5CEBA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus, k38m form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
401
structure length
387
Chain Sequence
b'MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLAAISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
molecule tags Hydrolase
total genus 134
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cebA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cebA02
1ERMA 2Y2QA 1I2SA 1S0WA 4LCMA 4OOMA 2DCFA 1G6AA 1QMEA 4PM7A 2V2FF 2G2UA 3VP3A 3NCKA 4BQMA 4GD6A 4N92A 4KG5A 5F83A 3HUMA 1DJBA 3G2YA 4HBTA 4D2OA 4UA6A 5FSRA 3VP2A 5J8XA 4EQIA 2WUQA 4DE3A 1FR6A 5CRFA 1LLBA 1PWCA 1XGJA 3CMZA 5TGFA 5F1FA 1YLWA 2Z2MB 4R23A 4DF6A 1K6SA 3IH9A 3RXWA 4QB8A 4S2PA 1FQGA 1FR1A 3UE0A 3FZCA 3GV9A 1AXBA 1N4OA 2Y2PA 3E2LA 3OPPA 3OPHA 4WBGA 5EVID 3N4IA 3HUOA 5D3OA 5GHYA 4CPKA 2IWCA 1IELA 4S2NA 4ZJ3A 2R9WA 4S2KA 2EX2A 1KDSA 2WGWB 1KDWA 4E3JA 1BLHA 1ZG6A 3G34A 4QY6A 2ZQDA 5CTMA 5FQKA 3DTMA 1KE3A 1IKIA 2ZD8A 5I94A 1ESIA 4JF6A 4FH4A 1XKZA 4OPRA 3VMAA 4ZAMA 5KSHA 4BL2A 2HPBA 1SCWA 4KZAA 4N9KA 3NC8A 2BLSA 1FCNA 2IWBA 4DKIA 3ZGAB 4IVIA 4KZ9A 2PU2A 4S2IA 1KGEA 2X01A 3GR2A 3FYZA 1K38A 2R9XA 1IYQA 3P09A 3S4XA 3IF5A 4E3OA 1KE4A 3M2JA 3UPOA 1JTGA 1CI8A 3IXGA 1J9MA 3IWOA 3SH7A 4GN2A 1M40A 2XD5A 3V5MA 3B3XA 2Q9MA 4EUZA 1H8YA 1ONGA 1SKFA 2X71A 1FOFA 3BLMA 3ZNTA 1CI9A 5FAQA 3WRZA 1KVLA 2JBFA 3DWKA 3WS5A 3P98A 4JXGA 3EQUA 4K0XA 3Q81A 2WAEA 1NJ4A 4OQIA 1I5QA 4DDSA 1G68A 1LL5A 1FCOA 4UA9A 2XQZA 5FDHA 1MWUA 4Y0TA 3GSGA 3UDXA 4IVKA 5HAPA 4KQRA 4JXVA 5E2FA 3LEZA 4WM9A 2WZXA 1PIOA 4OH0A 1M6KA 2XR0A 1XPBA 2XH9A 4B4XA 4IBXA 3C7UA 3O88A 1W79A 3CZDA 3N8RA 4FSFA 3ZG8B 1FSYA 4Q8IA 3WS0A 1PI5A 1KE0A 3UNWA 5CECA 3W4QA 2Y4AA 4RX3A 1FSWA 4BD1A 2WK0A 2Y2GA 4X69A 4JLFA 4EBLA 1L0EA 2J9OA 4DE2A 3PTEA 5IHVA 1KGFA 4X55A 5CEBA 1N9BA 2ZLYA 4KQOA 1CK3A 3GRJA 3SOIA 4LV1A 5GLCA 4IEDA 4JPMA 5FI6A 4B88A 3UE3A 2ZC4B 2P74A 4OPYA 1L2SA 3SS3A 3NBLA 3AGDA 2H0TA 2ZC5B 3OPLA 3VSKA 4PM9A 4MEZA 3M6BA 3IWIA 4OQHA 2QMIA 4KZBA 4EWFA 2Q9NA 4JF4A 3M2KA 5EOEA 1MPLA 1K56A 1PZOA 1DJAA 3V3SA 4BL3A 1ES5A 2XK1A 4OP8A 5FQMA 4WYYA 1H5XA 1ES3A 1GHPA 4DRTA 3DW0A 3ZHHA 4RA7A 4K91A 5E2HA 1YLYA 3IHBA 3IF6B 4KZ3A 2C6WB 4WEKA 4MBFA 2WKIA 3BLSA 1ZG4A 5U47A 1JWVA 4X68A 1DY6A 2C5WB 4WZ5A 3VFFA 3UY6A 4WELA 2ZM8A 3V3RA 5DF7A 4OOLA 1GHIA 1GA9A 4R0QA 4UA7A 5FQJA 3MKFA 1HTZA 4NETA 1HZOA 4PM5A 5CGSA 1S6RA 1RCJA 2WGWA 4BENA 3OCNA 5EUAA 2OV5A 1W8QA 3IXHA 4P6BA 3ZFZA 1HVBA 2A49A 3IQAA 2Y2IA 2P9VB 1PYYA 3OZHA 4L0LA 2H0YA 1XP4A 4HEFA 4EBNA 3BFCA 2QPNA 3IF6C 3QNCA 3MXRA 4LV3A 3PBTA 1LI0A 5FQQA 4ZJ2A 1NY0A 3UN7A 2B5RA 4HBUA 2XF3A 1ONHA 1EI5A 3NY4A 4N1HA 4Y0OA 3RJUA 5AQ7A 3S22A 4C6YA 3O87A 4Z9QA 4OKPA 3G30A 3MBZA 3FWLA 1KVMA 3BFFA 3OCLA 3I7JA 5A92A 5CHUA 5GLDA 3G35A 4R4SA 2HDUA 4PM8A 3VP4A 4S2MA 1K54C 2A3UA 4B4ZA 4WZ5C 3DWZA 3C4PA 5FQ9A 1PW8A 3A3JA 4UHUA 1E3UA 1K57C 1ERQA 5M1AA 5KSCA 2CC1A 2WKHA 4S2JA 5E2EA 1PW1A 1I2WA 4S2LA 4WMCD 3N8SA 4PPRA 4U3TA 5HL1A 1YLPA 3QHYA 5FAPA 3IT9A 4R1GA 4U0XA 2Y91A 4JF5A 1YLJA 2JCHA 4FD8A 5AQAA 2OLVA 4DE1A 5DVAA 3D4FA 3Q7ZA 5A93A 2Y55A 1ES4A 1CEGA 3O3VA 1YLZA 4BD0A 3MXSA 1LL9A 3HLWA 2J8YA 4MBHA 4YINA 5F82A 1BZAA 1ALQA 1Q2PA 3G4PA 2EXBA 4X6TA 1TDGA 4IBRA 2OLUA 3BFGA 4OP5A 2WADA 5EVIA 3G31A 2HP6A 4OLDA 5FI2A 3CG5A 3VOYA 1EWZA 5DF8A 3UDIA 1WYBA 2EX6A 1PI4A 2H10A 4YFMA 1K25A 4KG2A 3UPPA 5KZHA 4WZ4A 5EVIB 2PBYA 4S2OA 3PBNA 4RVAA 1L0DA 3UO9A 4XXRA 3Q7VB 3Q82A 4X53A 1XX2A 2HDRA 5AQBA 3CJMA 3IWQA 4XUZA 4HESA 5E43A 2OSUA 5EPHA 2XLNA 3O86A 3UE1A 2XDMA 5TFQA 3FKVA 5CHJA 1GA0A 5FA7A 5DF9A 5CGWA 1MXOA 1W8YA 2EXAA 3LY4A 3PBQA 4Y0UA 3HLDA 3UDFA 2X02A 4QD4A 5DTSA 4KZ8A 5FATA 2JE5A 3WS4A 2XEPA 2Z2LB 4LCLA 3ZG9B 3IXBA 5EVIC 1K4FA 1YQSA 3E2KA 4NK3A 2WGVA 5DTKA 