5CEBA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus, k38m form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
401
structure length
387
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLAAISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
total genus 134
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cebA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cebA02
3LCEA 4PM8A 4UHUA 1K6RA 3SH9A 1O7EA 1K25A 2EX8A 3MZEA 3Q7VA 3ZG0A 4DRTA 1DY6A 3BYDA 3VP3A 2ZC3B 3VP4A 5FA7A 1MXOA 3C5AA 3O86A 3QNCA 4C75A 2JE5A 1J9MA 1GHMA 2FFFB 1GHIA 2WKHA 4MBFA 3IWQA 1FR6A 4ZDXA 4PM5A 3LY3A 5FQKA 2Y2HA 4LCMA 2UWXA 1ZG4A 4XUXA 2Y59A 3CMZA 5E43A 1QMFA 3PAEA 2PBYA 3WS4A 2VGJA 3NDEA 3WS0A 3WS2A 4K0WA 1I2SA 1KDWA 1RCJA 5EVID 1NRFA 1WYCA 2J8YA 5HW3A 3OZHA 3WRTA 5GLAA 4EBNA 1SCWA 1PI4A 3UDIA 3W4QA 3ZCZA 5E2GA 3LY4A 4DE1A 4OOMA 5EOEA 2Y2QA 3MKEA 1IYPA 2P9VA 4JF5A 3OPPA 2WGIA 4C6YA 4RVAA 4X53A 4X56A 1WYBA 2R9XA 4UA6A 1PW8A 4H8RA 5HL1A 2RL3A 4S2JA 1PW1A 1L0DA 1K54A 4EBLA 4WYYA 3DTMA 4ZAMA 5DF8A 3VFHA 3VOYA 1BLHA 1PZPA 3IF6A 3O87A 4MEZA 2PU4A 4ZJ2A 4PMAA 3IH9A 1FSYA 3N8SA 1SDEA 2GDNA 5KSCA 2ZQAA 4FD8A 5FI6A 3M2KA 4JXGA 1EWZA 4PM7A 2Q9MA 2EX9A 4F94A 5EUAA 1Q2QA 4JPMA 1XKZA 1E4DA 1FCOA 3TSGA 4JF6A 5FQ9A 4KZ7A 1H8ZA 1XX2A 4WZ4A 1E3UA 1K55C 2XD5A 4KG6A 4K91A 4S2MA 1ZKJA 3HUMA 2G2UA 4KZ3A 2WGWB 4X55A 2WAFA 2P74A 4E3OA 1SHVA 3IWOA 2Y2GA 3GSGA 2Y2JA 4WZ5A 4IVIA 3N8RA 4NETA 4U0TA 3ZVTA 4IVKA 3NC8A 2EX2A 3ITAA 3GQZA 3VSLA 4KG5A 3MKFA 3MBZA 3BLMA 1H8YA 4MLLA 4CJNA 3DW0A 4PM6A 5FAQA 4U0XA 1N9BA 4HEFA 5KSHA 4Y7PA 2Y91A 1ES3A 4EUZA 1YLJA 4OPYA 2HPBA 5EVIB 3C4OA 2C5WB 4QD4A 4KZ9A 1PYYA 1MY8A 1S6RA 4GD8A 2A3UA 3VMAA 1YLTA 5A92A 4JBFA 4WMCA 3M6BA 2BLSA 3IT9A 3V3SA 4RA7A 4JKTA 3N8LA 2Y4AA 1ES5A 4KZ4A 4DXBA 3M6HA 1N4OA 1K57A 1G6AA 3A3JA 4KZ6A 4QHCA 1U60A 1EI5A 5FSRA 4CPKA 1HZOA 2IWCA 3HLBA 4RYEA 1K55A 1KDSA 2EFUA 2EXAA 1LI9A 1EROA 3IXHA 4IBRA 2IWBA 1M6KA 4MNRA 3GR2A 5GLBA 1JWVA 3HBRA 3S4XA 1JTGA 5FAOA 2E8IA 4P85A 5HX9A 4IBXA 3S22A 5M1AA 2WGVA 1FCMA 3TOIA 4E3IA 3A3FA 3GRJA 5GHXA 3PBTA 3ZFZA 4E3MA 1KE3A 2XFSA 1XA1A 4LCLA 5DF9A 5FDHA 2X01A 3BEBA 3IXGA 1W5DA 3FKWA 1YLPA 3IF6C 1MPLA 1LLBA 4KZ5A 3VSKA 1KE4A 2ZC4B 4LV1A 4BD1A 3PTEA 5CHUA 2XR0A 3G2YA 1FOFA 3LO7A 4XUZA 3RJUA 5CEDA 4GDBA 1KGEA 5CGSA 1BT5A 3SS4A 1FSWA 2IWDA 1NY0A 1SDNA 5BOHA 4DF6A 1BULA 4DDYA 3UPPA 2ZQ9A 1TDGA 4JXSA 2XGNA 4EBPA 1YLYA 3BFCA 2WYXA 4R4SA 2XK1A 1IEMA 1ONHA 3HLFA 1MWTA 3AGDA 1BLPA 3VP2A 3VP1A 4DXCA 1PWGA 4WZ5C 4GOGA 2OLUA 1IKGA 4WEJA 1XA7A 1NZOA 2C6WB 2H0YA 3BLSA 2DRWA 4OQIA 1ZC2A 4S2OA 4S2NC 3UY6A 4EV4A 2QMIA 3SOIA 3SH8A 1ERMA 5CEBA 4KQOA 5AQAA 4UA7A 4FH2A 5IHVA 2XF3A 2HP9A 1DJAA 3BM6A 3HL9A 3HLEA 1KGFA 1FR1A 2XFTA 2V20A 3QNBA 4QU3A 4OH0A 3MXRA 4UA9A 1GA9A 3AGFA 5CTNA 3GTCA 3DWKA 4KQQA 5CGXA 2ZLYA 3UE0A 3CJMA 1KVLA 4PPRA 3B3XA 3HUOA 3IHBA 3WS1A 1S0WA 2Y2PA 3FKVA 3IXBA 3AGEA 1GHPA 4LV2A 1ALQA 1JWPA 4KZAA 1C3BA 1HVBA 3GV9A 1KGGA 2XEPA 4MBKA 1K6SA 3PBSA 4KENB 5TFQA 1K57C 1AXBA 2Y2KA 3BFFA 2Y2NA 2ZM0A 4EWFA 2RCXA 3A3DA 2H10A 3SH7A 5JYOA 2X71A 4OPQA 2ZQ7A 3O88A 3QHYA 2ZQCA 4GN2A 4P6BA 4DE2A 4DE0A 4X6TA 3WRZA 1KE0A 1L2SA 3PAGA 3UNWA 5A91A 1IKIA 1L0FA 4E3JA 5E2EA 4R3JA 5EECA 3UDXA 3G34A 1MWSA 4S2NA 2WADA 1Q2PA 3D4FA 4OOYA 5JYPA 5KZHA 3C7VA 2ZM2A 3FV7A 5AQBA 3HLGA 1Y54A 2WKEA 3SS5A 4R4RA 1H5XA 3O3VA 5FQIA 2Z2MB 2WK0A 1E3UD 2XD1A 3S1YA 1ONGA 3RXWA 1NZUA 5AQ7A 3OCNA 4WM9A 5DVAA 3Q7VB 4OQ0A 2Y55A 2Y2OA 4OQHA 2ZQ8A 3E2LA 1ZG6A 3C7UA 1HD8A 2DNSA 4DE3A 3RXXA 3PBRA 4DDSA 1PIOA 1PWCA 5CXWA 5FI7A 4C3QA 3C4PA 4HESA 1I2WA 1L0EA 1ES4A 4R3BA 3W4OA 3UDFA 4YINA 2Y2MA 1HTZA 3HLDA 4JF4A 4M3KA 5CGWA 3OPHA 4GNUA 4GZBA 4OPRA 4OOLA 3NY4A 1RGYA 4OONA 4P87A 2X02A 1XXMA 2ZD8A 4ZTKA 4R23A 4R0QA 5E2FA 1RP5A 3FYZA 1LI0A 5HFOA 2ZC6B 3V5MA 5CECA 3GVBA 4WMCD 2QZ6A 3ISGA 5EVIC 4BENA 2P9VB 2ZJ9A 2ZM8A 4BL3A 4N1HA 5U47A 3E2KA 5GHYA 5M18A 5M19A 4A5RA 2EXBA 2ZC7A 3V50A 4RX3A 1ERQA 1XGJA 3BFGA 2WKIA 5FI2A 1ES2A 3ITBA 5GHZA 3V3RA 1BLCA 1K56A 3IF6B 3WWXA 1SKFA 4OP8A 2HP6A 5EPHA 5CRFA 2ZC5B 3P98A 3NI9A 4GKUA 3PBQA 1K4EA 3FZCA 3CZDA 4ZBEA 3PBOA 1YT4A 3IWIA 4Y0UA 1CI8A 2CC1A 1Z6FA 1ESUA 1CK3A 5G18A 4WBGA 5CERA 4Q8IA 1MBLA 3IQAA 5L2FA 4B4ZA 4JXVA 4OPZA 2FFYA 4BJPA 1GA0A 2V1ZA 3UPOA 5TR7A 1K4FA 2Q9NA 3GMWA 3Q82A 3DWZA 4OQGA 1W8QA 4QY5A 5EE8A 2WAEA 4BQMA 2DCFA 5D3OA 5FASA 5DF7A 5HAQA 1TDLA 2ZQDA 3ZNYA 4XXRA 4S2KA 2B5RA 3P09A 1WE4A 5GLDA 5EVIA 4N1XA 4FCFA 3HLWA 3ZG9B 3HUNA 3LEZA 1E25A 5DTTA 2Y2LA 4KZBA 4U3TA 1YLWA 2OSUA 4BL2A 5J8XA 2WZZA 4BD0A 4E6XA 3IF5A 1NXYA 3OPLA 4LV3A 4Y0OA 2WZXA 5A90A 2ZMAA 3NIAA 3NCKA 1BTLA 1MWUA 3G31A 4JLFA 1DJCA 3ZGAB 4X68A 3BFDA 4OKPA 5CHJA 5DTKA 2OV5A 3BFEA 3Q1FA 3ZHHA 3ZNTA 4GB7A 3JYIA 1VQQA 2EX6A 4Z9QA 3Q07A 2JCHA 1QMEA 4QJGA 1MKIA 2BG1A 4RX2A 3BECA 3N6IA 3WS5A 1GCEA 1TEMA 3OPRA 4IEDA 4OLDA 5TGFA 5HAPA 3MZFA 2XH9A 1W79A 2JC7A 1BSGA 5AQ9A 4ID4A 1FQGA 1XGIA 1CI9A 4S2PA 1PWDA 3MFDA 2XQZA 3HVFA 2WUQA 1VM1A 2A49A 4FH4A 1IELA 5FQQA 3UPNA 3TG9A 3G35A 5KMWA 1XPBA 1W8YA 3IH8A 3OC2A 2HDQA 4GDNA 4OP5A 4B4XA 1LHYA 3VFFA 3FWLA 1JWZA 5EVLA 5GL9A 3NDGA 2HDRA 5I94A 1K38A 1BZAA 1CEFA 5F1FA 1NYYA 2JBFA 3I7JA 3G4PA 1PI5A 2I72A 2G2WA 3ZG7B 4Y0TA 4E3LA 3ZDJA 1LL9A 1MWRA 5HARA 2H0TA 3UO9A 2Y2IA 2H5SA 1YMXA 3G30A 3CG5A 4P0MA 4R1GA 1JTDA 1YM1A 2EFXA 3IHAA 2J9PA 3OCLA 5F1GA 2J9OA 4ZJ1A 1O07A 3BRMA 5FAPA 4LV0A 4D2OA 4K0XA 4WEKA 1TVFA 4WELA 2XDMA 1RGZA 3EQVA 4N9KA 4HBUA 4E6WA 2HP5A 4DKIA 3MZDA 4S2LA 1I5QA 2VGKA 1PZOA 2R9WA 5FQJA 5CHMA 4GD6A 4UAAA 4BLMA 1NYMA 3VOZA 2HDUA 5HAIA 3V39A 4KG2A 4MBHA 1KVMA 2XLNA 1FCNA 4QB8A 3HLCA 4X69A 1YLZA 3HREA 4ZJ3A 4N92A 2QPNA 2OLVA 3VP0A 3NBLA 3A3EA 3UE1A 1W7FA 2Z2LB 5F83A 3W8KA 4O7DA 3EQUA 3ZG5A 1IYSA 4QY6A 4JXWA 1OMEA 5DTSA 5F82A 2PU2A 4OLGA 3Q7ZA 4KQRA 4LENA 1G68A 3W4PA 3MXSA 4L0LA 1L0GA 1DJBA 4KZ8A 3N7WA 4E3KA 3A3IA 4YFMA 5EOOA 4FSFA 5CTMA 1YMSA 4S2IA 2HDSA 4B88A 1LL5A 2WGWA 5GLCA 4EQIA 1JVJA 1IYQA 1K56D 1CEGA 4N9LA 4NK3A 4E3NA 3M2JA 5FQMA 2J7VA 3PBNA 4PM9A 3UN7A 3ZVWA 5FATA 3ZG8B 1IYOA 2V2FF 3G32A 1XP4A 3N4IA 1BLSA 5A93A 1K54C 3Q81A 1NJ4A 1M40A 4OVDA 3G2ZA 3SS3A 3UE3A 1YQSA 4HBTA 1BUEA 1ESIA 3IXDA 5E2HA
chains in the Genus database with same CATH superfamily
