2EX6A

Crystal structure of penicillin binding protein 4 (dacb) from escherichia coli, complexed with ampicillin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
450
structure length
450
Chain Sequence
TQLPAGANLALMVQKVGASAPAIDYHSQQMALPASTQKVITALAALIQLGPDFRFTTTLETKGNVENGVLKGDLVARFGADPTLKRQDIRNMVATLKKSGVNQIDGNVLIDTSIFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPKPGDMAFIRVASYYPVTMFSQVRTLPRGSAEAQYCELDVVPGDLNRFTLTGCLPQRSEPLPLAFAVQDGASYAGAILKYELKQAGITWSGTLLRQTQVNEPGTVVASKQSAPLHDLLKIMLKKSDNMIADTVFRMIGHARFNVPGTWRAGSDAVRQILRQQAGVDIGNTIIADGSGLSRHNLIAPATMMQVLQYIAQHDNELNFISMLPLAGYDGSLQYRAGLHQAGVDGKVSAKTGSLQGVYNLAGFITTASGQRMAFVQYLSGYAVEPADQRNRRIPLVRFESRLYKDIYQNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Penicillin-binding protein 4
publication title Crystal structure of penicillin binding protein 4 (dacB) from Escherichia coli, both in the native form and covalently linked to various antibiotics
pubmed doi rcsb
source organism Escherichia coli
total genus 134
structure length 450
sequence length 450
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2005-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2ex6A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 2ex6A02
3MZDA 4QHCA 1J9MA 1ONHA 1O7EA 1TDLA 2ZQDA 5EVIB 1K4EA 1PI5A 2Y59A 4XXRA 5CGSA 1FSYA 2G2WA 3NDEA 1S6RA 3O86A 1KDSA 4FD8A 4OH0A 1K55A 1C3BA 4CPKA 3C4OA 1SKFA 4A5RA 4KQOA 1O07A 2OLVA 3G30A 5EVIC 1NJ4A 3PBRA 4OLGA 3G2YA 3IWIA 4MBKA 3UN7A 5J8XA 3BRMA 1W79A 1K54C 4GDBA 1MXOA 1MWRA 1KE4A 4WZ4A 4DXBA 3LY4A 3C4PA 2XEPA 4R4RA 4R3JA 3VP2A 4ZTKA 1JTDA 4BQMA 2PU2A 1PWDA 1L0DA 3M2KA 5HAQA 5E2EA 3QNCA 4P0MA 4DE2A 3HLWA 4E6XA 5E2HA 1FR6A 1HD8A 4E6WA 3PAEA 3N4IA 5FQ9A 3S1YA 2A3UA 4KQQA 3SH9A 4R1GA 1HVBA 4ID4A 2Y2HA 5F82A 3UE1A 5KMWA 1MWTA 4JXSA 2XDMA 3W4PA 2EX6A 4BJPA 2Y2LA 3W8KA 1W8YA 4Q8IA 3UE0A 2WAEA 4KZAA 3NDGA 3M6HA 1SDNA 3UDXA 3NC8A 2WK0A 4WM9A 4X6TA 2Y2QA 1BLSA 4N9LA 5CECA 3UDFA 3BYDA 5M19A 5FQQA 1ONGA 1NXYA 3N6IA 2ZM2A 4Z9QA 5G18A 2HP9A 5FDHA 3FV7A 5HW3A 4OQ0A 2EXBA 4KZ9A 3ZNTA 4M3KA 3SS3A 3ZG5A 3A3FA 4Y0OA 5TR7A 2J9PA 4MEZA 1ZG4A 1XA1A 4XUZA 3QNBA 3C5AA 1I2SA 4OKPA 4WYYA 4X69A 5TFQA 2GDNA 2PBYA 4FCFA 4HBTA 4JXGA 5HAIA 3BEBA 3SS5A 4E3IA 1FCMA 1PZOA 4GKUA 3MBZA 4GNUA 3TG9A 1K38A 2XFTA 4EBPA 1PW1A 4KZ8A 5BOHA 2RCXA 1YLPA 1N9BA 5EVLA 4DRTA 1LLBA 4C6YA 3IHBA 4U0TA 5HARA 1I2WA 1FCNA 5FATA 4GOGA 1TEMA 2QPNA 3OPLA 1LI9A 1BULA 1PIOA 4OQGA 4PPRA 4GN2A 1CI8A 1H5XA 5GLAA 3WS5A 2X01A 1KE3A 5EVID 2XQZA 1CK3A 2V2FF 3SH7A 4WEJA 2HDRA 4EV4A 1M40A 3FZCA 3PBSA 3BLMA 2WGWA 1MPLA 2B5RA 4X55A 5CERA 4GDNA 3HLGA 3V50A 1G6AA 1PWGA 5HX9A 1SCWA 4DE1A 2J8YA 1WE4A 3OZHA 5D3OA 4LV1A 5DF7A 5FQMA 2OLUA 4Y0UA 2JBFA 4HESA 3SS4A 1TDGA 3OPPA 4OOMA 3HLDA 4RX3A 3GVBA 3QHYA 3CMZA 1RGYA 4R3BA 1FCOA 1H8ZA 4IEDA 4S2NC 3IF6A 4WEKA 4Y0TA 2XGNA 5E2GA 1JWZA 1MY8A 3ZG9B 3Q82A 2V1ZA 1XGIA 1G68A 5FSRA 1BUEA 1E4DA 1IYOA 1JWVA 2WKHA 5FA7A 3UO9A 4EQIA 2H10A 1GHMA 3MXSA 4E3KA 2XH9A 1K55C 3G2ZA 3OPHA 4HBUA 2BLSA 3DTMA 1SHVA 4JF4A 4WZ5C 4S2PA 4UA7A 1GHPA 3VP1A 2IWCA 1NRFA 1W8QA 1QMFA 1XX2A 4IBRA 2DNSA 3HREA 5EUAA 3Q7VB 2JC7A 4ZJ1A 1IELA 3VSLA 2R9XA 4BL3A 5A92A 4K91A 1IKGA 1M6KA 5DF9A 1AXBA 3Q1FA 1IYSA 4RYEA 4X53A 1L0GA 2EXAA 1K6RA 3A3DA 5FQKA 1K25A 4ZDXA 2Y2KA 5CHJA 5CEBA 2XR0A 5F1GA 5EOOA 2CC1A 5A93A 1MWUA 1XPBA 1BLPA 4OONA 5GHXA 4E3MA 2IWBA 3CJMA 3ZG0A 1E3UD 1GA0A 2XD1A 4KZ6A 3SH8A 1EI5A 2Y4AA 2Y2NA 2IWDA 3IH9A 4KG5A 4MNRA 1RGZA 4GB7A 4P6BA 3LCEA 1BLHA 2JCHA 2UWXA 4R0QA 2DRWA 4KQRA 1XKZA 3OC2A 5HL1A 1LL5A 4QU3A 3RXXA 2VGJA 1ERQA 4KENB 5GLDA 4C75A 1Y54A 3PBTA 3WS2A 3EQVA 4DDYA 2Y2OA 1NZUA 3O88A 4S2MA 3WS4A 4WBGA 3ZVWA 2Q9MA 4FH4A 5EVIA 1ES2A 3A3IA 3CZDA 2X71A 2P74A 5DTSA 1ZKJA 4RX2A 5FAOA 4BD1A 4BD0A 3ZGAB 3ZCZA 3MZEA 1K57A 1YLTA 3GRJA 5KSCA 1CI9A 1OMEA 2Z2LB 3E2LA 5L2FA 3ISGA 2WKIA 4BLMA 2HP5A 3UY6A 4DDSA 4QB8A 3MZFA 1XGJA 1YQSA 3HL9A 4X68A 3DW0A 3DWKA 5JYPA 4ZJ3A 2ZC4B 5FAQA 4OOLA 3VOZA 4OP8A 1PI4A 3IT9A 2HDUA 4U3TA 3IQAA 4JPMA 1KVMA 2RL3A 2DCFA 4OP5A 4KZBA 3MKEA 1BZAA 3TOIA 1N4OA 5CGXA 4KG6A 4GD8A 2H0YA 5CGWA 4ZAMA 2WZXA 4LV0A 5GLCA 1K6SA 3FWLA 3W4QA 3AGDA 1XXMA 1YLWA 3LO7A 4E3JA 3FKVA 1YLYA 2WKEA 5A90A 3ZDJA 2EX9A 4R23A 2Q9NA 2ZC5B 3P09A 4S2LA 5CHMA 3NBLA 3SOIA 5F1FA 2XFSA 5TGFA 2X02A 5U47A 2R9WA 4S2JA 2QMIA 3G35A 3G34A 1BSGA 4WMCA 1LL9A 3NY4A 1PW8A 4JF6A 3IF6C 4JXWA 4R4SA 5M1AA 1Q2PA 4QY6A 1ES5A 1HZOA 1XA7A 4XUXA 4OQIA 4KZ4A 1MWSA 3CG5A 1EROA 2FFFB 4UA9A 5IHVA 3GMWA 1ALQA 2ZC6B 2J9OA 4MBHA 2WGIA 2ZM8A 3PAGA 5DVAA 1E3UA 2WUQA 4P87A 3GV9A 4N92A 1S0WA 3GR2A 3PBNA 4KG2A 5EE8A 2EFUA 1K4FA 3BECA 3V3SA 4OQHA 3B3XA 2WAFA 4PM7A 4OLDA 1MKIA 1HTZA 4JXVA 3WRZA 2ZQ7A 1JWPA 3LEZA 4LCMA 2Y91A 4E3LA 1L2SA 3IXBA 5FI6A 2HDQA 1RP5A 3S22A 1ESUA 1GHIA 4OOYA 4C3QA 5I94A 2PU4A 4OPZA 1PZPA 1NY0A 4EUZA 4PMAA 4WMCD 5FQJA 3UE3A 3UPPA 4DKIA 3UDIA 3FYZA 4H8RA 2OSUA 1KGEA 2ZQ8A 4IVKA 1K56D 2JE5A 3WS1A 1IYQA 1KE0A 4KZ7A 4S2NA 4N1HA 5HFOA 4LCLA 5AQ9A 2V20A 1NYYA 5CTNA 2P9VB 1EWZA 3HLCA 4JF5A 5FQIA 3PBOA 2OV5A 3ZG8B 4UHUA 5DF8A 4IBXA 3N8RA 5M18A 3RJUA 2WYXA 3Q81A 5HAPA 1IKIA 1YM1A 3IXGA 3HUOA 1SDEA 3VSKA 1ERMA 3OCLA 2H5SA 3AGEA 3D4FA 3FKWA 4WZ5A 4BENA 1L0FA 5DTTA 1CEFA 1W7FA 1DJBA 4GZBA 4MLLA 3OCNA 3IXDA 1TVFA 3HLBA 1H8YA 1W5DA 1QMEA 5A91A 4DXCA 4ZBEA 1K57C 5FI7A 1E25A 3O87A 3PBQA 2WZZA 3ZFZA 5AQ7A 3BFDA 3IXHA 5GLBA 3VOYA 3VP0A 3HLEA 4EBNA 1ESIA 4S2IA 3BFCA 5KZHA 2A49A 2ZQ9A 3HBRA 2ZJ9A 4OVDA 1BTLA 3Q7VA 4DE0A 1K54A 1KVLA 2J7VA 3ITBA 3IWQA 5CRFA 3C7UA 4JBFA 1ES4A 5KSHA 3BM6A 4OPYA 3DWZA 5F83A 3OPRA 3ZNYA 4E3NA 4WELA 4U0XA 3P98A 1PWCA 4RA7A 5GHZA 3V39A 2H0TA 3ZVTA 1YT4A 2BG1A 4UA6A 3V3RA 3G32A 2ZQAA 4HEFA 3VMAA 4JLFA 4GD6A 1YMXA 5FI2A 2EX2A 2P9VA 4NETA 1JVJA 2Y2IA 4UAAA 3NIAA 4QJGA 1VM1A 2QZ6A 2WGWB 3A3JA 1WYBA 3BFFA 3Q7ZA 4PM6A 3JYIA 1LHYA 2EX8A 3MXRA 5CTMA 3BFGA 4MBFA 4CJNA 1FQGA 4BL2A 1YLJA 1CEGA 4PM5A 3BFEA 2ZMAA 4DF6A 4EWFA 5CEDA 1L0EA 1FR1A 5CHUA 1DY6A 1DJCA 1KGGA 2ZD8A 4B4ZA 3HLFA 4DE3A 4RVAA 1NZOA 1BT5A 2ZQCA 4O7DA 4D2OA 1NYMA 3BLSA 4P85A 1Q2QA 4EBLA 3IF6B 3UPOA 1I5QA 1KGFA 2WADA 3I7JA 2C6WB 2FFYA 3MFDA 3HVFA 4N1XA 1PYYA 3HUNA 3S4XA 2E8IA 3WRTA 1GCEA 3IWOA 3M6BA 2XF3A 3GSGA 4LV3A 4B88A 4OPQA 3ITAA 4B4XA 4K0WA 2EFXA 5AQAA 4L0LA 5E2FA 4LENA 3LY3A 1K56A 3E2KA 3UPNA 3NCKA 1JTGA 1YLZA 2ZC7A 2HP6A 2Y2JA 4KZ3A 2Y55A 2XD5A 4QD4A 5GL9A 4ZJ2A 3ZG7B 5GHYA 3WS0A 1WYCA 4NK3A 4N9KA 2I72A 3GQZA 4E3OA 4KZ5A 2Y2GA 1FOFA 1KDWA 3GTCA 5AQBA 4PM9A 1BLCA 4IVIA 3W4OA 3PTEA 4FSFA 4F94A 3C7VA 3NI9A 5DTKA 4X56A 1GA9A 1VQQA 4QY5A 3VP3A 3O3VA 3MKFA 4S2OA 3UNWA 5EECA 2WGVA 2HDSA 2Y2PA 2Z2MB 3VP4A 4YINA 3ZHHA 1XP4A 1DJAA 3N7WA 3HUMA 1IEMA 5EPHA 5EOEA 3IF5A 4OPRA 2VGKA 4K0XA 2C5WB 3EQUA 3Q07A 2ZC3B 3RXWA 4FH2A 3IH8A 1ZC2A 3G4PA 3N8LA 1IYPA 2XLNA 4S2KA 1U60A 2ZM0A 4YFMA 3AGFA 3TSGA 4JKTA 3VFFA 1RCJA 3N8SA 1YMSA 2Y2MA 3IHAA 5FASA 3V5MA 1FSWA 1MBLA 1ES3A 3A3EA 2HPBA 5E43A 3M2JA 2G2UA 4Y7PA 5CXWA 3WWXA 1ZG6A 4LV2A 1Z6FA 5JYOA 3VFHA 2XK1A 4PM8A 1LI0A 3G31A 2ZLYA 5FAPA
chains in the Genus database with same CATH superfamily