5CXWA 1BUEA 1C3BA 1SDNA 4GDNA 3TG9A 3W8KA 2Y2JA 2ZC3B 1JVJA 3QNBA 2ZQ8A 3HLBA 4KZ7A 2EX9A 2E8IA 5HAQA 4JBFA 4ID4A 3HLGA 4E6XA 5GLBA 3FKWA 3HUNA 3AGFA 5KMWA 2XD1A 4P0MA 1TDLA 2ZMAA 3IF6A 1JTDA 1K55C 1IKGA 5CGXA 3MZEA 3SH8A 4C75A 3HREA 2ZC6B 1K4EA 2Y2HA 3BYDA 3JYIA 2BG1A 4LENA 4DE0A 1BTLA 3FV7A 1H8ZA 2EFUA 5HAIA 4QJGA 4UAAA 3SS5A 5TR7A 4RX2A 1RP5A 5CEDA 1NYMA 4ZBEA 1IYPA 2IWDA 2JC7A 1K54A 5CTNA 5L2FA 4GDBA 3MZDA 2I72A 2J7VA 2P9VA 4KZ6A 1K57A 3PBOA 1LHYA 4KENB 2EFXA 5FASA 4KZ5A 1Y54A 2HP5A 1YMSA 3UPNA 5CHMA 4OLGA 3ZVTA 4WEJA 5HW3A 2V1ZA 3BFDA 4LV2A 5HX9A 5CERA 1PZPA 2EX8A 2Y2MA 2Y2NA 4OOYA 5M19A 4EBPA 4E3LA 3N8LA 1ES2A 1XXMA 3AGEA 1CEFA 3ITAA 5EE8A 3VFHA 4KG6A 4DDYA 4MNRA 4EV4A 3NDGA 1IEMA 1SDEA 2ZM0A 3M6HA 1NZOA 3IXDA 1WE4A 3S1YA 1O07A 2ZQAA 4PMAA 1Q2QA 3VP0A 3GQZA 3NDEA 3WRTA 3C4OA 1VQQA 2RCXA 3LCEA 4Y7PA 1RGYA 3GTCA 3HLFA 1Z6FA 5HFOA 4ZDXA 1XA1A 1OMEA 5FQIA 3A3DA 5HARA 4E3KA 3GVBA 4N1XA 4OVDA 3ZG7B 2GDNA 1DJCA 1GCEA 2DNSA 2XFSA 3PAGA 3PBRA 4OQ0A 5E2GA 5EVLA 4GD8A 3ISGA 4LV0A 3HBRA 4E3MA 3BM6A 2H5SA 1XGIA 3C5AA 3HLCA 5G18A 4K0WA 1MWRA 3RXXA 2WAFA 3BFEA 1BULA 2HDQA 5EECA 2Y59A 1XA7A 4P85A 4PM6A 3NIAA 4X56A 1RGZA 1W7FA 1K6RA 3A3FA 1BSGA 4GOGA 3W4OA 1JWZA 5GLAA 1BT5A 4JXSA 3ZDJA 1U60A 4RYEA 4P87A 3A3IA 3Q7VA 1NYYA 2QZ6A 3IH8A 3G2ZA 4OQGA 1BLCA 4E3IA 1SHVA 3N6IA 3VOZA 4OPZA 3BECA 5A91A 4QU3A 3ITBA 5GHXA 2FFFB 1BLSA 4ZJ1A 1KGGA 2WKEA 4S2NC 5A90A 1YT4A 1GHMA 4GNUA 3HL9A 1E25A 1MY8A 1MWSA 2VGKA 4DXCA 5FAOA 4ZTKA 1K56D 1MKIA 2ZQ7A 1W5DA 4R3JA 1BLPA 1K55A 3Q1FA 3V50A 1L0GA 2G2WA 1IYOA 4QY5A 2FFYA 3A3EA 4GZBA 3PBSA 2PU4A 4H8RA 3ZCZA 4OONA 2ZM2A 4KZ4A 3C7VA 4MLLA 1E4DA 1O7EA 3TSGA 3ZG5A 5FI7A 2WZZA 3ZVWA 4F94A 3HVFA 5DTTA 1ZC2A 3OPRA 2ZC7A 5EOOA 1PWDA 1WYCA 3GMWA 1NZUA 4FCFA 4WMCA 1HD8A 4E6WA 5GL9A 1ZKJA 4M3KA 1EROA 4A5RA 3NI9A 5AQ9A 2Y2KA 2WYXA 3W4PA 3BEBA 2HP9A 2VGJA 1LI9A 1VM1A 3SS4A 4OPQA 4GB7A 3WWXA 3WS1A 4R4RA 3PAEA 4O7DA 1NXYA 4QHCA 1JWPA 2UWXA 4R3BA 2WGIA 4BLMA 2HDSA 4BJPA 3V39A 3LY3A 4KQQA 1ESUA 3MKEA 4FH2A 4DXBA 4MBKA 2Y2OA 2Y2LA 5JYPA 4N9LA 3OC2A 2J9PA 2ZJ9A 3MZFA 4XUXA 1QMFA 3ZG0A 3VSLA 1PWGA 5M18A 4GKUA 1YLTA 3ZNYA 4U0TA 2XGNA 1TEMA 3SH9A 1L0FA 5GHZA 1MWTA 3LO7A 3BRMA 4CJNA 5BOHA 5JYOA 1FCMA 1TVFA 3N7WA 4C3QA 1MBLA 3MFDA 3TOIA 1YM1A 3G32A 2ZQCA 2DRWA 2V20A 3IHAA 2RL3A 4JXWA 4E3NA 3WS2A 2XFTA 2ZQ9A 1YMXA 1NRFA 3Q07A 4JKTA 3HLEA 5F1GA 3EQVA 1IYSA 3VP1A 1E3UD
chains in the Genus database with same CATH superfamily
1HLUP 1I2SA 1S0WA 4LCMA 1QMEA 2V8CA 1T1CA 2G2UA 2V2FF 5AJGA 3K2NA 4BQMA 4N92A 5F83A 3T4OA 1P9WA 3MR0A 1DJBA 4L9GA 1GSWA 4D2OA 2JKTI 5DFXA 2JKRM 1LLBA 5TGFA 3IH9A 3RXWA 4S2PA 3UE0A 3OPHA 1AXBA 1N4OA 3BY8A 4WBGA 1NWZA 4CPKA 4S2NA 4GS9A 4E3JA 2L0WA 5FQKA 3UMDA 4NBIA 3LGOA 1ESIA 4GS9B 4BL2A 3ZQ5A 3C38A 1FCNA 4DKIA 3A0RA 4HOIA 2X01A 1J7GA 2R9XA 5HDSA 3UPOA 1PFLA 1CI8A 5HWVA 3IXGA 2QKPA 1A0KA 3E0YA 4ETZA 3V5MA 3T1XA 1H8YA 1ONGA 3ZNTA 1FOFA 2EA9A 3EGXC 4PKYA 3WRZA 2JBFA 5FEGA 3WS5A 2Q0OA 4K0XA 4EEUA 1FCOA 4X1LA 2PYRA 4Y0TA 3GSGA 3UB7A 1M6KA 4O01A 3TW8A 3O88A 1W79A 3CZDA 1FSYA 5J4EA 3U4LP 5CECA 4Q0HA 4EBLA 3PTEA 3V67A 1N9BA 3DBAA 2ZLYA 4KQOA 2Z6CA 3GRJA 2WKRA 5FI6A 1ZTUA 1L2SA 3AGDA 2H0TA 5HDDA 3M6BA 1K56A 3V3SA 1SKOA 2XK1A 5FQMA 1H5XA 3CUEA 3DW0A 5L8MA 5F69A 4KZ3A 2C6WB 4WEKA 5U47A 2HL2A 4NBJA 3UY6A 3KYEA 1OJGA 1GA9A 4R0QA 2WKPA 2WGWA 2W1TB 3OZHA 5A8BA 1XP4A 4EBNA 3BFCA 1UWNX 3MXRA 1N9NA 4LV3A 4HBUA 4N1HA 2XF3A 4Y0OA 1EI5A 1NRJA 4Z9QA 3MBZA 3FWLA 3MJQA 3BFFA 3I7JA 4NXBA 4X1MA 1VETB 2HDUA 4S2MA 4WZ5C 1F5MA 1V9YA 3C4PA 4UHUA 4X25A 1K57C 4I3AA 4R38A 3N8SA 4R1GA 3KOCA 5DFYA 1NLYA 2QHKA 4FD8A 2OLVA 3E4QA 5AQAA 1V9ZA 5DVAA 5A93A 1ES4A 1OTAA 4BD0A 3HLWA 1JNUA 1T18A 3H82A 4KUKA 1TDGA 3BFGA 4OP5A 5EVIA 3DAVA 3LYXA 5FI2A 2EX6A 5DKKA 4WZ4A 