3LCEA 1K6RA 3SH9A 1O7EA 4IUKA 4DRTA 2V8CA 2ZC3B 3KO3A 5FA7A 3O86A 4GS9A 1GSXA 5MC7A 1S1YA 4UEYA 3C2WA 5FQKA 2UWXA 1ZG4A 2LB9A 1TS0A 3JPUA 2PBYA 2OAP1 4MDZA 1I2SA 1KDWA 5EVID 4LFUA 3OZHA 1PI4A 3W4QA 4LGWA 4RVAA 4X56A 4UA6A 1PW8A 2RL3A 4EBLA 4WYYA 4NXFA 3LYXA 1BLHA 3O87A 4ZJ2A 1TC5A 4RR6A 3D9YA 4CLCE 1SDEA 5HSQA 2ZQAA 3M2KA 4PM7A 5F68A 3QP4A 4CQHA 1Q2QA 4JPMA 4MN5A 5CX7A 4HP9A 4HJ4A 1XKZA 1FCOA 4ARZA 1UGUA 2WKQA 4KUKA 5FQ9A 3VV4A 1PFLA 5HPFA 1E3UA 2XD5A 3HUMA 4KZ3A 3UB8A 2PYPA 4E3OA 4RRMA 2Y2GA 2Y2JA 4IVIA 3N8RA 4YWZA 2D02A 3TRCA 3EGXC 3MBZA 4X25A 4S0IA 4JGOA 4HEFA 4Y7PA 5DJTA 1X0OA 3P7NA 4PKYA 3F1PB 4GD8A 1JNUA 4WMCA 1N9NA 2BLSA 1S4RA 3IT9A 1N4OA 1G28A 3FG8A 3A3JA 4KZ6A 4QHCA 3KO6A 4CPKA 5DKKA 1KDSA 3ZYTA 4B9OA 3KYEA 4HHDA 1JTGA 2E8IA 2WGVA 4GLQA 1P9RA 2R78A 1XA1A 3BEBA 1A0KA 2XA7M 1YLPA 3T4LA 4NXBA 3CUEA 4KZ5A 3VSKA 4BD1A 2ZC4B 2XR0A 2V1AA 1FOFA 2VV6A 3A0RA 5CEDA 4GDBA 1NY0A 2XGNA 1YLYA 3LMUA 3ULFA 2WYXA 3LIBA 1IEMA 4JGPA 3AGDA 2VX8A 4WZ5C 3B47A 1NZOA 3BLSA 2H0YA 4S2OA 2XRNA 3UB6A 2QMIA 3SH8A 5CEBA 3H7WB 2HJEA 4KQOA 3LMTA 4FH2A 2XF3A 2HP9A 3BM6A 3HL9A 3CPTB 1J3WA 3AGFA 1CF0A 3UE0A 3CJMA 3IS2A 2B18A 4RRBA 1S0WA 3IXBA 1GHPA 2FH5A 4O8GA 1JWPA 2VV8A 4KZAA 1SKOB 3GDIA 3GV9A 3H82B 4MBKA 1K57C 3KOCA 2Y2KA 3HCYA 4HH3A 4EWFA 2RCXA 3A3DA 4DE2A 4DE0A 4X6TA 1KE0A 3PAGA 3UNWA 1L0FA 4E3JA 3C7VA 3FV7A 3HLGA 4L9GA 2Z2MB 2KLIA 1NZUA 1OT9A 4Y5FA 2Y2OA 4OQHA 3VOLA 2ZQ8A 4GS9B 4C3QA 5F6AA 1S67L 3HLDA 5DKLA 4GNUA 4GZBA 3PD2A 4OOLA 1XXMA 4R23A 4R0QA 1RP5A 5HWTA 3E2KA 5M19A 3T1XA 4RX3A 1ERQA 3ITBA 1BLCA 4G3VA 2JKRM 3P98A 3NI9A 3PBQA 4WF0A 3PBOA 1CI8A 4ARZB 5G18A 3FPWA 4G3KA 1GA0A 1K4FA 3Q82A 4OQGA 4HH2A 5EE8A 4MMNA 5HWWA 2V0WA 4BBUA 5DF7A 5HAQA 1OTEA 2ZQDA 5L09A 2B5RA 4Q0JA 1WE4A 3S7QA 5EVIA 4N1XA 3HLWA 3ZG9B 5HD3A 1E25A 3JVVA 1DP9A 4U3TA 1UWPX 1YLWA 4BL2A 5J8XA 2WZZA 2VKSA 4E6XA 4PAUA 5A90A 1SZVA 1BTLA 2O99A 4JLFA 4WLAA 2K2NA 5DTKA 3BFEA 3ZNTA 4GB7A 1VQQA 4Z9QA 2JCHA 1MKIA 1GCEA 4IEDA 5TGFA 2PT7A 2J80A 1W79A 5AQ9A 1PWDA 1Y2QA 3UPNA 3ZQ5A 3TG9A 3G35A 3UB9A 2VGLM 4EEPA 4CLCC 3IH8A 4OP5A 2W3EA 3VFFA 1JWZA 5GL9A 1V9ZA 3NDGA 5LBRA 1TF1A 1NYYA 3G4PA 4RRCA 3C8CA 4BMWA 3ZG7B 4Y0TA 2H0TA 3G30A 1JTDA 2EFXA 3IHAA 3OCLA 3UE6A 1G6OA 1Y4OA 3KSFA 4D2OA 4K0XA 3NOUC 4WELA 5EV0A 2QKPA 4E6WA 2L0WA 1YSPA 3MZDA 4IUHA 4S2LA 3RTYA 1H3QA 4EXOA 2UV0E 4BLMA 4KG2A 4L9FA 4HIAA 1KVMA 4HJ3A 4X69A 3W2ZA 3KOBA 1CJFA 2QPNA 3VP0A 3A3EA 2Z2LB 3W8KA 3IS2B 4O7DA 5J3WA 1IYSA 4Y15A 2PU2A 4I5SA 4HI4A 1G68A 4L0LA 4KZ8A 3A3IA 1PNEA 5CTMA 1DRMA 1JVJA 4O01A 1CEGA 4N9LA 5FATA 1YKDA 3MXQA 3P01A 1XP4A 2O0YA 4I3JA 1M40A 4OVDA 3G2ZA 3U2AA 5L8MA 1ESIA 3OPRA 3IXDA 3S22A 4UHUA 3MZEA 2EX8A 3ZG0A 1DY6A 3VP3A 3KO9A 3VP4A 1MXOA 3C5AA 3T50A 1D7EA 3NECA 2L4RA 1GHMA 4R70A 4MBFA 3E0YA 3NJAA 2Y2HA 4XUXA 5E43A 1QMFA 2M1CA 3PAEA 5F69A 1OTAA 2VGJA 4L9EA 3R7WA 1P0ZA 1NRFA 5HW3A 2Y79A 3WRTA 3LI9A 1SCWA 3BJNA 5E2GA 3LY4A 3MKEA 2P9VA 4Z1WA 3OPPA 4NG2A 1PW1A 3DTMA 3VFHA 3VOYA 3IF6A 2PU4A 4KQDA 3IH9A 5TJJA 4Y13A 4FD8A 5FL3A 1T18A 2W3GA 1E4DA 1NLZA 4JF6A 1H8ZA 2QJ7A 1XX2A 4RR7A 2WAFA 3IWOA 3GSGA 2B95A 4U0TA 3VSLA 3CAXA 3BLMA 3BQ8A 2GZAA 4CJNA 4PKYG 3LR3A 4YNRA 2HPBA 5EVIB 3C4OA 3CUEC 4WL9A 1PYYA 1S6RA 3E4PA 2WKPA 3VMAA 2PRFA 4HQAA 5A92A 3M6BA 4I3IA 3FC7A 2PAVP 3T4TA 3V3SA 4RA7A 4JKTA 5IU1A 1PRQA 4B93A 5DJUA 5FSRA 2PR6A 2IWCA 2ZMVA 1FILA 1K55A 2EXAA 1LI9A 1EROA 3UMEA 1KOUA 4IBRA 2FZ0A 1JWVA 3HBRA 4R38A 1FCMA 3DTKA 3TOIA 4E3IA 3QP1A 3A3FA 3ZFZA 4E3MA 5FDHA 2X01A 3IXGA 1MPLA 1KE4A 2E8JA 4IJGA 1FSWA 2IWDA 3LR0A 1BULA 3DTIA 3UPPA 2ZQ9A 2PD8A 3HJKA 4JXSA 4RRDA 3HLFA 1MWTA 3VP2A 4DXCA 4GOGA 2OLUA 1IKGA 4WEJA 2C6WB 2GX5A 4OQIA 4EV4A 2DRWA 4RR9A 2J3WA 1D06A 5IHVA 1T19A 3KYQA 3QNBA 2HV1A 3PD5A 3DAVA 5CTNA 3GTCA 5CGXA 4EU0A 1T1BA 1KVLA 4PPRA 3IHBA 2Y2PA 3AGEA 3T4SA 2ZL1A 2HKZA 1HVBA 2D01A 4HNBA 5TFQA 1AXBA 2Y2NA 2W3DA 1F2KA 3LEQA 5JYOA 2ZQ7A 2W1RA 3O88A 4P6BA 2PHYA 3WRZA 4FOFA 5HD5A 2PBDP 4R3JA 3TE8A 3S7NA 5KZHA 2W27A 3O3VA 3JVUA 3T12B 1V9YA 2WK0A 4DN0A 4WM9A 5DVAA 3O5YA 4OQ0A 4GHIA 1ZG6A 2DNSA 4DE3A 1ACFA 3RXXA 3PBRA 4DDSA 1PIOA 4ME4A 4HESA 1I2WA 1L0EA 5IS1A 3EGDC 1HTZA 4M3KA 5CGWA 3R7WB 2ZD8A 4ZTKA 5AVEA 2JHEA 2HL2A 3V5MA 2QZ6A 5EVIC 4BENA 3HJIA 2P9VB 4BL3A 1IOUA 5U47A 5GHYA 4A5RA 2EXBA 4UQIM 3MR0A 5GHZA 3V3RA 3IF6B 1HLUP 5CRFA 2ZC5B 4HP4A 1P97A 1K4EA 3KO4A 3CZDA 4ZBEA 4Y0UA 2PR5A 1Z6FA 4O0PA 1XFNA 4Q8IA 4WBGA 4R6LA 1MC0A 5L2FA 4OPZA 2JKFA 4F3LA 3UPOA 1W8QA 2WAEA 2DCFA 1OTBA 4S2KA 1W63Q 3L7HA 4FCFA 4FUWA 1G5UA 3T4OA 1F9IA 4KZBA 4EERA 3S7OA 3B42A 3IF5A 1NXYA 3OPLA 4Y0OA 3E98A 4RRRA 1DJCA 5CHJA 2VLGA 3Q1FA 1F98A 3Q07A 3UB7A 4S03A 4QJGA 3WS5A 1TEMA 4QWOA 4OLDA 3VE3A 3F1NA 2PD7A 3MZFA 3VE4A 4P6ZM 2V1BA 2YKHA 1IFQA 1FQGA 1OTDA 1H0MA 1XGIA 4S2PA 1LSXA 3MFDA 3HVFA 1OPXA 4D60A 2WUQA 4FH4A 1W8YA 4B4XA 3FWLA 2K7SA 2HDRA 2I9VA 4G3WA 5TBMA 5F1FA 2JBFA 1UWNX 2P08A 3ZDJA 1MWRA 5HARA 4Y17A 3UO9A 2Y2IA 4KUOA 4P0MA 4R1GA 5C5KA 2J9PA 1VETA 2J9OA 1O07A 5FAPA 4LV0A 2XDMA 1RGZA 1ZHHB 3EQVA 2JKTM 5K5BA 2JN7A 3RFBA 1I5QA 1TS8A 2VGKA 5KIZA 2R9WA 5CHMA 4GD6A 1NYMA 5HAIA 3V39A 1MKMA 4BBVA 4ZJ3A 3UE1A 3NOTC 3KSGA 3CWFA 2ZL1B 4QY6A 1OMEA 3LR4A 4DJ2A 3Q7ZA 4LENA 3K3CA 2OOLA 3W4PA 3N7WA 4CLCD 3BW6A 4YFMA 5AJGA 5EOOA 4FSFA 4RR8A 4S2IA 3OLOA 4B88A 4DJ3A 2P7JA 1K56D 3M2JA 3ZVWA 2K31A 5A93A 1BLSA 3SS3A 3D3OA 4HBTA 4RRJA 4GW9A 1OTIA 3BYDA 5L07A 3IX3A 3QNCA 2JE5A 4GHIB 1GHIA 1FR6A 4ZDXA 1LT0A 1VHMA 3WS0A 3NDEA 3WS2A 4K0WA 4EW7A 3KNFA 1K0KA 5GLAA 3UDIA 3ZCZA 4DE1A 5EM0A 2GNXA 1WA9A 4JF5A 2WGIA 4X53A 2L1MA 2R9XA 5AVFA 1K54A 5DF8A 1PZPA 4MEZA 2ZOHA 1DP6A 4PMAA 2VJWA 3KSIA 2GDNA 4S0KA 4HOIA 4F94A 5EUAA 4HY8A 2HJ9C 3BWLA 4KZ7A 4WZ4A 1K55C 4K91A 2WGWB 2P74A 4F3LB 1SHVA 4WZ5A 4NETA 1OJ5A 4IVKA 3NC8A 2EX2A 3ITAA 4RRFA 3MKFA 3NOPC 4MLLA 4JGQA 4PM6A 2Y91A 4EUZA 4OPYA 2C5WB 2QJ5A 3R4KA 3KODA 1S1ZA 4RRKA 1YLTA 1GSVA 3N8LA 2Y4AA 1ES5A 1YAXA 4KZ4A 2A24A 4DXBA 1K57A 2QYBA 1U60A 5EFWA 3K3DA 1HZOA 1EW0A 1BYWA 3TW8A 4RYEA 2EFUA 2O9BA 2QHKA 1M6KA 4MNRA 3F1NB 3GR2A 5GLBA 3S4XA 5FAOA 4IBXA 2XA7S 3GRJA 1XJ3A 3PBTA 3A0SA 3E4QA 2QWSA 3FKWA 1LLBA 4Q0IA 4LV1A 3LIAA 5TBMB 3LO7A 3RJUA 3SS4A 1ZTUA 3KX0X 5HPIA 1SDNA 2KDKA 3GECA 5F5YA 3BFCA 1ONHA 4RQ9A 1VETB 1PWGA 4Y3IA 2J3TC 1NRJA 4BBTA 5AQAA 1DJAA 2O9CA 1KGFA 1FR1A 2V20A 1LSVA 1GA9A 4RRGA 3DWKA 4LRZE 3HUOA 3WS1A 4M4XA 4NBJA 2NUPC 1ALQA 1C3BA 3B33A 4KENB 3BFFA 4QPRA 2ZM0A 1S4SA 3SH7A 2H28A 3A0VA 2X71A 4OPQA 2ZBBA 1L2SA 2JKRI 5A91A 3MSHA 5FDSA 5E2EA 5EECA 3UDXA 3G34A 1MWSA 4S2NA 2WADA 1Q2PA 3D4FA 2O9AA 5JYPA 3SS5A 4R4RA 1H5XA 2V9AA 5FQIA 4EETB 2XD1A 3RXWA 3OCNA 3PYPA 3E2LA 3FPVA 1HD8A 5DFXA 3S7PA 2KX6A 1PWCA 5FI7A 5CXWA 3C4PA 2HL1A 1ES4A 4MN7A 3UDFA 4YINA 4JF4A 4HJ6A 3OPHA 4OPRA 4P87A 5EM1A 2WKRA 3FYZA 5HFOA 2ZC6B 5CECA 3ISGA 2ZJ9A 2ZM8A 4CLCA 5M18A 3V50A 1XGJA 2CMNA 2WKIA 2W0NA 1K56A 3QP8A 1SKFA 4I39A 5EPHA 4MCWA 1GSWA 3LGOA 3FZCA 5J4EA 3IWIA 5I5LA 2Z6CA 1CK3A 5CERA 1MBLA 3IQAA 4B4ZA 2M7VA 4JXVA 3MMHA 1ODVA 4MN6A 2DBOA 2V1ZA 5TR7A 2Q9NA 3GMWA 3LIFA 3OBFA 3TJZC 2DMWA 5FASA 3T1RA 1AWIA 3CITA 4IHQA 4LLOB 4K08A 3ZNYA 5GLDA 2OWHA 4ESPA 2VA0A 5DTTA 3PD4A 1CQAA 1YPRA 3T4QA 2WZXA 2ZMAA 3NIAA 2EWWA 3NCKA 1MWUA 3G31A 2EWVA 2A24B 3BFDA 3ZHHA 4WN5A 4XT2A 2OWJA 3BY8A 2PDRA 5HAPA 4RRIA 2JC7A 1BSGA 3V67A 4ID4A 1OJGA 2VGLS 2XQZA 4H6JA 1VM1A 5FQQA 1IELA 2OAQ1 2GJ3A 2HDQA 4GDNA 1LHYA 3LFVA 5EVLA 4NBIA 1K38A 1BZAA 3LICA 1CEFA 3IX4A 4E3LA 1J7GA 2ZOIA 4NEED 2H5SA 1YMXA 3MQQA 3MQOA 3BRMA 5HWVA 4YOFA 4HBUA 3EWKA 4GCZA 5FQJA 3KO5A 3VOZA 4I38A 3F1OA 4QB8A 2XLNA 1FCNA 3DTEA 3HLCA 5J61A 3QP2A 1YLZA 4RRLA 5G4YA 3KO7A 2OLVA 3NBLA 1W7FA 4AFIA 2W3HA 3EQUA 3ZG5A 4JXWA 5DTSA 4RRQA 5F82A 4OLGA 4JGRA 4KQRA 3CI6A 3MXSA 1L0GA 3EEAA 1YMSA 2VK3A 1LL5A 2WGWA 5GLCA 4NK3A 4E3NA 5FQMA 2J7VA 3PBNA 1TS7A 4PM9A 3UN7A 3ZG8B 3G32A 3N4IA 3PD3A 1K54C 3Q81A 3NHQA 