW8 A;  4RYE A;  2HP6 A;  4L0L A;  4R1G A;  1MWU A;  1ES3 A;  3NIA A;  1E4D A;  4GD8 A;  3RXX A;  4LEN A;  4XXR A;  4B88 A;  3GRJ A;  1BLC A;  2JC7 A;  3IH8 A;  3PAE A;  3BFE A;  2J8Y A;  2PU2 A;  3HLW A;  1KGF A;  5HL1 A;  3GV9 A;  1PZP A;  3NDG A;  4A5R A;  2P9V B;  2X02 A;  2Y2G A;  4JKT A;  1NZO A;  2XH9 A;  1BT5 A;  4KG2 A;  2ZQD A;  3RXW A;  5EE8 A;  2WAD A;  1BLH A;  3HLG A;  1FQG A;  3ZG5 A;  3NC8 A;  4ID4 A;  4IED A;  1WYC A;  4LCL A;  1ESI A;  2Z2L B;  4X55 A;  3ISG A;  4E3M A;  4KZ8 A;  3ZFZ A;  1XA1 A;  1K57 A;  3Q7Z A;  3NY4 A;  3BFF A;  4JF6 A;  4MBK A;  1JTD A;  5FAT A;  1E3U A;  1K4F A;  4JPM A;  4OH0 A;  4BD0 A;  4KQO A;  1ERO A;  2Y2O A;  3FKV A;  4OQG A;  1EI5 A;  4GDB A;  3SOI A;  4BEN A;  5BOH A;  1SCW A;  1LI9 A;  3HLE A;  2GDN A;  5DF8 A;  4KZB A;  3C7U A;  4GZB A;  3WS1 A;  1YLT A;  3DW0 A;  4BL2 A;  2DRW A;  4C3Q A;  3IH9 A;  4JF4 A;  3GSG A;  4OON A;  3MFD A;  1XKZ A;  4P87 A;  3VMA A;  2ZC6 B;  5GLD A;  1FSY A;  1YLZ A;  2WGI A;  1TEM A;  3N7W A;  5FAS A;  2JCH A;  1ZG4 A;  3VSK A;  1KDW A;  2WYX A;  4UAA A;  3G34 A;  1QMF A;  4UA6 A;  2WAF A;  1BTL A;  1SHV A;  4DF6 A;  2HP9 A;  1KVM A;  1L0F A;  4S2N A;  4C6Y A;  1GA9 A;  4EBN A;  1YM1 A;  3OCL A;  5EVI C;  1XP4 A;  4CJN A;  4Z9Q A;  1YLY A;  2DNS A;  3HLD A;  4X69 A;  5FQQ A;  2XDM A;  3IF5 A;  1W8Y A;  3P98 A;  4Y7P A;  5F1F A;  1L0E A;  3PBO A;  5F1G A;  2C6W B;  2P9V A;  4YIN A;  2X01 A;  3DWK A;  4PM7 A;  4LV3 A;  4K91 A;  3ZVW A;  3IF6 C;  3G4P A;  5FQJ A;  4PM9 A;  3A3D A;  3ITA A;  3AGE A;  5M1A A;  2QZ6 A;  4IVK A;  1L0G A;  3S22 A;  1ONH A;  1XA7 A;  2EX9 A;  3UDI A;  3BFC A;  1MBL A;  3HLF A;  2Y2K A;  4DRT A;  3UN7 A;  4IBX A;  4WBG A;  4R4R A;  3ZCZ A;  5JYO A;  4WEJ A;  3FYZ A;  4QJG A;  2ZM8 A;  1W5D A;  3HBR A;  2Y91 A;  3UDF A;  1XPB A;  2XFT A;  2I72 A;  1SDN A;  2VGJ A;  4X6T A;  3OCN A;  3BFD A;  1W79 A;  3M6H A;  3A3F A;  4HEF A;  1YLW A;  3PBS A;  5CHU A;  3UY6 A;  3QNB A;  1NZU A;  4KG6 A;  1VM1 A;  1KE3 A;  3W8K A;  4KZ4 A;  3W4P A;  1HVB A;  4OPR A;  1K6R A;  2WK0 A;  1KE0 A;  1ERQ A;  1NRF A;  4QY6 A;  4KZ7 A;  4CPK A;  2IWB A;  1SKF A;  4UA9 A;  1ES5 A;  3UPN A;  5F82 A;  3ZVT A;  2G2W A;  3OPP A;  5HAI A;  3QNC A;  2Y2N A;  3WRZ A;  4E6X A;  1H8Z A;  3N6I A;  1XX2 A;  3ZNT A;  5EOO A;  1BLP A;  4R3J A;  4GN2 A;  1BUE A;  4KQQ A;  3P09 A;  4OQI A;  3VP1 A;  2XR0 A;  3G30 A;  5CGW A;  2XLN A;  4WEK A;  2Y55 A;  5DVA A;  3TSG A;  1K54 C;  5A92 A;  1PI5 A;  5EVL A;  4KQR A;  2V2F F;  5AQA A;  3PBQ A;  1K57 C;  1S0W A;  1YMS A;  3IHB A;  4WM9 A;  3UDX A;  3OZH A;  5CEB A;  1VQQ A;  1G68 A;  1E25 A;  1YLJ A;  1ZC2 A;  3VSL A;  1JVJ A;  4WYY A;  4K0W A;  4Y0O A;  1M40 A;  1ALQ A;  3RJU A;  4B4Z A;  1ES2 A;  5TR7 A;  1NYM A;  2C5W B;  4QB8 A;  4S2K A;  1AXB A;  5E2E A;  3BRM A;  3AGD A;  3O88 A;  4OVD A;  1LI0 A;  2JBF A;  3GR2 A;  4MLL A;  5GHZ A;  4XUZ A;  2J9O A;  5DTS A;  1PW1 A;  4HES A;  5CGX A;  4LV2 A;  2R9W A;  1FOF A;  2H0Y A;  3N8L A;  1K38 A;  1K56 D;  2RL3 A;  4GOG A;  1MWT A;  1IYQ A;  3O86 A;  3OC2 A;  3LY4 A;  1KGE A;  2Y4A A;  3IXD A;  2FFF B;  4JXS A;  4E6W A;  4C75 A;  3A3J A;  4JBF A;  4EQI A;  1K55 A;  5CTN A;  4GD6 A;  2VGK A;  4GNU A;  3M2J A;  3LCE A;  4S2I A;  3FWL A;  5FQM A;  1ESU A;  3OPL A;  3Q1F A;  3BFG A;  4NET A;  5L2F A;  2ZM0 A;  4F94 A;  5F83 A;  1IYP A;  1DJB A;  3N4I A;  4KZ6 A;  2H0T A;  3IQA A;  3BLS A;  4WZ5 A;  3V3R A;  1ZG6 A;  3VP2 A;  4KZ9 A;  4OOY A;  4PM6 A;  5GL9 A;  5HW3 A;  5EEC A;  2V1Z A;  4MBF A;  3Q82 A;  2HDS A;  1CI9 A;  5AQB A;  