5EVIB 2PBYA 4RRAA 4X53A 1YAXA 5AQBA 3UB8A 3IWQA 4GCZA 3EEHA 4XUZA 4HESA 5E43A 5EPHA 3FKVA 5FA7A 4I5SA 2PAVP 3HLDA 2H28A 2JE5A 2Z2LB 3T4TA 1VB6A 4NK3A 1STZA 2K31A 2WGVA 3TG9A 2Y2JA 2ZC3B 1JVJA 3QNBA 3HLBA 4ID4A 1T19A 3OBFA 5LBRA 1XJ4A 1TS8A 3MZEA 5CGXA 3HREA 3RH8B 4LENA 2BG1A 2EWVA 1NLZA 2V8FA 2W1RA 1L3LA 1MC0A 4R3AA 1RP5A 3UB5P 5CEDA 2A2LA 2IWDA 3T4SA 2JC7A 1K54A 2M1CA 2HL1A 5F68A 4DN0A 4KZ6A 2QJ5A 2XA7M 1EW0A 3PBOA 3RTYA 2VV6A 5EVEA 5KIZA 5EM0A 1PZPA 4OOYA 2ZBBA 2DMWA 1ES2A 3ITAA 3QP8A 3ICYA 3NDGA 1OPXA 2AVXA 1SDEA 5HWTA 1NZOA 3KNFA 3S7OA 3T1SA 1Q2QA 2A24A 3C4OA 3LCEA 1RGYA 3F1PA 5FQIA 4E3KA 3GVBA 1GCEA 2DNSA 5EVLA 4LV0A 3BFEA 1CJFA 1ODVA 4X56A 5GLAA 4LFUA 1NYYA 3T4LA 3CI6A 2FFFB 2WKEA 4S2NC 1GHMA 3VE3A 2VGKA 4DXCA 5FAOA 1K56D 3V50A 1L0GA 4QY5A 4GZBA 3PBSA 2PU4A 3IX3A 4MLLA 3ZG5A 3TSGA 2WZZA 2G7UA 5DTTA 2ZC7A 3R7WB 4RRGA 4FCFA 1WYCA 4WMCA 4E6WA 3NI9A 5AQ9A 3KOBA 1LI9A 1VM1A 4MN5A 4O7DA 1JWPA 2PT7A 4R3BA 2W3EA 4BLMA 4BJPA 4FH2A 2Y2OA 1F2KA 1J3WA 3OC2A 4XUXA 1QMFA 2YKHA 1PWGA 3O5YA 3MQOA 2XGNA 3SH9A 4K08A 2E8JA 3LO7A 3BRMA 1OTBA 3N7WA 3G32A 2ZQCA 5J61A 2V20A 2XFTA 3KNPA 1YMXA 3IS2A 1LT0A 2Y2QA 2L4RA 2DCFA 1G6AA 3VP3A 3NCKA 3IS2B 4BBVA 4GD6A 4GW9A 3NOPC 4UA6A 3KSGA 1XGJA 3CMZA 4PHTA 1YLWA 4DF6A 4QB8A 4JGRA 3GV9A 3OPPA 3E2LA 5EVID 5D3OA 4IUKA 2VA0A 5FDSA 1BLHA 2ZQDA 3H7WA 1IKIA 2PYPA 4XT2A 4R6LA 4ZAMA 5KSHA 3E4OA 2HPBA 3H7WB 4N9KA 2KDKA 3NC8A 4XT2B 3DTIA 3A0SA 3GR2A 1K38A 4E3OA 3IWOA 3SH7A 3B3XA 2XROA 3KO7A 3BLMA 4JGOA 1KVLA 2O0YA 3E4PA 2M7UA 3D3OA 4OQIA 2WAEA 1LL5A 1Z09A 3BY9A 4CLCA 3PHYA 1MWUA 4P6ZS 1G28A 1FILA 4JXVA 3LEZA 2PD7A 3SZTA 2XR0A 4CLCB 3C7UA 2ZOHA 3ZG8B 2K7SA 1PI5A 3MS6A 1KE0A 1N9OA 4RR7A 4RX3A 3NOTC 4X69A 4ESPA 3QP2A 1X0OA 3DTKA 3PR6A 4LV1A 4JPMA 4B88A 4FOFA 3UE3A 2PBDP 3SS3A 3OPLA 5HPIA 3IWIA 4OQHA 4EWFA 2Q9NA 3HJIA 3M2KA 1MPLA 4EEPA 4RRIA 1ES3A 4RRHA 2JHEA 5DJUA 3ZHHA 4RA7A 4K91A 3B47A 3IHBA 5CX7A 3IF6B 4MBFA 2WKIA 1JWVA 1T1BA 5EFWA 3V3RA 4OOLA 5FQJA 2OAQ1 4RRJA 4NETA 1HZOA 3TE8A 5CGSA 4ARZB 2OV5A 4P6BA 3IXHA 3VE4A 3PD3A 2W0NA 3UN7A 3KO6A 5AVEA 3RJUA 3QP6A 3O87A 3C2WA 3LR3A 4NG2A 4DJ3A 1PNEA 5A92A 2NUTC 4R4SA 1K54C 1VEUB 4B4ZA 3DWZA 3MMHA 3CLOA 3PD2A 1E3UA 1ERQA 5M1AA 2WKHA 5E2EA 2OWHA 1PW1A 1I2WA 2L1MA 4WMCD 4PPRA 4U3TA 4IJGA 5HL1A 2QJ7A 3EWKA 4JF5A 2JCHA 4FTXA 3D4FA 2Y55A 3HCYA 1CEGA 3KYZA 5IU1A 2J8YA 4X6TA 4IBRA 4GHIB 1UWPX 3CG5A 1EWZA 3EOIA 1D7EA 1K25A 4KG2A 5KZHA 5IT5A 3PBNA 4MDZA 2HDRA 3CJMA 3LEQA 2OSUA 4EU0A 4MN7A 1GA0A 1OTDA 4HJ3A 2W3HA 5CGWA 1MXOA 1TS7A 1W8YA 4LRXC 3BQ8A 3UDFA 2X02A 3T4QA 1YQSA 3FPVA 1TS0A 3E2KA 2ZQ8A 3IX8A 2EX9A 5HAQA 2WKQA 4JBFA 4E6XA 3FKWA 4B93A 2P08A 3D9YA 4NEED 5KMWA 1TDLA 2ZMAA 3LI9A 3KSHA 2VZWA 3FV7A 1H8ZA 2EFUA 3GDIA 5HAIA 1YSQA 4RX2A 4HP9A 1IYPA 3CPTB 5HZHA 4GDBA 2HGVA 2W1TA 2PHYA 3KODA 4RRQA 3FC7A 2EFXA 4WF0A 5FASA 5HW3A 2V1ZA 4LV2A 5HX9A 2EX8A 4EESA 2Y8HA 3W2ZA 3P01A 3AGEA 3LIEA 5EE8A 1VETA 4KG6A 4EV4A 3QP4A 1IEMA 4II7A 2ZM0A 3IXDA 3S1YA 1O07A 3NDEA 4CLCD 2RCXA 4Y7PA 3MQQA 4PKYG 5HARA 2KLIA 3ZG7B 2GDNA 2XFSA 5E2GA 1LSXA 3LICA 3KSIA 3HBRA 3BM6A 3CHWP 1XJ3A 1XGIA 3HLCA 4K0WA 3MF0A 2Y59A 4NXGA 3NIAA 4HNBA 4HY8A 1W7FA 3W4OA 3ZDJA 2J80A 4RYEA 4P87A 3A3IA 2QZ6A 3G2ZA 1BLCA 4YNRA 4S02A 5A91A 3LMVA 5GHXA 3ITBA 2BASA 4ZJ1A 4GNUA 1E25A 2HL0A 1LSVA 1W5DA 1K55A 3ZCZA 3A3EA 4H8RA 4UQIM 2ZM2A 1E4DA 1O7EA 4S0LA 4F94A 1ZC2A 1HD8A 1OT9A 4GLQA 1EROA 4BWIA 3W4PA 5L10A 2HP9A 2VGJA 3SS4A 2JKTM 3WWXA 2V1BA 4R4RA 3PAEA 2WGIA 2HDSA 3V39A 2J3WA 5HD5A 2Y2LA 2VKSA 1G5UA 3ZG0A 3JVVA 5FL3A 1P97A 4O8GA 5EM1A 2GX5A 4AFIA 4LLOB 1L0FA 1XJ6A 1TVFA 1YM1A 2DRWA 2RL3A 3LIDA 3Q07A 4Z1WA 1Y2QA 5F1GA 1E3UD 1ERMA 4Q0IA 4PM7A 1H0MA 3BW6A 4EUVA 4KG5A 3C30A 3HUMA 2NUPC 3PD4A 2PD8A 5FSRA 2WUQA 4S0KA 4DE3A 5CRFA 3F1OA 3S7PA 