1YQSA 4PM8A 2BTFP 4FTXA 3MJQA 1K25A 3Q7VA 2JKGA 4EQ1A 4C75A 3ICYA 1J9MA 2FFFB 2WKHA 3IWQA 4PM5A 1MZUA 3LY3A 4ETXA 2XROA 3T4JA 4LCMA 2Y59A 3CMZA 3WS4A 4EEUA 1RCJA 3LIEA 1NWZA 1WYCA 2J8YA 5HDDA 3KYZA 5IT5A 4OOMA 5EOEA 2Y2QA 1IYPA 2VV7A 4C6YA 1WYBA 4H8RA 5HL1A 4S2JA 1L0DA 1W63M 4ZAMA 4CLCB 3T1SA 4RRHA 1FSYA 3N8SA 5KSCA 5FI6A 4JXGA 1EWZA 3IBJA 1LSWA 2Q9MA 2EX9A 2YKFA 3C38A 4NKPA 3TSGA 4WUJA 1F5MA 1D1JA 1XJ6A 5HZHA 4KG6A 4S2MA 1ZKJA 2G2UA 4X55A 4S0LA 2IA2A 3ZVTA 3GQZA 4KG5A 3BY9A 2Q0OA 1H8YA 3DW0A 5FAQA 4U0XA 1N9BA 5KSHA 1ES3A 3UB5P 1Y28A 1YLJA 4QD4A 4KZ9A 1MY8A 2HGVA 2A3UA 4JBFA 1STZA 2LB5A 5FEFA 2Y8HA 3M6HA 1G6AA 1EI5A 3HLBA 4XT2B 1P9WA 1Z09A 3IXHA 1LL8A 2IWBA 3MF0A 3MQ0A 4P85A 5HX9A 5L10A 5M1AA 4H6JB 3K2NA 5GHXA 1VEUA 1KE3A 2XFSA 5DF9A 4LCLA 1W5DA 3IF6C 3IX8A 3PTEA 5CHUA 3G2YA 3PHYA 3EEHA 4XUZA 1KGEA 5CGSA 1BT5A 1VB6A 2KOIA 5BOHA 4DF6A 4DDYA 1TDGA 4EBPA 3IBRA 4R4SA 2XK1A 2A2LA 2OKVA 1BLPA 2ACGA 1T1CA 3VP1A 1XA7A 4EBNA 1ZC2A 3UY6A 4S2NC 4Y2FA 3PXPA 3SOIA 1ERMA 4UA7A 2W1TA 2G7UA 3HLEA 4EUVA 2XFTA 2B02A 4QU3A 4NXGA 4OH0A 3F1OB 3MXRA 4UA9A 4KQQA 2ZLYA 3E4OA 3B3XA 3FKVA 1DP8A 4LV2A 2XSSA 1KGGA 2XEPA 1K6SA 3LI8A 3PBSA 4Q0HA 3RH8B 3U4LP 4LRXC 2H10A 5EVEA 3QHYA 2ZQCA 4GN2A 3L9KA 1IKIA 3QP6A 4OOYA 2ZM2A 5AQBA 1Y54A 2WKEA 1E3UD 3S1YA 3LR5A 1ONGA 3KSHA 5AQ7A 3Q7VB 2Y55A 4NXEA 2J3TD 3C7UA 1YSQA 3MS6A 4PHTA 1JKEA 4R3BA 3LMVA 4LPZA 3W4OA 2Y2MA 3NY4A 1RGYA 4OONA 2X02A 2VEAA 3LIDA 5E2FA 2P04A 1LI0A 3GVBA 4WMCD 2INWA 4UQIS 3C30A 5HDSA 4N1HA 5HL6A 1XFQA 3G6OA 2ZC7A 2PYRA 3BFGA 3MFXA 5FI2A 1ES2A 3WWXA 4OP8A 2HP6A 4GKUA 4X1LA 3SW1A 1YT4A 1TD5A 2CC1A 1ESUA 5HDCA 5J7EA 1FIKA 2MJ6A 1L3LA 2FFYA 4BJPA 1XJ4A 3DWZA 4QY5A 1TS6A 4BQMA 5D3OA 2EA9A 3D72A 2W3FA 1TDLA 4XXRA 3KNPA 4I3AA 3P09A 4DMZA 3HUNA 3LEZA 4ZRRA 4II7A 3T1QB 1H8MA 3F1PA 2Y2LA 3NULA 2ZMFA 2OSUA 2HZ5A 4BD0A 4EESA 3T4KA 4LV3A 3DBAA 5G4ZA 3ZGAB 4X68A 4BWIA 4OKPA 2JKTI 2OV5A 1OT6A 1XJ2A 3JYIA 2EX6A 4P6ZS 5A8BA 1QMEA 2BG1A 4RX2A 3BECA 3N6IA 2M7UA 2XH9A 4X1MA 1CI9A 5FEGA 3QP5A 2BASA 2A49A 4S0JA 1T1AA 5KMWA 1XPBA 3CLOA 3OC2A 1VEUB 4GJ4A 5I94A 3I7JA 1PI5A 2I72A 2G2WA 1LL9A 1S66L 3EOIA 3CG5A 1YM1A 3SZTA 5F1GA 1N9OA 3CHWP 4ZJ1A 4E04A 2V0UA 2HL0A 4WEKA 1TVFA 4N9KA 2HP5A 4DKIA 3H7WA 2VZWA 3BQAA 2Z6DA 1PZOA 1N9LA 3CPTA 3H9WA 4S02A 4UAAA 2W1TB 2HDUA 2HF6A 4MBHA 3HREA 3LUQA 4N92A 4RRAA 5F83A 1SKOA 4ETZA 3H82A 2V8FA 4E3KA 1DJBA 3UMDA 2HDSA 4LRYC 2NUTC 3PR6A 3OOVA 4EQIA 1IYQA 1NLYA 4R3AA 1IYOA 2V2FF 1NJ4A 3UE3A 2AVXA 1BUEA 5DFYA 5E2HA
chains in the Genus database with same CATH topology
4RRJA 3LCEA 4PM8A 4UHUA 1K6RA 3SH9A 1O7EA 1K25A 2EX8A 3MZEA 3Q7VA 3ZG0A 4DRTA 1DY6A 3BYDA 3VP3A 2ZC3B 3KO3A 3KO9A 3VP4A 5FA7A 1MXOA 3C5AA 3O86A 3QNCA 4C75A 2JE5A 1J9MA 1GHMA 2FFFB 1GHIA 2WKHA 4MBFA 3IWQA 1FR6A 4ZDXA 4PM5A 3LY3A 5FQKA 2Y2HA 4LCMA 2UWXA 1ZG4A 4XUXA 2Y59A 3CMZA 5E43A 1QMFA 3PAEA 2PBYA 3WS4A 2VGJA 3NDEA 3WS0A 3WS2A 4K0WA 1I2SA 1KDWA 1RCJA 5EVID 1NRFA 3KNFA 1WYCA 2J8YA 5HW3A 3OZHA 3WRTA 5GLAA 4EBNA 1SCWA 1PI4A 3UDIA 3W4QA 3ZCZA 5E2GA 3LY4A 4DE1A 4OOMA 5EOEA 2Y2QA 3MKEA 1IYPA 2P9VA 4JF5A 3OPPA 2WGIA 4C6YA 4RVAA 4X53A 4X56A 1WYBA 2R9XA 4UA6A 1PW8A 4H8RA 5HL1A 2RL3A 4S2JA 1PW1A 1L0DA 1K54A 4EBLA 4WYYA 3DTMA 4ZAMA 5DF8A 3VFHA 3VOYA 4RRHA 1BLHA 1PZPA 3IF6A 3O87A 4MEZA 2PU4A 4ZJ2A 4PMAA 1TC5A 3IH9A 4RR6A 1FSYA 3N8SA 1SDEA 2GDNA 5KSCA 2ZQAA 4FD8A 5FI6A 3M2KA 4S0KA 4JXGA 1EWZA 4PM7A 2Q9MA 2EX9A 4F94A 5EUAA 1Q2QA 4JPMA 1XKZA 1E4DA 1FCOA 3TSGA 4JF6A 5FQ9A 4KZ7A 1H8ZA 1XX2A 4WZ4A 1E3UA 1K55C 2XD5A 4KG6A 4K91A 4S2MA 1ZKJA 3HUMA 2G2UA 4RR7A 4KZ3A 2WGWB 4X55A 2WAFA 2P74A 4E3OA 1SHVA 3IWOA 2Y2GA 4RRMA 3GSGA 2Y2JA 4WZ5A 4IVIA 3N8RA 4S0LA 4NETA 4U0TA 3ZVTA 4IVKA 3NC8A 2EX2A 3ITAA 3GQZA 3VSLA 4KG5A 4RRFA 3MKFA 3MBZA 4S0IA 3BLMA 1H8YA 4MLLA 4CJNA 3DW0A 4PM6A 5FAQA 4U0XA 1N9BA 4HEFA 5KSHA 4Y7PA 2Y91A 1ES3A 4EUZA 1YLJA 4OPYA 2HPBA 5EVIB 3C4OA 2C5WB 4QD4A 4KZ9A 1PYYA 1MY8A 1S6RA 4GD8A 3KODA 2A3UA 3VMAA 4RRKA 1YLTA 5A92A 4JBFA 4WMCA 3M6BA 2BLSA 3IT9A 3V3SA 4RA7A 4JKTA 3N8LA 2Y4AA 1ES5A 4KZ4A 4DXBA 3M6HA 1N4OA 1K57A 1G6AA 3A3JA 4KZ6A 4QHCA 1U60A 1EI5A 5FSRA 4CPKA 1HZOA 2IWCA 3HLBA 4RYEA 1K55A 1KDSA 2EFUA 2EXAA 1LI9A 1EROA 3IXHA 4IBRA 2IWBA 1M6KA 4MNRA 3GR2A 5GLBA 1JWVA 3HBRA 3S4XA 1JTGA 5FAOA 2E8IA 4P85A 5HX9A 4IBXA 3S22A 5M1AA 2WGVA 1FCMA 3TOIA 4E3IA 3A3FA 3GRJA 5GHXA 3PBTA 3ZFZA 4E3MA 1KE3A 2XFSA 1XA1A 4LCLA 5DF9A 5FDHA 2X01A 3BEBA 3IXGA 1W5DA 3FKWA 1YLPA 3IF6C 1MPLA 1LLBA 4KZ5A 3VSKA 1KE4A 2ZC4B 4LV1A 4BD1A 3PTEA 5CHUA 2XR0A 3G2YA 1FOFA 3LO7A 4XUZA 3RJUA 5CEDA 4GDBA 1KGEA 5CGSA 1BT5A 3SS4A 1FSWA 2IWDA 1NY0A 1SDNA 5BOHA 4DF6A 1BULA 4DDYA 3UPPA 2ZQ9A 1TDGA 4JXSA 2XGNA 4EBPA 1YLYA 3BFCA 3LMUA 4RRDA 2WYXA 4R4SA 2XK1A 1IEMA 1ONHA 3HLFA 1MWTA 3AGDA 2OKVA 1BLPA 3VP2A 3VP1A 4DXCA 1PWGA 4WZ5C 4GOGA 2OLUA 1IKGA 4WEJA 1XA7A 1NZOA 2C6WB 2H0YA 3BLSA 2DRWA 4OQIA 1ZC2A 4S2OA 4S2NC 3UY6A 4EV4A 2QMIA 3SOIA 3SH8A 1ERMA 5CEBA 4KQOA 5AQAA 4UA7A 4FH2A 3LMTA 5IHVA 2XF3A 2HP9A 1DJAA 3BM6A 3HL9A 3HLEA 1KGFA 1FR1A 2XFTA 2V20A 3QNBA 4QU3A 3PD5A 4OH0A 3MXRA 4UA9A 1GA9A 4RRGA 3AGFA 5CTNA 3GTCA 3DWKA 4KQQA 5CGXA 2ZLYA 3UE0A 3CJMA 1KVLA 4PPRA 3B3XA 4RRBA 3HUOA 3IHBA 3WS1A 1S0WA 2Y2PA 3FKVA 4NBJA 3IXBA 3AGEA 1GHPA 4LV2A 1ALQA 1JWPA 2HKZA 4KZAA 1C3BA 1HVBA 3GV9A 1KGGA 2XEPA 4MBKA 1K6SA 3PBSA 4KENB 5TFQA 1K57C 1AXBA 3KOCA 2Y2KA 3BFFA 2Y2NA 2ZM0A 4EWFA 2RCXA 3A3DA 2H10A 3SH7A 5JYOA 2X71A 4OPQA 2ZQ7A 3O88A 3QHYA 2ZQCA 4GN2A 4P6BA 4DE2A 4DE0A 4X6TA 3WRZA 1KE0A 1L2SA 3PAGA 3UNWA 5A91A 1IKIA 1L0FA 4E3JA 5E2EA 4R3JA 5EECA 3UDXA 3G34A 1MWSA 4S2NA 2WADA 1Q2PA 3D4FA 4OOYA 5JYPA 5KZHA 3C7VA 2ZM2A 3FV7A 5AQBA 3HLGA 1Y54A 2WKEA 3SS5A 4R4RA 1H5XA 3O3VA 5FQIA 2Z2MB 2WK0A 1E3UD 2XD1A 3S1YA 1ONGA 3RXWA 1NZUA 5AQ7A 3OCNA 4WM9A 5DVAA 3Q7VB 4OQ0A 2Y55A 2Y2OA 4OQHA 2ZQ8A 3E2LA 1ZG6A 3C7UA 1HD8A 2DNSA 4DE3A 3RXXA 3PBRA 4DDSA 1PIOA 1PWCA 5CXWA 5FI7A 4C3QA 1JKEA 3C4PA 4HESA 2HL1A 1I2WA 1L0EA 1ES4A 4R3BA 3LMVA 3W4OA 3UDFA 4YINA 2Y2MA 1HTZA 3HLDA 4JF4A 4M3KA 5CGWA 3OPHA 4GNUA 4GZBA 3PD2A 4OPRA 4OOLA 3NY4A 1RGYA 4OONA 4P87A 2X02A 1XXMA 2ZD8A 4ZTKA 4R23A 4R0QA 5E2FA 1RP5A 3FYZA 1LI0A 5HFOA 2ZC6B 2HL2A 3V5MA 5CECA 3GVBA 4WMCD 2QZ6A 3ISGA 5EVIC 4BENA 2P9VB 2ZJ9A 2ZM8A 4BL3A 4N1HA 5U47A 3E2KA 5GHYA 5M18A 5M19A 4A5RA 2EXBA 2ZC7A 3V50A 4RX3A 1ERQA 1XGJA 3BFGA 2WKIA 5FI2A 1ES2A 3ITBA 5GHZA 3V3RA 1BLCA 1K56A 3IF6B 3WWXA 1SKFA 4OP8A 2HP6A 5EPHA 5CRFA 2ZC5B 3P98A 3NI9A 4GKUA 3PBQA 1K4EA 3FZCA 3KO4A 3CZDA 4ZBEA 3PBOA 1YT4A 3IWIA 4Y0UA 1CI8A 2CC1A 1Z6FA 1ESUA 1CK3A 5G18A 4WBGA 5CERA 4Q8IA 1MBLA 3IQAA 5L2FA 4B4ZA 4JXVA 4OPZA 2FFYA 4BJPA 2DBOA 1GA0A 2V1ZA 3UPOA 5TR7A 1K4FA 2Q9NA 3GMWA 3Q82A 3DWZA 4OQGA 1W8QA 4QY5A 5EE8A 2WAEA 4BQMA 2DCFA 5D3OA 5FASA 5DF7A 5HAQA 1TDLA 2ZQDA 3ZNYA 4XXRA 4S2KA 3KNPA 2B5RA 3P09A 1WE4A 5GLDA 5EVIA 4N1XA 4FCFA 3HLWA 3ZG9B 3HUNA 3LEZA 1E25A 5DTTA 2Y2LA 3PD4A 4KZBA 4U3TA 1YLWA 2OSUA 4BL2A 5J8XA 2WZZA 4BD0A 4E6XA 3IF5A 1NXYA 3OPLA 4LV3A 4Y0OA 2WZXA 5A90A 2ZMAA 3NIAA 3NCKA 1BTLA 1MWUA 3G31A 4JLFA 1DJCA 