5HAP A;  4OPY A;  5EOE A;  1G6A A;  4JXW A;  3S1Y A;  5U47 A;  4E3O A;  3HVF A;  4EUZ A;  2XQZ A;  2Y2P A;  2ZC7 A;  1TDL A;  4ZDX A;  3UPO A;  3UE0 A;  3E2L A;  3IHA A;  4JXG A;  3O87 A;  2Y2I A;  3JYI A;  4DXB A;  1KGG A;  5EVI D;  4RA7 A;  1PWD A;  1WE4 A;  5EPH A;  3MKE A;  3G2Z A;  2WUQ A;  3Q7V A;  2FFY A;  4FCF A;  3LY3 A;  5FQ9 A;  3D4F A;  4OQ0 A;  4ZBE A;  2XFS A;  1DY6 A;  4FH2 A;  4MNR A;  4KG5 A;  1Q2P A;  3HLB A;  3IF6 B;  2OLV A;  1IEL A;  2V20 A;  2ZM2 A;  4S2L A;  4FSF A;  4ZJ1 A;  2E8I A;  2H5S A;  4ZJ2 A;  4LCM A; 
#chains in the Genus database with same CATH topology
 2LB5 A;  2XEP A;  1FSW A;  1IEM A;  3S4X A;  2ZQC A;  4UQI S;  3H82 A;  4EBL A;  3IWO A;  3KSG A;  4XUX A;  3SS5 A;  3G6O A;  1DP9 A;  1FCN A;  3KX0 X;  3UNW A;  3EOI A;  2B18 A;  3EEA A;  3G35 A;  5CER A;  2ZC5 B;  1GSV A;  2YKF A;  3LR0 A;  3PBN A;  1T18 A;  4OLD A;  5EUA A;  5EM1 A;  3SW1 A;  4RRJ A;  2IWC A;  4JLF A;  3O5Y A;  4XT2 A;  1NYY A;  3I7J A;  3CIT A;  2W1T B;  5GHX A;  1JWV A;  4GLQ A;  2OSU A;  5L09 A;  3BWL A;  3Q81 A;  1Q2Q A;  4KUO A;  5HL6 A;  5HSQ A;  2I9V A;  3HLC A;  5HWW A;  3IX3 A;  4E04 A;  4CLC A;  2OV5 A;  2H10 A;  2GZA A;  3OPH A;  4U0T A;  1JWP A;  3NOU C;  3WS4 A;  4FH4 A;  4DKI A;  3BEB A;  4WZ5 C;  3K2N A;  1C3B A;  1QME A;  3AGF A;  2OLU A;  1TS8 A;  2W3D A;  3HL9 A;  3KSI A;  4Y0U A;  2RCX A;  4OPQ A;  3A0S A;  2PDR A;  1OTD A;  2HP5 A;  3VFF A;  3VFH A;  3S7O A;  4PM8 A;  1VET B;  4B9O A;  4GKU A;  4G3V A;  3VOL A;  3ZG0 A;  2ZQ8 A;  5FSR A;  1IKI A;  3C5A A;  2XK1 A;  1K54 A;  2UV0 E;  4ESP A;  4II7 A;  4S2M A;  2HL2 A;  4UHU A;  5AQ9 A;  1H8Y A;  1M6K A;  4M4X A;  2KOI A;  3HJI A;  3NOP C;  3LEZ A;  2XA7 M;  2CMN A;  3LIF A;  3N8S A;  5CHM A;  3CG5 A;  3SH9 A;  1S67 L;  2W3E A;  5DTK A;  1S1Y A;  3E0Y A;  3BY9 A;  1K56 A;  2JN7 A;  4RX2 A;  3CWF A;  4KZ5 A;  3TRC A;  4S02 A;  1KOU A;  1MPL A;  4UA7 A;  5TBM A;  3ZGA B;  4RRH A;  2BLS A;  2Q9M A;  4I5S A;  4EER A;  3T4T A;  2QMI A;  3ZQ5 A;  3WS2 A;  1P0Z A;  2R78 A;  3UE1 A;  2X71 A;  4HNB A;  3DWZ A;  4Q8I A;  5FQK A;  5F6A A;  3EQV A;  5HDD A;  2W1R A;  4EEU A;  4HBT A;  4P6Z M;  3V5M A;  3B3X A;  1J7G A;  4ETX A;  1YQS A;  5FQI A;  3LO7 A;  5JYP A;  4NXF A;  1MXO A;  3VP4 A;  4R0Q A;  1KVL A;  3UB6 A;  1I5Q A;  3UB9 A;  4RX3 A;  4Y0T A;  1CI8 A;  4LGW A;  3D72 A;  1LL5 A;  1YT4 A;  2G2U A;  2OAQ 1;  3LYX A;  2PU4 A;  5HPI A;  1HD8 A;  4N9K A;  5M19 A;  4BL3 A;  5FAO A;  4QWO A;  1IKG A;  4AFI A;  3RXX A;  3GRJ A;  1D7E A;  2JC7 A;  2PU2 A;  3QP2 A;  3GV9 A;  4HY8 A;  2ZL1 B;  2P9V B;  2Y2G A;  1NZO A;  1BT5 A;  2FZ0 A;  2WAD A;  5EE8 A;  3LGO A;  4R38 A;  4HIA A;  3OLO A;  4RRD A;  4UQI M;  4GJ4 A;  4KZ8 A;  3Q7Z A;  1K57 A;  1XFN A;  4DMZ A;  5FAT A;  1E3U A;  1K4F A;  3KOB A;  4YWZ A;  4Y2F A;  2Y2O A;  1LI9 A;  2GDN A;  1YLT A;  4C3Q A;  3VE4 A;  3P7N A;  3MFD A;  5F69 A;  4R70 A;  1FSY A;  2WGI A;  3N7W A;  4Q0J A;  2WYX A;  2A24 B;  1YSP A;  1BTL A;  3KO7 A;  4EBN A;  3BW6 A;  1YPR A;  3OCL A;  2Y8H A;  3HLD A;  4HHD A;  2ACG A;  1W8Y A;  4Y7P A;  5F1F A;  1L0E A;  3DWK A;  4PM7 A;  4EXO A;  4K91 A;  3G4P A;  4S0J A;  4PM9 A;  5DJU A;  4CLC C;  1CQA A;  1L0G A;  1OJ5 A;  1ONH A;  2W3H A;  3UDI A;  3F1N B;  1UGU A;  4UEY A;  4BBU A;  3UN7 A;  3CAX A;  4L9F A;  4IBX A;  4R4R A;  3ZCZ A;  5JYO A;  3FYZ A;  4QJG A;  3DAV A;  2Y91 A;  1V9Y A;  2XFT A;  4RR9 A;  1TS6 A;  1W79 A;  3MQQ A;  4HEF A;  5A8B A;  4WF0 A;  1KE3 A;  2VGL S;  2WK0 A;  1ERQ A;  1NRF A;  4KZ7 A;  4PKY A;  4RRC A;  5F82 A;  1XFQ A;  2HL1 