2Z2MB 3VV4A 1FR1A 2CMNA 4HHDA 5I5LA 2Y2PA 3N4IA 3HUOA 1DP8A 2IWCA 1IELA 3F1OB 2R9WA 2EX2A 1KDWA 1ZG6A 1S67L 3DTMA 4NXFA 1KE3A 4DMZA 2ZD8A 4JF6A 4FH4A 1XKZA 4OPRA 5HD3A 5MC7A 1LL8A 2BLSA 2R78A 3KX0X 2YKFA 2IWBA 4KZ9A 2VEAA 4S2IA 1KGEA 4LGWA 1IYQA 3P09A 3S4XA 1KE4A 1JTGA 3NJAA 3LIAA 2PR5A 2XD5A 2Q9MA 3B33A 4UEYA 4GJ4A 1CI9A 3U2AA 2W3DA 2HZ5A 2JKRI 4Y15A 3EQUA 3Q81A 4DDSA 1NJ4A 1CF0A 3R7WA 1G68A 2XQZA 3PYPA 4RRBA 3KYQA 3UDXA 5G4YA 5HAPA 4KQRA 4WM9A 3RFBA 1XPBA 2XH9A 4IBXA 5FEFA 2XA7S 3N8RA 4Q8IA 1DRMA 3WS0A 3L9KA 3UNWA 5K5BA 1FSWA 4BD1A 2WK0A 1L0EA 4DE2A 1S66L 4X55A 5CEBA 3SOIA 5GLCA 2ZC4B 2P74A 4OPYA 3NBLA 1VHMA 4L9EA 4BMWA 2QMIA 4BBUA 2UV0E 4JF4A 1PZOA 4JGPA 1ES5A 4OP8A 4EXOA 3VOLA 2LB9A 4DRTA 5E2HA 1TC5A 4HIAA 1ZHHB 3K3DA 4WZ5A 3L7HA 2ZOIA 4WELA 3IBJA 2OOLA 2W27A 1S6RA 1RCJA 3OCNA 1W8QA 3ZFZA 2A49A 3IQAA 2Y2IA 2P9VB 1PYYA 1GSXA 4L0LA 2H0YA 4S03A 2QPNA 3QNCA 3CWFA 1LI0A 3PBTA 3CUEC 4ZJ2A 1NY0A 2B5RA 3S22A 3NY4A 4OKPA 1KVMA 1YSPA 5CHUA 3VP4A 3MFXA 5FQ9A 1PW8A 4KUOA 2CC1A 2OKVA 4S2JA 4S2LA 3LMUA 3KO5A 1YLPA 3QHYA 3UMEA 2GNXA 3IT9A 3LMTA 4PAUA 4U0XA 1UGUA 4DE1A 3F1NB 3Q7ZA 1BYWA 3O3VA 2VJWA 4YINA 5F82A 1ALQA 1BZAA 2EXBA 2VGLM 3NOUC 5G4ZA 2INWA 2OLUA 4RR8A 3G31A 2HP6A 4OLDA 3LUQA 4HQAA 3VOYA 1WYBA 4RR9A 1P0ZA 3H9WA 4YFMA 5HPFA 3UPPA 4CLCE 4S2OA 3UO9A 4RVAA 1L0DA 4XXRA 3Q7VB 1XX2A 1G6OA 2VK3A 4H6JA 3PD5A 2XSSA 3O86A 3K3CA 3S7NA 4H6JB 4EERA 2V9AA 3PBQA 4Y0UA 5DTSA 4KZ8A 5FATA 2O9CA 2XEPA 5EVIC 1K4FA 3W8KA 1BUEA 1C3BA 4GDNA 2EWWA 3CITA 2E8IA 4KQDA 3HLGA 3FG8A 5TJJA 4EQ1A 2XD1A 4MN6A 4P0MA 2ZMVA 3IF6A 1K55C 4C75A 2ZC6B 4RRKA 3JYIA 4DE0A 3FPWA 2PRFA 4UAAA 3SS5A 5HSQA 3OLOA 5TR7A 4ZBEA 5L2FA 4ARZA 1OTIA 2P04A 4S0JA 3ULFA 1Y54A 1YMSA 3UPNA 3LR0A 4OLGA 3ZVTA 2LB5A 1W63M 2Y2NA 4O0PA 5M19A 2VGLS 4EBPA 1H8MA 3N8LA 4E3LA 1XXMA 5J7EA 3VFHA 1VEUA 3IX4A 4MNRA 3M6HA 4YWZA 1WE4A 3EGDC 2ZQAA 3VP0A 3WRTA 2O9AA 3DTEA 1VQQA 5DKLA 3HLFA 4QWOA 4WUJA 1PRQA 4ZDXA 1XA1A 1OMEA 3A3DA 1DJCA 3OOVA 4GD8A 4E3MA 2H5SA 3C5AA 1OT6A 2FZ0A 3G6OA 2WAFA 4GHIA 1BULA 2HDQA 5EECA 1F9IA 2IA2A 1RGZA 3A3FA 4GOGA 1IFQA 1BT5A 2HJ9C 1U60A 1H3QA 3IH8A 4E3IA 1DP6A 3VOZA 4I3JA 3T1QB 4QU3A 4E04A 1BLSA 5EV0A 1P9RA 3LR5A 3UB6A 3HL9A 1YPRA 4ZTKA 1MKIA 3Q1FA 1OJ5A 2G2WA 1IYOA 3KSFA 4JGQA 4OONA 3C7VA 4HJ6A 3NULA 3QP1A 5EOOA 1PWDA 3T4JA 1NZUA 2OAP1 2O99A 4A5RA 3UE6A 2Y2KA 2WYXA 3A0VA 4OPQA 2VX8A 2V1AA 3WS1A 4QHCA 3SW1A 4RRFA 3BJNA 3C8CA 2KOIA 4WL9A 5JYPA 4N9LA 1Y4OA 3VSLA 4G3KA 3CPTA 3BWLA 5M18A 3ZNYA 4U0TA 4R70A 1MKMA 5HDCA 4CJNA 1W63Q 5BOHA 5JYOA 4C3QA 1MBLA 3T4KA 2QYBA 3TOIA 3IHAA 4JXWA 3WS2A 1NRFA 2PR6A 3GECA 4JKTA 2M7VA 1S4SA 3EQVA 1SKOB 4OOMA 5HWWA 1Y28A 3G2YA 4HBTA 2W3FA 3VP2A 5J8XA 4EQIA 1FR6A 1PWCA 5F1FA 4R23A 1ACFA 4NXEA 1K6SA 3IBRA 4ETXA 1FQGA 3FZCA 3NHQA 1CQAA 1LSWA 4WN5A 5GHYA 4ZJ3A 4S2KA 1KDSA 2WGWB 3BQAA 2P7JA 5CTMA 3G34A 4QY6A 3E98A 5I94A 4YOFA 3VMAA 2PDRA 1SCWA 4KZAA 1K0KA 3ZGAB 4IVIA 2PU2A 3D72A 3FYZA 3IF5A 3M2JA 2QWSA 1J9MA 3T12B 4I3IA 4GN2A 1M40A 1D06A 4EUZA 1SKFA 2X71A 1T1AA 5FAQA 4BBTA 3DWKA 3T1RA 3P98A 4JXGA 1N9LA 4FUWA 1I5QA 5TBMA 2XRNA 3MQ0A 3TRCA 2HJEA 4UA9A 5FDHA 4B9OA 3H82B 4IVKA 5E2FA 4IHQA 5TBMB 2WZXA 1PIOA 4OH0A 4B4XA 4FSFA 5L07A 1AWIA 4RRCA 1XJ2A 4Q0JA 3W4QA 2Y4AA 2Y2GA 4JLFA 2J9OA 5IHVA 3T50A 1KGFA 1CK3A 3MXQA 4IEDA 4CLCC 3S7QA 3HJKA 2ZC5B 3LR4A 5F6AA 2K2NA 3VSKA 4PM9A 4MEZA 1D1JA 4KZBA 1JKEA 3P7NA 5EOEA 1DJAA 4BL3A 4EW7A 2MJ6A 2OWJA 4WYYA 3ZYTA 1GHPA 1XFNA 2J3TD 1S1YA 1YLYA 1YKDA 2JKFA 3BLSA 1ZG4A 2ACGA 4Y5FA 4X68A 1DY6A 2C5WB 3VFFA 4QPRA 3MSHA 3QP5A 2D02A 2JN7A 2ZM8A 5DF7A 4UA7A 1GHIA 3MKFA 1HTZA 4PM5A 2VV8A 4BENA 2FH5A 5EUAA 3TJZC 1HVBA 5L09A 4HEFA 3IF6C 5AVFA 5FQQA 3UB9A 1DP9A 4I38A 4C6YA 1ONHA 5AQ7A 4UQIS 3G30A 4Y17A 3OCLA 4EETB 5GLDA 3G35A 4PM8A 2A3UA 