4RRRA 3ZGAB 4X68A 3BFDA 4OKPA 5CHJA 5DTKA 2OV5A 3BFEA 3Q1FA 3ZHHA 3ZNTA 4GB7A 3JYIA 1VQQA 2EX6A 4Z9QA 4RR9A 3Q07A 4S03A 2JCHA 1QMEA 4QJGA 1MKIA 2BG1A 4RX2A 3BECA 3N6IA 3WS5A 1GCEA 1TEMA 3OPRA 4IEDA 4OLDA 5TGFA 5HAPA 4RRIA 3MZFA 2XH9A 1W79A 2JC7A 1BSGA 5AQ9A 4ID4A 1FQGA 1XGIA 1CI9A 4S2PA 1PWDA 3MFDA 2XQZA 3HVFA 1Y2QA 2WUQA 1VM1A 2A49A 4FH4A 1IELA 5FQQA 3UPNA 3TG9A 3G35A 4S0JA 5KMWA 1XPBA 1W8YA 3IH8A 3OC2A 2HDQA 4GDNA 4OP5A 4B4XA 1LHYA 3VFFA 3FWLA 1JWZA 5EVLA 5GL9A 4NBIA 3NDGA 2HDRA 5I94A 1K38A 1BZAA 1CEFA 5F1FA 1NYYA 2JBFA 3I7JA 3G4PA 1PI5A 2I72A 4RRCA 2G2WA 3ZG7B 4Y0TA 4E3LA 1J7GA 3ZDJA 1LL9A 1MWRA 5HARA 2H0TA 3UO9A 2Y2IA 2H5SA 1YMXA 3G30A 3CG5A 4P0MA 4R1GA 1JTDA 1YM1A 2EFXA 3IHAA 2J9PA 3OCLA 5F1GA 2J9OA 4ZJ1A 1O07A 3BRMA 5FAPA 4LV0A 4D2OA 4K0XA 2HL0A 4WEKA 1TVFA 4WELA 2XDMA 1RGZA 3EQVA 4N9KA 4HBUA 4E6WA 2HP5A 4DKIA 3MZDA 4S2LA 1I5QA 2VGKA 1PZOA 2R9WA 5FQJA 4S02A 5CHMA 3KO5A 4GD6A 4UAAA 4BLMA 1NYMA 3VOZA 2HDUA 5HAIA 3V39A 4KG2A 4MBHA 1KVMA 2XLNA 1FCNA 4QB8A 3HLCA 4X69A 5J61A 4RRLA 1YLZA 3HREA 3KO7A 4ZJ3A 3KOBA 4N92A 2QPNA 2OLVA 3VP0A 4RRAA 3NBLA 3A3EA 3UE1A 1W7FA 2Z2LB 5F83A 3W8KA 4O7DA 3EQUA 3ZG5A 1IYSA 4QY6A 4JXWA 1OMEA 5DTSA 4RRQA 5F82A 2PU2A 4OLGA 3Q7ZA 4KQRA 4LENA 1G68A 3W4PA 3MXSA 4L0LA 1L0GA 1DJBA 4KZ8A 3N7WA 4E3KA 3A3IA 4YFMA 5EOOA 4FSFA 5CTMA 4RR8A 1YMSA 4S2IA 2HDSA 4B88A 1LL5A 2WGWA 5GLCA 4EQIA 1JVJA 1IYQA 1K56D 1CEGA 4N9LA 4NK3A 4E3NA 3M2JA 5FQMA 2J7VA 3PBNA 4PM9A 3UN7A 3ZVWA 5FATA 3ZG8B 1IYOA 2V2FF 3G32A 1XP4A 3N4IA 1BLSA 5A93A 1K54C 3Q81A 3PD3A 1NJ4A 1M40A 4OVDA 3G2ZA 3SS3A 3UE3A 1YQSA 4HBTA 1BUEA 1ESIA 3IXDA 5E2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCE A;  4PM8 A;  4UHU A;  1K6R A;  3SH9 A;  1O7E A;  1K25 A;  2EX8 A;  3MZE A;  3Q7V A;  3ZG0 A;  4DRT A;  1DY6 A;  3BYD A;  3VP3 A;  2ZC3 B;  3VP4 A;  5FA7 A;  1MXO A;  3C5A A;  3O86 A;  3QNC A;  4C75 A;  2JE5 A;  1J9M A;  1GHM A;  2FFF B;  1GHI A;  2WKH A;  4MBF A;  3IWQ A;  1FR6 A;  4ZDX A;  4PM5 A;  3LY3 A;  5FQK A;  2Y2H A;  4LCM A;  2UWX A;  1ZG4 A;  4XUX A;  2Y59 A;  3CMZ A;  5E43 A;  1QMF A;  3PAE A;  2PBY A;  3WS4 A;  2VGJ A;  3NDE A;  3WS0 A;  3WS2 A;  4K0W A;  1I2S A;  1KDW A;  1RCJ A;  5EVI D;  1NRF A;  1WYC A;  2J8Y A;  5HW3 A;  3OZH A;  3WRT A;  5GLA A;  4EBN A;  1SCW A;  1PI4 A;  3UDI A;  3W4Q A;  3ZCZ A;  5E2G A;  3LY4 A;  4DE1 A;  4OOM A;  5EOE A;  2Y2Q A;  3MKE A;  1IYP A;  2P9V A;  4JF5 A;  3OPP A;  2WGI A;  4C6Y A;  4RVA A;  4X53 A;  4X56 A;  1WYB A;  2R9X A;  4UA6 A;  1PW8 A;  4H8R A;  5HL1 A;  2RL3 A;  4S2J A;  1PW1 A;  1L0D A;  1K54 A;  4EBL A;  4WYY A;  3DTM A;  4ZAM A;  5DF8 A;  3VFH A;  3VOY A;  1BLH A;  1PZP A;  3IF6 A;  3O87 A;  4MEZ A;  2PU4 A;  4ZJ2 A;  4PMA A;  3IH9 A;  1FSY A;  3N8S A;  1SDE A;  2GDN A;  5KSC A;  2ZQA A;  4FD8 A;  5FI6 A;  3M2K A;  4JXG A;  1EWZ A;  4PM7 A;  2Q9M A;  2EX9 A;  4F94 A;  5EUA A;  1Q2Q A;  4JPM A;  1XKZ A;  1E4D A;  1FCO A;  3TSG A;  4JF6 A;  5FQ9 A;  4KZ7 A;  1H8Z A;  1XX2 A;  4WZ4 A;  1E3U A;  1K55 C;  2XD5 A;  4KG6 A;  4K91 A;  4S2M A;  1ZKJ A;  3HUM A;  2G2U A;  4KZ3 A;  2WGW B;  4X55 A;  2WAF A;  2P74 A;  4E3O A;  1SHV A;  3IWO A;  2Y2G A;  3GSG A;  2Y2J A;  4WZ5 A;  4IVI A;  3N8R A;  4NET A;  4U0T A;  3ZVT A;  4IVK A;  3NC8 A;  2EX2 A;  3ITA A;  3GQZ A;  3VSL A;  4KG5 A;  3MKF A;  3MBZ A;  3BLM A;  1H8Y A;  4MLL A;  4CJN A;  3DW0 A;  4PM6 A;  5FAQ A;  4U0X A;  1N9B A;  4HEF A;  5KSH A;  4Y7P A;  2Y91 A;  1ES3 A;  4EUZ A;  1YLJ A;  4OPY A;  2HPB A;  5EVI B;  3C4O A;  2C5W B;  4QD4 A;  4KZ9 A;  1PYY A;  1MY8 A;  1S6R A;  4GD8 A;  2A3U A;  3VMA A;  1YLT A;  5A92 A;  4JBF A;  4WMC A;  3M6B A;  2BLS A;  3IT9 A;  3V3S A;  4RA7 A;  4JKT A;  3N8L A;  2Y4A A;  1ES5 A;  4KZ4 A;  4DXB A;  3M6H A;  1N4O A;  1K57 A;  1G6A A;  3A3J A;  4KZ6 A;  4QHC A;  1U60 A;  1EI5 A;  5FSR A;  4CPK A;  1HZO A;  2IWC A;  3HLB A;  4RYE A;  1K55 A;  1KDS A;  2EFU A;  2EXA A;  1LI9 A;  1ERO A;  3IXH A;  4IBR A;  2IWB A;  1M6K A;  4MNR A;  3GR2 A;  5GLB A;  1JWV A;  3HBR A;  3S4X A;  1JTG A;  5FAO A;  2E8I A;  4P85 A;  5HX9 A;  4IBX A;  3S22 A;  5M1A A;  2WGV A;  1FCM A;  3TOI A;  4E3I A;  3A3F A;  3GRJ A;  5GHX A;  3PBT A;  3ZFZ A;  4E3M A;  1KE3 A;  2XFS A;  1XA1 A;  4LCL A;  5DF9 A;  5FDH A;  2X01 A;  3BEB A;  3IXG A;  1W5D A;  3FKW A;  1YLP A;  3IF6 C;  1MPL A;  1LLB A;  4KZ5 A;  3VSK A;  1KE4 A;  2ZC4 B;  4LV1 A;  4BD1 A;  3PTE A;  5CHU A;  2XR0 A;  3G2Y A;  1FOF A;  3LO7 A;  4XUZ A;  3RJU A;  5CED A;  4GDB A;  1KGE A;  5CGS A;  1BT5 A;  3SS4 A;  1FSW A;  2IWD A;  1NY0 A;  1SDN A;  5BOH A;  4DF6 A;  1BUL A;  4DDY A;  3UPP A;  2ZQ9 A;  1TDG A;  4JXS A;  2XGN A;  4EBP A;  1YLY A;  3BFC A;  2WYX A;  4R4S A;  2XK1 A;  1IEM A;  1ONH A;  3HLF A;  1MWT A;  3AGD A;  1BLP A;  3VP2 A;  3VP1 A;  4DXC A;  1PWG A;  4WZ5 C;  4GOG A;  2OLU A;  1IKG A;  4WEJ A;  1XA7 A;  1NZO A;  2C6W B;  2H0Y A;  3BLS A;  2DRW A;  4OQI A;  1ZC2 A;  4S2O A;  4S2N C;  3UY6 A;  4EV4 A;  2QMI A;  3SOI A;  3SH8 A;  1ERM A;  5CEB A;  4KQO A;  5AQA A;  4UA7 A;  4FH2 A;  5IHV A;  2XF3 A;  2HP9 A;  1DJA A;  3BM6 A;  3HL9 A;  3HLE A;  1KGF A;  1FR1 A;  2XFT A;  2V20 A;  3QNB A;  4QU3 A;  4OH0 A;  3MXR A;  4UA9 A;  1GA9 A;  3AGF A;  5CTN A;  3GTC A;  3DWK A;  4KQQ A;  5CGX A;  2ZLY A;  3UE0 A;  3CJM A;  1KVL A;  4PPR A;  3B3X A;  3HUO A;  3IHB A;  3WS1 A;  1S0W A;  2Y2P A;  3FKV A;  3IXB A;  3AGE A;  1GHP A;  4LV2 A;  1ALQ A;  1JWP A;  4KZA A;  1C3B A;  1HVB A;  3GV9 A;  1KGG A;  2XEP A;  4MBK A;  1K6S A;  3PBS A;  4KEN B;  5TFQ A;  1K57 C;  1AXB A;  2Y2K A;  3BFF A;  2Y2N A;  2ZM0 A;  4EWF A;  2RCX A;  3A3D A;  2H10 A;  3SH7 A;  5JYO A;  2X71 A;  4OPQ A;  2ZQ7 A;  3O88 A;  3QHY A;  2ZQC A;  4GN2 A;  4P6B A;  4DE2 A;  4DE0 A;  4X6T A;  3WRZ A;  1KE0 A;  1L2S A;  3PAG A;  3UNW A;  5A91 A;  1IKI A;  1L0F A;  4E3J A;  5E2E A;  4R3J A;  5EEC A;  3UDX A;  3G34 A;  1MWS A;  4S2N A;  2WAD A;  1Q2P A;  3D4F A;  4OOY A;  5JYP A;  5KZH A;  3C7V A;  2ZM2 A;  3FV7 A;  5AQB A;  3HLG A;  1Y54 A;  2WKE A;  3SS5 A;  4R4R A;  1H5X A;  3O3V A;  5FQI A;  2Z2M B;  2WK0 A;  1E3U D;  2XD1 A;  3S1Y A;  1ONG A;  3RXW A;  1NZU A;  5AQ7 A;  3OCN A;  4WM9 A;  5DVA A;  3Q7V B;  4OQ0 A;  2Y55 A;  2Y2O A;  4OQH A;  2ZQ8 A;  3E2L A;  1ZG6 A;  3C7U A;  1HD8 A;  2DNS A;  4DE3 A;  3RXX A;  3PBR A;  4DDS A;  1PIO A;  1PWC A;  5CXW A;  5FI7 A;  4C3Q A;  3C4P A;  4HES A;  1I2W A;  1L0E A;  1ES4 A;  4R3B A;  3W4O A;  3UDF A;  4YIN A;  2Y2M A;  1HTZ A;  3HLD A;  4JF4 A;  4M3K A;  5CGW A;  3OPH A;  4GNU A;  4GZB A;  4OPR A;  4OOL A;  3NY4 A;  1RGY A;  4OON A;  4P87 A;  2X02 A;  1XXM A;  2ZD8 A;  4ZTK A;  4R23 A;  4R0Q A;  5E2F A;  1RP5 A;  3FYZ A;  1LI0 A;  5HFO A;  2ZC6 B;  3V5M A;  5CEC A;  3GVB A;  4WMC D;  2QZ6 A;  3ISG A;  5EVI C;  4BEN A;  2P9V B;  2ZJ9 A;  2ZM8 A;  4BL3 A;  4N1H A;  5U47 A;  3E2K A;  5GHY A;  5M18 A;  5M19 A;  4A5R A;  2EXB A;  2ZC7 A;  3V50 A;  4RX3 A;  1ERQ A;  1XGJ A;  3BFG A;  2WKI A;  5FI2 