A;  2VZW A;  5HAI A;  2Y2N A;  4E6X A;  3N6I A;  4RRI A;  5EOO A;  4LFU A;  1BLP A;  1BYW A;  4R3J A;  1P9W A;  1BUE A;  3IBJ A;  4NEE D;  3VP1 A;  4NBJ A;  5DVA A;  2XR0 A;  3G30 A;  5CGW A;  3TSG A;  1K54 C;  5EVL A;  1V9Z A;  1P9R A;  3PBQ A;  1S0W A;  3UDX A;  4RR6 A;  3OZH A;  1VQQ A;  1ZC2 A;  3PD3 A;  4WYY A;  4K0W A;  4Y0O A;  1WA9 A;  1ES2 A;  1NWZ A;  3R7W B;  4QB8 A;  3O88 A;  2H0Y A;  2V8C A;  3KNP A;  4BWI A;  2RL3 A;  4GOG A;  1MWT A;  3O86 A;  3OC2 A;  3LY4 A;  2Y4A A;  2FFF B;  4E6W A;  1N9O A;  3UB5 P;  4GD6 A;  2VGK A;  3KO9 A;  2B95 A;  3LCE A;  1UWN X;  1ESU A;  2JKT M;  3BFG A;  4NET A;  3N4I A;  1DJB A;  4WZ5 A;  3VP2 A;  1TC5 A;  5HW3 A;  4Z1W A;  2V1B A;  4RR7 A;  1CI9 A;  4IUK A;  5EOE A;  4JXW A;  3W2Z A;  5U47 A;  4Y13 A;  2P04 A;  3UPO A;  3UE0 A;  3IHA A;  3O87 A;  1KGG A;  2W27 A;  1PNE A;  1PWD A;  1WE4 A;  2Y79 A;  3L9K A;  2JHE A;  2V1A A;  2WUQ A;  3LMV A;  3T4J A;  3LY3 A;  2PHY A;  5FQ9 A;  4MN5 A;  1TS7 A;  4MNR A;  4CLC E;  4KG5 A;  1DP8 A;  4S2L A;  4FOF A;  4ZJ1 A;  3LMT A;  2VK3 A;  1EW0 A;  4ZJ2 A;  2EX6 A;  1J9M A;  5KZH A;  5DKL A;  2ZMV A;  4GS9 A;  3T4L A;  5CTM A;  3C2W A;  4BLM A;  2HDU A;  2WAE A;  5FI7 A;  4PAU A;  3BY8 A;  1GSX A;  3O3V A;  1PWG A;  2CC1 A;  5FI2 A;  4OP8 A;  1YSQ A;  1H5X A;  5HFO A;  4PM5 A;  4QHC A;  2Z2M B;  1RCJ A;  3A0V A;  3QP5 A;  4DDS A;  3WWX A;  4R3A A;  4N92 A;  1IOU A;  4HJ6 A;  1XXM A;  3MZD A;  3IF6 A;  4YFM A;  4IHQ A;  1XGI A;  3FKW A;  2Y2M A;  2H28 A;  2P7J A;  2O0Y A;  4RRL A;  3IWQ A;  5HWT A;  4E3K A;  5IHV A;  3IT9 A;  1ES4 A;  1LL9 A;  3BYD A;  3MJQ A;  4ZAM A;  5FDH A;  3ZHH A;  5AQ7 A;  2B5R A;  3MFX A;  3DTE A;  2V9A A;  1XJ2 A;  4NKP A;  5KSH A;  4PKY G;  1S6R A;  1OT9 A;  1H3Q A;  1U60 A;  3W4Q A;  2JKF A;  1PYY A;  3WS5 A;  2XRN A;  4QD4 A;  2O9A A;  3ITB A;  3MZF A;  3SS4 A;  1DP6 A;  4B4X A;  2V0W A;  3IX4 A;  2HDR A;  2W1T A;  2ZOH A;  3F1P A;  1NJ4 A;  2OAP 1;  3DTK A;  2WGW B;  4S0I A;  3M2K A;  2WKH A;  3OBF A;  1GHI A;  2QJ7 A;  5EV0 A;  5E2F A;  3V50 A;  2J3W A;  2EFX A;  4KEN B;  3KO3 A;  2XD1 A;  3CZD A;  5DF7 A;  4WN5 A;  3ULF A;  2VA0 A;  3MXQ A;  4PMA A;  4U0X A;  2PBY A;  2EWW A;  3LIA A;  4HP9 A;  3IX8 A;  3HUM A;  4JGR A;  2R9X A;  1KDS A;  2ZC4 B;  4I3A A;  4JF5 A;  3FPW A;  3CMZ A;  3A3I A;  1BLS A;  4X25 A;  4KZ3 A;  1FIL A;  1RGZ A;  2XF3 A;  3CI6 A;  2Y2H A;  3BM6 A;  2KDK A;  1VET A;  4EW7 A;  1JNU A;  1FIK A;  2PAV P;  4S2P A;  1RP5 A;  5J61 A;  4ETZ A;  3LMU A;  5CED A;  2NUP C;  5HAR A;  2Z6D A;  3PAG A;  4KZA A;  1FR6 A;  3CLO A;  4BD1 A;  2KX6 A;  5CHJ A;  4U3T A;  1PI4 A;  2EX8 A;  4FTX A;  4R23 A;  4F3L B;  3ZNY A;  4EEP A;  4N1H A;  4RRQ A;  5HD5 A;  4DE1 A;  3E2K A;  3PD4 A;  3MXR A;  5DF9 A;  1AWI A;  1NLY A;  2ZQA A;  2WKE A;  3K3C A;  3WRT A;  4D2O A;  1T1B A;  3T4Q A;  3UE3 A;  4RRF A;  1FCM A;  3MZE A;  1TDG A;  2Y59 A;  3W4O A;  2VV7 A;  4LRX C;  3IWI A;  3TOI A;  3NCK A;  1O07 A;  4MEZ A;  3Q7V B;  5M18 A;  4RYE A;  2HP6 A;  4PHT A;  4R1G A;  3B47 A;  4NXG A;  1ES3 A;  4XXR A;  4B88 A;  2HGV A;  2Q0O A;  3PAE A;  3BFE A;  3HLW A;  3KO4 A;  5HL1 A;  4A5R A;  2X02 A;  2M7U A;  3RXW A;  2HF6 A;  3HLG A;  3MS6 A;  4E3M A;  4MBK A;  4I3J A;  4JPM A;  1W63 M;  4OH0 A;  1ERO A;  4R6L A;  3JVU A;  4GDB A;  3SOI A;  2DBO A;  2INW A;  5AVF A;  5DF8 A;  4KZB A;  3C7U A;  4RRM A;  3WS1 A;  2WKP A;  2K31 A;  4JF4 A;  3GSG A;  4P87 A;  5DJT A;  5GLD A;  2JCH A;  3VSK A;  4WL9 A;  4YNR A;  2EA9 A;  5HD3 A;  4S2N A;  4LRZ E;  1YKD A;  2DNS A;  3KYQ A;  2ZL1 A;  2P9V