4F3LA 4IUHA 1MZUA 1S1ZA 3A3JA 5KSCA 3KO4A 4NKPA 2A24B 4L9FA 2HKZA 4F3LB 5FAPA 5F5YA 2Y91A 1YLJA 4HH2A 3F1PB 2B95A 3B42A 1YLZA 2D01A 3MXSA 1LL9A 4MBHA 1Q2PA 2VV7A 3G4PA 2WADA 3PXPA 5DF8A 3UDIA 4LRZE 1PI4A 2H10A 1S4RA 3KO3A 2HV1A 2J3TC 3Q82A 4RRDA 1TS6A 2B02A 2XLNA 3UE1A 2XDMA 5TFQA 5CHJA 2V0UA 5DF9A 5DJTA 2EXAA 3LY4A 4QD4A 3WS4A 4MMNA 3ZG9B 4LCLA 3IXBA 5DTKA 5CXWA 1SDNA 4KZ7A 3LFVA 4HH3A 1TF1A 5GLBA 3HUNA 3JPUA 4LPZA 3AGFA 1JTDA 4DJ2A 1IKGA 3SH8A 4Y2FA 1K4EA 2Y2HA 2I9VA 3BYDA 2GJ3A 1BTLA 4QJGA 4RRMA 1NYMA 4P6ZM 5CTNA 3MZDA 2I72A 2J7VA 4G3VA 2P9VA 3NECA 1K57A 1LHYA 4KENB 4KZ5A 3CAXA 2HP5A 5CHMA 4WEJA 3BFDA 5CERA 1TD5A 2Y2MA 4RRRA 4HJ4A 5IS1A 1CEFA 4DDYA 3LIBA 4HP4A 4RR6A 4Y13A 4S0IA 4PMAA 3GQZA 5HL6A 5J3WA 3GTCA 4I39A 4D60A 1Z6FA 5HFOA 3F1NA 4LRYC 4N1XA 4OVDA 1IOUA 3PAGA 4OQ0A 3PBRA 2DBOA 3ISGA 5G18A 4ZRRA 1MWRA 3RXXA 1XA7A 4P85A 4PM6A 1KOUA 4WLAA 1K6RA 1BSGA 1JWZA 4JXSA 1WA9A 2BTFP 3Q7VA 1FIKA 4OQGA 1SHVA 3N6IA 2KX6A 4OPZA 3BECA 4RQ9A 2ZMFA 1KGGA 5A90A 1YT4A 2Y79A 1MY8A 1MWSA 2Z6DA 2ZQ7A 4R3JA 1BLPA 2W3GA 5C5KA 3JVUA 4MCWA 2FFYA 4KZ4A 3LI8A 1XFQA 5FI7A 3ZVWA 3HVFA 3OPRA 1GSVA 3GMWA 5GL9A 1ZKJA 4M3KA 4CQHA 1SZVA 2GZAA 3BEBA 3EEAA 2O9BA 4GB7A 1NXYA 4HI4A 2UWXA 3LIFA 2B18A 3LY3A 4KQQA 1ESUA 3MKEA 4DXBA 3KO9A 4MBKA 1F98A 2JKGA 1OTEA 2J9PA 2ZJ9A 3MZFA 4ME4A 2V0WA 4GKUA 1YLTA 1TEMA 4Y3IA 4M4XA 5GHZA 1MWTA 4RRLA 1FCMA 2ZL1A 3R4KA 3MFDA 2HF6A 4E3NA 2ZQ9A 2VLGA 3HLEA 2ZL1B 4G3WA 1IYSA 3VP1A
chains in the Genus database with same CATH topology
1ERMA 2Y2QA 1I2SA 1S0WA 4LCMA 4OOMA 2DCFA 1G6AA 1QMEA 4PM7A 2V2FF 2G2UA 3VP3A 3NCKA 4BQMA 4GD6A 4N92A 4KG5A 5F83A 3HUMA 1DJBA 3PD4A 3G2YA 4HBTA 4D2OA 4UA6A 5FSRA 3VP2A 5J8XA 4EQIA 2WUQA 4S0KA 4DE3A 1FR6A 5CRFA 1LLBA 1PWCA 1XGJA 3CMZA 5TGFA 5F1FA 1YLWA 2Z2MB 4R23A 4DF6A 1K6SA 3IH9A 3RXWA 4QB8A 4S2PA 1FQGA 1FR1A 3UE0A 3FZCA 3GV9A 1AXBA 1N4OA 2Y2PA 3E2LA 3OPPA 3OPHA 4WBGA 5EVID 3N4IA 3HUOA 5D3OA 5GHYA 4CPKA 2IWCA 1IELA 4S2NA 4ZJ3A 2R9WA 4S2KA 2EX2A 1KDSA 2WGWB 1KDWA 4E3JA 1BLHA 1ZG6A 3G34A 4QY6A 2ZQDA 5CTMA 5FQKA 4NBIA 3DTMA 1KE3A 1IKIA 2ZD8A 5I94A 1ESIA 4JF6A 4FH4A 1XKZA 4OPRA 3VMAA 4ZAMA 5KSHA 4BL2A 2HPBA 1SCWA 4KZAA 4N9KA 3NC8A 2BLSA 1FCNA 2IWBA 4DKIA 3ZGAB 4IVIA 4KZ9A 2PU2A 4S2IA 1KGEA 2X01A 1J7GA 3GR2A 3FYZA 1K38A 2R9XA 1IYQA 3P09A 3S4XA 3IF5A 4E3OA 1KE4A 3M2JA 3UPOA 1JTGA 1CI8A 3IXGA 1J9MA 3IWOA 3SH7A 4GN2A 1M40A 2XD5A 3V5MA 3B3XA 2Q9MA 4EUZA 1H8YA 1ONGA 1SKFA 2X71A 1FOFA 3BLMA 3ZNTA 3KO7A 1CI9A 5FAQA 3WRZA 1KVLA 2JBFA 3DWKA 3WS5A 3P98A 4JXGA 3EQUA 4K0XA 3Q81A 2WAEA 1NJ4A 4OQIA 1I5QA 4DDSA 1G68A 1LL5A 1FCOA 4UA9A 2XQZA 5FDHA 1MWUA 4Y0TA 4RRBA 3GSGA 3UDXA 4IVKA 5HAPA 4KQRA 4JXVA 5E2FA 3LEZA 4WM9A 2WZXA 1PIOA 4OH0A 1M6KA 2XR0A 1XPBA 2XH9A 4B4XA 4IBXA 3C7UA 3O88A 1W79A 3CZDA 3N8RA 4FSFA 3ZG8B 1FSYA 4Q8IA 3WS0A 1PI5A 1KE0A 3UNWA 4RRCA 5CECA 3W4QA 2Y4AA 4RX3A 1FSWA 4RR7A 4BD1A 2WK0A 2Y2GA 4X69A 4JLFA 4EBLA 1L0EA 2J9OA 4DE2A 3PTEA 5IHVA 1KGFA 4X55A 5CEBA 1N9BA 2ZLYA 4KQOA 1CK3A 3GRJA 3SOIA 4LV1A 5GLCA 4IEDA 4JPMA 5FI6A 4B88A 3UE3A 2ZC4B 2P74A 4OPYA 1L2SA 3SS3A 3NBLA 3AGDA 2H0TA 2ZC5B 3OPLA 3VSKA 4PM9A 4MEZA 3M6BA 3IWIA 4OQHA 2QMIA 4KZBA 4EWFA 1JKEA 2Q9NA 4JF4A 3M2KA 5EOEA 1MPLA 1K56A 1PZOA 1DJAA 3V3SA 4BL3A 1ES5A 2XK1A 4OP8A 5FQMA 4WYYA 4RRIA 1H5XA 1ES3A 4RRHA 1GHPA 4DRTA 3DW0A 3ZHHA 4RA7A 4K91A 5E2HA 1YLYA 3IHBA 3IF6B 4KZ3A 1TC5A 2C6WB 4WEKA 4MBFA 2WKIA 3BLSA 1ZG4A 5U47A 1JWVA 2HL2A 4X68A 1DY6A 2C5WB 4NBJA 4WZ5A 3VFFA 3UY6A 4WELA 2ZM8A 3V3RA 5DF7A 4OOLA 1GHIA 1GA9A 4R0QA 4UA7A 5FQJA 4RRJA 3MKFA 1HTZA 4NETA 1HZOA 4PM5A 5CGSA 1S6RA 1RCJA 2WGWA 4BENA 3OCNA 5EUAA 2OV5A 1W8QA 3IXHA 4P6BA 3ZFZA 1HVBA 2A49A 3IQAA 2Y2IA 2P9VB 1PYYA 3OZHA 4L0LA 2H0YA 1XP4A 4HEFA 3PD3A 4S03A 4EBNA 3BFCA 2QPNA 3IF6C 3QNCA 3MXRA 4LV3A 