4QHCA 1J9MA 4PKYG 3K3CA 3NDEA 1S6RA 4FD8A 3C4OA 1SKFA 5EVIC 1NJ4A 4OLGA 3G2YA 1K54C 4WZ4A 2A24A 4B9OA 3G6OA 1XFNA 3KO3A 4ZTKA 3CWFA 1PWDA 2W3FA 4RRKA 3QNCA 4P0MA 4E6XA 1ZHHB 5FQ9A 2BASA 4KQQA 2Y2HA 1NLZA 5KMWA 1D7EA 3U2AA 1W8YA 2O9BA 4Q8IA 2WAEA 4G3VA 2VGLM 3UDXA 3NC8A 2Y2QA 1LSXA 3LUQA 5CECA 4CLCE 4NEED 5M19A 5FQQA 3N6IA 2HJEA 3FV7A 3BQ8A 3A3FA 3NULA 2VKSA 2GZAA 3D72A 1TC5A 2K31A 5TFQA 4HBTA 4Z1WA 3BEBA 3SS5A 4EW7A 1FCMA 4GNUA 4GKUA 4QWOA 3TG9A 4HH3A 1PW1A 4KZ8A 1YLPA 1ZTUA 4DRTA 5HARA 2JHEA 1TEMA 3OPLA 1BULA 1PIOA 4GN2A 2KLIA 3WS5A 2V1AA 1LT0A 3SH7A 1M40A 3FZCA 2B5RA 3KODA 2V8FA 3NECA 1H8MA 5AVFA 5D3OA 3T1XA 1OTIA 2OLUA 2JBFA 2HL1A 3CMZA 2W27A 4S2NC 1JWZA 1MY8A 1DRMA 3UO9A 1E4DA 2NUPC 2XH9A 4P6ZS 1TS6A 1GHPA 3EGDC 1OTAA 1W8QA 3HREA 5EUAA 5A92A 3Q1FA 4X53A 2EA9A 2QHKA 3A0VA 2Y2KA 5AJGA 2YKFA 4UEYA 5CEBA 5A93A 1XPBA 1BLPA 1CF0A 5GHXA 3KNPA 2XD1A 4MNRA 1H3QA 1RGZA 2PHYA 4MN6A 5G4YA 2JKRM 4KQRA 4QU3A 3CI6A 4KENB 3WS2A 3EQVA 1NZUA 3WS4A 4WBGA 3C38A 2Q9MA 1ES2A 2ZL1A 1ZKJA 3MZEA 1CI9A 3UMEA 3LICA 2Z2LB 2HP5A 2Y8HA 3DWKA 1G6OA 2ZC4B 1PRQA 5FAQA 4ETZA 4OP8A 3IT9A 4U3TA 2V1BA 2RL3A 1D06A 3MKEA 3JVVA 4Y13A 3TOIA 2HV1A 4KG6A 2H0YA 2V9AA 2L1MA 3AGDA 4L9EA 5L07A 1YLWA 3FKVA 3KSGA 2WKEA 4CLCB 4EUVA 3NBLA 5F1FA 2XFSA 3HJIA 2Y79A 1YPRA 2QMIA 2P04A 4X25A 4R4SA 1V9YA 4OQIA 4KZ4A 3S7QA 3CG5A 5IHVA 2ZC6B 2Q0OA 2WGIA 2ZM8A 4Y3IA 2WUQA 3GR2A 3PBNA 5DFXA 4OQHA 2WAFA 4ZRRA 4I38A 1HTZA 1EW0A 1JWPA 3T1SA 4E3LA 4CLCA 3MQQA 2PU4A 1PZPA 4PMAA 4DKIA 3FYZA 4H8RA 4NBJA 3H7WB 4IVKA 4L9FA 3T4SA 4RRDA 5HFOA 2E8JA 2V20A 1NYYA 3ZQ5A 5FEGA 4Q0IA 2P9VB 1EWZA 3HLCA 4JF5A 3PBOA 5DF8A 4IBXA 3LIFA 4RQ9A 2V0UA 2XROA 5HAPA 1IKIA 3IXGA 4BBVA 1ERMA 3AGEA 3T12B 4BENA 4Q0JA 5DTTA 1H0MA 1W7FA 4GZBA 1W5DA 4DJ3A 4DXCA 2B02A 4O0PA 4CLCD 4WF0A 3ZFZA 3BFDA 5GLBA 4EBNA 3CAXA 5KZHA 2A49A 2ZJ9A 2GX5A 5HPFA 1K54A 2XA7S 3IWQA 3DWZA 3OPRA 3H7WA 2H0TA 1LSWA 4GD6A 2P9VA 1OJ5A 4H6JA 3NIAA 1VM1A 2WGWB 4IUKA 4PM6A 3B47A 1LHYA 4MBFA 1FQGA 2ZMAA 4S0KA 4MCWA 5A8BA 1KGGA 3TRCA 4I5SA 1NZOA 2D01A 4D2OA 1NYMA 3I7JA 2C6WB 3MFDA 4N1XA 1PYYA 2E8IA 1GCEA 1F9IA 4LV3A 4GCZA 1K56A 3E2KA 3UPNA 1GSWA 4KZ3A 4ZJ2A 2XD5A 4QD4A 3LR5A 5F69A 3H9WA 2O9CA 1FOFA 4PM9A 1BLCA 4IVIA 3W4OA 3PTEA 4F94A 4GS9B 5DTKA 1GA9A 3R4KA 3O3VA 1VHMA 3MKFA 4YINA 4DJ2A 1TD5A 4OPRA 1S1YA 2C5WB 5HDCA 3EQUA 3Q07A 2ZC3B 3C30A 3BQAA 4S2KA 3VFFA 3N8SA 3V5MA 1FSWA 1ES3A 2ZMVA 4HOIA 4EU0A 4S0IA 4LV2A 1Z6FA 4NBIA 5EM1A 5MC7A 5LBRA 3S7PA 1ONHA 2I9VA 2PD7A 1K4EA 2AVXA 1KDSA 5IU1A 4RRRA 5FDSA 1C3BA 4RRQA 4A5RA 4EEUA 3UN7A 5DFYA 4GDBA 1N9LA 5C5KA 1KE4A 1GSXA 4DXBA 3LY4A 3C4PA 4PHTA 3KYEA 1P97A 3C2WA 1JTDA 2K7SA 4HJ4A 5EV0A 5E2EA 1X0OA 4DE2A 1HD8A 4E6WA 3PAEA 3N4IA 3S1YA 1HVBA 4ID4A 1MWTA 3TE8A 3E98A 3TW8A 3W8KA 3BJNA 3KO6A 4KZAA 3M6HA 1SDNA 4X6TA 4N9LA 1ONGA 1NXYA 5DJUA 2ZM2A 5G18A 2B95A 5FDHA 4KZ9A 3ZG5A 5TR7A 3EEHA 3EOIA 5FL3A 3C5AA 1I2SA 4X69A 2GDNA 4JXGA 1ACFA 2XFTA 3CHWP 2HGVA 5EVLA 4U0TA 5FATA 4PPRA 4RR6A 4M4XA 2V2FF 2ACGA 3OBFA 4WEJA 2M7UA 3PBSA 1MPLA 4R70A 4CLCC 5CERA 3HLGA 3LGOA 3RFBA 1SCWA 2J8YA 3OZHA 3PD3A 2D02A 5FQMA 2M7VA 4ME4A 3SS4A 5DKLA 1J3WA 2ZOHA 4EXOA 1S67L 1FCOA 4IEDA 4Y2FA 4MMNA 5HSQA 3LR4A 2FH5A 3ZG9B 1JWVA 2WKHA 5FA7A 2H10A 3MXSA 4FOFA 4G3WA 1K55C 4RR7A 3G2ZA 4HBUA 2PDRA 1XJ3A 3LYXA 4UA7A 4IBRA 4LLOB 4ZJ1A 1IKGA 1M6KA 4UQIM 1AXBA 4MN7A 5DF9A 2EXAA 5FQKA 4ZDXA 5EOOA 4HY8A 4HP9A 1MWUA 2IWBA 1E3UD 1GA0A 1FILA 1EI5A 5TBMB 2Y2NA 2IWDA 2INWA 3IH9A 4P6BA 1OTEA 3LCEA 1BLHA 4R0QA 1PFLA 3UB8A 2OOLA 1XKZA 1LL5A 2HJ9C 4DMZA 3B33A 2VGJA 1ERQA 5AVEA 3PBTA 5TJJA 3O88A 3A3IA 3CZDA 5HPIA 3QP6A 3KO7A 4RX2A 5FAOA 4BD1A 3ZCZA 3KSHA 3KOBA 2W3DA 3E2LA 5L2FA 3IBRA 4BLMA 3MZFA 3HL9A 4KUKA 5L8MA 4NKPA 1OTDA 4OOLA 3VOZA 1PI4A 4JPMA 2DCFA 4KZBA 2VV7A 1N4OA 4R38A 3PD2A 1K6SA 3W4QA 1TF1A 3P01A 3LO7A 5I5LA 4F3LB 4R23A 2ZC5B 3P09A 2KDKA 3SOIA 2X02A 5U47A 2R9WA 4S2JA 1BSGA 4WMCA 1LL9A 3NY4A 1PW8A 3UB6A 3T50A 1DP6A 1VETB 1T19A 3K2NA 4XUXA 1XJ6A 1EROA 2FFFB 4UA9A 3GMWA 2J9OA 4MBHA 3PAGA 2L0WA 3GV9A 1NRJA 4N92A 1T18A 1K4FA 3V3SA 3B3XA 4PM7A 4OLDA 4FTXA 3WRZA 2ZQ7A 4LCMA 3MS6A 2HDQA 2PRFA 1LL8A 4OOYA 3W2ZA 4C3QA 4OPZA 4WMCD 3UE3A 3LIAA 5L09A 1JKEA 4N1HA 1VETA 3F1NB 3TJZC 3LFVA 3ICYA 4UHUA 3K3DA 3RJUA 1SDEA 2VV8A 2O99A 3OCLA 3SW1A 3H82B 3JVUA 3IXDA 5HD3A 5J7EA 3HLBA 4ZBEA 3ULFA 1E25A 3O87A 3GECA 2VK3A 2VLGA 5AQ7A 1GSVA 3VOYA 3VP0A 1ESIA 4S2IA 4GJ4A 5CRFA 3C7UA 1ES4A 5KSHA 1ODVA 4OPYA 1A0KA 2J3WA 4WELA 4U0XA 4HH2A 2BG1A 3G32A 2PR6A 2ZQAA 4HEFA 4JLFA 1LSVA 5FI2A 2EX2A 3F1NA 4NETA 2JKFA 4UAAA 3OOVA 2QZ6A 3IX4A 2PR5A 2W1TB 3JYIA 4RRAA 2ZBBA 5CTMA 3BFGA 4CJNA 1CEGA 4EERA 4PM5A 3BFEA 4DF6A 1FR1A 5CHUA 1DY6A 1DJCA 2JKTI 3VV4A 4E04A 2OKVA 2ZQCA 4O7DA 1S4RA 1CQAA 4EBLA 3GDIA 3IF6B 2WADA 2KOIA 2O0YA 2FFYA 3MR0A 1T1CA 1K0KA 2XF3A 4YNRA 4K0WA 2EFXA 3DBAA 4L0LA 3NOPC 5E2FA 3NCKA 1YLZA 2HP6A 4P6ZM 2QJ5A 4G3KA 5GHYA 4NK3A 5F5YA 1TS0A 2I72A 4Y5FA 4E3OA 3GTCA 4NXGA 4HIAA 3C7VA 5HDSA 3MQ0A 5F6AA 3UNWA 5EECA 3E0YA 2Y2PA 2Z2MB 3VP4A 1XP4A 3N7WA 3IF5A 1CJFA 4HHDA 3RXWA 3IH8A 3G4PA 2XLNA 1U60A 4YFMA 4JKTA 3IHAA 3A3EA 1VEUB 3KO5A 4Y7PA 5CXWA 3KOCA 3NHQA 2XK1A 4PM8A 1KOUA 1LI0A 3G31A 2ZLYA 3VP3A 3MZDA 5EVIB 1PI5A 3D9YA 2Y59A 4XXRA 2G2WA 2P7JA 3O86A 4I3AA 3DTKA 1K55A 4OH0A 4KQOA 3CITA 3PBRA 4MBKA 3BRMA 1W79A 1MWRA 3T4QA 2XEPA 4R4RA 3O5YA 3R7WB 4R3JA 3VP2A 4BQMA 2PU2A 3M2KA 1L0DA 4GHIB 1OPXA 3BY9A 4RRHA 3HLWA 4I3JA 5E2HA 1YKDA 1FR6A 4YWZA 1D1JA 1VEUA 2A3UA 3SH9A 4BBUA 2K2NA 4RRLA 2XDMA 3W4PA 4BJPA 1SZVA 4HJ3A 4KQDA 2Y2LA 2W3HA 1XFQA 2WKRA 3UE0A 1J7GA 2PAVP 1BLSA 3BYDA 3FPWA 4OQ0A 2EXBA 4M3KA 3SS3A 4Y0OA 2J9PA 2QYBA 1XA1A 4XUZA 1G5UA 3F1OB 4WYYA 1S4SA 3R7WA 2PBYA 5HAIA 4RRBA 1PZOA 3MBZA 4GHIA 2JKGA 1K38A 1NLYA 4MDZA 4EBPA 5BOHA 2JKRI 1LLBA 1FCNA 2ZMFA 4GOGA 1LI9A 5GLAA 4WL9A 2X01A 1KE3A 5EVID 3JPUA 2FZ0A 2HDRA 5EM0A 4HP4A 2WGWA 5DJTA 3V50A 3IS2B 1G6AA 1PWGA 3LMVA 4DE1A 2L4RA 3QP2A 4LV1A 4QPRA 4Y0UA 1TDGA 3OPPA 4OOMA 3HLDA 4RX3A 3GVBA 4R3BA 1H8ZA 5E2GA 1BUEA 1IYOA 1Y2QA 4EQIA 4E3KA 2PYPA 5J3WA 3KSIA 1N9OA 4JF4A 3EEAA 4IUHA 3VP1A 2IWCA 3IBJA 1QMFA 4MN5A 4XT2B 4ETXA 3Q7VB 2JC7A 1IELA 4JGRA 2R9XA 3VSLA 1IYSA 4GS9A 4PKYA 1L0GA 3IS2A 1K6RA 3A3DA 1K25A 5CHJA 3UB7A 2W1RA 2XA7M 3OLOA 4I39A 2EWWA 5F1GA 4HQAA 4OONA 3CJMA 3ZG0A 3VOLA 4NXEA 3SH8A 2Y4AA 3LR3A 1IOUA 4KG5A 4NXBA 4I3IA 4LRYC 2DRWA 2OWJA 3OC2A 5HL1A 4BBTA 3PD4A 3FG8A 4C75A 2A2LA 4DDYA 3S7OA 2Y2OA 4S2MA 4FH4A 5K5BA 2P74A 5DTSA 4XT2A 3ZGAB 1F2KA 1OMEA 3ISGA 4Y15A 2WKIA 3BWLA 4CQHA 3UY6A 4QB8A 1YQSA 3DW0A 4O01A 4ZJ3A 2DMWA 3IQAA 4RRFA 1BZAA 4GD8A 2Z6CA 4ZAMA 3KO9A 2WZXA 4LV0A 5GLCA 1Y4OA 2HF6A 1XXMA 4Q0HA 4E3JA 1S66L 5A90A 3ZDJA 3T4OA 1PNEA 1XJ4A 4S2LA 3MFXA 2GNXA 5TGFA 2VGLS 4PAUA 2YKHA 3G34A 1S1ZA 4LFUA 5CX7A 2O9AA 4JGQA 4JF6A 1SKOB 3IF6C 4JXWA 1ES5A 1HZOA 5HD5A 2H28A 2VV6A 1NWZA 4L9GA 3QP4A 5L10A 1E3UA 4KG2A 5EE8A 3BECA 5J61A 1MKIA 4X1MA 3PYPA 4JXVA 3MQOA 3LEZA 2A24B 1V9ZA 1L2SA 3IXBA 1ESUA 1GHIA 2VJWA 4RR9A 3UPPA 3UDIA 1TS7A 2OSUA 1KGEA 2ZQ8A 2JE5A 1SKOA 1KE0A 4LCLA 3LIEA 3QP8A 5FQIA 2PYRA 3ZG8B 3P7NA 3N8RA 3Q81A 1YM1A 3HUOA 3KYQA 3MSHA 4WZ5A 3FKWA 1L0FA 1CEFA 1DJBA 3C8CA 1TVFA 4EEPA 4ARZB 3SZTA 1K57C 2JKTM 5FI7A 