A;  4YIN A;  3IF6 C;  3CPT B;  4IJG A;  3A3D A;  3ITA A;  3AGE A;  4S03 A;  3S22 A;  2PYP A;  2EX9 A;  5DFY A;  3TE8 A;  4WBG A;  5G4Z A;  4WEJ A;  3E4Q A;  3HBR A;  1XPB A;  5L10 A;  3PR6 A;  2VGJ A;  3OCN A;  3BFD A;  3PXP A;  5CHU A;  1YLW A;  3PBS A;  3QNB A;  4HJ3 A;  2QHK A;  5FEG A;  1NZU A;  1F9I A;  1VM1 A;  4KZ4 A;  3HCY A;  4QY6 A;  1Y4O A;  1ES5 A;  3U4L P;  3UPN A;  2G2W A;  2A24 A;  3QNC A;  4Y3I A;  4OQI A;  1CF0 A;  4ARZ A;  5A92 A;  2ZBB A;  5AQA A;  3IHB A;  1F2K A;  1E25 A;  3BQ8 A;  5TR7 A;  4S2K A;  3F1N A;  4KQD A;  3GR2 A;  2J9O A;  1PW1 A;  2R9W A;  1FOF A;  3MF0 A;  2HKZ A;  1X0O A;  1KGE A;  3S7Q A;  1LSW A;  5FQM A;  2K7S A;  2WKR A;  3MR0 A;  5L2F A;  4F94 A;  5F83 A;  4KZ6 A;  2H0T A;  2A2L A;  1VHM A;  1S1Z A;  4PM6 A;  2V1Z A;  4MBF A;  3Q82 A;  2HDS A;  5AQB A;  5HAP A;  1G6A A;  3S1Y A;  2V8F A;  4ZDX A;  3E2L A;  2Y2I A;  3JYI A;  4RRK A;  5EVI D;  4JGO A;  5HWV A;  3MKE A;  2FFY A;  3RH8 B;  3R4K A;  3PHY A;  4ZBE A;  2XFS A;  4FH2 A;  3H9W A;  5L07 A;  3HLB A;  3NUL A;  1IEL A;  3LR4 A;  4FSF A;  2ZOI A;  3PBT A;  1LSX A;  3HUO A;  4PPR A;  2ZQ9 A;  3EWK A;  3PBR A;  3TG9 A;  5DFX A;  5A91 A;  4G3K A;  3UMD A;  1CEG A;  1OTB A;  4RRG A;  2O99 A;  3PTE A;  3V3S A;  1GHM A;  4N9L A;  4LV1 A;  5CGS A;  5HX9 A;  4E3I A;  4RVA A;  1HZO A;  4RRA A;  3IXG A;  1RGY A;  4O8G A;  4WUJ A;  5HPF A;  3SH7 A;  3KOD A;  3EEH A;  4P85 A;  3GVB A;  1A0K A;  3BEC A;  2HZ5 A;  4FUW A;  1XGJ A;  4H8R A;  3G31 A;  4G3W A;  3LR3 A;  4DE2 A;  4OKP A;  1DJA A;  5AJG A;  1BZA A;  1ZKJ A;  2VJW A;  5E2G A;  3HRE A;  4QPR A;  2BG1 A;  3L7H A;  1K0K A;  4BJP A;  4NK3 A;  3IS2 B;  4KUK A;  3ZG8 B;  2Y2L A;  5GLB A;  3DBA A;  3DTM A;  4WEL A;  3JVV A;  1XJ6 A;  2DCF A;  3GDI A;  2VX8 A;  4E3N A;  4OOL A;  4S2J A;  2PR6 A;  4X53 A;  1ERM A;  1LL8 A;  3H7W B;  4R4S A;  4DE3 A;  5LBR A;  1CJF A;  3UO9 A;  4L9E A;  2PD7 A;  4S2N C;  4DE0 A;  3UE6 A;  1FR1 A;  2OKV A;  1OT6 A;  2WKI A;  1ONG A;  3D3O A;  3LI8 A;  4X68 A;  2J7V A;  4H6J A;  4HOI A;  3T4O A;  1K25 A;  3CUE A;  3RTY A;  1I2S A;  1PFL A;  1KE4 A;  4K0X A;  1VEU B;  1Y54 A;  2M1C A;  1BUL A;  4HQA A;  3C4O A;  1MWR A;  4IVI A;  4IBR A;  2W3F A;  4I3I A;  4EBP A;  5J3W A;  4WMC D;  5EVI B;  1FCO A;  4I39 A;  1K4E A;  2VEA A;  1L0D A;  4GDN A;  2G7U A;  1DJC A;  1G28 A;  4R3B A;  3UPP A;  3KNF A;  1MY8 A;  1SKO A;  2JKG A;  2Y2Q A;  5J4E A;  2EFU A;  1N9L A;  3EQU A;  3M6B A;  5CEC A;  3LID A;  2VLG A;  4WZ4 A;  3PYP A;  4Y17 A;  3K3D A;  3KYZ A;  2PR5 A;  1L3L A;  2XSS A;  2HDQ A;  5A93 A;  4X56 A;  3G32 A;  4EU0 A;  1JWZ A;  1YMX A;  4OLG A;  3U2A A;  2P74 A;  4N1X A;  5IU1 A;  4QU3 A;  1K6S A;  3ZDJ A;  3ZG9 B;  4BQM A;  2M7V A;  1TVF A;  2WGV A;  4GHI B;  3NBL A;  1T1C A;  2Z6C A;  2WGW A;  1W8Q A;  3BLM A;  2JKR I;  4P6B A;  5FAP A;  3RFB A;  1MKM A;  3V39 A;  4WMC A;  2B02 A;  1OTE A;  2XA7 S;  3GEC A;  2PT7 A;  3SZT A;  2D01 A;  4NXB A;  3QP6 A;  5G18 A;  4JGQ A;  1PWC A;  2Q9N A;  3Q07 A;  4S2O A;  2QKP A;  4Q0I A;  5D3O A;  2DMW A;  1OPX A;  4EUV A;  4MN6 A;  3FV7 A;  3KOC A;  3E98 A;  4QY5 A;  2XD5 A;  1J3W A;  5FA7 A;  2OOL A;  3LIE A;  4RRB A;  3CJM A;  3VOY A;  4HBU A;  2Y2J A;  3MBZ A;  3OOV A;  1NRJ A;  1PW8 A;  4IUH A;  3MMH A;  4L0L A;  4HH3 A;  3NIA A;  2ZMF A;  4BBT A;  3IH8 A;  4P6Z S;  1OTI A;  3NDG A;  1Y28 A;  4JKT A;  2ZQD A;  3UB8 A;  1BLH A;  3QP1 A;  5G4Y A;  2BAS A;  1FQG A;  3ZG5 A;  1IFQ A;  4F3L A;  4X55 A;  3ISG A;  3NY4 A;  1W63 Q;  3BFF A;  3FG8 A;  4JF6 A;  2PRF A;  1S4S A;  1JTD A;  4KQO