3PBTA 1LI0A 5FQQA 4ZJ2A 1NY0A 3UN7A 2B5RA 4HBUA 2XF3A 1ONHA 1EI5A 3NY4A 4N1HA 4Y0OA 3RJUA 5AQ7A 3S22A 4C6YA 3O87A 4Z9QA 4OKPA 3G30A 3MBZA 3FWLA 1KVMA 3BFFA 3OCLA 3I7JA 5A92A 5CHUA 5GLDA 3G35A 4R4SA 2HDUA 4PM8A 3VP4A 4S2MA 1K54C 2A3UA 4B4ZA 4WZ5C 3DWZA 3C4PA 5FQ9A 1PW8A 3PD2A 3A3JA 4UHUA 1E3UA 1K57C 1ERQA 5M1AA 5KSCA 2CC1A 2WKHA 2OKVA 3KO4A 4S2JA 5E2EA 1PW1A 1I2WA 4S2LA 4WMCD 3N8SA 4PPRA 4U3TA 5HL1A 2HKZA 1YLPA 3KO5A 3QHYA 5FAPA 3IT9A 3LMTA 4R1GA 4U0XA 2Y91A 3KOCA 4JF5A 1YLJA 2JCHA 4FD8A 5AQAA 2OLVA 4DE1A 5DVAA 3D4FA 3Q7ZA 5A93A 2Y55A 1ES4A 1CEGA 3O3VA 1YLZA 4BD0A 3MXSA 1LL9A 3HLWA 2J8YA 4MBHA 4YINA 5F82A 1BZAA 1ALQA 1Q2PA 3G4PA 2EXBA 4X6TA 1TDGA 4IBRA 2OLUA 3BFGA 4OP5A 2WADA 4RR8A 5EVIA 3G31A 2HP6A 4OLDA 5FI2A 3CG5A 3VOYA 1EWZA 5DF8A 3UDIA 1WYBA 4RR9A 2EX6A 1PI4A 2H10A 4YFMA 3KO3A 1K25A 4KG2A 3UPPA 5KZHA 4WZ4A 5EVIB 2PBYA 4S2OA 3PBNA 4RVAA 1L0DA 3UO9A 4XXRA 4RRAA 3Q7VB 3Q82A 4X53A 1XX2A 4RRDA 2HDRA 5AQBA 3CJMA 3IWQA 4XUZA 4HESA 5E43A 2OSUA 3PD5A 5EPHA 2XLNA 3O86A 3UE1A 2XDMA 5TFQA 3FKVA 5CHJA 1GA0A 5FA7A 5DF9A 5CGWA 1MXOA 1W8YA 2EXAA 3LY4A 3PBQA 4Y0UA 3HLDA 3UDFA 2X02A 4QD4A 5DTSA 4KZ8A 5FATA 2JE5A 3WS4A 2XEPA 2Z2LB 4LCLA 3ZG9B 3IXBA 5EVIC 1K4FA 1YQSA 3E2KA 4NK3A 2WGVA 5DTKA 5CXWA 1BUEA 1C3BA 1SDNA 4GDNA 3TG9A 3W8KA 2Y2JA 2ZC3B 1JVJA 3QNBA 2ZQ8A 3HLBA 4KZ7A 2EX9A 2E8IA 5HAQA 4JBFA 4ID4A 3HLGA 4E6XA 5GLBA 3FKWA 3HUNA 3AGFA 5KMWA 2XD1A 4P0MA 1TDLA 2ZMAA 3IF6A 1JTDA 1K55C 1IKGA 5CGXA 3MZEA 3SH8A 4C75A 3HREA 2ZC6B 4RRKA 1K4EA 2Y2HA 3BYDA 3JYIA 2BG1A 4LENA 4DE0A 1BTLA 3FV7A 1H8ZA 2EFUA 5HAIA 4QJGA 4UAAA 3SS5A 5TR7A 4RX2A 4RRMA 1RP5A 5CEDA 1NYMA 4ZBEA 1IYPA 2IWDA 2JC7A 1K54A 5CTNA 5L2FA 4GDBA 2HL1A 3MZDA 2I72A 2J7VA 2P9VA 4KZ6A 1K57A 3KODA 4RRQA 3PBOA 1LHYA 4S0JA 4KENB 2EFXA 5FASA 4KZ5A 3LMUA 1Y54A 2HP5A 1YMSA 3UPNA 5CHMA 4OLGA 3ZVTA 4WEJA 5HW3A 2V1ZA 3BFDA 4LV2A 5HX9A 5CERA 1PZPA 2EX8A 2Y2MA 2Y2NA 4OOYA 4RRRA 5M19A 4EBPA 4E3LA 3N8LA 1ES2A 1XXMA 3AGEA 1CEFA 3ITAA 5EE8A 3VFHA 4KG6A 4DDYA 4MNRA 4EV4A 3NDGA 1IEMA 4RR6A 1SDEA 2ZM0A 3M6HA 1NZOA 3KNFA 3IXDA 1WE4A 3S1YA 1O07A 2ZQAA 4S0IA 4PMAA 1Q2QA 3VP0A 3GQZA 3NDEA 3WRTA 3C4OA 1VQQA 2RCXA 3LCEA 4Y7PA 1RGYA 3GTCA 3HLFA 1Z6FA 5HFOA 4ZDXA 1XA1A 1OMEA 5FQIA 3A3DA 5HARA 4E3KA 3GVBA 4N1XA 4OVDA 3ZG7B 2GDNA 1DJCA 1GCEA 2DNSA 2XFSA 3PAGA 3PBRA 4OQ0A 5E2GA 5EVLA 2DBOA 4GD8A 3ISGA 4LV0A 3HBRA 4E3MA 3BM6A 2H5SA 1XGIA 3C5AA 3HLCA 5G18A 4K0WA 1MWRA 3RXXA 2WAFA 3BFEA 1BULA 2HDQA 5EECA 2Y59A 1XA7A 4P85A 4PM6A 3NIAA 4X56A 1RGZA 1W7FA 1K6RA 3A3FA 1BSGA 4GOGA 3W4OA 1JWZA 5GLAA 1BT5A 4JXSA 3ZDJA 1U60A 4RYEA 4P87A 3A3IA 3Q7VA 1NYYA 2QZ6A 3IH8A 3G2ZA 4OQGA 1BLCA 4E3IA 1SHVA 3N6IA 3VOZA 4OPZA 3BECA 5A91A 3LMVA 4S02A 4QU3A 3ITBA 5GHXA 2FFFB 1BLSA 4ZJ1A 1KGGA 2WKEA 4S2NC 5A90A 1YT4A 1GHMA 4GNUA 3HL9A 1E25A 2HL0A 1MY8A 1MWSA 2VGKA 4DXCA 5FAOA 4ZTKA 1K56D 1MKIA 2ZQ7A 1W5DA 4R3JA 1BLPA 1K55A 3Q1FA 3V50A 1L0GA 2G2WA 1IYOA 4QY5A 2FFYA 3A3EA 4GZBA 3PBSA 2PU4A 4H8RA 3ZCZA 4OONA 2ZM2A 4KZ4A 3C7VA 4MLLA 1E4DA 1O7EA 3TSGA 3ZG5A 4S0LA 5FI7A 2WZZA 3ZVWA 4F94A 3HVFA 5DTTA 1ZC2A 3OPRA 2ZC7A 5EOOA 4RRGA 1PWDA 1WYCA 3GMWA 1NZUA 4FCFA 4WMCA 1HD8A 4E6WA 5GL9A 1ZKJA 4M3KA 1EROA 4A5RA 3NI9A 5AQ9A 2Y2KA 2WYXA 3W4PA 3BEBA 3KOBA 2HP9A 2VGJA 1LI9A 1VM1A 3SS4A 4OPQA 4GB7A 3WWXA 3WS1A 4R4RA 3PAEA 4O7DA 1NXYA 4QHCA 1JWPA 2UWXA 4R3BA 4RRFA 2WGIA 4BLMA 2HDSA 4BJPA 3V39A 3LY3A 4KQQA 1ESUA 3MKEA 4FH2A 4DXBA 3KO9A 4MBKA 2Y2OA 2Y2LA 5JYPA 4N9LA 3OC2A 2J9PA 2ZJ9A 3MZFA 4XUXA 1QMFA 3ZG0A 3VSLA 1PWGA 5M18A 4GKUA 1YLTA 3ZNYA 4U0TA 2XGNA 1TEMA 3SH9A 1L0FA 5GHZA 1MWTA 3LO7A 4RRLA 3BRMA 4CJNA 5BOHA 5JYOA 1FCMA 1TVFA 3N7WA 4C3QA 1MBLA 3MFDA 3TOIA 1YM1A 3G32A 2ZQCA 2DRWA 2V20A 3IHAA 2RL3A 4JXWA 4E3NA 5J61A 3WS2A 2XFTA 2ZQ9A 3KNPA 1YMXA 1NRFA 3Q07A 4JKTA 