2QKPA 1L3LA 3L9KA 3PBQA 2HZ5A 2G7UA 3BW6A 1P9RA 3BFCA 3HBRA 3UMDA 3QP1A 4DE0A 2J7VA 3ITBA 3BM6A 3KYZA 3ZNYA 4E3NA 4ESPA 1YSPA 5HZHA 4LPZA 3P98A 4RA7A 3V39A 3ZVTA 3VMAA 4S0JA 3EGXC 1JVJA 2HL2A 4QJGA 3A3JA 4HJ6A 3PD5A 3Q7ZA 5IS1A 5TBMA 2EX8A 3MXRA 3RH8B 2UV0E 3CUEA 4BL2A 1UGUA 4ARZA 3V67A 3KX0X 2ZD8A 4DE3A 3LR0A 1BT5A 3BLSA 3UPOA 3E4OA 2QWSA 1I5QA 4X1LA 3NOUC 1W63Q 4EESA 3HUNA 3WRTA 3M6BA 3GSGA 3ITAA 4B4XA 4WN5A 5AQAA 3LY3A 2CMNA 5IT5A 1OT9A 1JTGA 5G4ZA 2Y55A 5GL9A 3WS0A 1WYCA 3GQZA 5AQBA 1Y28A 3LIBA 3UB5P 4FSFA 1F5MA 5HWWA 3NI9A 1VQQA 4FUWA 3T4LA 4S2OA 2DBOA 1YSQA 3FPVA 3VE4A 3ZHHA 3HUMA 5EPHA 4F3LA 1MKMA 2PD8A 4BMWA 2ZM0A 3AGFA 3TSGA 1RCJA 1YMSA 5HL6A 2OAP1 5FASA 1XJ2A 2G2UA 3VFHA 1DP9A 1TDLA 2ZQDA 1O7EA 2ZL1B 3PR6A 2V0WA 5CGSA 1FSYA 3LI9A 4CPKA 1YAXA 3U4LP 1O07A 2OLVA 1IFQA 3G30A 2WKPA 3T4JA 3DAVA 3IWIA 3BY8A 5J8XA 1MXOA 2PT7A 2QJ7A 2HL0A 5HAQA 1MC0A 4S02A 4R1GA 5F82A 3UE1A 2VX8A 4JXSA 4IHQA 2EX6A 3NDGA 2WK0A 4WM9A 4RRIA 3UDFA 4Z9QA 3H82A 2HP9A 5HW3A 1VB6A 3ZNTA 4MEZA 4LRZE 1ZG4A 3QNBA 4OKPA 4FCFA 4E3IA 4D60A 2JN7A 4YOFA 2NUTC 3NJAA 2M1CA 2RCXA 1N9BA 4C6YA 1FIKA 3IHBA 3VE3A 1I2WA 4S03A 2QPNA 1WA9A 4OQGA 4RRGA 1CI8A 1H5XA 2BTFP 2XQZA 1CK3A 1OTBA 4EV4A 3BLMA 4X55A 3LI8A 4GDNA 2W1TA 4JGPA 3B42A 5HX9A 3FC7A 1WE4A 3RTYA 1UWNX 2KX6A 5DF7A 4HESA 2W0NA 3IX8A 3QHYA 2B18A 1RGYA 4Y0TA 3IF6A 4WEKA 2XGNA 3ZYTA 3Q82A 2V1ZA 1XGIA 1G68A 5FSRA 1GHMA 4LRXC 3OPHA 4IJGA 2BLSA 3DTMA 1SHVA 4WZ5C 4S2PA 2HKZA 4RR8A 1NRFA 1T1AA 4K08A 4AFIA 1XX2A 2J3TD 2DNSA 3F1PB 4BL3A 4K91A 3KO4A 4RYEA 4R3AA 3T1QB 1P0ZA 2J80A 2XR0A 2CC1A 4RRCA 4H6JB 4E3MA 1W63M 2IA2A 4KZ6A 3UB9A 4GB7A 2UWXA 2JCHA 4HI4A 2V8CA 3RXXA 5GLDA 1Y54A 4LGWA 3CUEC 1T1BA 3ZVWA 5EVIA 2X71A 1P9WA 2P08A 1UWPX 3CPTB 3HCYA 3F1PA 4BD0A 1K57A 1YLTA 3GRJA 5KSCA 3MF0A 4GW9A 5DKKA 4DDSA 1XGJA 4X68A 5JYPA 1STZA 2HDUA 1KVMA 4OP5A 1F98A 5CGXA 5CGWA 3FWLA 3CLOA 5F68A 4RRMA 1YLYA 2EWVA 2EX9A 2Q9NA 4B93A 5CHMA 1MZUA 2MJ6A 3G35A 3T4TA 3CPTA 1JNUA 2LB5A 3QP5A 5M1AA 1Q2PA 3KSFA 4QY6A 3PXPA 1XA7A 4NG2A 2LB9A 1MWSA 1HLUP 1OJGA 4R6LA 5HWVA 1ALQA 5EFWA 3LIDA 5DVAA 3F1OA 4P87A 1OT6A 1S0WA 3DTEA 2EFUA 4S0LA 2VEAA 4HNBA 4WLAA 2Y91A 2W3EA 5FI6A 1RP5A 3S22A 3L7HA 1DP8A 5I94A 5FEFA 1NY0A 4EUZA 5FQJA 3S7NA 3A0RA 4EETB 4DN0A 1K56D 3WS1A 1IYQA 4KZ7A 4S2NA 5AQ9A 3KNFA 2XRNA 3D3OA 5J4EA 5CTNA 2OV5A 4EQ1A 5M18A 2WYXA 4II7A 3VSKA 3A0SA 2H5SA 3D4FA 2PBDP 5HWTA 5EVEA 4MLLA 3OCNA 1H8YA 1QMEA 5A91A 3UE6A 4RRJA 4KUOA 2WZZA 3LEQA 3IXHA 4UQIS 3HLEA 2VA0A 3NOTC 4BWIA 2ZQ9A 4OVDA 1BTLA 3Q7VA 1KVLA 4JBFA 4WUJA 5F83A 1PWCA 5GHZA 1AWIA 3IX3A 1YT4A 4UA6A 3V3RA 2ZOIA 1YMXA 2GJ3A 3T1RA 3T4KA 2Y2IA 5HDDA 3BFFA 4O8GA 1WYBA 2R78A 2OWHA 3LMUA 4Y17A 5KIZA 1YLJA 2J3TC 4EWFA 5CEDA 1L0EA 3E4QA 3HJKA 4B4ZA 3HLFA 4RVAA 2XSSA 4P85A 3MMHA 3PHYA 1Q2QA 1KGFA 3HVFA 3S4XA 3IWOA 4B88A 4OPQA 1N9NA 4JGOA 3DTIA 4LENA 1Z09A 2ZC7A 4NXFA 3MJQA 2Y2JA 3ZG7B 2WKQA 4GLQA 4N9KA 2VZWA 1G28A 4KZ5A 2W3GA 2Y2GA 1KDWA 2Z6DA 4X56A 4QY5A 3EWKA 2WGVA 2HDSA 3E4PA 1DJAA 1IEMA 5EOEA 2VGKA 4K0XA 4FH2A 3LMTA 1ZC2A 3N8LA 1IYPA 1BYWA 2Y2MA 2OAQ1 1TS8A 1MBLA 2HPBA 5E43A 3M2JA 3WWXA 1ZG6A 5JYOA 3MXQA 5FAPA
chains in the Genus database with same CATH topology
3MZDA 4QHCA 1J9MA 1ONHA 1O7EA 1TDLA 2ZQDA 5EVIB 1K4EA 1PI5A 2Y59A 4XXRA 5CGSA 1FSYA 2G2WA 3NDEA 1S6RA 3O86A 1KDSA 4FD8A 4OH0A 1K55A 4RRRA 1C3BA 4CPKA 3C4OA 4RRQA 1SKFA 4A5RA 4KQOA 1O07A 2OLVA 3G30A 5EVIC 1NJ4A 3PBRA 4OLGA 3G2YA 3IWIA 4MBKA 3UN7A 5J8XA 3BRMA 1W79A 1K54C 4GDBA 1MXOA 1MWRA 1KE4A 4WZ4A 4DXBA 3LY4A 3C4PA 2XEPA 4R4RA 4R3JA 3VP2A 3KO3A 4ZTKA 1JTDA 4BQMA 2PU2A 1PWDA 1L0DA 3M2KA 5HAQA 2HL0A 4RRKA 5E2EA 4RRHA 3QNCA 4P0MA 4DE2A 3HLWA 4E6XA 5E2HA 1FR6A 1HD8A 4E6WA 3PAEA 3N4IA 5FQ9A 3S1YA 4S02A 2A3UA 4KQQA 3SH9A 4R1GA 1HVBA 4ID4A 2Y2HA 5F82A 3UE1A 5KMWA 1MWTA 4JXSA 4RRLA 2XDMA 3W4PA 2EX6A 4BJPA 2Y2LA 3W8KA 1W8YA 4Q8IA 3UE0A 2WAEA 1J7GA 4KZAA 3NDGA 3M6HA 1SDNA 3UDXA 3NC8A 2WK0A 4WM9A 4X6TA 4RRIA 2Y2QA 1BLSA 4N9LA 5CECA 3UDFA 3BYDA 5M19A 5FQQA 1ONGA 1NXYA 3N6IA 2ZM2A 4Z9QA 5G18A 2HP9A 5FDHA 3FV7A 5HW3A 4OQ0A 2EXBA 4KZ9A 3ZNTA 4M3KA 3SS3A 3ZG5A 3A3FA 4Y0OA 5TR7A 2J9PA 4MEZA 1ZG4A 1XA1A 4XUZA 3QNBA 3C5AA 1I2SA 4OKPA 4WYYA 4X69A 5TFQA 1TC5A 2GDNA 2PBYA 4FCFA 4HBTA 4JXGA 5HAIA 3BEBA 3SS5A 4RRBA 4E3IA 1FCMA 1PZOA 4GKUA 3MBZA 4GNUA 3TG9A 1K38A 2XFTA 4EBPA 1PW1A 4KZ8A 5BOHA 2RCXA 1YLPA 1N9BA 5EVLA 4DRTA 1LLBA 4C6YA 3IHBA 4U0TA 5HARA 1I2WA 1FCNA 5FATA 4GOGA 4S03A 1TEMA 2QPNA 3OPLA 1LI9A 1BULA 1PIOA 4OQGA 4PPRA 4RRGA 4GN2A 1CI8A 1H5XA 5GLAA 4RR6A 3WS5A 2X01A 1KE3A 5EVID 2XQZA 1CK3A 2V2FF 3SH7A 4WEJA 2HDRA 4EV4A 1M40A 3FZCA 3PBSA 3BLMA 2WGWA 1MPLA 2B5RA 4X55A 5CERA 3KODA 4GDNA 3HLGA 3V50A 1G6AA 1PWGA 5HX9A 3LMVA 1SCWA 4DE1A 2J8YA 1WE4A 3OZHA 3PD3A 5D3OA 4LV1A 5DF7A 5FQMA 2OLUA 4Y0UA 2JBFA 4HESA 3SS4A 2HL1A 1TDGA 3OPPA 4OOMA 3HLDA 4RX3A 3GVBA 3QHYA 3CMZA 1RGYA 4R3BA 1FCOA 1H8ZA 4IEDA 4S2NC 3IF6A 4WEKA 4Y0TA 2XGNA 5E2GA 1JWZA 1MY8A 3ZG9B 3Q82A 2V1ZA 1XGIA 1G68A 5FSRA 1BUEA 1E4DA 1IYOA 1JWVA 2WKHA 5FA7A 3UO9A 1Y2QA 4EQIA 2H10A 1GHMA 3MXSA 4E3KA 2XH9A 1K55C 4RR7A 3G2ZA 3OPHA 4HBUA 2BLSA 3DTMA 1SHVA 4JF4A 4WZ5C 4S2PA 2HKZA 4UA7A 1GHPA 3VP1A 2IWCA 4RR8A 1NRFA 1W8QA 1QMFA 1XX2A 4IBRA 2DNSA 3HREA 5EUAA 3Q7VB 2JC7A 4ZJ1A 1IELA 3VSLA 2R9XA 4BL3A 5A92A 4K91A 1IKGA 1M6KA 5DF9A 1AXBA 3KO4A 3Q1FA 1IYSA 4RYEA 4X53A 1L0GA 2EXAA 4S0IA 1K6RA 3A3DA 5FQKA 1K25A 4ZDXA 2Y2KA 5CHJA 5CEBA 2XR0A 5F1GA 5EOOA 2CC1A 4RRCA 5A93A 1MWUA 1XPBA 1BLPA 4OONA 5GHXA 4E3MA 3KNPA 2IWBA 3CJMA 3ZG0A 1E3UD 1GA0A 2XD1A 4KZ6A 3SH8A 1EI5A 2Y4AA 2Y2NA 2IWDA 3IH9A 4KG5A 4MNRA 1RGZA 4GB7A 4P6BA 3LCEA 1BLHA 2JCHA 2UWXA 4R0QA 2DRWA 4KQRA 1XKZA 3OC2A 5HL1A 1LL5A 4QU3A 3PD4A 3RXXA 2VGJA 1ERQA 4KENB 5GLDA 4C75A 1Y54A 3PBTA 3WS2A 3EQVA 4DDYA 2Y2OA 1NZUA 3O88A 4S2MA 3WS4A 4WBGA 3ZVWA 2Q9MA 4FH4A 5EVIA 1ES2A 3A3IA 3CZDA 2X71A 2P74A 5DTSA 3KO7A 1ZKJA 4RX2A 5FAOA 4BD1A 4BD0A 3ZGAB 3ZCZA 3MZEA 1K57A 1YLTA 3GRJA 3KOBA 5KSCA 1CI9A 1OMEA 2Z2LB 3E2LA 5L2FA 3ISGA 2WKIA 4BLMA 2HP5A 3UY6A 4DDSA 4QB8A 3MZFA 1XGJA 1YQSA 3HL9A 4X68A 3DW0A 3DWKA 5JYPA 4ZJ3A 2ZC4B 5FAQA 4OOLA 3VOZA 4OP8A 1PI4A 3IT9A 2HDUA 4U3TA 3IQAA 4JPMA 1KVMA 2RL3A 4RRFA 2DCFA 4OP5A 4KZBA 3MKEA 1BZAA 3TOIA 1N4OA 5CGXA 4KG6A 4GD8A 2H0YA 3PD2A 5CGWA 4ZAMA 3KO9A 2WZXA 4LV0A 5GLCA 1K6SA 3FWLA 4RRMA 3W4QA 3AGDA 1XXMA 1YLWA 3LO7A 4E3JA 3FKVA 1YLYA 2WKEA 5A90A 3ZDJA 2EX9A 4R23A 2Q9NA 2ZC5B 3P09A 4S2LA 5CHMA 3NBLA 3SOIA 5F1FA 2XFSA 5TGFA 2X02A 5U47A 2R9WA 4S2JA 2QMIA 3G35A 3G34A 1BSGA 4WMCA 1LL9A 3NY4A 1PW8A 4JF6A 3IF6C 4JXWA 4R4SA 5M1AA 1Q2PA 4QY6A 1ES5A 1HZOA 1XA7A 4XUXA 4OQIA 4KZ4A 1MWSA 3CG5A 1EROA 2FFFB 4UA9A 5IHVA 3GMWA 1ALQA 2ZC6B 2J9OA 4MBHA 2WGIA 2ZM8A 3PAGA 5DVAA 1E3UA 2WUQA 4P87A 3GV9A 4N92A 1S0WA 3GR2A 3PBNA 4KG2A 5EE8A 2EFUA 1K4FA 4S0LA 3BECA 3V3SA 4OQHA 3B3XA 2WAFA 4PM7A 5J61A 4OLDA 1MKIA 1HTZA 4JXVA 3WRZA 2ZQ7A 1JWPA 3LEZA 4LCMA 2Y91A 4E3LA 1L2SA 3IXBA 5FI6A 2HDQA 1RP5A 3S22A 1ESUA 1GHIA 4RR9A 4OOYA 4C3QA 5I94A 2PU4A 4OPZA 1PZPA 1NY0A 4EUZA 4PMAA 4WMCD 5FQJA 3UE3A 3UPPA 4DKIA 3UDIA 3FYZA 4H8RA 2OSUA 4NBJA 1JKEA 1KGEA 2ZQ8A 4IVKA 1K56D 2JE5A 4RRDA 3WS1A 