A;  1ES2 A;  3ITB A;  5GHZ A;  3V3R A;  1BLC A;  1K56 A;  3IF6 B;  3WWX A;  1SKF A;  4OP8 A;  2HP6 A;  5EPH A;  5CRF A;  2ZC5 B;  3P98 A;  3NI9 A;  4GKU A;  3PBQ A;  1K4E A;  3FZC A;  3CZD A;  4ZBE A;  3PBO A;  1YT4 A;  3IWI A;  4Y0U A;  1CI8 A;  2CC1 A;  1Z6F A;  1ESU A;  1CK3 A;  5G18 A;  4WBG A;  5CER A;  4Q8I A;  1MBL A;  3IQA A;  5L2F A;  4B4Z A;  4JXV A;  4OPZ A;  2FFY A;  4BJP A;  1GA0 A;  2V1Z A;  3UPO A;  5TR7 A;  1K4F A;  2Q9N A;  3GMW A;  3Q82 A;  3DWZ A;  4OQG A;  1W8Q A;  4QY5 A;  5EE8 A;  2WAE A;  4BQM A;  2DCF A;  5D3O A;  5FAS A;  5DF7 A;  5HAQ A;  1TDL A;  2ZQD A;  3ZNY A;  4XXR A;  4S2K A;  2B5R A;  3P09 A;  1WE4 A;  5GLD A;  5EVI A;  4N1X A;  4FCF A;  3HLW A;  3ZG9 B;  3HUN A;  3LEZ A;  1E25 A;  5DTT A;  2Y2L A;  4KZB A;  4U3T A;  1YLW A;  2OSU A;  4BL2 A;  5J8X A;  2WZZ A;  4BD0 A;  4E6X A;  3IF5 A;  1NXY A;  3OPL A;  4LV3 A;  4Y0O A;  2WZX A;  5A90 A;  2ZMA A;  3NIA A;  3NCK A;  1BTL A;  1MWU A;  3G31 A;  4JLF A;  1DJC A;  3ZGA B;  4X68 A;  3BFD A;  4OKP A;  5CHJ A;  5DTK A;  2OV5 A;  3BFE A;  3Q1F A;  3ZHH A;  3ZNT A;  4GB7 A;  3JYI A;  1VQQ A;  2EX6 A;  4Z9Q A;  3Q07 A;  2JCH A;  1QME A;  4QJG A;  1MKI A;  2BG1 A;  4RX2 A;  3BEC A;  3N6I A;  3WS5 A;  1GCE A;  1TEM A;  3OPR A;  4IED A;  4OLD A;  5TGF A;  5HAP A;  3MZF A;  2XH9 A;  1W79 A;  2JC7 A;  1BSG A;  5AQ9 A;  4ID4 A;  1FQG A;  1XGI A;  1CI9 A;  4S2P A;  1PWD A;  3MFD A;  2XQZ A;  3HVF A;  2WUQ A;  1VM1 A;  2A49 A;  4FH4 A;  1IEL A;  5FQQ A;  3UPN A;  3TG9 A;  3G35 A;  5KMW A;  1XPB A;  1W8Y A;  3IH8 A;  3OC2 A;  2HDQ A;  4GDN A;  4OP5 A;  4B4X A;  1LHY A;  3VFF A;  3FWL A;  1JWZ A;  5EVL A;  5GL9 A;  3NDG A;  2HDR A;  5I94 A;  1K38 A;  1BZA A;  1CEF A;  5F1F A;  1NYY A;  2JBF A;  3I7J A;  3G4P A;  1PI5 A;  2I72 A;  2G2W A;  3ZG7 B;  4Y0T A;  4E3L A;  3ZDJ A;  1LL9 A;  1MWR A;  5HAR A;  2H0T A;  3UO9 A;  2Y2I A;  2H5S A;  1YMX A;  3G30 A;  3CG5 A;  4P0M A;  4R1G A;  1JTD A;  1YM1 A;  2EFX A;  3IHA A;  2J9P A;  3OCL A;  5F1G A;  2J9O A;  4ZJ1 A;  1O07 A;  3BRM A;  5FAP A;  4LV0 A;  4D2O A;  4K0X A;  4WEK A;  1TVF A;  4WEL A;  2XDM A;  1RGZ A;  3EQV A;  4N9K A;  4HBU A;  4E6W A;  2HP5 A;  4DKI A;  3MZD A;  4S2L A;  1I5Q A;  2VGK A;  1PZO A;  2R9W A;  5FQJ A;  5CHM A;  4GD6 A;  4UAA A;  4BLM A;  1NYM A;  3VOZ A;  2HDU A;  5HAI A;  3V39 A;  4KG2 A;  4MBH A;  1KVM A;  2XLN A;  1FCN A;  4QB8 A;  3HLC A;  4X69 A;  1YLZ A;  3HRE A;  4ZJ3 A;  4N92 A;  2QPN A;  2OLV A;  3VP0 A;  3NBL A;  3A3E A;  3UE1 A;  1W7F A;  2Z2L B;  5F83 A;  3W8K A;  4O7D A;  3EQU A;  3ZG5 A;  1IYS A;  4QY6 A;  4JXW A;  1OME A;  5DTS A;  5F82 A;  2PU2 A;  4OLG A;  3Q7Z A;  4KQR A;  4LEN A;  1G68 A;  3W4P A;  3MXS A;  4L0L A;  1L0G A;  1DJB A;  4KZ8 A;  3N7W A;  4E3K A;  3A3I A;  4YFM A;  5EOO A;  4FSF A;  5CTM A;  1YMS A;  4S2I A;  2HDS A;  4B88 A;  1LL5 A;  2WGW A;  5GLC A;  4EQI A;  1JVJ A;  1IYQ A;  1K56 D;  1CEG A;  4N9L A;  4NK3 A;  4E3N A;  3M2J A;  5FQM A;  2J7V A;  3PBN A;  4PM9 A;  3UN7 A;  3ZVW A;  5FAT A;  3ZG8 B;  1IYO A;  2V2F F;  3G32 A;  1XP4 A;  3N4I A;  1BLS A;  5A93 A;  1K54 C;  3Q81 A;  1NJ4 A;  1M40 A;  4OVD A;  3G2Z A;  3SS3 A;  3UE3 A;  1YQS A;  4HBT A;  1BUE A;  1ESI A;  3IXD A;  5E2H A; 
#chains in the Genus database with same CATH topology
 3LCE A;  1K6R A;  3SH9 A;  1O7E A;  4IUK A;  4DRT A;  2V8C A;  2ZC3 B;  3KO3 A;  5FA7 A;  3O86 A;  4GS9 A;  1GSX A;  5MC7 A;  1S1Y A;  4UEY A;  3C2W A;  5FQK A;  2UWX A;  1ZG4 A;  2LB9 A;  1TS0 A;  3JPU A;  2PBY A;  2OAP 1;  4MDZ A;  1I2S A;  1KDW A;  5EVI D;  4LFU A;  3OZH A;  1PI4 A;  3W4Q A;  4LGW A;  4RVA A;  4X56 A;  4UA6 A;  1PW8 A;  2RL3 A;  4EBL A;  4WYY A;  4NXF A;  3LYX A;  1BLH A;  3O87 A;  4ZJ2 A;  1TC5 A;  4RR6 A;  3D9Y A;  4CLC E;  1SDE A;  5HSQ A;  2ZQA A;  3M2K A;  4PM7 A;  5F68 A;  3QP4 A;  4CQH A;  1Q2Q A;  4JPM A;  4MN5 A;  5CX7 A;  4HP9 A;  4HJ4 A;  1XKZ A;  1FCO A;  4ARZ A;  1UGU A;  2WKQ A;  4KUK A;  5FQ9 A;  3VV4 A;  1PFL A;  5HPF A;  1E3U A;  2XD5 A;  3HUM A;  4KZ3 A;  3UB8 A;  2PYP A;  4E3O A;  4RRM A;  2Y2G A;  2Y2J A;  4IVI A;  3N8R A;  4YWZ A;  2D02 A;  3TRC A;  3EGX C;  3MBZ A;  4X25 A;  4S0I A;  4JGO A;  4HEF A;  4Y7P A;  5DJT A;  1X0O A;  3P7N A;  4PKY A;  3F1P B;  4GD8 A;  1JNU A;  4WMC A;  1N9N A;  2BLS A;  1S4R A;  3IT9 A;  1N4O A;  1G28 A;  3FG8 A;  3A3J A;  4KZ6 A;  4QHC A;  3KO6 A;  4CPK A;  5DKK A;  1KDS A;  3ZYT A;  4B9O A;  3KYE A;  4HHD A;  1JTG A;  2E8I A;  2WGV A;  4GLQ A;  1P9R A;  2R78 A;  1XA1 A;  3BEB A;  1A0K A;  2XA7 M;  1YLP A;  3T4L A;  4NXB A;  3CUE A;  4KZ5 A;  3VSK A;  4BD1 A;  2ZC4 B;  2XR0 A;  2V1A A;  1FOF A;  2VV6 A;  3A0R A;  5CED A;  4GDB A;  1NY0 A;  2XGN A;  1YLY A;  3LMU A;  3ULF A;  2WYX A;  3LIB A;  1IEM A;  4JGP A;  3AGD A;  2VX8 A;  4WZ5 C;  3B47 A;  1NZO A;  3BLS A;  2H0Y A;  4S2O A;  2XRN A;  3UB6 A;  2QMI A;  3SH8 A;  5CEB A;  3H7W B;  2HJE A;  4KQO A;  3LMT A;  4FH2 A;  2XF3 A;  2HP9 A;  3BM6 A;  3HL9 A;  3CPT B;  1J3W A;  3AGF A;  1CF0 A;  3UE0 A;  3CJM A;  3IS2 A;  2B18 A;  4RRB A;  1S0W A;  3IXB A;  1GHP A;  2FH5 A;  4O8G A;  1JWP A;  2VV8 A;  4KZA A;  1SKO B;  3GDI A;  3GV9 A;  3H82 B;  4MBK A;  1K57 C;  3KOC A;  2Y2K A;  3HCY A;  4HH3 A;  4EWF A;  2RCX A;  3A3D A;  4DE2 A;  4DE0 A;  4X6T A;  1KE0 A;  3PAG A;  3UNW A;  1L0F A;  4E3J A;  3C7V A;  3FV7 A;  3HLG A;  4L9G A;  2Z2M B;  2KLI A;  1NZU A;  1OT9 A;  4Y5F A;  2Y2O A;  4OQH A;  3VOL A;  2ZQ8 A;  4GS9 B;  4C3Q A;  5F6A A;  1S67 L;  3HLD A;  5DKL A;  4GNU A;  4GZB A;  3PD2 A;  4OOL A;  1XXM A;  4R23 A;  4R0Q A;  1RP5 A;  5HWT A;  3E2K A;  5M19 A;  3T1X A;  4RX3 A;  1ERQ A;  3ITB A;  1BLC A;  4G3V A;  2JKR M;  3P98 A;  3NI9 A;  3PBQ A;  4WF0 A;  3PBO A;  1CI8 A;  4ARZ B;  5G18 A;  3FPW A;  4G3K A;  1GA0 A;  1K4F A;  3Q82 A;  4OQG A;  4HH2 A;  5EE8 A;  4MMN A;  5HWW A;  2V0W A;  4BBU A;  5DF7 A;  5HAQ A;  1OTE A;  2ZQD A;  5L09 A;  2B5R A;  4Q0J A;  1WE4 A;  3S7Q A;  5EVI A;  4N1X A;  3HLW A;  3ZG9 B;  5HD3 A;  1E25 A;  3JVV A;  1DP9 A;  4U3T A;  1UWP X;  1YLW A;  4BL2 A;  5J8X A;  2WZZ A;  2VKS A;  4E6X A;  4PAU A;  5A90 A;  1SZV A;  1BTL A;  2O99 A;  4JLF A;  4WLA A;  2K2N A;  5DTK A;  3BFE A;  3ZNT A;  4GB7 A;  1VQQ A;  4Z9Q A;  2JCH A;  1MKI A;  1GCE A;  4IED A;  5TGF A;  2PT7 A;  2J80 A;  1W79 A;  5AQ9 A;  1PWD A;  1Y2Q A;  3UPN A;  3ZQ5 A;  3TG9 A;  3G35 A;  3UB9 A;  2VGL M;  4EEP A;  4CLC C;  3IH8 A;  4OP5 A;  2W3E A;  3VFF A;  1JWZ A;  5GL9 A;  1V9Z A;  3NDG A;  5LBR A;  1TF1 A;  1NYY A;  3G4P A;  4RRC A;  3C8C A;  4BMW A;  3ZG7 B;  4Y0T A;  2H0T A;  3G30 A;  1JTD A;  2EFX A;  3IHA A;  3OCL A;  3UE6 A;  1G6O A;  1Y4O A;  3KSF A;  4D2O A;  4K0X A;  3NOU C;  4WEL A;  5EV0 A;  2QKP A;  4E6W A;  2L0W A;  1YSP A;  3MZD A;  4IUH A;  4S2L A;  3RTY A;  1H3Q A;  4EXO A;  2UV0 E;  4BLM A;  4KG2 A;  4L9F A;  4HIA A;  1KVM A;  4HJ3 A;  4X69 A;  3W2Z A;  3KOB A;  1CJF A;  2QPN A;  3VP0 A;  3A3E A;  2Z2L B;  3W8K A;  3IS2 