3HLEA 1Y2QA 5F1GA 3EQVA 1IYSA 3VP1A 1E3UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERM A;  2Y2Q A;  1I2S A;  1S0W A;  4LCM A;  4OOM A;  2DCF A;  1G6A A;  1QME A;  4PM7 A;  2V2F F;  2G2U A;  3VP3 A;  3NCK A;  4BQM A;  4GD6 A;  4N92 A;  4KG5 A;  5F83 A;  3HUM A;  1DJB A;  3G2Y A;  4HBT A;  4D2O A;  4UA6 A;  5FSR A;  3VP2 A;  5J8X A;  4EQI A;  2WUQ A;  4DE3 A;  1FR6 A;  5CRF A;  1LLB A;  1PWC A;  1XGJ A;  3CMZ A;  5TGF A;  5F1F A;  1YLW A;  2Z2M B;  4R23 A;  4DF6 A;  1K6S A;  3IH9 A;  3RXW A;  4QB8 A;  4S2P A;  1FQG A;  1FR1 A;  3UE0 A;  3FZC A;  3GV9 A;  1AXB A;  1N4O A;  2Y2P A;  3E2L A;  3OPP A;  3OPH A;  4WBG A;  5EVI D;  3N4I A;  3HUO A;  5D3O A;  5GHY A;  4CPK A;  2IWC A;  1IEL A;  4S2N A;  4ZJ3 A;  2R9W A;  4S2K A;  2EX2 A;  1KDS A;  2WGW B;  1KDW A;  4E3J A;  1BLH A;  1ZG6 A;  3G34 A;  4QY6 A;  2ZQD A;  5CTM A;  5FQK A;  3DTM A;  1KE3 A;  1IKI A;  2ZD8 A;  5I94 A;  1ESI A;  4JF6 A;  4FH4 A;  1XKZ A;  4OPR A;  3VMA A;  4ZAM A;  5KSH A;  4BL2 A;  2HPB A;  1SCW A;  4KZA A;  4N9K A;  3NC8 A;  2BLS A;  1FCN A;  2IWB A;  4DKI A;  3ZGA B;  4IVI A;  4KZ9 A;  2PU2 A;  4S2I A;  1KGE A;  2X01 A;  3GR2 A;  3FYZ A;  1K38 A;  2R9X A;  1IYQ A;  3P09 A;  3S4X A;  3IF5 A;  4E3O A;  1KE4 A;  3M2J A;  3UPO A;  1JTG A;  1CI8 A;  3IXG A;  1J9M A;  3IWO A;  3SH7 A;  4GN2 A;  1M40 A;  2XD5 A;  3V5M A;  3B3X A;  2Q9M A;  4EUZ A;  1H8Y A;  1ONG A;  1SKF A;  2X71 A;  1FOF A;  3BLM A;  3ZNT A;  1CI9 A;  5FAQ A;  3WRZ A;  1KVL A;  2JBF A;  3DWK A;  3WS5 A;  3P98 A;  4JXG A;  3EQU A;  4K0X A;  3Q81 A;  2WAE A;  1NJ4 A;  4OQI A;  1I5Q A;  4DDS A;  1G68 A;  1LL5 A;  1FCO A;  4UA9 A;  2XQZ A;  5FDH A;  1MWU A;  4Y0T A;  3GSG A;  3UDX A;  4IVK A;  5HAP A;  4KQR A;  4JXV A;  5E2F A;  3LEZ A;  4WM9 A;  2WZX A;  1PIO A;  4OH0 A;  1M6K A;  2XR0 A;  1XPB A;  2XH9 A;  4B4X A;  4IBX A;  3C7U A;  3O88 A;  1W79 A;  3CZD A;  3N8R A;  4FSF A;  3ZG8 B;  1FSY A;  4Q8I A;  3WS0 A;  1PI5 A;  1KE0 A;  3UNW A;  5CEC A;  3W4Q A;  2Y4A A;  4RX3 A;  1FSW A;  4BD1 A;  2WK0 A;  2Y2G A;  4X69 A;  4JLF A;  4EBL A;  1L0E A;  2J9O A;  4DE2 A;  3PTE A;  5IHV A;  1KGF A;  4X55 A;  5CEB A;  1N9B A;  2ZLY A;  4KQO A;  1CK3 A;  3GRJ A;  3SOI A;  4LV1 A;  5GLC A;  4IED A;  4JPM A;  5FI6 A;  4B88 A;  3UE3 A;  2ZC4 B;  2P74 A;  4OPY A;  1L2S A;  3SS3 A;  3NBL A;  3AGD A;  2H0T A;  2ZC5 B;  3OPL A;  3VSK A;  4PM9 A;  4MEZ A;  3M6B A;  3IWI A;  4OQH A;  2QMI A;  4KZB A;  4EWF A;  2Q9N A;  4JF4 A;  3M2K A;  5EOE A;  1MPL A;  1K56 A;  1PZO A;  1DJA A;  3V3S A;  4BL3 A;  1ES5 A;  2XK1 A;  4OP8 A;  5FQM A;  4WYY A;  1H5X A;  1ES3 A;  1GHP A;  4DRT A;  3DW0 A;  3ZHH A;  4RA7 A;  4K91 A;  5E2H A;  1YLY A;  3IHB A;  3IF6 B;  4KZ3 A;  2C6W B;  4WEK A;  4MBF A;  2WKI A;  3BLS A;  1ZG4 A;  5U47 A;  1JWV A;  4X68 A;  1DY6 A;  2C5W B;  4WZ5 A;  3VFF A;  3UY6 A;  4WEL A;  2ZM8 A;  3V3R A;  5DF7 A;  4OOL A;  1GHI A;  1GA9 A;  4R0Q A;  4UA7 A;  5FQJ A;  3MKF A;  1HTZ A;  4NET A;  1HZO A;  4PM5 A;  5CGS A;  1S6R A;  1RCJ A;  2WGW A;  4BEN A;  3OCN A;  5EUA A;  2OV5 A;  1W8Q A;  3IXH A;  4P6B A;  3ZFZ A;  1HVB A;  2A49 A;  3IQA A;  2Y2I A;  2P9V B;  1PYY A;  3OZH A;  4L0L A;  2H0Y A;  1XP4 A;  4HEF A;  4EBN A;  3BFC A;  2QPN A;  3IF6 C;  3QNC A;  3MXR A;  4LV3 A;  3PBT A;  1LI0 A;  5FQQ A;  4ZJ2 A;  1NY0 A;  3UN7 A;  2B5R A;  4HBU A;  2XF3 A;  1ONH A;  1EI5 A;  3NY4 A;  4N1H A;  4Y0O A;  3RJU A;  5AQ7 A;  3S22 A;  4C6Y A;  3O87 A;  4Z9Q A;  4OKP A;  3G30 A;  3MBZ A;  3FWL A;  1KVM A;  3BFF A;  3OCL A;  3I7J A;  5A92 A;  5CHU A;  5GLD A;  3G35 A;  4R4S A;  2HDU A;  4PM8 A;  3VP4 A;  4S2M A;  1K54 C;  2A3U A;  4B4Z A;  4WZ5 C;  3DWZ A;  3C4P A;  5FQ9 A;  1PW8 A;  3A3J A;  4UHU A;  1E3U A;  1K57 C;  