1IYQA 1KE0A 4KZ7A 4S2NA 4N1HA 5HFOA 4LCLA 5AQ9A 3KNFA 2V20A 1NYYA 5CTNA 2P9VB 1EWZA 3HLCA 4JF5A 5FQIA 3PBOA 2OV5A 3ZG8B 4UHUA 5DF8A 4IBXA 3N8RA 5M18A 3RJUA 2WYXA 3Q81A 5HAPA 1IKIA 1YM1A 3IXGA 3HUOA 1SDEA 3VSKA 1ERMA 3OCLA 2H5SA 3AGEA 3D4FA 3FKWA 4WZ5A 4BENA 1L0FA 5DTTA 1CEFA 1W7FA 1DJBA 4GZBA 4MLLA 3OCNA 3IXDA 1TVFA 3HLBA 1H8YA 1W5DA 1QMEA 5A91A 4DXCA 4ZBEA 1K57C 5FI7A 1E25A 3O87A 4RRJA 3PBQA 2WZZA 3ZFZA 5AQ7A 3BFDA 3IXHA 5GLBA 3VOYA 3VP0A 3HLEA 4EBNA 1ESIA 4S2IA 3BFCA 5KZHA 2A49A 2ZQ9A 3HBRA 2ZJ9A 4OVDA 1BTLA 3Q7VA 4DE0A 1K54A 1KVLA 2J7VA 3ITBA 3IWQA 5CRFA 3C7UA 4JBFA 1ES4A 5KSHA 3BM6A 4OPYA 3DWZA 5F83A 3OPRA 3ZNYA 4E3NA 4WELA 4U0XA 3P98A 1PWCA 4RA7A 5GHZA 3V39A 2H0TA 3ZVTA 1YT4A 2BG1A 4UA6A 3V3RA 3G32A 2ZQAA 4HEFA 3VMAA 4JLFA 4GD6A 1YMXA 5FI2A 4S0JA 2EX2A 2P9VA 4NETA 1JVJA 2HL2A 2Y2IA 4UAAA 3NIAA 4QJGA 1VM1A 2QZ6A 2WGWB 3A3JA 1WYBA 3BFFA 3Q7ZA 3PD5A 4PM6A 3JYIA 4RRAA 1LHYA 2EX8A 3MXRA 5CTMA 3LMUA 3BFGA 4MBFA 4CJNA 1FQGA 4BL2A 1YLJA 1CEGA 4PM5A 3BFEA 2ZMAA 4DF6A 4EWFA 5CEDA 1L0EA 1FR1A 4S0KA 5CHUA 1DY6A 1DJCA 1KGGA 2ZD8A 4B4ZA 3HLFA 4DE3A 2OKVA 4RVAA 1NZOA 1BT5A 2ZQCA 4O7DA 4D2OA 1NYMA 3BLSA 4P85A 1Q2QA 4EBLA 3IF6B 3UPOA 1I5QA 1KGFA 2WADA 3I7JA 2C6WB 2FFYA 3MFDA 3HVFA 4N1XA 1PYYA 3HUNA 3S4XA 2E8IA 3WRTA 1GCEA 3IWOA 3M6BA 2XF3A 3GSGA 4LV3A 4B88A 4OPQA 3ITAA 4B4XA 4K0WA 2EFXA 5AQAA 4L0LA 5E2FA 4LENA 3LY3A 1K56A 3E2KA 3UPNA 3NCKA 1JTGA 1YLZA 2ZC7A 2HP6A 2Y2JA 4KZ3A 2Y55A 2XD5A 4QD4A 5GL9A 4ZJ2A 3ZG7B 5GHYA 3WS0A 1WYCA 4NK3A 4N9KA 2I72A 3GQZA 4E3OA 4KZ5A 2Y2GA 1FOFA 1KDWA 3GTCA 5AQBA 4PM9A 1BLCA 4IVIA 3W4OA 3PTEA 4FSFA 4F94A 3C7VA 3NI9A 5DTKA 4X56A 1GA9A 1VQQA 4QY5A 3VP3A 3O3VA 3MKFA 4S2OA 3UNWA 5EECA 2DBOA 2WGVA 2HDSA 2Y2PA 2Z2MB 3VP4A 4YINA 3ZHHA 1XP4A 1DJAA 3N7WA 3HUMA 1IEMA 5EPHA 5EOEA 3IF5A 4OPRA 2VGKA 4K0XA 2C5WB 3EQUA 3Q07A 2ZC3B 3RXWA 4FH2A 3LMTA 3IH8A 1ZC2A 3G4PA 3N8LA 1IYPA 2XLNA 4S2KA 1U60A 2ZM0A 4YFMA 3AGFA 3TSGA 4JKTA 3VFFA 1RCJA 3N8SA 1YMSA 2Y2MA 3IHAA 5FASA 3V5MA 1FSWA 1MBLA 1ES3A 3A3EA 2HPBA 5E43A 3M2JA 3KO5A 2G2UA 4Y7PA 5CXWA 3WWXA 1ZG6A 4LV2A 3KOCA 1Z6FA 5JYOA 3VFHA 2XK1A 4NBIA 4PM8A 1LI0A 3G31A 2ZLYA 5FAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZD A;  4QHC A;  1J9M A;  1ONH A;  1O7E A;  1TDL A;  2ZQD A;  5EVI B;  1K4E A;  1PI5 A;  2Y59 A;  4XXR A;  5CGS A;  1FSY A;  2G2W A;  3NDE A;  1S6R A;  3O86 A;  1KDS A;  4FD8 A;  4OH0 A;  1K55 A;  1C3B A;  4CPK A;  3C4O A;  1SKF A;  4A5R A;  4KQO A;  1O07 A;  2OLV A;  3G30 A;  5EVI C;  1NJ4 A;  3PBR A;  4OLG A;  3G2Y A;  3IWI A;  4MBK A;  3UN7 A;  5J8X A;  3BRM A;  1W79 A;  1K54 C;  4GDB A;  1MXO A;  1MWR A;  1KE4 A;  4WZ4 A;  4DXB A;  3LY4 A;  3C4P A;  2XEP A;  4R4R A;  4R3J A;  3VP2 A;  4ZTK A;  1JTD A;  4BQM A;  2PU2 A;  1PWD A;  1L0D A;  3M2K A;  5HAQ A;  5E2E A;  3QNC A;  4P0M A;  4DE2 A;  3HLW A;  4E6X A;  5E2H A;  1FR6 A;  1HD8 A;  4E6W A;  3PAE A;  3N4I A;  5FQ9 A;  3S1Y A;  2A3U A;  4KQQ A;  3SH9 A;  4R1G A;  1HVB A;  4ID4 A;  2Y2H A;  5F82 A;  3UE1 A;  5KMW A;  1MWT A;  4JXS A;  2XDM A;  3W4P A;  2EX6 A;  4BJP A;  2Y2L A;  3W8K A;  1W8Y A;  4Q8I A;  3UE0 A;  2WAE A;  4KZA A;  3NDG A;  3M6H A;  1SDN A;  3UDX A;  3NC8 A;  2WK0 A;  4WM9 A;  4X6T A;  2Y2Q A;  1BLS A;  4N9L A;  5CEC A;  3UDF A;  3BYD A;  5M19 A;  5FQQ A;  1ONG A;  1NXY A;  3N6I A;  2ZM2 A;  4Z9Q A;  5G18 A;  2HP9 A;  5FDH A;  3FV7 A;  5HW3 A;  4OQ0 A;  2EXB A;  4KZ9 A;  3ZNT A;  4M3K A;  3SS3 A;  3ZG5 A;  3A3F A;  4Y0O A;  5TR7 A;  2J9P A;  4MEZ A;  1ZG4 A;  1XA1 A;  4XUZ A;  3QNB A;  3C5A A;  1I2S A;  4OKP A;  4WYY A;  4X69 A;  5TFQ A;  2GDN A;  2PBY A;  4FCF A;  4HBT A;  4JXG A;  5HAI A;  3BEB A;  3SS5 A;  4E3I A;  1FCM A;  1PZO A;  4GKU A;  3MBZ A;  4GNU A;  3TG9 A;  1K38 A;  2XFT A;  4EBP A;  1PW1 A;  4KZ8 A;  5BOH A;  2RCX A;  1YLP A;  1N9B A;  5EVL A;  4DRT A;  1LLB A;  4C6Y A;  3IHB A;  4U0T A;  5HAR A;  1I2W A;  1FCN A;  5FAT A;  4GOG A;  1TEM A;  2QPN A;  3OPL A;  1LI9 A;  1BUL A;  1PIO A;  4OQG A;  4PPR A;  4GN2 A;  1CI8 A;  1H5X A;  5GLA A;  3WS5 A;  2X01 A;  1KE3 A;  5EVI D;  2XQZ A;  1CK3 A;  2V2F F;  3SH7 A;  4WEJ A;  2HDR A;  4EV4 A;  1M40 A;  3FZC A;  3PBS A;  3BLM A;  2WGW A;  1MPL A;  2B5R A;  4X55 A;  5CER A;  4GDN A;  3HLG A;  3V50 A;  1G6A A;  1PWG A;  5HX9 A;  1SCW A;  4DE1 A;  2J8Y A;  1WE4 A;  3OZH A;  5D3O A;  4LV1 A;  5DF7 A;  5FQM A;  2OLU A;  4Y0U A;  2JBF A;  4HES A;  3SS4 A;  1TDG A;  3OPP A;  4OOM A;  3HLD A;  4RX3 A;  3GVB A;  3QHY A;  3CMZ A;  1RGY A;  4R3B A;  1FCO A;  1H8Z A;  4IED A;  4S2N C;  3IF6 A;  4WEK A;  4Y0T A;  2XGN A;  5E2G A;  1JWZ A;  1MY8 A;  3ZG9 B;  3Q82 A;  2V1Z A;  1XGI A;  1G68 A;  5FSR A;  1BUE A;  1E4D A;  1IYO A;  1JWV A;  2WKH A;  5FA7 A;  3UO9 A;  4EQI A;  2H10 A;  1GHM A;  3MXS A;  4E3K A;  2XH9 A;  1K55 C;  3G2Z A;  3OPH A;  4HBU A;  2BLS A;  3DTM A;  1SHV A;  4JF4 A;  4WZ5 C;  4S2P A;  4UA7 A;  1GHP A;  3VP1 A;  2IWC A;  1NRF A;  1W8Q A;  1QMF A;  1XX2 A;  4IBR A;  2DNS A;  3HRE A;  5EUA A;  3Q7V B;  2JC7 A;  4ZJ1 A;  1IEL A;  3VSL A;  2R9X A;  4BL3 A;  5A92 A;  4K91 A;  1IKG A;  1M6K A;  5DF9 A;  1AXB A;  3Q1F A;  1IYS A;  4RYE A;  4X53 A;  1L0G A;  2EXA A;  1K6R A;  3A3D A;  5FQK A;  1K25 A;  4ZDX A;  2Y2K A;  5CHJ A;  5CEB A;  2XR0 A;  5F1G A;  5EOO A;  2CC1 A;  5A93 A;  1MWU A;  1XPB A;  1BLP A;  4OON A;  5GHX A;  4E3M A;  2IWB A;  3CJM A;  3ZG0 A;  1E3U D;  1GA0 A;  2XD1 A;  4KZ6 A;  3SH8 A;  1EI5 A;  2Y4A A;  2Y2N A;  2IWD A;  3IH9 A;  4KG5 A;  4MNR A;  1RGZ A;  4GB7 A;  4P6B A;  3LCE A;  1BLH A;  2JCH A;  2UWX A;  4R0Q A;  2DRW A;  4KQR A;  1XKZ A;  3OC2 A;  5HL1 A;  1LL5 A;  4QU3 A;  3RXX A;  2VGJ A;  1ERQ A;  4KEN B;  5GLD A;  4C75 A;  1Y54 A;  3PBT A;  3WS2 A;  3EQV A;  4DDY A;  2Y2O A;  1NZU A;  3O88 A;  4S2M A;  3WS4 A;  4WBG A;  3ZVW A;  2Q9M A;  4FH4 A;  5EVI A;  1ES2 A;  3A3I A;  3CZD A;  2X71 A;  2P74 A;  5DTS A;  1ZKJ A;  4RX2 A;  5FAO A;  4BD1 A;  4BD0 A;  3ZGA B;  3ZCZ A;  3MZE A;  1K57 A;  1YLT A;  3GRJ A;  5KSC A;  1CI9 A;  1OME A;  2Z2L B;  3E2L A;  5L2F A;  3ISG A;  2WKI A;  4BLM A;  2HP5 A;  3UY6 A;  4DDS A;  4QB8 A;  3MZF A;  1XGJ A;  1YQS A;  3HL9 A;  4X68 A;  3DW0 A;  3DWK A;  5JYP A;  4ZJ3 A;  2ZC4 B;  5FAQ A;  4OOL A;  3VOZ A;  4OP8 A;  1PI4 A;  3IT9 A;  2HDU A;  4U3T A;  3IQA A;  4JPM A;  1KVM A;  2RL3 A;  2DCF A;  4OP5 A;  4KZB A;  3MKE A;  1BZA A;  3TOI A;  1N4O A;  5CGX A;  4KG6 A;  4GD8 A;  2H0Y A;  5CGW A;  4ZAM A;  2WZX A;  4LV0 A;  5GLC A;  1K6S A;  3FWL A;  3W4Q A;  3AGD A;  1XXM A;  1YLW A;  3LO7 A;  4E3J A;  3FKV A;  1YLY A;  2WKE A;  5A90 A;  3ZDJ A;  2EX9 A;  4R23 A;  2Q9N A;  2ZC5 B;  3P09 A;  4S2L A;  5CHM A;  3NBL A;  3SOI A;  5F1F A;  2XFS A;  5TGF A;  2X02 A;  5U47 A;  2R9W A;  4S2J A;  2QMI A;  3G35 A;  3G34 A;  1BSG A;  4WMC A;  1LL9 A;  3NY4 A;  1PW8 A;  4JF6 A;  3IF6 C;  4JXW A;  4R4S A;  5M1A A;  1Q2P A;  4QY6 A;  1ES5 A;  1HZO A;  1XA7 A;  4XUX A;  4OQI A;  4KZ4 A;  1MWS A;  3CG5 A;  1ERO A;  2FFF B;  4UA9 A;  5IHV A;  3GMW A;  1ALQ A;  2ZC6 B;  2J9O A;  4MBH A;  2WGI A;  2ZM8 A;  3PAG A;  5DVA