B;  4O7D A;  5J3W A;  1IYS A;  4Y15 A;  2PU2 A;  4I5S A;  4HI4 A;  1G68 A;  4L0L A;  4KZ8 A;  3A3I A;  1PNE A;  5CTM A;  1DRM A;  1JVJ A;  4O01 A;  1CEG A;  4N9L A;  5FAT A;  1YKD A;  3MXQ A;  3P01 A;  1XP4 A;  2O0Y A;  4I3J A;  1M40 A;  4OVD A;  3G2Z A;  3U2A A;  5L8M A;  1ESI A;  3OPR A;  3IXD A;  3S22 A;  4UHU A;  3MZE A;  2EX8 A;  3ZG0 A;  1DY6 A;  3VP3 A;  3KO9 A;  3VP4 A;  1MXO A;  3C5A A;  3T50 A;  1D7E A;  3NEC A;  2L4R A;  1GHM A;  4R70 A;  4MBF A;  3E0Y A;  3NJA A;  2Y2H A;  4XUX A;  5E43 A;  1QMF A;  2M1C A;  3PAE A;  5F69 A;  1OTA A;  2VGJ A;  4L9E A;  3R7W A;  1P0Z A;  1NRF A;  5HW3 A;  2Y79 A;  3WRT A;  3LI9 A;  1SCW A;  3BJN A;  5E2G A;  3LY4 A;  3MKE A;  2P9V A;  4Z1W A;  3OPP A;  4NG2 A;  1PW1 A;  3DTM A;  3VFH A;  3VOY A;  3IF6 A;  2PU4 A;  4KQD A;  3IH9 A;  5TJJ A;  4Y13 A;  4FD8 A;  5FL3 A;  1T18 A;  2W3G A;  1E4D A;  1NLZ A;  4JF6 A;  1H8Z A;  2QJ7 A;  1XX2 A;  4RR7 A;  2WAF A;  3IWO A;  3GSG A;  2B95 A;  4U0T A;  3VSL A;  3CAX A;  3BLM A;  3BQ8 A;  2GZA A;  4CJN A;  4PKY G;  3LR3 A;  4YNR A;  2HPB A;  5EVI B;  3C4O A;  3CUE C;  4WL9 A;  1PYY A;  1S6R A;  3E4P A;  2WKP A;  3VMA A;  2PRF A;  4HQA A;  5A92 A;  3M6B A;  4I3I A;  3FC7 A;  2PAV P;  3T4T A;  3V3S A;  4RA7 A;  4JKT A;  5IU1 A;  1PRQ A;  4B93 A;  5DJU A;  5FSR A;  2PR6 A;  2IWC A;  2ZMV A;  1FIL A;  1K55 A;  2EXA A;  1LI9 A;  1ERO A;  3UME A;  1KOU A;  4IBR A;  2FZ0 A;  1JWV A;  3HBR A;  4R38 A;  1FCM A;  3DTK A;  3TOI A;  4E3I A;  3QP1 A;  3A3F A;  3ZFZ A;  4E3M A;  5FDH A;  2X01 A;  3IXG A;  1MPL A;  1KE4 A;  2E8J A;  4IJG A;  1FSW A;  2IWD A;  3LR0 A;  1BUL A;  3DTI A;  3UPP A;  2ZQ9 A;  2PD8 A;  3HJK A;  4JXS A;  4RRD A;  3HLF A;  1MWT A;  3VP2 A;  4DXC A;  4GOG A;  2OLU A;  1IKG A;  4WEJ A;  2C6W B;  2GX5 A;  4OQI A;  4EV4 A;  2DRW A;  4RR9 A;  2J3W A;  1D06 A;  5IHV A;  1T19 A;  3KYQ A;  3QNB A;  2HV1 A;  3PD5 A;  3DAV A;  5CTN A;  3GTC A;  5CGX A;  4EU0 A;  1T1B A;  1KVL A;  4PPR A;  3IHB A;  2Y2P A;  3AGE A;  3T4S A;  2ZL1 A;  2HKZ A;  1HVB A;  2D01 A;  4HNB A;  5TFQ A;  1AXB A;  2Y2N A;  2W3D A;  1F2K A;  3LEQ A;  5JYO A;  2ZQ7 A;  2W1R A;  3O88 A;  4P6B A;  2PHY A;  3WRZ A;  4FOF A;  5HD5 A;  2PBD P;  4R3J A;  3TE8 A;  3S7N A;  5KZH A;  2W27 A;  3O3V A;  3JVU A;  3T12 B;  1V9Y A;  2WK0 A;  4DN0 A;  4WM9 A;  5DVA A;  3O5Y A;  4OQ0 A;  4GHI A;  1ZG6 A;  2DNS A;  4DE3 A;  1ACF A;  3RXX A;  3PBR A;  4DDS A;  1PIO A;  4ME4 A;  4HES A;  1I2W A;  1L0E A;  5IS1 A;  3EGD C;  1HTZ A;  4M3K A;  5CGW A;  3R7W B;  2ZD8 A;  4ZTK A;  5AVE A;  2JHE A;  2HL2 A;  3V5M A;  2QZ6 A;  5EVI C;  4BEN A;  3HJI A;  2P9V B;  4BL3 A;  1IOU A;  5U47 A;  5GHY A;  4A5R A;  2EXB A;  4UQI M;  3MR0 A;  5GHZ A;  3V3R A;  3IF6 B;  1HLU P;  5CRF A;  2ZC5 B;  4HP4 A;  1P97 A;  1K4E A;  3KO4 A;  3CZD A;  4ZBE A;  4Y0U A;  2PR5 A;  1Z6F A;  4O0P A;  1XFN A;  4Q8I A;  4WBG A;  4R6L A;  1MC0 A;  5L2F A;  4OPZ A;  2JKF A;  4F3L A;  3UPO A;  1W8Q A;  2WAE A;  2DCF A;  1OTB A;  4S2K A;  1W63 Q;  3L7H A;  4FCF A;  4FUW A;  1G5U A;  3T4O A;  1F9I A;  4KZB A;  4EER A;  3S7O A;  3B42 A;  3IF5 A;  1NXY A;  3OPL A;  4Y0O A;  3E98 A;  4RRR A;  1DJC A;  5CHJ A;  2VLG A;  3Q1F A;  1F98 A;  3Q07 A;  3UB7 A;  4S03 A;  4QJG A;  3WS5 A;  1TEM A;  4QWO A;  4OLD A;  3VE3 A;  3F1N A;  2PD7 A;  3MZF A;  3VE4 A;  4P6Z M;  2V1B A;  2YKH A;  1IFQ A;  1FQG A;  1OTD A;  1H0M A;  1XGI A;  4S2P A;  1LSX A;  3MFD A;  3HVF A;  1OPX A;  4D60 A;  2WUQ A;  4FH4 A;  1W8Y A;  4B4X A;  3FWL A;  2K7S A;  2HDR A;  2I9V A;  4G3W A;  5TBM A;  5F1F A;  2JBF A;  1UWN X;  2P08 A;  3ZDJ A;  1MWR A;  5HAR A;  4Y17 A;  3UO9 A;  2Y2I A;  4KUO A;  4P0M A;  4R1G A;  5C5K A;  2J9P A;  1VET A;  2J9O A;  1O07 A;  5FAP A;  4LV0 A;  2XDM A;  1RGZ A;  1ZHH B;  3EQV A;  2JKT M;  5K5B A;  2JN7 A;  3RFB A;  1I5Q A;  1TS8 A;  2VGK A;  5KIZ A;  2R9W A;  5CHM A;  4GD6 A;  1NYM A;  5HAI A;  3V39 A;  1MKM A;  4BBV A;  4ZJ3 A;  3UE1 A;  3NOT C;  3KSG A;  3CWF A;  2ZL1 B;  4QY6 A;  1OME A;  3LR4 A;  4DJ2 A;  3Q7Z A;  4LEN A;  3K3C A;  2OOL A;  3W4P A;  3N7W A;  4CLC D;  3BW6 A;  4YFM A;  5AJG A;  5EOO A;  4FSF A;  4RR8 A;  4S2I A;  3OLO A;  4B88 A;  4DJ3 A;  2P7J A;  1K56 D;  3M2J A;  3ZVW A;  2K31 A;  5A93 A;  1BLS A;  3SS3 A;  3D3O A;  4HBT A;  4RRJ A;  4GW9 A;  1OTI A;  3BYD A;  5L07 A;  3IX3 A;  3QNC A;  2JE5 A;  4GHI B;  1GHI A;  1FR6 A;  4ZDX A;  1LT0 A;  1VHM A;  3WS0 A;  3NDE A;  3WS2 A;  4K0W A;  4EW7 A;  3KNF A;  1K0K A;  5GLA A;  3UDI A;  3ZCZ A;  4DE1 A;  5EM0 A;  2GNX A;  1WA9 A;  4JF5 A;  2WGI A;  4X53 A;  2L1M A;  2R9X A;  5AVF A;  1K54 A;  5DF8 A;  1PZP A;  4MEZ A;  2ZOH A;  1DP6 A;  4PMA A;  2VJW A;  3KSI A;  2GDN A;  4S0K A;  4HOI A;  4F94 A;  5EUA A;  4HY8 A;  2HJ9 C;  3BWL A;  4KZ7 A;  4WZ4 A;  1K55 C;  4K91 A;  2WGW B;  2P74 A;  4F3L B;  1SHV A;  4WZ5 A;  4NET A;  1OJ5 A;  4IVK A;  3NC8 A;  2EX2 A;  3ITA A;  4RRF A;  3MKF A;  3NOP C;  4MLL A;  4JGQ A;  4PM6 A;  2Y91 A;  4EUZ A;  4OPY A;  2C5W B;  2QJ5 A;  3R4K A;  3KOD A;  1S1Z A;  4RRK A;  1YLT A;  1GSV A;  3N8L A;  2Y4A A;  1ES5 A;  1YAX A;  4KZ4 A;  2A24 A;  4DXB A;  1K57 A;  2QYB A;  1U60 A;  5EFW A;  3K3D A;  1HZO A;  1EW0 A;  1BYW A;  3TW8 A;  4RYE A;  2EFU A;  2O9B A;  2QHK A;  1M6K A;  4MNR A;  3F1N B;  3GR2 A;  5GLB A;  3S4X A;  5FAO A;  4IBX A;  2XA7 S;  3GRJ A;  1XJ3 A;  3PBT A;  3A0S A;  3E4Q A;  2QWS A;  3FKW A;  1LLB A;  4Q0I A;  4LV1 A;  3LIA A;  5TBM B;  3LO7 A;  3RJU A;  3SS4 A;  1ZTU A;  3KX0 X;  5HPI A;  1SDN A;  2KDK A;  3GEC A;  5F5Y A;  3BFC A;  1ONH A;  4RQ9 A;  1VET B;  1PWG A;  4Y3I A;  2J3T C;  1NRJ A;  4BBT A;  5AQA A;  1DJA A;  2O9C A;  1KGF A;  1FR1 A;  2V20 A;  1LSV A;  1GA9 A;  4RRG A;  3DWK A;  4LRZ E;  3HUO A;  3WS1 A;  4M4X A;  4NBJ A;  2NUP C;  1ALQ A;  1C3B A;  3B33 A;  4KEN B;  3BFF A;  4QPR A;  2ZM0 A;  1S4S A;  3SH7 A;  2H28 A;  3A0V A;  2X71 A;  4OPQ A;  2ZBB A;  1L2S A;  2JKR I;  5A91 A;  3MSH A;  5FDS A;  5E2E A;  5EEC A;  3UDX A;  3G34 A;  1MWS A;  4S2N A;  2WAD A;  1Q2P A;  3D4F A;  2O9A A;  5JYP A;  3SS5 A;  4R4R A;  1H5X A;  2V9A A;  5FQI A;  4EET B;  2XD1 A;  3RXW A;  3OCN A;  3PYP A;  3E2L A;  3FPV A;  1HD8 A;  5DFX A;  3S7P A;  2KX6 A;  1PWC A;  5FI7 A;  5CXW A;  3C4P A;  2HL1 A;  1ES4 A;  4MN7 A;  3UDF A;  4YIN A;  4JF4 A;  4HJ6 A;  3OPH A;  4OPR A;  4P87 A;  5EM1 A;  2WKR A;  3FYZ A;  5HFO A;  2ZC6 B;  5CEC A;  3ISG A;  2ZJ9 A;  2ZM8 A;  4CLC A;  5M18 A;  3V50 A;  1XGJ A;  2CMN A;  2WKI A;  2W0N A;  1K56 A;  3QP8 A;  1SKF A;  4I39 A;  5EPH A;  4MCW A;  1GSW A;  3LGO A;  3FZC A;  5J4E A;  3IWI A;  5I5L A;  2Z6C A;  1CK3 A;  5CER A;  1MBL A;  3IQA A;  4B4Z A;  2M7V A;  4JXV A;  3MMH A;  1ODV A;  4MN6 A;  2DBO A;  2V1Z A;  5TR7 A;  2Q9N A;  3GMW A;  3LIF A;  3OBF A;  3TJZ C;  2DMW A;  5FAS A;  3T1R A;  1AWI A;  3CIT A;  4IHQ A;  4LLO B;  4K08 A;  3ZNY A;  5GLD A;  2OWH A;  4ESP A;  2VA0 A;  5DTT A;  3PD4 A;  1CQA A;  1YPR A;  3T4Q A;  2WZX A;  