A;  4OQG A;  1EI5 A;  4BEN A;  1F98 A;  4RRR A;  3NHQ A;  3HLE A;  4GZB A;  3DW0 A;  2DRW A;  4MN7 A;  2KLI A;  3NEC A;  2VGL M;  3MQ0 A;  4OON A;  2J3T D;  1XKZ A;  1YLZ A;  1TEM A;  5FAS A;  1ZG4 A;  5AVE A;  1QMF A;  2XRO A;  4UA6 A;  1SHV A;  2HP9 A;  1L0F A;  3UME A;  2WKQ A;  5EVI C;  4CJN A;  4Z9Q A;  1YLY A;  4X69 A;  5FQQ A;  2XDM A;  4CLC D;  3P98 A;  3KO6 A;  3PBO A;  5F1G A;  2C6W B;  2L0W A;  2X01 A;  4NBI A;  3HJK A;  1XA7 A;  3NOT C;  2JKR M;  5L8M A;  1MBL A;  3HLF A;  2Y2K A;  4DJ2 A;  4DRT A;  5F68 A;  3T4K A;  3FPV A;  5TJJ A;  3QP4 A;  2ZM8 A;  3UDF A;  3VV4 A;  2I72 A;  1SDN A;  1G6O A;  3M6H A;  3UY6 A;  2IA2 A;  4OPR A;  5FL3 A;  2GNX A;  1T1A A;  5DKK A;  1ZHH B;  3MSH A;  3ZVT A;  3F1O B;  3CHW P;  3OPP A;  2OWJ A;  2LB9 A;  3F1P B;  3WRZ A;  2L4R A;  1H8Z A;  3CUE C;  3ZNT A;  4GN2 A;  5C5K A;  3P09 A;  2BTF P;  4WEK A;  2Y55 A;  4KQR A;  2V2F F;  5CEB A;  2W0N A;  1G68 A;  1YLJ A;  4GW9 A;  1JVJ A;  3CPT A;  2NUT C;  5MC7 A;  2C5W B;  5E2E A;  3BRM A;  1LSV A;  3AGD A;  4OVD A;  1LI0 A;  5GHZ A;  3LFV A;  4XUZ A;  4GCZ A;  5CGX A;  1K56 D;  1IYQ A;  4MMN A;  5CX7 A;  4JXS A;  4C75 A;  4L9G A;  3H82 B;  4EQI A;  1K55 A;  1T19 A;  3M2J A;  5J7E A;  2P08 A;  4KZ9 A;  5GL9 A;  5EEC A;  1S66 L;  4OPY A;  2O9B A;  4EUZ A;  4E3O A;  2XQZ A;  2Y2P A;  2ZC7 A;  1TDL A;  4XT2 B;  1F5M A;  4RA7 A;  2PBD P;  3G2Z A;  4FCF A;  3S7P A;  3D4F A;  1DY6 A;  2QYB A;  1Q2P A;  2OLV A;  2V20 A;  2W3G A;  4Y15 A;  3UB7 A;  4CLC B;  2H5S A;  4LCM A;  4HH2 A;  1Z6F A;  2O9C A;  5E43 A;  5TGF A;  2ZC3 B;  1MKI A;  3C8C A;  1PZO A;  1NY0 A;  1N9B A;  4OPZ A;  2ZQ7 A;  3MKF A;  4O0P A;  1JTG A;  5KSC A;  1P97 A;  4DDY A;  4OQH A;  2VV8 A;  2WZZ A;  2ZD8 A;  4JXV A;  1NXY A;  4RQ9 A;  2WZX A;  4E3J A;  1JKE A;  4JGP A;  3SH8 A;  1CK3 A;  3LIC A;  2E8J A;  3QHY A;  4DN0 A;  1L2S A;  5FAQ A;  1GHP A;  3A3E A;  4D60 A;  4EV4 A;  5F5Y A;  2PD8 A;  1OTA A;  4LPZ A;  4B93 A;  3VP0 A;  1PIO A;  4ZRR A;  4ZTK A;  1HTZ A;  3JPU A;  3EGX C;  1E3U D;  3E4P A;  3WS0 A;  4X1M A;  4HJ4 A;  2GJ3 A;  3MXS A;  5CRF A;  1OJG A;  2EX2 A;  5FI6 A;  1I2W A;  3IXB A;  4X1L A;  1S4R A;  4OOM A;  3BQA A;  4E3L A;  1YLP A;  1SDE A;  1GA0 A;  4ME4 A;  5GLC A;  1DRM A;  3T50 A;  1NLZ A;  3QP8 A;  4S0L A;  1BSG A;  5TBM B;  5GLA A;  2QWS A;  3LI9 A;  5EM0 A;  3D9Y A;  4NXE A;  3GMW A;  2FH5 A;  3T12 B;  4DJ3 A;  3NI9 A;  1VB6 A;  4CQH A;  4OP5 A;  5TFQ A;  2K2N A;  2A49 A;  3C7V A;  5CXW A;  2UWX A;  5KIZ A;  2JE5 A;  1MWS A;  1WYB A;  2GX5 A;  1OME A;  3N8R A;  5EVE A;  2A3U A;  3IS2 A;  2ZLY A;  2JKT I;  4DXC A;  5IT5 A;  1N9N A;  1CEF A;  3EGD C;  3C38 A;  3R7W A;  5FEF A;  3V67 A;  4GB7 A;  1LLB A;  1LHY A;  3E4O A;  1H8M A;  3VP3 A;  1IYS A;  2MJ6 A;  3OPR A;  3NDE A;  1EWZ A;  3VOZ A;  4O7D A;  2EXA A;  2J3T C;  3FZC A;  5GHY A;  5HAQ A;  1G5U A;  5I94 A;  5A90 A;  3H7W A;  2EXB A;  2ZJ9 A;  4EWF A;  5HZH A;  3C4P A;  3T1S A;  1PRQ A;  2XGN A;  4ARZ B;  2EWV A;  3LIB A;  3HUN A;  1TF1 A;  4HI4 A;  3T4S A;  4FD8 A;  5DTT A;  1N4O A;  3T1R A;  5J8X A;  1XJ4 A;  4MDZ A;  1VEU A;  3ZG7 B;  3SS3 A;  3GQZ A;  2IWD A;  4MBH A;  3LR5 A;  5EVI A;  2ZMA A;  1W7F A;  1UWP X;  2L1M A;  4P0M A;  4M3K A;  3ICY A;  5KMW A;  3T1Q B;  1IYO A;  2HPB A;  1K55 C;  5E2H A;  4EET B;  4ZJ3 A;  4LV0 A;  3KSF A;  3T1X A;  2PYR A;  1LT0 A;  1Z09 A;  2QPN A;  1YAX A;  4Q0H A;  3IXH A;  1GCE A;  1O7E A;  4I38 A;  2J9P A;  3GTC A;  1MZU A;  3G2Y A;  3PD2 A;  1MWU A;  1E4D A;  4GD8 A;  4LEN A;  1BLC A;  5I5L A;  2J8Y A;  4GHI A;  