A;  1E3U A;  2WUQ A;  4P87 A;  3GV9 A;  4N92 A;  1S0W A;  3GR2 A;  3PBN A;  4KG2 A;  5EE8 A;  2EFU A;  1K4F A;  3BEC A;  3V3S A;  4OQH A;  3B3X A;  2WAF A;  4PM7 A;  4OLD A;  1MKI A;  1HTZ A;  4JXV A;  3WRZ A;  2ZQ7 A;  1JWP A;  3LEZ A;  4LCM A;  2Y91 A;  4E3L A;  1L2S A;  3IXB A;  5FI6 A;  2HDQ A;  1RP5 A;  3S22 A;  1ESU A;  1GHI A;  4OOY A;  4C3Q A;  5I94 A;  2PU4 A;  4OPZ A;  1PZP A;  1NY0 A;  4EUZ A;  4PMA A;  4WMC D;  5FQJ A;  3UE3 A;  3UPP A;  4DKI A;  3UDI A;  3FYZ A;  4H8R A;  2OSU A;  1KGE A;  2ZQ8 A;  4IVK A;  1K56 D;  2JE5 A;  3WS1 A;  1IYQ A;  1KE0 A;  4KZ7 A;  4S2N A;  4N1H A;  5HFO A;  4LCL A;  5AQ9 A;  2V20 A;  1NYY A;  5CTN A;  2P9V B;  1EWZ A;  3HLC A;  4JF5 A;  5FQI A;  3PBO A;  2OV5 A;  3ZG8 B;  4UHU A;  5DF8 A;  4IBX A;  3N8R A;  5M18 A;  3RJU A;  2WYX A;  3Q81 A;  5HAP A;  1IKI A;  1YM1 A;  3IXG A;  3HUO A;  1SDE A;  3VSK A;  1ERM A;  3OCL A;  2H5S A;  3AGE A;  3D4F A;  3FKW A;  4WZ5 A;  4BEN A;  1L0F A;  5DTT A;  1CEF A;  1W7F A;  1DJB A;  4GZB A;  4MLL A;  3OCN A;  3IXD A;  1TVF A;  3HLB A;  1H8Y A;  1W5D A;  1QME A;  5A91 A;  4DXC A;  4ZBE A;  1K57 C;  5FI7 A;  1E25 A;  3O87 A;  3PBQ A;  2WZZ A;  3ZFZ A;  5AQ7 A;  3BFD A;  3IXH A;  5GLB A;  3VOY A;  3VP0 A;  3HLE A;  4EBN A;  1ESI A;  4S2I A;  3BFC A;  5KZH A;  2A49 A;  2ZQ9 A;  3HBR A;  2ZJ9 A;  4OVD A;  1BTL A;  3Q7V A;  4DE0 A;  1K54 A;  1KVL A;  2J7V A;  3ITB A;  3IWQ A;  5CRF A;  3C7U A;  4JBF A;  1ES4 A;  5KSH A;  3BM6 A;  4OPY A;  3DWZ A;  5F83 A;  3OPR A;  3ZNY A;  4E3N A;  4WEL A;  4U0X A;  3P98 A;  1PWC A;  4RA7 A;  5GHZ A;  3V39 A;  2H0T A;  3ZVT A;  1YT4 A;  2BG1 A;  4UA6 A;  3V3R A;  3G32 A;  2ZQA A;  4HEF A;  3VMA A;  4JLF A;  4GD6 A;  1YMX A;  5FI2 A;  2EX2 A;  2P9V A;  4NET A;  1JVJ A;  2Y2I A;  4UAA A;  3NIA A;  4QJG A;  1VM1 A;  2QZ6 A;  2WGW B;  3A3J A;  1WYB A;  3BFF A;  3Q7Z A;  4PM6 A;  3JYI A;  1LHY A;  2EX8 A;  3MXR A;  5CTM A;  3BFG A;  4MBF A;  4CJN A;  1FQG A;  4BL2 A;  1YLJ A;  1CEG A;  4PM5 A;  3BFE A;  2ZMA A;  4DF6 A;  4EWF A;  5CED A;  1L0E A;  1FR1 A;  5CHU A;  1DY6 A;  1DJC A;  1KGG A;  2ZD8 A;  4B4Z A;  3HLF A;  4DE3 A;  4RVA A;  1NZO A;  1BT5 A;  2ZQC A;  4O7D A;  4D2O A;  1NYM A;  3BLS A;  4P85 A;  1Q2Q A;  4EBL A;  3IF6 B;  3UPO A;  1I5Q A;  1KGF A;  2WAD A;  3I7J A;  2C6W B;  2FFY A;  3MFD A;  3HVF A;  4N1X A;  1PYY A;  3HUN A;  3S4X A;  2E8I A;  3WRT A;  1GCE A;  3IWO A;  3M6B A;  2XF3 A;  3GSG A;  4LV3 A;  4B88 A;  4OPQ A;  3ITA A;  4B4X A;  4K0W A;  2EFX A;  5AQA A;  4L0L A;  5E2F A;  4LEN A;  3LY3 A;  1K56 A;  3E2K A;  3UPN A;  3NCK A;  1JTG A;  1YLZ A;  2ZC7 A;  2HP6 A;  2Y2J A;  4KZ3 A;  2Y55 A;  2XD5 A;  4QD4 A;  5GL9 A;  4ZJ2 A;  3ZG7 B;  5GHY A;  3WS0 A;  1WYC A;  4NK3 A;  4N9K A;  2I72 A;  3GQZ A;  4E3O A;  4KZ5 A;  2Y2G A;  1FOF A;  1KDW A;  3GTC A;  5AQB A;  4PM9 A;  1BLC A;  4IVI A;  3W4O A;  3PTE A;  4FSF A;  4F94 A;  3C7V A;  3NI9 A;  5DTK A;  4X56 A;  1GA9 A;  1VQQ A;  4QY5 A;  3VP3 A;  3O3V A;  3MKF A;  4S2O A;  3UNW A;  5EEC A;  2WGV A;  2HDS A;  2Y2P A;  2Z2M B;  3VP4 A;  4YIN A;  3ZHH A;  1XP4 A;  1DJA A;  3N7W A;  3HUM A;  1IEM A;  5EPH A;  5EOE A;  3IF5 A;  4OPR A;  2VGK A;  4K0X A;  2C5W B;  3EQU A;  3Q07 A;  2ZC3 B;  3RXW A;  4FH2 A;  3IH8 A;  1ZC2 A;  3G4P A;  3N8L A;  1IYP A;  2XLN A;  4S2K A;  1U60 A;  2ZM0 A;  4YFM A;  3AGF A;  3TSG A;  4JKT A;  3VFF A;  1RCJ A;  3N8S A;  1YMS A;  2Y2M A;  3IHA A;  5FAS A;  3V5M A;  1FSW A;  1MBL A;  1ES3 A;  3A3E A;  2HPB A;  5E43 A;  3M2J A;  2G2U A;  4Y7P A;  5CXW A;  3WWX A;  1ZG6 A;  4LV2 A;  1Z6F A;  5JYO A;  3VFH A;  2XK1 A;  4PM8 A;  1LI0 A;  3G31 A;  2ZLY A;  5FAP A; 
#chains in the Genus database with same CATH topology
 4QHC A;  1J9M A;  4PKY G;  3K3C A;  3NDE A;  1S6R A;  4FD8 A;  3C4O A;  1SKF A;  5EVI C;  1NJ4 A;  4OLG A;  3G2Y A;  1K54 C;  4WZ4 A;  2A24 A;  4B9O A;  3G6O A;  1XFN A;  3KO3 A;  4ZTK A;  3CWF A;  1PWD A;  2W3F A;  4RRK A;  3QNC A;  4P0M A;  4E6X A;  1ZHH B;  5FQ9 A;  2BAS A;  4KQQ A;  2Y2H A;  1NLZ A;  5KMW A;  1D7E A;  3U2A A;  1W8Y A;  2O9B A;  4Q8I A;  2WAE A;  4G3V A;  2VGL M;  3UDX A;  3NC8 A;  2Y2Q A;  1LSX A;  3LUQ A;  5CEC A;  4CLC E;  4NEE D;  5M19 A;  5FQQ A;  3N6I A;  2HJE A;  3FV7 A;  3BQ8 A;  3A3F A;  3NUL A;  2VKS A;  2GZA A;  3D72 A;  1TC5 A;  2K31 A;  5TFQ A;  4HBT A;  4Z1W A;  3BEB A;  3SS5 A;  4EW7 A;  1FCM A;  4GNU A;  4GKU A;  4QWO A;  3TG9 A;  4HH3 A;  1PW1 A;  4KZ8 A;  1YLP A;  1ZTU A;  4DRT A;  5HAR A;  2JHE A;  1TEM A;  3OPL A;  1BUL A;  1PIO A;  4GN2 A;  2KLI A;  3WS5 A;  2V1A A;  1LT0 A;  3SH7 A;  1M40 A;  3FZC A;  2B5R A;  3KOD A;  2V8F A;  3NEC A;  1H8M A;  5AVF A;  5D3O A;  3T1X A;  1OTI A;  2OLU A;  2JBF A;  2HL1 A;  3CMZ A;  2W27 A;  4S2N C;  1JWZ A;  1MY8 A;  1DRM A;  3UO9 A;  1E4D A;  2NUP C;  2XH9 A;  4P6Z S;  1TS6 A;  1GHP A;  3EGD C;  1OTA A;  1W8Q A;  3HRE A;  5EUA A;  5A92 A;  3Q1F A;  4X53 A;  2EA9 A;  2QHK A;  3A0V A;  2Y2K A;  5AJG A;  2YKF A;  4UEY A;  5CEB A;  5A93 A;  1XPB A;  1BLP A;  1CF0 A;  5GHX A;  3KNP A;  2XD1 A;  4MNR A;  1H3Q A;  1RGZ A;  2PHY A;  4MN6 A;  5G4Y A;  2JKR M;  4KQR A;  4QU3 A;  3CI6 A;  4KEN B;  3WS2 A;  3EQV A;  1NZU A;  3WS4 A;  4WBG A;  3C38 A;  2Q9M A;  1ES2 A;  2ZL1 A;  1ZKJ A;  3MZE A;  1CI9 A;  3UME A;  3LIC A;  2Z2L B;  2HP5 A;  2Y8H A;  3DWK A;  1G6O A;  2ZC4 B;  1PRQ A;  5FAQ A;  4ETZ A;  4OP8 A;  3IT9 A;  4U3T A;  2V1B A;  2RL3 A;  1D06 A;  3MKE A;  3JVV A;  4Y13 A;  3TOI A;  2HV1 A;  4KG6 A;  2H0Y A;  2V9A A;  2L1M A;  3AGD A;  4L9E A;  5L07 A;  1YLW A;  3FKV A;  3KSG A;  2WKE A;  4CLC B;  4EUV A;  3NBL A;  5F1F A;  2XFS A;  3HJI A;  2Y79 A;  1YPR A;  2QMI A;  2P04 A;  4X25 A;  4R4S A;  1V9Y A;  4OQI A;  4KZ4 A;  3S7Q A;  3CG5 A;  5IHV A;  2ZC6 B;  2Q0O A;  2WGI A;  2ZM8 A;  4Y3I A;  2WUQ A;  3GR2 A;  3PBN A;  5DFX A;  4OQH A;  2WAF A;  4ZRR A;  4I38 A;  1HTZ A;  1EW0 A;  1JWP A;  3T1S A;  4E3L A;  4CLC A;  3MQQ A;  2PU4 A;  1PZP A;  4PMA A;  4DKI A;  3FYZ A;  4H8R A;  4NBJ A;  3H7W B;  4IVK A;  4L9F A;  3T4S A;  4RRD A;  5HFO A;  2E8J A;  2V20 A;  1NYY A;  3ZQ5 A;  5FEG A;  4Q0I A;  2P9V B;  1EWZ A;  3HLC A;  4JF5 A;  3PBO A;  5DF8 A;  4IBX A;  3LIF A;  4RQ9 A;  2V0U A;  2XRO A;  5HAP A;  1IKI A;  3IXG A;  4BBV A;  1ERM A;  3AGE A;  3T12 B;  4BEN A;  4Q0J A;  5DTT A;  1H0M A;  1W7F A;  4GZB A;  1W5D A;  4DJ3 A;  4DXC A;  2B02 A;  4O0P A;  4CLC D;  4WF0 A;  3ZFZ A;  3BFD A;  5GLB A;  4EBN A;  3CAX A;  5KZH A;  2A49 A;  2ZJ9 A;  2GX5 A;  5HPF A;  1K54 A;  2XA7 S;  3IWQ A;  3DWZ A;  3OPR A;  3H7W A;  2H0T A;  1LSW A;  4GD6 A;  2P9V A;  1OJ5 A;  4H6J A;  3NIA A;  1VM1 A;  2WGW B;  4IUK A;  4PM6 A;  3B47 A;  1LHY A;  4MBF A;  1FQG A;  2ZMA A;  4S0K A;  4MCW A;  5A8B A;  1KGG A;  3TRC A;  4I5S A;  1NZO A;  2D01 A;  4D2O A;  1NYM A;  3I7J A;  2C6W B;  3MFD A;  4N1X A;  1PYY A;  2E8I A;  1GCE A;  1F9I A;  4LV3 A;  4GCZ A;  1K56 A;  3E2K A;  3UPN A;  1GSW A;  4KZ3 A;  4ZJ2 A;  2XD5 A;  4QD4 A;  3LR5 A;  5F69 A;  3H9W A;  2O9C A;  1FOF A;  4PM9 A;  1BLC A;  4IVI A;  3W4O A;  