2ZMA A;  3NIA A;  2EWW A;  3NCK A;  1MWU A;  3G31 A;  2EWV A;  2A24 B;  3BFD A;  3ZHH A;  4WN5 A;  4XT2 A;  2OWJ A;  3BY8 A;  2PDR A;  5HAP A;  4RRI A;  2JC7 A;  1BSG A;  3V67 A;  4ID4 A;  1OJG A;  2VGL S;  2XQZ A;  4H6J A;  1VM1 A;  5FQQ A;  1IEL A;  2OAQ 1;  2GJ3 A;  2HDQ A;  4GDN A;  1LHY A;  3LFV A;  5EVL A;  4NBI A;  1K38 A;  1BZA A;  3LIC A;  1CEF A;  3IX4 A;  4E3L A;  1J7G A;  2ZOI A;  4NEE D;  2H5S A;  1YMX A;  3MQQ A;  3MQO A;  3BRM A;  5HWV A;  4YOF A;  4HBU A;  3EWK A;  4GCZ A;  5FQJ A;  3KO5 A;  3VOZ A;  4I38 A;  3F1O A;  4QB8 A;  2XLN A;  1FCN A;  3DTE A;  3HLC A;  5J61 A;  3QP2 A;  1YLZ A;  4RRL A;  5G4Y A;  3KO7 A;  2OLV A;  3NBL A;  1W7F A;  4AFI A;  2W3H A;  3EQU A;  3ZG5 A;  4JXW A;  5DTS A;  4RRQ A;  5F82 A;  4OLG A;  4JGR A;  4KQR A;  3CI6 A;  3MXS A;  1L0G A;  3EEA A;  1YMS A;  2VK3 A;  1LL5 A;  2WGW A;  5GLC A;  4NK3 A;  4E3N A;  5FQM A;  2J7V A;  3PBN A;  1TS7 A;  4PM9 A;  3UN7 A;  3ZG8 B;  3G32 A;  3N4I A;  3PD3 A;  1K54 C;  3Q81 A;  3NHQ A;  1YQS A;  4PM8 A;  2BTF P;  4FTX A;  3MJQ A;  1K25 A;  3Q7V A;  2JKG A;  4EQ1 A;  4C75 A;  3ICY A;  1J9M A;  2FFF B;  2WKH A;  3IWQ A;  4PM5 A;  1MZU A;  3LY3 A;  4ETX A;  2XRO A;  3T4J A;  4LCM A;  2Y59 A;  3CMZ A;  3WS4 A;  4EEU A;  1RCJ A;  3LIE A;  1NWZ A;  1WYC A;  2J8Y A;  5HDD A;  3KYZ A;  5IT5 A;  4OOM A;  5EOE A;  2Y2Q A;  1IYP A;  2VV7 A;  4C6Y A;  1WYB A;  4H8R A;  5HL1 A;  4S2J A;  1L0D A;  1W63 M;  4ZAM A;  4CLC B;  3T1S A;  4RRH A;  1FSY A;  3N8S A;  5KSC A;  5FI6 A;  4JXG A;  1EWZ A;  3IBJ A;  1LSW A;  2Q9M A;  2EX9 A;  2YKF A;  3C38 A;  4NKP A;  3TSG A;  4WUJ A;  1F5M A;  1D1J A;  1XJ6 A;  5HZH A;  4KG6 A;  4S2M A;  1ZKJ A;  2G2U A;  4X55 A;  4S0L A;  2IA2 A;  3ZVT A;  3GQZ A;  4KG5 A;  3BY9 A;  2Q0O A;  1H8Y A;  3DW0 A;  5FAQ A;  4U0X A;  1N9B A;  5KSH A;  1ES3 A;  3UB5 P;  1Y28 A;  1YLJ A;  4QD4 A;  4KZ9 A;  1MY8 A;  2HGV A;  2A3U A;  4JBF A;  1STZ A;  2LB5 A;  5FEF A;  2Y8H A;  3M6H A;  1G6A A;  1EI5 A;  3HLB A;  4XT2 B;  1P9W A;  1Z09 A;  3IXH A;  1LL8 A;  2IWB A;  3MF0 A;  3MQ0 A;  4P85 A;  5HX9 A;  5L10 A;  5M1A A;  4H6J B;  3K2N A;  5GHX A;  1VEU A;  1KE3 A;  2XFS A;  5DF9 A;  4LCL A;  1W5D A;  3IF6 C;  3IX8 A;  3PTE A;  5CHU A;  3G2Y A;  3PHY A;  3EEH A;  4XUZ A;  1KGE A;  5CGS A;  1BT5 A;  1VB6 A;  2KOI A;  5BOH A;  4DF6 A;  4DDY A;  1TDG A;  4EBP A;  3IBR A;  4R4S A;  2XK1 A;  2A2L A;  2OKV A;  1BLP A;  2ACG A;  1T1C A;  3VP1 A;  1XA7 A;  4EBN A;  1ZC2 A;  3UY6 A;  4S2N C;  4Y2F A;  3PXP A;  3SOI A;  1ERM A;  4UA7 A;  2W1T A;  2G7U A;  3HLE A;  4EUV A;  2XFT A;  2B02 A;  4QU3 A;  4NXG A;  4OH0 A;  3F1O B;  3MXR A;  4UA9 A;  4KQQ A;  2ZLY A;  3E4O A;  3B3X A;  3FKV A;  1DP8 A;  4LV2 A;  2XSS A;  1KGG A;  2XEP A;  1K6S A;  3LI8 A;  3PBS A;  4Q0H A;  3RH8 B;  3U4L P;  4LRX C;  2H10 A;  5EVE A;  3QHY A;  2ZQC A;  4GN2 A;  3L9K A;  1IKI A;  3QP6 A;  4OOY A;  2ZM2 A;  5AQB A;  1Y54 A;  2WKE A;  1E3U D;  3S1Y A;  3LR5 A;  1ONG A;  3KSH A;  5AQ7 A;  3Q7V B;  2Y55 A;  4NXE A;  2J3T D;  3C7U A;  1YSQ A;  3MS6 A;  4PHT A;  1JKE A;  4R3B A;  3LMV A;  4LPZ A;  3W4O A;  2Y2M A;  3NY4 A;  1RGY A;  4OON A;  2X02 A;  2VEA A;  3LID A;  5E2F A;  2P04 A;  1LI0 A;  3GVB A;  4WMC D;  2INW A;  4UQI S;  3C30 A;  5HDS A;  4N1H A;  5HL6 A;  1XFQ A;  3G6O A;  2ZC7 A;  2PYR A;  3BFG A;  3MFX A;  5FI2 A;  1ES2 A;  3WWX A;  4OP8 A;  2HP6 A;  4GKU A;  4X1L A;  3SW1 A;  1YT4 A;  1TD5 A;  2CC1 A;  1ESU A;  5HDC A;  5J7E A;  1FIK A;  2MJ6 A;  1L3L A;  2FFY A;  4BJP A;  1XJ4 A;  3DWZ A;  4QY5 A;  1TS6 A;  4BQM A;  5D3O A;  2EA9 A;  3D72 A;  2W3F A;  1TDL A;  4XXR A;  3KNP A;  4I3A A;  3P09 A;  4DMZ A;  3HUN A;  3LEZ A;  4ZRR A;  4II7 A;  3T1Q B;  1H8M A;  3F1P A;  2Y2L A;  3NUL A;  2ZMF A;  2OSU A;  2HZ5 A;  4BD0 A;  4EES A;  3T4K A;  4LV3 A;  3DBA A;  5G4Z A;  3ZGA B;  4X68 A;  4BWI A;  4OKP A;  2JKT I;  2OV5 A;  1OT6 A;  1XJ2 A;  3JYI A;  2EX6 A;  4P6Z S;  5A8B A;  1QME A;  2BG1 A;  4RX2 A;  3BEC A;  3N6I A;  2M7U A;  2XH9 A;  4X1M A;  1CI9 A;  5FEG A;  3QP5 A;  2BAS A;  2A49 A;  4S0J A;  1T1A A;  5KMW A;  1XPB A;  3CLO A;  3OC2 A;  1VEU B;  4GJ4 A;  5I94 A;  3I7J A;  1PI5 A;  2I72 A;  2G2W A;  1LL9 A;  1S66 L;  3EOI A;  3CG5 A;  1YM1 A;  3SZT A;  5F1G A;  1N9O A;  3CHW P;  4ZJ1 A;  4E04 A;  2V0U A;  2HL0 A;  4WEK A;  1TVF A;  4N9K A;  2HP5 A;  4DKI A;  3H7W A;  2VZW A;  3BQA A;  2Z6D A;  1PZO A;  1N9L A;  3CPT A;  3H9W A;  4S02 A;  4UAA A;  2W1T B;  2HDU A;  2HF6 A;  4MBH A;  3HRE A;  3LUQ A;  4N92 A;  4RRA A;  5F83 A;  1SKO A;  4ETZ A;  3H82 A;  2V8F A;  4E3K A;  1DJB A;  3UMD A;  2HDS A;  4LRY C;  2NUT C;  3PR6 A;  3OOV A;  4EQI A;  1IYQ A;  1NLY A;  4R3A A;  1IYO A;  2V2F F;  1NJ4 A;  3UE3 A;  2AVX A;  1BUE A;  5DFY A;  5E2H A; 
#chains in the Genus database with same CATH homology
 4RRJ A;  3LCE A;  4PM8 A;  4UHU A;  1K6R A;  3SH9 A;  1O7E A;  1K25 A;  2EX8 A;  3MZE A;  3Q7V A;  3ZG0 A;  4DRT A;  1DY6 A;  3BYD A;  3VP3 A;  2ZC3 B;  3KO3 A;  3KO9 A;  3VP4 A;  5FA7 A;  1MXO A;  3C5A A;  3O86 A;  3QNC A;  4C75 A;  2JE5 A;  1J9M A;  1GHM A;  2FFF B;  1GHI A;  2WKH A;  4MBF A;  3IWQ A;  1FR6 A;  4ZDX A;  4PM5 A;  3LY3 A;  5FQK A;  2Y2H A;  4LCM A;  2UWX A;  1ZG4 A;  4XUX A;  2Y59 A;  3CMZ A;  5E43 A;  1QMF A;  3PAE A;  2PBY A;  3WS4 A;  2VGJ A;  3NDE A;  3WS0 A;  3WS2 A;  4K0W A;  1I2S A;  1KDW A;  1RCJ A;  5EVI D;  1NRF A;  3KNF A;  1WYC A;  2J8Y A;  5HW3 A;  3OZH A;  3WRT A;  5GLA A;  4EBN A;  1SCW A;  1PI4 A;  3UDI A;  3W4Q A;  3ZCZ A;  5E2G A;  3LY4 A;  4DE1 A;  4OOM A;  5EOE A;  2Y2Q A;  3MKE A;  1IYP A;  2P9V A;  4JF5 A;  3OPP A;  2WGI A;  4C6Y A;  4RVA A;  4X53 A;  4X56 A;  1WYB A;  2R9X A;  4UA6 A;  1PW8 A;  4H8R A;  5HL1 A;  2RL3 A;  4S2J A;  1PW1 A;  1L0D A;  1K54 A;  4EBL A;  4WYY A;  3DTM A;  4ZAM A;  5DF8 A;  3VFH A;  3VOY A;  4RRH A;  1BLH A;  1PZP A;  3IF6 A;  3O87 A;  4MEZ A;  2PU4 A;  4ZJ2 A;  4PMA A;  1TC5 A;  3IH9 A;  4RR6 A;  1FSY A;  3N8S A;  1SDE A;  2GDN A;  5KSC A;  2ZQA A;  4FD8 A;  5FI6 A;  3M2K A;  4S0K A;  4JXG A;  1EWZ A;  4PM7 A;  2Q9M A;  2EX9 A;  4F94 A;  5EUA A;  1Q2Q A;  4JPM A;  1XKZ A;  1E4D A;  1FCO A;  3TSG A;  4JF6 A;  5FQ9 A;  4KZ7 A;  1H8Z A;  1XX2 A;  4WZ4 A;  1E3U A;  1K55 C;  2XD5 A;  4KG6 A;  4K91 A;  4S2M A;  1ZKJ A;  3HUM A;  2G2U A;  4RR7 A;  4KZ3 A;  2WGW B;  4X55 A;  2WAF A;  2P74 A;  4E3O A;  1SHV A;  3IWO A;  2Y2G A;  4RRM A;  3GSG A;  2Y2J A;  4WZ5 A;  4IVI A;  3N8R A;  4S0L A;  4NET A;  4U0T A;  3ZVT A;  4IVK A;  3NC8 A;  2EX2 A;  3ITA A;  3GQZ A;  3VSL A;  4KG5 A;  4RRF A;  3MKF A;  3MBZ A;  4S0I A;  3BLM A;  1H8Y A;  4MLL A;  4CJN A;  3DW0 A;  4PM6 A;  5FAQ A;  4U0X A;  1N9B A;  4HEF A;  5KSH A;  4Y7P A;  2Y91 A;  1ES3 A;  4EUZ A;  1YLJ A;  4OPY A;  2HPB A;  5EVI B;  3C4O A;  2C5W B;  4QD4 A;  4KZ9 A;  1PYY A;  1MY8 A;  1S6R A;  4GD8 A;  3KOD A;  2A3U A;  3VMA A;  4RRK A;  1YLT A;  5A92 A;  4JBF A;  4WMC A;  3M6B A;  2BLS A;  3IT9 A;  