1KGF A;  1PZP A;  4LLO B;  1Y2Q A;  2XH9 A;  4KG2 A;  3NC8 A;  1ZTU A;  4ID4 A;  4IED A;  1WYC A;  4LCL A;  1ESI A;  2Z2L B;  1GSW A;  3ZFZ A;  1XA1 A;  4BD0 A;  3KYE A;  3LEQ A;  3FKV A;  4EQ1 A;  1STZ A;  5BOH A;  1SCW A;  3VE3 A;  1ACF A;  2OWH A;  3KO5 A;  4BL2 A;  1SZV A;  3IH9 A;  3VMA A;  2HJ9 C;  2ZC6 B;  1KDW A;  4RR8 A;  4UAA A;  3G34 A;  5HDC A;  3BJN A;  2WAF A;  4K08 A;  4DF6 A;  1KVM A;  4C6Y A;  1GA9 A;  1YM1 A;  1XP4 A;  1HLU P;  3IF5 A;  3C30 A;  2HV1 A;  4LV3 A;  1XJ3 A;  3ZVW A;  5FQJ A;  3PD5 A;  3B42 A;  2AVX A;  2QZ6 A;  4IVK A;  5M1A A;  3BFC A;  3S7N A;  4YOF A;  3LUQ A;  1W5D A;  4X6T A;  3A3F A;  1D06 A;  3TJZ C;  4KG6 A;  1ODV A;  3W8K A;  4EES A;  3A0R A;  3W4P A;  1HVB A;  1TS0 A;  1K6R A;  4H6J B;  1KE0 A;  2HJE A;  4CPK A;  2IWB A;  1SKF A;  2VKS A;  4UA9 A;  3DTI A;  4BBV A;  1XX2 A;  1D1J A;  3TW8 A;  4KQQ A;  2XLN A;  3IBR A;  5HDS A;  1PI5 A;  4HP4 A;  4LRY C;  2HL0 A;  1K57 C;  2J80 A;  1YMS A;  4WM9 A;  3VSL A;  3ZYT A;  1H0M A;  1M40 A;  1ALQ A;  3RJU A;  4B4Z A;  2D02 A;  1NYM A;  5K5B A;  1AXB A;  5IS1 A;  1SKO B;  3NJA A;  2JBF A;  4MLL A;  4BMW A;  2VV6 A;  5DTS A;  4HES A;  4LV2 A;  4MCW A;  3N8L A;  1K38 A;  3IXD A;  3A3J A;  5FDS A;  4JBF A;  4GS9 B;  1MC0 A;  5CTN A;  4GNU A;  4S2I A;  3FWL A;  3P01 A;  3OPL A;  3Q1F A;  2QJ5 A;  3FC7 A;  2ZM0 A;  4WLA A;  1IYP A;  3IQA A;  4O01 A;  3BLS A;  2YKH A;  3V3R A;  1ZG6 A;  4OOY A;  3F1O A;  5EFW A;  3HVF A;  4Y5F A;  4JXG A;  4DXB A;  5EPH A;  3Q7V A;  1TD5 A;  4S0K A;  4OQ0 A;  4NG2 A;  3IF6 B;  3KSH A;  2ZM2 A;  2V0U A;  3B33 A;  2E8I A;  3MQO A; 
#chains in the Genus database with same CATH homology
 2EX6 A;  1Z6F A;  2XEP A;  3PBT A;  5E43 A;  1FSW A;  1IEM A;  5TGF A;  1J9M A;  2ZC3 B;  1MKI A;  3HUO A;  5KZH A;  1PZO A;  1NY0 A;  1N9B A;  4OPZ A;  4PPR A;  3S4X A;  2ZQ7 A;  2ZQC A;  3MKF A;  1JTG A;  2ZQ9 A;  3PBR A;  3TG9 A;  5KSC A;  4EBL A;  3IWO A;  5CTM A;  5A91 A;  4XUX A;  4BLM A;  3SS5 A;  4DDY A;  4OQH A;  1CEG A;  2HDU A;  1FCN A;  3UNW A;  4RRG A;  2WZZ A;  2ZD8 A;  3PTE A;  3V3S A;  1GHM A;  4JXV A;  4N9L A;  2WAE A;  3G35 A;  4LV1 A;  5CGS A;  1NXY A;  5FI7 A;  2WZX A;  5HX9 A;  5CER A;  2ZC5 B;  4E3I A;  4RVA A;  4E3J A;  1HZO A;  4RRA A;  3IXG A;  3PBN A;  3O3V A;  1JKE A;  1PWG A;  4OLD A;  3SH8 A;  1RGY A;  5EUA A;  1CK3 A;  2CC1 A;  5FI2 A;  4OP8 A;  2IWC A;  4RRJ A;  4JLF A;  3SH7 A;  3QHY A;  3KOD A;  4P85 A;  1H5X A;  5HFO A;  3GVB A;  1L2S A;  3BEC A;  4QHC A;  1NYY A;  3I7J A;  1XGJ A;  5FAQ A;  4PM5 A;  1GHP A;  1RCJ A;  2Z2M B;  3A3E A;  4EV4 A;  4H8R A;  3G31 A;  5GHX A;  1JWV A;  4DE2 A;  4OKP A;  1DJA A;  1BZA A;  3VP0 A;  4DDS A;  1PIO A;  4ZTK A;  1ZKJ A;  1HTZ A;  2OSU A;  3WWX A;  3Q81 A;  1Q2Q A;  3HRE A;  4N92 A;  5E2G A;  1XXM A;  3MZD A;  3IF6 A;  2BG1 A;  4YFM A;  1XGI A;  3FKW A;  1E3U D;  2Y2M A;  3HLC A;  4BJP A;  4NK3 A;  3WS0 A;  2OV5 A;  2H10 A;  3ZG8 B;  3IWQ A;  4RRL A;  4E3K A;  5IHV A;  3OPH A;  2Y2L A;  5GLB A;  4U0T A;  1JWP A;  3IT9 A;  3MXS A;  3DTM A;  1ES4 A;  3WS4 A;  5CRF A;  4FH4 A;  1LL9 A;  3BYD A;  4DKI A;  3BEB A;  2EX2 A;  5FI6 A;  4WZ5 C;  4WEL A;  1I2W A;  4ZAM A;  5FDH A;  2DCF A;  3IXB A;  1C3B A;  1QME A;  3AGF A;  2B5R A;  2OLU A;  5AQ7 A;  3ZHH A;  4OOM A;  4E3N A;  4OOL A;  4S2J A;  3HL9 A;  1YLP A;  4E3L A;  1SDE A;  4Y0U A;  1GA0 A;  2RCX A;  4X53 A;  1ERM A;  5GLC A;  4OPQ A;  5KSH A;  4R4S A;  1S6R A;  4S0L A;  1BSG A;  2HP5 A;  5GLA A;  1U60 A;  3VFF A;  3VFH A;  3W4Q A;  4DE3 A;  1PYY A;  3UO9 A;  4S2N C;  4DE0 A;  