3PTE A;  4F94 A;  4GS9 B;  5DTK A;  1GA9 A;  3R4K A;  3O3V A;  1VHM A;  3MKF A;  4YIN A;  4DJ2 A;  1TD5 A;  4OPR A;  1S1Y A;  2C5W B;  5HDC A;  3EQU A;  3Q07 A;  2ZC3 B;  3C30 A;  3BQA A;  4S2K A;  3VFF A;  3N8S A;  3V5M A;  1FSW A;  1ES3 A;  2ZMV A;  4HOI A;  4EU0 A;  4S0I A;  4LV2 A;  1Z6F A;  4NBI A;  5EM1 A;  5MC7 A;  5LBR A;  3S7P A;  1ONH A;  2I9V A;  2PD7 A;  1K4E A;  2AVX A;  1KDS A;  5IU1 A;  4RRR A;  5FDS A;  1C3B A;  4RRQ A;  4A5R A;  4EEU A;  3UN7 A;  5DFY A;  4GDB A;  1N9L A;  5C5K A;  1KE4 A;  1GSX A;  4DXB A;  3LY4 A;  3C4P A;  4PHT A;  3KYE A;  1P97 A;  3C2W A;  1JTD A;  2K7S A;  4HJ4 A;  5EV0 A;  5E2E A;  1X0O A;  4DE2 A;  1HD8 A;  4E6W A;  3PAE A;  3N4I A;  3S1Y A;  1HVB A;  4ID4 A;  1MWT A;  3TE8 A;  3E98 A;  3TW8 A;  3W8K A;  3BJN A;  3KO6 A;  4KZA A;  3M6H A;  1SDN A;  4X6T A;  4N9L A;  1ONG A;  1NXY A;  5DJU A;  2ZM2 A;  5G18 A;  2B95 A;  5FDH A;  4KZ9 A;  3ZG5 A;  5TR7 A;  3EEH A;  3EOI A;  5FL3 A;  3C5A A;  1I2S A;  4X69 A;  2GDN A;  4JXG A;  1ACF A;  2XFT A;  3CHW P;  2HGV A;  5EVL A;  4U0T A;  5FAT A;  4PPR A;  4RR6 A;  4M4X A;  2V2F F;  2ACG A;  3OBF A;  4WEJ A;  2M7U A;  3PBS A;  1MPL A;  4R70 A;  4CLC C;  5CER A;  3HLG A;  3LGO A;  3RFB A;  1SCW A;  2J8Y A;  3OZH A;  3PD3 A;  2D02 A;  5FQM A;  2M7V A;  4ME4 A;  3SS4 A;  5DKL A;  1J3W A;  2ZOH A;  4EXO A;  1S67 L;  1FCO A;  4IED A;  4Y2F A;  4MMN A;  5HSQ A;  3LR4 A;  2FH5 A;  3ZG9 B;  1JWV A;  2WKH A;  5FA7 A;  2H10 A;  3MXS A;  4FOF A;  4G3W A;  1K55 C;  4RR7 A;  3G2Z A;  4HBU A;  2PDR A;  1XJ3 A;  3LYX A;  4UA7 A;  4IBR A;  4LLO B;  4ZJ1 A;  1IKG A;  1M6K A;  4UQI M;  1AXB A;  4MN7 A;  5DF9 A;  2EXA A;  5FQK A;  4ZDX A;  5EOO A;  4HY8 A;  4HP9 A;  1MWU A;  2IWB A;  1E3U D;  1GA0 A;  1FIL A;  1EI5 A;  5TBM B;  2Y2N A;  2IWD A;  2INW A;  3IH9 A;  4P6B A;  1OTE A;  3LCE A;  1BLH A;  4R0Q A;  1PFL A;  3UB8 A;  2OOL A;  1XKZ A;  1LL5 A;  2HJ9 C;  4DMZ A;  3B33 A;  2VGJ A;  1ERQ A;  5AVE A;  3PBT A;  5TJJ A;  3O88 A;  3A3I A;  3CZD A;  5HPI A;  3QP6 A;  3KO7 A;  4RX2 A;  5FAO A;  4BD1 A;  3ZCZ A;  3KSH A;  3KOB A;  2W3D A;  3E2L A;  5L2F A;  3IBR A;  4BLM A;  3MZF A;  3HL9 A;  4KUK A;  5L8M A;  4NKP A;  1OTD A;  4OOL A;  3VOZ A;  1PI4 A;  4JPM A;  2DCF A;  4KZB A;  2VV7 A;  1N4O A;  4R38 A;  3PD2 A;  1K6S A;  3W4Q A;  1TF1 A;  3P01 A;  3LO7 A;  5I5L A;  4F3L B;  4R23 A;  2ZC5 B;  3P09 A;  2KDK A;  3SOI A;  2X02 A;  5U47 A;  2R9W A;  4S2J A;  1BSG A;  4WMC A;  1LL9 A;  3NY4 A;  1PW8 A;  3UB6 A;  3T50 A;  1DP6 A;  1VET B;  1T19 A;  3K2N A;  4XUX A;  1XJ6 A;  1ERO A;  2FFF B;  4UA9 A;  3GMW A;  2J9O A;  4MBH A;  3PAG A;  2L0W A;  3GV9 A;  1NRJ A;  4N92 A;  1T18 A;  1K4F A;  3V3S A;  3B3X A;  4PM7 A;  4OLD A;  4FTX A;  3WRZ A;  2ZQ7 A;  4LCM A;  3MS6 A;  2HDQ A;  2PRF A;  1LL8 A;  4OOY A;  3W2Z A;  4C3Q A;  4OPZ A;  4WMC D;  3UE3 A;  3LIA A;  5L09 A;  1JKE A;  4N1H A;  1VET A;  3F1N B;  3TJZ C;  3LFV A;  3ICY A;  4UHU A;  3K3D A;  3RJU A;  1SDE A;  2VV8 A;  2O99 A;  3OCL A;  3SW1 A;  3H82 B;  3JVU A;  3IXD A;  5HD3 A;  5J7E A;  3HLB A;  4ZBE A;  3ULF A;  1E25 A;  3O87 A;  3GEC A;  2VK3 A;  2VLG A;  5AQ7 A;  1GSV A;  3VOY A;  3VP0 A;  1ESI A;  4S2I A;  4GJ4 A;  5CRF A;  3C7U A;  1ES4 A;  5KSH A;  1ODV A;  4OPY A;  1A0K A;  2J3W A;  4WEL A;  4U0X A;  4HH2 A;  2BG1 A;  3G32 A;  2PR6 A;  2ZQA A;  4HEF A;  4JLF A;  1LSV A;  5FI2 A;  2EX2 A;  3F1N A;  4NET A;  2JKF A;  4UAA A;  3OOV A;  2QZ6 A;  3IX4 A;  2PR5 A;  2W1T B;  3JYI A;  4RRA A;  2ZBB A;  5CTM A;  3BFG A;  4CJN A;  1CEG A;  4EER A;  4PM5 A;  3BFE A;  4DF6 A;  1FR1 A;  5CHU A;  1DY6 A;  1DJC A;  2JKT I;  3VV4 A;  4E04 A;  2OKV A;  2ZQC A;  4O7D A;  1S4R A;  1CQA A;  4EBL A;  3GDI A;  3IF6 B;  2WAD A;  2KOI A;  2O0Y A;  2FFY A;  3MR0 A;  1T1C A;  1K0K A;  2XF3 A;  4YNR A;  4K0W A;  2EFX A;  3DBA A;  4L0L A;  3NOP C;  5E2F A;  3NCK A;  1YLZ A;  2HP6 A;  4P6Z M;  2QJ5 A;  4G3K A;  5GHY A;  4NK3 A;  5F5Y A;  1TS0 A;  2I72 A;  4Y5F A;  4E3O A;  3GTC A;  4NXG A;  4HIA A;  3C7V A;  5HDS A;  3MQ0 A;  5F6A A;  3UNW A;  5EEC A;  3E0Y A;  2Y2P A;  2Z2M B;  3VP4 A;  1XP4 A;  3N7W A;  3IF5 A;  1CJF A;  4HHD A;  3RXW A;  3IH8 A;  3G4P A;  2XLN A;  1U60 A;  4YFM A;  4JKT A;  3IHA A;  3A3E A;  1VEU B;  3KO5 A;  4Y7P A;  5CXW A;  3KOC A;  3NHQ A;  2XK1 A;  4PM8 A;  1KOU A;  1LI0 A;  3G31 A;  2ZLY A;  3VP3 A;  3MZD A;  5EVI B;  1PI5 A;  3D9Y A;  2Y59 A;  4XXR A;  2G2W A;  2P7J A;  3O86 A;  4I3A A;  3DTK A;  1K55 A;  4OH0 A;  4KQO A;  3CIT A;  3PBR A;  4MBK A;  3BRM A;  1W79 A;  1MWR A;  3T4Q A;  2XEP A;  4R4R A;  3O5Y A;  3R7W B;  4R3J A;  3VP2 A;  4BQM A;  2PU2 A;  3M2K A;  1L0D A;  4GHI B;  1OPX A;  3BY9 A;  4RRH A;  3HLW A;  4I3J A;  5E2H A;  1YKD A;  1FR6 A;  4YWZ A;  1D1J A;  1VEU A;  2A3U A;  3SH9 A;  4BBU A;  2K2N A;  4RRL A;  2XDM A;  3W4P A;  4BJP A;  1SZV A;  4HJ3 A;  4KQD A;  2Y2L A;  2W3H A;  1XFQ A;  2WKR A;  3UE0 A;  1J7G A;  2PAV P;  1BLS A;  3BYD A;  3FPW A;  4OQ0 A;  2EXB A;  4M3K A;  3SS3 A;  4Y0O A;  2J9P A;  2QYB A;  1XA1 A;  4XUZ A;  1G5U A;  3F1O B;  4WYY A;  1S4S A;  3R7W A;  2PBY A;  5HAI A;  4RRB A;  1PZO A;  3MBZ A;  4GHI A;  2JKG A;  1K38 A;  1NLY A;  4MDZ A;  4EBP A;  5BOH A;  2JKR I;  1LLB A;  1FCN A;  2ZMF A;  4GOG A;  1LI9 A;  5GLA A;  4WL9 A;  2X01 A;  1KE3 A;  5EVI D;  3JPU A;  2FZ0 A;  2HDR A;  5EM0 A;  4HP4 A;  2WGW A;  5DJT A;  3V50 A;  3IS2 B;  1G6A A;  1PWG A;  3LMV A;  4DE1 A;  2L4R A;  3QP2 A;  4LV1 A;  4QPR A;  4Y0U A;  1TDG A;  3OPP A;  4OOM A;  3HLD A;  4RX3 A;  3GVB A;  4R3B A;  1H8Z A;  5E2G A;  1BUE A;  1IYO A;  1Y2Q A;  4EQI A;  4E3K A;  2PYP A;  5J3W A;  3KSI A;  1N9O A;  4JF4 A;  3EEA A;  4IUH A;  3VP1 A;  2IWC A;  3IBJ A;  1QMF A;  4MN5 A;  4XT2 B;  4ETX A;  3Q7V B;  2JC7 A;  1IEL A;  4JGR A;  2R9X A;  3VSL A;  1IYS A;  4GS9 A;  4PKY A;  1L0G A;  3IS2 A;  1K6R A;  3A3D A;  1K25 A;  5CHJ A;  3UB7 A;  2W1R A;  2XA7 M;  3OLO A;  4I39 A;  2EWW A;  5F1G A;  4HQA A;  4OON A;  3CJM A;  3ZG0 A;  3VOL A;  4NXE A;  3SH8 A;  2Y4A A;  3LR3 A;  1IOU A;  4KG5 A;  4NXB A;  4I3I A;  4LRY C;  2DRW A;  2OWJ A;  3OC2 A;  5HL1 A;  4BBT A;  3PD4 A;  3FG8 A;  4C75 A;  2A2L A;  4DDY A;  3S7O A;  2Y2O A;  4S2M A;  4FH4 A;  5K5B A;  2P74 A;  5DTS A;  4XT2 A;  3ZGA B;  1F2K A;  1OME A;  3ISG A;  4Y15 A;  2WKI A;  3BWL A;  4CQH A;  3UY6 A;  4QB8 A;  1YQS A;  3DW0 A;  4O01 A;  4ZJ3 A;  2DMW A;  3IQA A;  4RRF A;  1BZA A;  4GD8 A;  2Z6C A;  4ZAM A;  3KO9 A;  2WZX A;  4LV0 A;  5GLC A;  1Y4O A;  2HF6 A;  1XXM A;  4Q0H A;  4E3J A;  1S66 L;  5A90 A;  3ZDJ A;  3T4O A;  1PNE A;  1XJ4 A;  4S2L A;  3MFX A;  2GNX A;  5TGF A;  2VGL S;  4PAU A;  2YKH A;  3G34 A;  1S1Z A;  4LFU A;  5CX7 A;  2O9A A;  4JGQ A;  4JF6 A;  1SKO B;  3IF6 C;  4JXW A;  1ES5 A;  1HZO A;  5HD5 A;  2H28 A;  2VV6 A;  1NWZ A;  4L9G A;  3QP4 A;  5L10 A;  1E3U A;  4KG2 A;  5EE8 A;  3BEC A;  5J61 A;  1MKI A;  4X1M A;  3PYP A;  4JXV A;  3MQO A;  3LEZ A;  2A24 B;  1V9Z A;  1L2S A;  3IXB A;  1ESU A;  1GHI A;  2VJW A;  4RR9 A;  3UPP A;  3UDI A;  1TS7 A;  2OSU A;  1KGE