3V3S A;  4RA7 A;  4JKT A;  3N8L A;  2Y4A A;  1ES5 A;  4KZ4 A;  4DXB A;  3M6H A;  1N4O A;  1K57 A;  1G6A A;  3A3J A;  4KZ6 A;  4QHC A;  1U60 A;  1EI5 A;  5FSR A;  4CPK A;  1HZO A;  2IWC A;  3HLB A;  4RYE A;  1K55 A;  1KDS A;  2EFU A;  2EXA A;  1LI9 A;  1ERO A;  3IXH A;  4IBR A;  2IWB A;  1M6K A;  4MNR A;  3GR2 A;  5GLB A;  1JWV A;  3HBR A;  3S4X A;  1JTG A;  5FAO A;  2E8I A;  4P85 A;  5HX9 A;  4IBX A;  3S22 A;  5M1A A;  2WGV A;  1FCM A;  3TOI A;  4E3I A;  3A3F A;  3GRJ A;  5GHX A;  3PBT A;  3ZFZ A;  4E3M A;  1KE3 A;  2XFS A;  1XA1 A;  4LCL A;  5DF9 A;  5FDH A;  2X01 A;  3BEB A;  3IXG A;  1W5D A;  3FKW A;  1YLP A;  3IF6 C;  1MPL A;  1LLB A;  4KZ5 A;  3VSK A;  1KE4 A;  2ZC4 B;  4LV1 A;  4BD1 A;  3PTE A;  5CHU A;  2XR0 A;  3G2Y A;  1FOF A;  3LO7 A;  4XUZ A;  3RJU A;  5CED A;  4GDB A;  1KGE A;  5CGS A;  1BT5 A;  3SS4 A;  1FSW A;  2IWD A;  1NY0 A;  1SDN A;  5BOH A;  4DF6 A;  1BUL A;  4DDY A;  3UPP A;  2ZQ9 A;  1TDG A;  4JXS A;  2XGN A;  4EBP A;  1YLY A;  3BFC A;  3LMU A;  4RRD A;  2WYX A;  4R4S A;  2XK1 A;  1IEM A;  1ONH A;  3HLF A;  1MWT A;  3AGD A;  2OKV A;  1BLP A;  3VP2 A;  3VP1 A;  4DXC A;  1PWG A;  4WZ5 C;  4GOG A;  2OLU A;  1IKG A;  4WEJ A;  1XA7 A;  1NZO A;  2C6W B;  2H0Y A;  3BLS A;  2DRW A;  4OQI A;  1ZC2 A;  4S2O A;  4S2N C;  3UY6 A;  4EV4 A;  2QMI A;  3SOI A;  3SH8 A;  1ERM A;  5CEB A;  4KQO A;  5AQA A;  4UA7 A;  4FH2 A;  3LMT A;  5IHV A;  2XF3 A;  2HP9 A;  1DJA A;  3BM6 A;  3HL9 A;  3HLE A;  1KGF A;  1FR1 A;  2XFT A;  2V20 A;  3QNB A;  4QU3 A;  3PD5 A;  4OH0 A;  3MXR A;  4UA9 A;  1GA9 A;  4RRG A;  3AGF A;  5CTN A;  3GTC A;  3DWK A;  4KQQ A;  5CGX A;  2ZLY A;  3UE0 A;  3CJM A;  1KVL A;  4PPR A;  3B3X A;  4RRB A;  3HUO A;  3IHB A;  3WS1 A;  1S0W A;  2Y2P A;  3FKV A;  4NBJ A;  3IXB A;  3AGE A;  1GHP A;  4LV2 A;  1ALQ A;  1JWP A;  2HKZ A;  4KZA A;  1C3B A;  1HVB A;  3GV9 A;  1KGG A;  2XEP A;  4MBK A;  1K6S A;  3PBS A;  4KEN B;  5TFQ A;  1K57 C;  1AXB A;  3KOC A;  2Y2K A;  3BFF A;  2Y2N A;  2ZM0 A;  4EWF A;  2RCX A;  3A3D A;  2H10 A;  3SH7 A;  5JYO A;  2X71 A;  4OPQ A;  2ZQ7 A;  3O88 A;  3QHY A;  2ZQC A;  4GN2 A;  4P6B A;  4DE2 A;  4DE0 A;  4X6T A;  3WRZ A;  1KE0 A;  1L2S A;  3PAG A;  3UNW A;  5A91 A;  1IKI A;  1L0F A;  4E3J A;  5E2E A;  4R3J A;  5EEC A;  3UDX A;  3G34 A;  1MWS A;  4S2N A;  2WAD A;  1Q2P A;  3D4F A;  4OOY A;  5JYP A;  5KZH A;  3C7V A;  2ZM2 A;  3FV7 A;  5AQB A;  3HLG A;  1Y54 A;  2WKE A;  3SS5 A;  4R4R A;  1H5X A;  3O3V A;  5FQI A;  2Z2M B;  2WK0 A;  1E3U D;  2XD1 A;  3S1Y A;  1ONG A;  3RXW A;  1NZU A;  5AQ7 A;  3OCN A;  4WM9 A;  5DVA A;  3Q7V B;  4OQ0 A;  2Y55 A;  2Y2O A;  4OQH A;  2ZQ8 A;  3E2L A;  1ZG6 A;  3C7U A;  1HD8 A;  2DNS A;  4DE3 A;  3RXX A;  3PBR A;  4DDS A;  1PIO A;  1PWC A;  5CXW A;  5FI7 A;  4C3Q A;  1JKE A;  3C4P A;  4HES A;  2HL1 A;  1I2W A;  1L0E A;  1ES4 A;  4R3B A;  3LMV A;  3W4O A;  3UDF A;  4YIN A;  2Y2M A;  1HTZ A;  3HLD A;  4JF4 A;  4M3K A;  5CGW A;  3OPH A;  4GNU A;  4GZB A;  3PD2 A;  4OPR A;  4OOL A;  3NY4 A;  1RGY A;  4OON A;  4P87 A;  2X02 A;  1XXM A;  2ZD8 A;  4ZTK A;  4R23 A;  4R0Q A;  5E2F A;  1RP5 A;  3FYZ A;  1LI0 A;  5HFO A;  2ZC6 B;  2HL2 A;  3V5M A;  5CEC A;  3GVB A;  4WMC D;  2QZ6 A;  3ISG A;  5EVI C;  4BEN A;  2P9V B;  2ZJ9 A;  2ZM8 A;  4BL3 A;  4N1H A;  5U47 A;  3E2K A;  5GHY A;  5M18 A;  5M19 A;  4A5R A;  2EXB A;  2ZC7 A;  3V50 A;  4RX3 A;  1ERQ A;  1XGJ A;  3BFG A;  2WKI A;  5FI2 A;  1ES2 A;  3ITB A;  5GHZ A;  3V3R A;  1BLC A;  1K56 A;  3IF6 B;  3WWX A;  1SKF A;  4OP8 A;  2HP6 A;  5EPH A;  5CRF A;  2ZC5 B;  3P98 A;  3NI9 A;  4GKU A;  3PBQ A;  1K4E A;  3FZC A;  3KO4 A;  3CZD A;  4ZBE A;  3PBO A;  1YT4 A;  3IWI A;  4Y0U A;  1CI8 A;  2CC1 A;  1Z6F A;  1ESU A;  1CK3 A;  5G18 A;  4WBG A;  5CER A;  4Q8I A;  1MBL A;  3IQA A;  5L2F A;  4B4Z A;  4JXV A;  4OPZ A;  2FFY A;  4BJP A;  2DBO A;  1GA0 A;  2V1Z A;  3UPO A;  5TR7 A;  1K4F A;  2Q9N A;  3GMW A;  3Q82 A;  3DWZ A;  4OQG A;  1W8Q A;  4QY5 A;  5EE8 A;  2WAE A;  4BQM A;  2DCF A;  5D3O A;  5FAS A;  5DF7 A;  5HAQ A;  1TDL A;  2ZQD A;  3ZNY A;  4XXR A;  4S2K A;  3KNP A;  2B5R A;  3P09 A;  1WE4 A;  5GLD A;  5EVI A;  4N1X A;  4FCF A;  3HLW A;  3ZG9 B;  3HUN A;  3LEZ A;  1E25 A;  5DTT A;  2Y2L A;  3PD4 A;  4KZB A;  4U3T A;  1YLW A;  2OSU A;  4BL2 A;  5J8X A;  2WZZ A;  4BD0 A;  4E6X A;  3IF5 A;  1NXY A;  3OPL A;  4LV3 A;  4Y0O A;  2WZX A;  5A90 A;  2ZMA A;  3NIA A;  3NCK A;  1BTL A;  1MWU A;  3G31 A;  4JLF A;  1DJC A;  4RRR A;  3ZGA B;  4X68 A;  3BFD A;  4OKP A;  5CHJ A;  5DTK A;  2OV5 A;  3BFE A;  3Q1F A;  3ZHH A;  3ZNT A;  4GB7 A;  3JYI A;  1VQQ A;  2EX6 A;  4Z9Q A;  4RR9 A;  3Q07 A;  4S03 A;  2JCH A;  1QME A;  4QJG A;  1MKI A;  2BG1 A;  4RX2 A;  3BEC A;  3N6I A;  3WS5 A;  1GCE A;  1TEM A;  3OPR A;  4IED A;  4OLD A;  5TGF A;  5HAP A;  4RRI A;  3MZF A;  2XH9 A;  1W79 A;  2JC7 A;  1BSG A;  5AQ9 A;  4ID4 A;  1FQG A;  1XGI A;  1CI9 A;  4S2P A;  1PWD A;  3MFD A;  2XQZ A;  3HVF A;  1Y2Q A;  2WUQ A;  1VM1 A;  2A49 A;  4FH4 A;  1IEL A;  5FQQ A;  3UPN A;  3TG9 A;  3G35 A;  4S0J A;  5KMW A;  1XPB A;  1W8Y A;  3IH8 A;  3OC2 A;  2HDQ A;  4GDN A;  4OP5 A;  4B4X A;  1LHY A;  3VFF A;  3FWL A;  1JWZ A;  5EVL A;  5GL9 A;  4NBI A;  3NDG A;  2HDR A;  5I94 A;  1K38 A;  1BZA A;  1CEF A;  5F1F A;  1NYY A;  2JBF A;  3I7J A;  3G4P A;  1PI5 A;  2I72 A;  4RRC A;  2G2W A;  3ZG7 B;  4Y0T A;  4E3L A;  1J7G A;  3ZDJ A;  1LL9 A;  1MWR A;  5HAR A;  2H0T A;  3UO9 A;  2Y2I A;  2H5S A;  1YMX A;  3G30 A;  3CG5 A;  4P0M A;  4R1G A;  1JTD A;  1YM1 A;  2EFX A;  3IHA A;  2J9P A;  3OCL A;  5F1G A;  2J9O A;  4ZJ1 A;  1O07 A;  3BRM A;  5FAP A;  4LV0 A;  4D2O A;  4K0X A;  2HL0 A;  4WEK A;  1TVF A;  4WEL A;  2XDM A;  1RGZ A;  3EQV A;  4N9K A;  4HBU A;  4E6W A;  2HP5 A;  4DKI A;  3MZD A;  4S2L A;  1I5Q A;  2VGK A;  1PZO A;  2R9W A;  5FQJ A;  4S02 A;  5CHM A;  3KO5 A;  4GD6 A;  4UAA A;  4BLM A;  1NYM A;  3VOZ A;  2HDU A;  5HAI A;  3V39 A;  4KG2 A;  4MBH A;  1KVM A;  2XLN A;  1FCN A;  4QB8 A;  3HLC A;  4X69 A;  5J61 A;  4RRL A;  1YLZ A;  3HRE A;  3KO7 A;  4ZJ3 A;  3KOB A;  4N92 A;  2QPN A;  2OLV A;  3VP0 A;  4RRA A;  3NBL A;  3A3E A;  3UE1 A;  1W7F A;  2Z2L B;  5F83 A;  3W8K A;  4O7D A;  3EQU A;  3ZG5 A;  1IYS A;  4QY6 A;  4JXW A;  1OME A;  5DTS A;  4RRQ A;  5F82 A;  2PU2 A;  4OLG A;  3Q7Z A;  4KQR A;  4LEN A;  1G68 A;  3W4P A;  3MXS A;  4L0L A;  1L0G A;  1DJB A;  4KZ8 A;  3N7W A;  4E3K A;  3A3I A;  4YFM A;  5EOO A;  4FSF A;  5CTM A;  4RR8 A;  1YMS A;  4S2I A;  2HDS A;  4B88 A;  1LL5 A;  2WGW A;  5GLC A;  4EQI A;  1JVJ A;  1IYQ A;  1K56 D;  1CEG A;  4N9L A;  4NK3 A;  4E3N A;  3M2J A;  5FQM A;  2J7V A;  3PBN A;  4PM9 A;  3UN7 A;  3ZVW A;  5FAT A;  3ZG8 B;  1IYO A;  2V2F F;  3G32 A;  1XP4 A;  3N4I A;  1BLS A;  5A93 A;  1K54 C;  3Q81 A;  3PD3 A;  1NJ4 A;  1M40 A;  4OVD A;  3G2Z A;  3SS3 A;  3UE3 A;  1YQS A;  4HBT A;  1BUE A;  1ESI A;  3IXD A;  5E2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...