1FR1 A;  3WS5 A;  2OKV A;  4PM8 A;  2WKI A;  4GKU A;  1ONG A;  4QD4 A;  3ZG0 A;  4X68 A;  2ZQ8 A;  5FSR A;  2J7V A;  1IKI A;  3ITB A;  3MZF A;  1K25 A;  3GMW A;  3SS4 A;  4B4X A;  1I2S A;  3NI9 A;  1KE4 A;  2HDR A;  4K0X A;  3C5A A;  4OP5 A;  5TFQ A;  1Y54 A;  1NJ4 A;  2XK1 A;  1BUL A;  2A49 A;  1K54 A;  3C7V A;  2UWX A;  5CXW A;  2JE5 A;  3C4O A;  4S2M A;  1MWR A;  1MWS A;  2WGW B;  2HL2 A;  1WYB A;  4IVI A;  4S0I A;  3M2K A;  4IBR A;  4UHU A;  2WKH A;  5AQ9 A;  1GHI A;  4EBP A;  1H8Y A;  1M6K A;  1OME A;  3N8R A;  2A3U A;  4WMC D;  5E2F A;  5EVI B;  3V50 A;  2EFX A;  1FCO A;  4KEN B;  3KO3 A;  1K4E A;  2ZLY A;  2XD1 A;  3LEZ A;  3CZD A;  4DXC A;  1L0D A;  4GDN A;  5DF7 A;  1CEF A;  1DJC A;  3N8S A;  4R3B A;  5CHM A;  3CG5 A;  3SH9 A;  3UPP A;  3KNF A;  4PMA A;  4U0X A;  4GB7 A;  1LLB A;  1MY8 A;  2PBY A;  1LHY A;  5DTK A;  2Y2Q A;  2EFU A;  3VP3 A;  3EQU A;  1IYS A;  3OPR A;  3VOZ A;  3NDE A;  1EWZ A;  1K56 A;  3M6B A;  5CEC A;  4O7D A;  2EXA A;  3HUM A;  3FZC A;  5GHY A;  2R9X A;  5HAQ A;  4RX2 A;  1KDS A;  2ZC4 B;  4JF5 A;  4WZ4 A;  5I94 A;  4KZ5 A;  5A90 A;  3CMZ A;  2EXB A;  1BLS A;  2ZJ9 A;  3A3I A;  4EWF A;  1MPL A;  4S02 A;  4UA7 A;  3C4P A;  4KZ3 A;  3ZGA B;  1RGZ A;  2HDQ A;  2XGN A;  4RRH A;  5A93 A;  2XF3 A;  3HUN A;  3G32 A;  4X56 A;  2BLS A;  2Q9M A;  1JWZ A;  2Y2H A;  3BM6 A;  1YMX A;  4FD8 A;  2QMI A;  4OLG A;  5DTT A;  2P74 A;  4N1X A;  3WS2 A;  1N4O A;  3UE1 A;  2X71 A;  4S2P A;  4QU3 A;  1K6S A;  3DWZ A;  4Q8I A;  1RP5 A;  5FQK A;  3ZDJ A;  3ZG9 B;  4BQM A;  5J8X A;  5J61 A;  1TVF A;  3LMU A;  2WGV A;  3EQV A;  5CED A;  3NBL A;  4HBT A;  5HAR A;  3PAG A;  3ZG7 B;  3V5M A;  4KZA A;  1FR6 A;  2WGW A;  3B3X A;  3SS3 A;  1W8Q A;  3BLM A;  4P6B A;  5FAP A;  1J7G A;  1YQS A;  3GQZ A;  5FQI A;  4BD1 A;  2IWD A;  4MBH A;  3LO7 A;  3V39 A;  5JYP A;  4WMC A;  4U3T A;  5CHJ A;  1MXO A;  1PI4 A;  2ZMA A;  1W7F A;  2EX8 A;  4R0Q A;  5EVI A;  3VP4 A;  1KVL A;  4R23 A;  4P0M A;  4M3K A;  3ZNY A;  1I5Q A;  4RX3 A;  4Y0T A;  4N1H A;  1CI8 A;  4RRQ A;  5KMW A;  4DE1 A;  1IYO A;  2HPB A;  3E2K A;  5G18 A;  3PD4 A;  3MXR A;  5DF9 A;  1LL5 A;  1K55 C;  1PWC A;  2Q9N A;  1YT4 A;  3Q07 A;  2G2U A;  2ZQA A;  5E2H A;  4S2O A;  2PU4 A;  2WKE A;  4ZJ3 A;  3WRT A;  5D3O A;  4D2O A;  4LV0 A;  1HD8 A;  4N9K A;  3UE3 A;  4RRF A;  1FCM A;  5M19 A;  3FV7 A;  4BL3 A;  3KOC A;  2QPN A;  4QY5 A;  3MZE A;  1TDG A;  2Y59 A;  2XD5 A;  3W4O A;  3IXH A;  1GCE A;  1O7E A;  5FA7 A;  5FAO A;  3IWI A;  3TOI A;  2J9P A;  3GTC A;  3NCK A;  1O07 A;  4RRB A;  3CJM A;  4MEZ A;  3VOY A;  1IKG A;  3G2Y A;  3Q7V B;  4HBU A;  5M18 A;  2Y2J A;  3MBZ A;  1PW8 A;  4RYE A;  2HP6 A;  4L0L A;  4R1G A;  3PD2 A;  1MWU A;  1ES3 A;  3NIA A;  1E4D A;  4GD8 A;  3RXX A;  4LEN A;  4XXR A;  4B88 A;  3GRJ A;  1BLC A;  2JC7 A;  3IH8 A;  3PAE A;  3BFE A;  2J8Y A;  2PU2 A;  3HLW A;  1KGF A;  3KO4 A;  5HL1 A;  3GV9 A;  1PZP A;  3NDG A;  4A5R A;  2P9V B;  2X02 A;  2Y2G A;  4JKT A;  1Y2Q A;  1NZO A;  2XH9 A;  1BT5 A;  4KG2 A;  2ZQD A;  3RXW A;  5EE8 A;  2WAD A;  1BLH A;  3HLG A;  1FQG A;  3ZG5 A;  3NC8 A;  4ID4 A;  4IED A;  1WYC A;  4RRD A;  4LCL A;  1ESI A;  2Z2L B;  4X55 A;  3ISG A;  4E3M A;  4KZ8 A;  3ZFZ A;  1XA1 A;  1K57 A;  3Q7Z A;  3NY4 A;  3BFF A;  4JF6 A;  4MBK A;  1JTD A;  5FAT A;  1E3U A;  1K4F A;  4JPM A;  4OH0 A;  4BD0 A;  3KOB A;  4KQO A;  1ERO A;  2Y2O A;  3FKV A;  4OQG A;  1EI5 A;  4GDB A;  3SOI A;  2DBO A;  4BEN A;  5BOH A;  1SCW A;  4RRR A;  1LI9 A;  3HLE A;  2GDN A;  5DF8 A;  4KZB A;  3C7U A;  4GZB A;  4RRM A;  3WS1 