A;  2ZQ8 A;  2JE5 A;  1SKO A;  1KE0 A;  4LCL A;  3LIE A;  3QP8 A;  5FQI A;  2PYR A;  3ZG8 B;  3P7N A;  3N8R A;  3Q81 A;  1YM1 A;  3HUO A;  3KYQ A;  3MSH A;  4WZ5 A;  3FKW A;  1L0F A;  1CEF A;  1DJB A;  3C8C A;  1TVF A;  4EEP A;  4ARZ B;  3SZT A;  1K57 C;  2JKT M;  5FI7 A;  2QKP A;  1L3L A;  3L9K A;  3PBQ A;  2HZ5 A;  2G7U A;  3BW6 A;  1P9R A;  3BFC A;  3HBR A;  3UMD A;  3QP1 A;  4DE0 A;  2J7V A;  3ITB A;  3BM6 A;  3KYZ A;  3ZNY A;  4E3N A;  4ESP A;  1YSP A;  5HZH A;  4LPZ A;  3P98 A;  4RA7 A;  3V39 A;  3ZVT A;  3VMA A;  4S0J A;  3EGX C;  1JVJ A;  2HL2 A;  4QJG A;  3A3J A;  4HJ6 A;  3PD5 A;  3Q7Z A;  5IS1 A;  5TBM A;  2EX8 A;  3MXR A;  3RH8 B;  2UV0 E;  3CUE A;  4BL2 A;  1UGU A;  4ARZ A;  3V67 A;  3KX0 X;  2ZD8 A;  4DE3 A;  3LR0 A;  1BT5 A;  3BLS A;  3UPO A;  3E4O A;  2QWS A;  1I5Q A;  4X1L A;  3NOU C;  1W63 Q;  4EES A;  3HUN A;  3WRT A;  3M6B A;  3GSG A;  3ITA A;  4B4X A;  4WN5 A;  5AQA A;  3LY3 A;  2CMN A;  5IT5 A;  1OT9 A;  1JTG A;  5G4Z A;  2Y55 A;  5GL9 A;  3WS0 A;  1WYC A;  3GQZ A;  5AQB A;  1Y28 A;  3LIB A;  3UB5 P;  4FSF A;  1F5M A;  5HWW A;  3NI9 A;  1VQQ A;  4FUW A;  3T4L A;  4S2O A;  2DBO A;  1YSQ A;  3FPV A;  3VE4 A;  3ZHH A;  3HUM A;  5EPH A;  4F3L A;  1MKM A;  2PD8 A;  4BMW A;  2ZM0 A;  3AGF A;  3TSG A;  1RCJ A;  1YMS A;  5HL6 A;  2OAP 1;  5FAS A;  1XJ2 A;  2G2U A;  3VFH A;  1DP9 A;  1TDL A;  2ZQD A;  1O7E A;  2ZL1 B;  3PR6 A;  2V0W A;  5CGS A;  1FSY A;  3LI9 A;  4CPK A;  1YAX A;  3U4L P;  1O07 A;  2OLV A;  1IFQ A;  3G30 A;  2WKP A;  3T4J A;  3DAV A;  3IWI A;  3BY8 A;  5J8X A;  1MXO A;  2PT7 A;  2QJ7 A;  2HL0 A;  5HAQ A;  1MC0 A;  4S02 A;  4R1G A;  5F82 A;  3UE1 A;  2VX8 A;  4JXS A;  4IHQ A;  2EX6 A;  3NDG A;  2WK0 A;  4WM9 A;  4RRI A;  3UDF A;  4Z9Q A;  3H82 A;  2HP9 A;  5HW3 A;  1VB6 A;  3ZNT A;  4MEZ A;  4LRZ E;  1ZG4 A;  3QNB A;  4OKP A;  4FCF A;  4E3I A;  4D60 A;  2JN7 A;  4YOF A;  2NUT C;  3NJA A;  2M1C A;  2RCX A;  1N9B A;  4C6Y A;  1FIK A;  3IHB A;  3VE3 A;  1I2W A;  4S03 A;  2QPN A;  1WA9 A;  4OQG A;  4RRG A;  1CI8 A;  1H5X A;  2BTF P;  2XQZ A;  1CK3 A;  1OTB A;  4EV4 A;  3BLM A;  4X55 A;  3LI8 A;  4GDN A;  2W1T A;  4JGP A;  3B42 A;  5HX9 A;  3FC7 A;  1WE4 A;  3RTY A;  1UWN X;  2KX6 A;  5DF7 A;  4HES A;  2W0N A;  3IX8 A;  3QHY A;  2B18 A;  1RGY A;  4Y0T A;  3IF6 A;  4WEK A;  2XGN A;  3ZYT A;  3Q82 A;  2V1Z A;  1XGI A;  1G68 A;  5FSR A;  1GHM A;  4LRX C;  3OPH A;  4IJG A;  2BLS A;  3DTM A;  1SHV A;  4WZ5 C;  4S2P A;  2HKZ A;  4RR8 A;  1NRF A;  1T1A A;  4K08 A;  4AFI A;  1XX2 A;  2J3T D;  2DNS A;  3F1P B;  4BL3 A;  4K91 A;  3KO4 A;  4RYE A;  4R3A A;  3T1Q B;  1P0Z A;  2J80 A;  2XR0 A;  2CC1 A;  4RRC A;  4H6J B;  4E3M A;  1W63 M;  2IA2 A;  4KZ6 A;  3UB9 A;  4GB7 A;  2UWX A;  2JCH A;  4HI4 A;  2V8C A;  3RXX A;  5GLD A;  1Y54 A;  4LGW A;  3CUE C;  1T1B A;  3ZVW A;  5EVI A;  2X71 A;  1P9W A;  2P08 A;  1UWP X;  3CPT B;  3HCY A;  3F1P A;  4BD0 A;  1K57 A;  1YLT A;  3GRJ A;  5KSC A;  3MF0 A;  4GW9 A;  5DKK A;  4DDS A;  1XGJ A;  4X68 A;  5JYP A;  1STZ A;  2HDU A;  1KVM A;  4OP5 A;  1F98 A;  5CGX A;  5CGW A;  3FWL A;  3CLO A;  5F68 A;  4RRM A;  1YLY A;  2EWV A;  2EX9 A;  2Q9N A;  4B93 A;  5CHM A;  1MZU A;  2MJ6 A;  3G35 A;  3T4T A;  3CPT A;  1JNU A;  2LB5 A;  3QP5 A;  5M1A A;  1Q2P A;  3KSF A;  4QY6 A;  3PXP A;  1XA7 A;  4NG2 A;  2LB9 A;  1MWS A;  1HLU P;  1OJG A;  4R6L A;  5HWV A;  1ALQ A;  5EFW A;  3LID A;  5DVA A;  3F1O A;  4P87 A;  1OT6 A;  1S0W A;  3DTE A;  2EFU A;  4S0L A;  2VEA A;  4HNB A;  4WLA A;  2Y91 A;  2W3E A;  5FI6 A;  1RP5 A;  3S22 A;  3L7H A;  1DP8 A;  5I94 A;  5FEF A;  1NY0 A;  4EUZ A;  5FQJ A;  3S7N A;  3A0R A;  4EET B;  4DN0 A;  1K56 D;  3WS1 A;  1IYQ A;  4KZ7 A;  4S2N A;  5AQ9 A;  3KNF A;  2XRN A;  3D3O A;  5J4E A;  5CTN A;  2OV5 A;  4EQ1 A;  5M18 A;  2WYX A;  4II7 A;  3VSK A;  3A0S A;  2H5S A;  3D4F A;  2PBD P;  5HWT A;  5EVE A;  4MLL A;  3OCN A;  1H8Y A;  1QME A;  5A91 A;  3UE6 A;  4RRJ A;  4KUO A;  2WZZ A;  3LEQ A;  3IXH A;  4UQI S;  3HLE A;  2VA0 A;  3NOT C;  4BWI A;  2ZQ9 A;  4OVD A;  1BTL A;  3Q7V A;  1KVL A;  4JBF A;  4WUJ A;  5F83 A;  1PWC A;  5GHZ A;  1AWI A;  3IX3 A;  1YT4 A;  4UA6 A;  3V3R A;  2ZOI A;  1YMX A;  2GJ3 A;  3T1R A;  3T4K A;  2Y2I A;  5HDD A;  3BFF A;  4O8G A;  1WYB A;  2R78 A;  2OWH A;  3LMU A;  4Y17 A;  5KIZ A;  1YLJ A;  2J3T C;  4EWF A;  5CED A;  1L0E A;  3E4Q A;  3HJK A;  4B4Z A;  3HLF A;  4RVA A;  2XSS A;  4P85 A;  3MMH A;  3PHY A;  1Q2Q A;  1KGF A;  3HVF A;  3S4X A;  3IWO A;  4B88 A;  4OPQ A;  1N9N A;  4JGO A;  3DTI A;  4LEN A;  1Z09 A;  2ZC7 A;  4NXF A;  3MJQ A;  2Y2J A;  3ZG7 B;  2WKQ A;  4GLQ A;  4N9K A;  2VZW A;  1G28 A;  4KZ5 A;  2W3G A;  2Y2G A;  1KDW A;  2Z6D A;  4X56 A;  4QY5 A;  3EWK A;  2WGV A;  2HDS A;  3E4P A;  1DJA A;  1IEM A;  5EOE A;  2VGK A;  4K0X A;  4FH2 A;  3LMT A;  1ZC2 A;  3N8L A;  1IYP A;  1BYW A;  2Y2M A;  2OAQ 1;  1TS8 A;  1MBL A;  2HPB A;  5E43 A;  3M2J A;  3WWX A;  1ZG6 A;  5JYO A;  3MXQ A;  5FAP A; 
#chains in the Genus database with same CATH homology
 3MZD A;  4QHC A;  1J9M A;  1ONH A;  1O7E A;  1TDL A;  2ZQD A;  5EVI B;  1K4E A;  1PI5 A;  2Y59 A;  4XXR A;  5CGS A;  1FSY A;  2G2W A;  3NDE A;  1S6R A;  3O86 A;  1KDS A;  4FD8 A;  4OH0 A;  1K55 A;  4RRR A;  1C3B A;  4CPK A;  3C4O A;  4RRQ A;  1SKF A;  4A5R A;  4KQO A;  1O07 A;  2OLV A;  3G30 A;  5EVI C;  1NJ4 A;  3PBR A;  4OLG A;  3G2Y A;  3IWI A;  4MBK A;  3UN7 A;  5J8X A;  3BRM A;  1W79 A;  1K54 C;  4GDB A;  1MXO A;  1MWR A;  1KE4 A;  4WZ4 A;  4DXB A;  3LY4 A;  3C4P A;  2XEP A;  4R4R A;  4R3J A;  3VP2 A;  3KO3 A;  4ZTK A;  1JTD A;  4BQM A;  2PU2 A;  1PWD A;  1L0D A;  3M2K A;  5HAQ A;  2HL0 A;  4RRK A;  5E2E A;  4RRH A;  3QNC A;  4P0M A;  4DE2 A;  3HLW A;  4E6X A;  5E2H A;  1FR6 A;  1HD8 A;  4E6W A;  3PAE A;  3N4I A;  5FQ9 A;  3S1Y A;  4S02 A;  2A3U A;  4KQQ A;  3SH9 A;  4R1G A;  1HVB A;  4ID4 A;  2Y2H A;  5F82 A;  3UE1 A;  5KMW A;  1MWT A;  4JXS A;  4RRL A;  2XDM A;  3W4P A;  2EX6 A;  4BJP A;  2Y2L A;  3W8K A;  1W8Y A;  4Q8I A;  3UE0 A;  2WAE A;  1J7G A;  4KZA A;  3NDG A;  3M6H A;  1SDN A;  3UDX A;  3NC8 A;  2WK0 A;  4WM9 A;  4X6T A;  4RRI A;  2Y2Q A;  1BLS A;  4N9L A;  5CEC A;  3UDF A;  3BYD A;  5M19 A;  5FQQ A;  1ONG A;  1NXY A;  3N6I A;  2ZM2 A;  4Z9Q A;  5G18 A;  2HP9 A;  5FDH A;  3FV7 A;  5HW3 A;  4OQ0 A;  2EXB A;  4KZ9 A;  3ZNT A;  4M3K A;  3SS3 A;  3ZG5 A;  3A3F A;  4Y0O A;  5TR7 A;  2J9P A;  4MEZ A;  1ZG4 A;  1XA1 A;  4XUZ A;  3QNB A;  3C5A A;  1I2S A;  4OKP A;  4WYY A;  4X69 A;  5TFQ A;  1TC5 A;  2GDN A;  2PBY A;  4FCF A;  4HBT A;  4JXG A;  5HAI A;  3BEB A;  3SS5 A;  4RRB A;  4E3I A;  1FCM A;  1PZO A;  4GKU A;  3MBZ A;  4GNU A;  3TG9 A;  1K38 A;  2XFT A;  4EBP A;  1PW1 A;  4KZ8 A;  5BOH A;  2RCX A;  1YLP A;  1N9B A;  5EVL A;  4DRT A;  1LLB A;  4C6Y A;  3IHB A;  4U0T A;  5HAR A;  1I2W A;  1FCN A;  5FAT A;  4GOG A;  4S03 A;  1TEM A;  2QPN A;  3OPL A;  1LI9 A;  1BUL A;  1PIO A;  4OQG A;  4PPR A;  4RRG A;  4GN2 A;  1CI8 A;  1H5X A;  5GLA A;  4RR6 A;  3WS5 A;  2X01 A;  1KE3 A;  5EVI D;  2XQZ A;  1CK3 A;  2V2F F;  3SH7 A;  4WEJ A;  2HDR A;  4EV4 A;  1M40 A;  3FZC A;  3PBS A;  3BLM A;  2WGW A;  1MPL A;  2B5R A;  4X55 A;  5CER A;  3KOD A;  4GDN A;  3HLG A;  3V50 A;  1G6A A;  1PWG A;  5HX9 A;  3LMV A;  1SCW A;  4DE1 A;  2J8Y A;  1WE4 A;  3OZH A;  3PD3 A;  5D3O A;  4LV1 A;  5DF7 A;  5FQM A;  2OLU A;  4Y0U A;  2JBF A;  4HES A;  3SS4 A;  2HL1 A;  1TDG A;  3OPP A;  4OOM A;  3HLD A;  4RX3 A;  3GVB A;  3QHY A;  3CMZ A;  1RGY A;  4R3B A;  1FCO A;  1H8Z A;  4IED A;  4S2N C;  3IF6 A;  4WEK A;  4Y0T A;  2XGN A;  5E2G A;  1JWZ A;  1MY8 A;  3ZG9 B;  3Q82 A;  2V1Z A;  1XGI A;  1G68 A;  5FSR A;  1BUE A;  1E4D A;  1IYO A;  1JWV A;  2WKH A;  5FA7 A;  3UO9 A;  1Y2Q A;  4EQI A;  2H10 A;  1GHM A;  3MXS A;  4E3K A;  2XH9 A;  1K55 C;  4RR7 A;  3G2Z A;  3OPH A;  4HBU A;  2BLS A;  3DTM A;  1SHV A;  4JF4 A;  4WZ5 C;  4S2P A;  2HKZ A;  4UA7 A;  1GHP A;  3VP1 A;  2IWC A;  4RR8 A;  1NRF A;  1W8Q A;  1QMF A;  1XX2 A;  4IBR A;  2DNS A;  3HRE A;  5EUA A;  3Q7V B;  2JC7 A;  4ZJ1 A;  1IEL A;  3VSL A;  2R9X A;  4BL3 A;  5A92 A;  4K91 A;  1IKG A;  1M6K A;  5DF9 A;  1AXB A;  3KO4 A;  3Q1F A;  1IYS A;  4RYE A;  4X53 A;  1L0G A;  2EXA A;  4S0I A;  1K6R A;  3A3D A;  5FQK A;  1K25 A;  4ZDX A;  2Y2K A;  5CHJ A;  5CEB A;  2XR0 A;  5F1G A;  5EOO A;  2CC1 A;  4RRC A;  5A93 A;  1MWU A;  1XPB A;  1BLP A;  4OON A;  5GHX A;  4E3M A;  3KNP A;  2IWB A;  3CJM A;  3ZG0 A;  1E3U D;  1GA0 A;  2XD1 A;  4KZ6 A;  3SH8 A;  1EI5 A;  2Y4A A;  2Y2N A;  2IWD A;  3IH9 A;  4KG5 A;  4MNR A;  1RGZ A;  4GB7 A;  4P6B A;  3LCE A;  1BLH A;  2JCH A;  2UWX A;  4R0Q A;  2DRW A;  4KQR A;  1XKZ A;  3OC2 A;  5HL1 A;  1LL5 A;  4QU3 A;  3PD4 A;  3RXX A;  2VGJ A;  1ERQ A;  4KEN B;  5GLD A;  4C75 A;  1Y54 A;  3PBT A;  3WS2 A;  3EQV A;  4DDY A;  2Y2O A;  1NZU A;  3O88 A;  4S2M A;  3WS4 A;  4WBG A;  3ZVW A;  2Q9M A;  4FH4 A;  5EVI A;  1ES2 A;  3A3I A;  3CZD A;  2X71 A;  2P74 A;  5DTS A;  3KO7 A;  1ZKJ A;  4RX2 A;  5FAO A;  4BD1 A;  4BD0 A;  3ZGA B;  3ZCZ A;  3MZE A;  1K57 A;  1YLT A;  3GRJ A;  3KOB A;  5KSC A;  1CI9 A;  1OME A;  2Z2L B;  3E2L A;  5L2F A;  3ISG A;  2WKI A;  4BLM A;  2HP5 A;  3UY6 A;  4DDS A;  4QB8 A;  3MZF A;  1XGJ A;  1YQS A;  3HL9 A;  4X68 A;  3DW0 A;  3DWK A;  5JYP A;  4ZJ3 A;  2ZC4 B;  5FAQ A;  4OOL A;  3VOZ A;  4OP8 A;  1PI4 A;  3IT9 A;  2HDU A;  4U3T A;  3IQA A;  4JPM A;  1KVM A;  2RL3 A;  4RRF A;  2DCF A;  4OP5 A;  4KZB A;  3MKE A;  1BZA A;  3TOI A;  1N4O A;  5CGX A;  4KG6 A;  4GD8 A;  2H0Y A;  3PD2 A;  5CGW A;  4ZAM A;  3KO9 A;  2WZX A;  4LV0 A;  5GLC A;  1K6S A;  3FWL A;  4RRM A;  3W4Q A;  3AGD A;  1XXM A;  1YLW A;  3LO7 A;  4E3J A;  3FKV A;  1YLY A;  2WKE A;  5A90 A;  3ZDJ A;  2EX9 A;  4R23 A;  2Q9N A;  2ZC5 B;  3P09 A;  4S2L A;  5CHM A;  3NBL A;  3SOI A;  5F1F A;  2XFS A;  5TGF A;  2X02 A;  5U47 A;  2R9W A;  4S2J A;  2QMI A;  3G35 A;  3G34 A;  1BSG A;  4WMC A;  1LL9 A;  3NY4 A;  1PW8 A;  4JF6 A;  3IF6 C;  4JXW A;  4R4S A;  5M1A A;  1Q2P A;  4QY6 A;  1ES5 A;  1HZO A;  1XA7 A;  4XUX A;  4OQI A;  4KZ4 A;  1MWS A;  3CG5 A;  1ERO A;  2FFF B;  4UA9 A;  5IHV A;  3GMW A;  1ALQ A;  2ZC6 B;  2J9O A;  4MBH A;  2WGI A;  2ZM8 A;  3PAG A;  5DVA A;  1E3U A;  2WUQ A;  4P87 A;  3GV9 A;  4N92 A;  1S0W A;  3GR2 A;  3PBN A;  4KG2 A;  5EE8 A;  2EFU A;  1K4F A;  4S0L A;  3BEC A;  3V3S A;  4OQH A;  3B3X A;  2WAF A;  4PM7 A;  5J61 A;  4OLD A;  1MKI A;  1HTZ A;  4JXV A;  3WRZ A;  2ZQ7 A;  1JWP A;  3LEZ A;  4LCM A;  2Y91 A;  4E3L A;  1L2S A;  3IXB A;  5FI6 A;  2HDQ A;  1RP5 A;  3S22 A;  1ESU A;  1GHI A;  4RR9 A;  4OOY A;  4C3Q A;  5I94 A;  2PU4 A;  4OPZ A;  1PZP A;  1NY0 A;  4EUZ A;  4PMA A;  4WMC D;  5FQJ A;  3UE3 A;  3UPP A;  4DKI A;  3UDI A;  3FYZ A;  4H8R A;  2OSU A;  4NBJ A;  1JKE A;  1KGE A;  2ZQ8 A;  4IVK A;  1K56 D;  2JE5 A;  4RRD A;  3WS1 A;  1IYQ A;  1KE0 A;  4KZ7 A;  4S2N A;  4N1H A;  5HFO A;  4LCL A;  5AQ9 A;  3KNF A;  2V20 A;  1NYY A;  5CTN A;  2P9V B;  1EWZ A;  3HLC A;  4JF5 A;  5FQI A;  3PBO A;  2OV5 A;  3ZG8 B;  4UHU A;  5DF8 A;  4IBX A;  3N8R A;  5M18 A;  3RJU A;  2WYX A;  3Q81 A;  5HAP A;  1IKI A;  1YM1 A;  3IXG A;  3HUO A;  1SDE A;  3VSK A;  1ERM A;  3OCL A;  2H5S A;  3AGE A;  3D4F A;  3FKW A;  4WZ5 A;  4BEN A;  1L0F A;  5DTT A;  1CEF A;  1W7F A;  1DJB A;  4GZB A;  4MLL A;  3OCN A;  3IXD A;  1TVF A;  3HLB A;  1H8Y A;  1W5D A;  1QME A;  5A91 A;  4DXC A;  4ZBE A;  1K57 C;  5FI7 A;  1E25 A;  3O87 A;  4RRJ A;  3PBQ A;  2WZZ A;  3ZFZ A;  5AQ7 A;  3BFD A;  3IXH A;  5GLB A;  3VOY A;  3VP0 A;  3HLE A;  4EBN A;  1ESI A;  4S2I A;  3BFC A;  5KZH A;  2A49 A;  2ZQ9 A;  3HBR A;  2ZJ9 A;  4OVD A;  1BTL A;  3Q7V A;  4DE0 A;  1K54 A;  1KVL A;  2J7V A;  3ITB A;  3IWQ A;  5CRF A;  3C7U A;  4JBF A;  1ES4 A;  5KSH A;  3BM6 A;  4OPY A;  3DWZ A;  5F83 A;  3OPR A;  3ZNY A;  4E3N A;  4WEL A;  4U0X A;  3P98 A;  1PWC A;  4RA7 A;  5GHZ A;  3V39 A;  2H0T A;  3ZVT A;  1YT4 A;  2BG1 A;  4UA6 A;  3V3R A;  3G32 A;  2ZQA A;  4HEF A;  3VMA A;  4JLF A;  4GD6 A;  1YMX A;  5FI2 A;  4S0J A;  2EX2 A;  2P9V A;  4NET A;  1JVJ A;  2HL2 A;  2Y2I A;  4UAA A;  3NIA A;  4QJG A;  1VM1 A;  2QZ6 A;  2WGW B;  3A3J A;  1WYB A;  3BFF A;  3Q7Z A;  3PD5 A;  4PM6 A;  3JYI A;  4RRA A;  1LHY A;  2EX8 A;  3MXR A;  5CTM A;  3LMU A;  3BFG A;  4MBF A;  4CJN A;  1FQG A;  4BL2 A;  1YLJ A;  1CEG A;  4PM5 A;  3BFE A;  2ZMA A;  4DF6 A;  4EWF A;  5CED A;  1L0E A;  1FR1 A;  4S0K A;  5CHU A;  1DY6 A;  1DJC A;  1KGG A;  2ZD8 A;  4B4Z A;  3HLF A;  4DE3 A;  2OKV A;  4RVA A;  1NZO A;  1BT5 A;  2ZQC A;  4O7D A;  4D2O A;  1NYM A;  3BLS A;  4P85 A;  1Q2Q A;  4EBL A;  3IF6 B;  3UPO A;  1I5Q A;  1KGF A;  2WAD A;  3I7J A;  2C6W B;  2FFY A;  3MFD A;  3HVF A;  4N1X A;  1PYY A;  3HUN A;  3S4X A;  2E8I A;  3WRT A;  1GCE A;  3IWO A;  3M6B A;  2XF3 A;  3GSG A;  4LV3 A;  4B88 A;  4OPQ A;  3ITA A;  4B4X A;  4K0W A;  2EFX A;  5AQA A;  4L0L A;  5E2F A;  4LEN A;  3LY3 A;  1K56 A;  3E2K A;  3UPN A;  3NCK A;  1JTG A;  1YLZ A;  2ZC7 A;  2HP6 A;  2Y2J A;  4KZ3 A;  2Y55 A;  2XD5 A;  4QD4 A;  5GL9 A;  4ZJ2 A;  3ZG7 B;  5GHY A;  3WS0 A;  1WYC A;  4NK3 A;  4N9K A;  2I72 A;  3GQZ A;  4E3O A;  4KZ5 A;  2Y2G A;  1FOF A;  1KDW A;  3GTC A;  5AQB A;  4PM9 A;  1BLC A;  4IVI A;  3W4O A;  3PTE A;  4FSF A;  4F94 A;  3C7V A;  3NI9 A;  5DTK A;  4X56 A;  1GA9 A;  1VQQ A;  4QY5 A;  3VP3 A;  3O3V A;  3MKF A;  4S2O A;  3UNW A;  5EEC A;  2DBO A;  2WGV A;  2HDS A;  2Y2P A;  2Z2M B;  3VP4 A;  4YIN A;  3ZHH A;  1XP4 A;  1DJA A;  3N7W A;  3HUM A;  1IEM A;  5EPH A;  5EOE A;  3IF5 A;  4OPR A;  2VGK A;  4K0X A;  2C5W B;  3EQU A;  3Q07 A;  2ZC3 B;  3RXW A;  4FH2 A;  3LMT A;  3IH8 A;  1ZC2 A;  3G4P A;  3N8L A;  1IYP A;  2XLN A;  4S2K A;  1U60 A;  2ZM0 A;  4YFM A;  3AGF A;  3TSG A;  4JKT A;  3VFF A;  1RCJ A;  3N8S A;  1YMS A;  2Y2M A;  3IHA A;  5FAS A;  3V5M A;  1FSW A;  1MBL A;  1ES3 A;  3A3E A;  2HPB A;  5E43 A;  3M2J A;  3KO5 A;  2G2U A;  4Y7P A;  5CXW A;  3WWX A;  1ZG6 A;  4LV2 A;  3KOC A;  1Z6F A;  5JYO A;  3VFH A;  2XK1 A;  4NBI A;  4PM8 A;  1LI0 A;  3G31 A;  2ZLY A;  5FAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...