A;  1YLT A;  3KO5 A;  3DW0 A;  4BL2 A;  2DRW A;  4C3Q A;  3IH9 A;  4JF4 A;  3GSG A;  4OON A;  3MFD A;  1XKZ A;  4P87 A;  3VMA A;  2ZC6 B;  5GLD A;  1FSY A;  1YLZ A;  2WGI A;  1TEM A;  3N7W A;  5FAS A;  2JCH A;  1ZG4 A;  3VSK A;  1KDW A;  2WYX A;  4RR8 A;  4UAA A;  3G34 A;  1QMF A;  4UA6 A;  2WAF A;  1BTL A;  1SHV A;  4DF6 A;  2HP9 A;  1KVM A;  1L0F A;  4S2N A;  3KO7 A;  4C6Y A;  1GA9 A;  4EBN A;  1YM1 A;  3OCL A;  5EVI C;  1XP4 A;  4CJN A;  4Z9Q A;  1YLY A;  2DNS A;  3HLD A;  4X69 A;  5FQQ A;  2XDM A;  3IF5 A;  1W8Y A;  3P98 A;  4Y7P A;  5F1F A;  1L0E A;  3PBO A;  5F1G A;  2C6W B;  2P9V A;  4YIN A;  2X01 A;  3DWK A;  4PM7 A;  4LV3 A;  4K91 A;  3ZVW A;  3IF6 C;  4NBI A;  3G4P A;  5FQJ A;  4S0J A;  4PM9 A;  3A3D A;  3PD5 A;  3ITA A;  3AGE A;  5M1A A;  2QZ6 A;  4IVK A;  1L0G A;  3S22 A;  4S03 A;  1ONH A;  1XA7 A;  2EX9 A;  3UDI A;  3BFC A;  1MBL A;  3HLF A;  2Y2K A;  4DRT A;  3UN7 A;  4IBX A;  4WBG A;  4R4R A;  3ZCZ A;  5JYO A;  4WEJ A;  3FYZ A;  4QJG A;  2ZM8 A;  1W5D A;  3HBR A;  2Y91 A;  3UDF A;  1XPB A;  2XFT A;  2I72 A;  1SDN A;  2VGJ A;  4X6T A;  4RR9 A;  3OCN A;  3BFD A;  1W79 A;  3M6H A;  3A3F A;  4HEF A;  1YLW A;  3PBS A;  5CHU A;  3UY6 A;  3QNB A;  1NZU A;  4KG6 A;  1VM1 A;  1KE3 A;  3W8K A;  4KZ4 A;  3W4P A;  1HVB A;  4OPR A;  1K6R A;  2WK0 A;  1KE0 A;  1ERQ A;  1NRF A;  4QY6 A;  4KZ7 A;  4CPK A;  2IWB A;  1SKF A;  4UA9 A;  4RRC A;  1ES5 A;  3UPN A;  5F82 A;  3ZVT A;  2HL1 A;  2G2W A;  3OPP A;  5HAI A;  3QNC A;  2Y2N A;  3WRZ A;  4E6X A;  1H8Z A;  3N6I A;  1XX2 A;  3ZNT A;  5EOO A;  4RRI A;  1BLP A;  4R3J A;  4GN2 A;  1BUE A;  4KQQ A;  3P09 A;  4OQI A;  3VP1 A;  4NBJ A;  2XR0 A;  3G30 A;  5CGW A;  2XLN A;  4WEK A;  2Y55 A;  5DVA A;  3TSG A;  1K54 C;  5A92 A;  1PI5 A;  5EVL A;  4KQR A;  2V2F F;  2HL0 A;  5AQA A;  3PBQ A;  1K57 C;  1S0W A;  1YMS A;  3IHB A;  4WM9 A;  3UDX A;  3OZH A;  5CEB A;  4RR6 A;  1VQQ A;  1G68 A;  1E25 A;  1YLJ A;  1ZC2 A;  3VSL A;  1JVJ A;  4WYY A;  3PD3 A;  4K0W A;  4Y0O A;  1M40 A;  1ALQ A;  3RJU A;  4B4Z A;  1ES2 A;  5TR7 A;  1NYM A;  2C5W B;  4QB8 A;  4S2K A;  1AXB A;  5E2E A;  3BRM A;  3AGD A;  3O88 A;  4OVD A;  1LI0 A;  2JBF A;  3GR2 A;  4MLL A;  5GHZ A;  4XUZ A;  2J9O A;  5DTS A;  1PW1 A;  4HES A;  5CGX A;  4LV2 A;  2R9W A;  1FOF A;  2H0Y A;  3N8L A;  1K38 A;  1K56 D;  2HKZ A;  3KNP A;  2RL3 A;  4GOG A;  1MWT A;  1IYQ A;  3O86 A;  3OC2 A;  3LY4 A;  1KGE A;  2Y4A A;  3IXD A;  2FFF B;  4JXS A;  4E6W A;  4C75 A;  3A3J A;  4JBF A;  4EQI A;  1K55 A;  5CTN A;  4GD6 A;  2VGK A;  4GNU A;  3KO9 A;  3M2J A;  3LCE A;  4S2I A;  3FWL A;  5FQM A;  1ESU A;  3OPL A;  3Q1F A;  3BFG A;  4NET A;  5L2F A;  2ZM0 A;  4F94 A;  5F83 A;  1IYP A;  1DJB A;  3N4I A;  4KZ6 A;  2H0T A;  3IQA A;  3BLS A;  4WZ5 A;  3V3R A;  1ZG6 A;  3VP2 A;  4KZ9 A;  4OOY A;  4PM6 A;  5GL9 A;  1TC5 A;  5HW3 A;  5EEC A;  2V1Z A;  4MBF A;  3Q82 A;  4RR7 A;  2HDS A;  1CI9 A;  5AQB A;  5HAP A;  4OPY A;  5EOE A;  1G6A A;  4JXW A;  3S1Y A;  5U47 A;  4E3O A;  3HVF A;  4EUZ A;  2XQZ A;  2Y2P A;  2ZC7 A;  1TDL A;  4ZDX A;  3UPO A;  3UE0 A;  3E2L A;  3IHA A;  4JXG A;  3O87 A;  2Y2I A;  3JYI A;  4DXB A;  1KGG A;  4RRK A;  5EVI D;  4RA7 A;  1PWD A;  1WE4 A;  5EPH A;  3MKE A;  3G2Z A;  2WUQ A;  3Q7V A;  2FFY A;  4FCF A;  3LMV A;  3LY3 A;  4S0K A;  5FQ9 A;  3D4F A;  4OQ0 A;  4ZBE A;  2XFS A;  1DY6 A;  4FH2 A;  4MNR A;  4KG5 A;  1Q2P A;  3HLB A;  3IF6 B;  2OLV A;  1IEL A;  2V20 A;  2ZM2 A;  4S2L A;  4FSF A;  4ZJ1 A;  3LMT A;  2E8I A;  2H5S A;  4ZJ2 A;  4LCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...