1ERQ A;  5M1A A;  5KSC A;  2CC1 A;  2WKH A;  4S2J A;  5E2E A;  1PW1 A;  1I2W A;  4S2L A;  4WMC D;  3N8S A;  4PPR A;  4U3T A;  5HL1 A;  1YLP A;  3QHY A;  5FAP A;  3IT9 A;  4R1G A;  4U0X A;  2Y91 A;  4JF5 A;  1YLJ A;  2JCH A;  4FD8 A;  5AQA A;  2OLV A;  4DE1 A;  5DVA A;  3D4F A;  3Q7Z A;  5A93 A;  2Y55 A;  1ES4 A;  1CEG A;  3O3V A;  1YLZ A;  4BD0 A;  3MXS A;  1LL9 A;  3HLW A;  2J8Y A;  4MBH A;  4YIN A;  5F82 A;  1BZA A;  1ALQ A;  1Q2P A;  3G4P A;  2EXB A;  4X6T A;  1TDG A;  4IBR A;  2OLU A;  3BFG A;  4OP5 A;  2WAD A;  5EVI A;  3G31 A;  2HP6 A;  4OLD A;  5FI2 A;  3CG5 A;  3VOY A;  1EWZ A;  5DF8 A;  3UDI A;  1WYB A;  2EX6 A;  1PI4 A;  2H10 A;  4YFM A;  1K25 A;  4KG2 A;  3UPP A;  5KZH A;  4WZ4 A;  5EVI B;  2PBY A;  4S2O A;  3PBN A;  4RVA A;  1L0D A;  3UO9 A;  4XXR A;  3Q7V B;  3Q82 A;  4X53 A;  1XX2 A;  2HDR A;  5AQB A;  3CJM A;  3IWQ A;  4XUZ A;  4HES A;  5E43 A;  2OSU A;  5EPH A;  2XLN A;  3O86 A;  3UE1 A;  2XDM A;  5TFQ A;  3FKV A;  5CHJ A;  1GA0 A;  5FA7 A;  5DF9 A;  5CGW A;  1MXO A;  1W8Y A;  2EXA A;  3LY4 A;  3PBQ A;  4Y0U A;  3HLD A;  3UDF A;  2X02 A;  4QD4 A;  5DTS A;  4KZ8 A;  5FAT A;  2JE5 A;  3WS4 A;  2XEP A;  2Z2L B;  4LCL A;  3ZG9 B;  3IXB A;  5EVI C;  1K4F A;  1YQS A;  3E2K A;  4NK3 A;  2WGV A;  5DTK A;  5CXW A;  1BUE A;  1C3B A;  1SDN A;  4GDN A;  3TG9 A;  3W8K A;  2Y2J A;  2ZC3 B;  1JVJ A;  3QNB A;  2ZQ8 A;  3HLB A;  4KZ7 A;  2EX9 A;  2E8I A;  5HAQ A;  4JBF A;  4ID4 A;  3HLG A;  4E6X A;  5GLB A;  3FKW A;  3HUN A;  3AGF A;  5KMW A;  2XD1 A;  4P0M A;  1TDL A;  2ZMA A;  3IF6 A;  1JTD A;  1K55 C;  1IKG A;  5CGX A;  3MZE A;  3SH8 A;  4C75 A;  3HRE A;  2ZC6 B;  1K4E A;  2Y2H A;  3BYD A;  3JYI A;  2BG1 A;  4LEN A;  4DE0 A;  1BTL A;  3FV7 A;  1H8Z A;  2EFU A;  5HAI A;  4QJG A;  4UAA A;  3SS5 A;  5TR7 A;  4RX2 A;  1RP5 A;  5CED A;  1NYM A;  4ZBE A;  1IYP A;  2IWD A;  2JC7 A;  1K54 A;  5CTN A;  5L2F A;  4GDB A;  3MZD A;  2I72 A;  2J7V A;  2P9V A;  4KZ6 A;  1K57 A;  3PBO A;  1LHY A;  4KEN B;  2EFX A;  5FAS A;  4KZ5 A;  1Y54 A;  2HP5 A;  1YMS A;  3UPN A;  5CHM A;  4OLG A;  3ZVT A;  4WEJ A;  5HW3 A;  2V1Z A;  3BFD A;  4LV2 A;  5HX9 A;  5CER A;  1PZP A;  2EX8 A;  2Y2M A;  2Y2N A;  4OOY A;  5M19 A;  4EBP A;  4E3L A;  3N8L A;  1ES2 A;  1XXM A;  3AGE A;  1CEF A;  3ITA A;  5EE8 A;  3VFH A;  4KG6 A;  4DDY A;  4MNR A;  4EV4 A;  3NDG A;  1IEM A;  1SDE A;  2ZM0 A;  3M6H A;  1NZO A;  3IXD A;  1WE4 A;  3S1Y A;  1O07 A;  2ZQA A;  4PMA A;  1Q2Q A;  3VP0 A;  3GQZ A;  3NDE A;  3WRT A;  3C4O A;  1VQQ A;  2RCX A;  3LCE A;  4Y7P A;  1RGY A;  3GTC A;  3HLF A;  1Z6F A;  5HFO A;  4ZDX A;  1XA1 A;  1OME A;  5FQI A;  3A3D A;  5HAR A;  4E3K A;  3GVB A;  4N1X A;  4OVD A;  3ZG7 B;  2GDN A;  1DJC A;  1GCE A;  2DNS A;  2XFS A;  3PAG A;  3PBR A;  4OQ0 A;  5E2G A;  5EVL A;  4GD8 A;  3ISG A;  4LV0 A;  3HBR A;  4E3M A;  3BM6 A;  2H5S A;  1XGI A;  3C5A A;  3HLC A;  5G18 A;  4K0W A;  1MWR A;  3RXX A;  2WAF A;  3BFE A;  1BUL A;  2HDQ A;  5EEC A;  2Y59 A;  1XA7 A;  4P85 A;  4PM6 A;  3NIA A;  4X56 A;  1RGZ A;  1W7F A;  1K6R A;  3A3F A;  1BSG A;  4GOG A;  3W4O A;  1JWZ A;  5GLA A;  1BT5 A;  4JXS A;  3ZDJ A;  1U60 A;  4RYE A;  4P87 A;  3A3I A;  3Q7V A;  1NYY A;  2QZ6 A;  3IH8 A;  3G2Z A;  4OQG A;  1BLC A;  4E3I A;  1SHV A;  3N6I A;  3VOZ A;  4OPZ A;  3BEC A;  5A91 A;  4QU3 A;  3ITB A;  5GHX A;  2FFF B;  1BLS A;  4ZJ1 A;  1KGG A;  2WKE A;  4S2N C;  5A90 A;  1YT4 A;  1GHM A;  4GNU A;  3HL9 A;  1E25 A;  1MY8 A;  1MWS A;  2VGK A;  4DXC A;  5FAO A;  4ZTK A;  1K56 D;  1MKI A;  2ZQ7 A;  1W5D A;  4R3J A;  1BLP A;  1K55 A;  3Q1F A;  3V50 A;  1L0G A;  2G2W A;  1IYO A;  4QY5 A;  2FFY A;  3A3E A;  4GZB A;  3PBS A;  2PU4 A;  4H8R A;  3ZCZ A;  4OON A;  2ZM2 A;  4KZ4 A;  3C7V A;  4MLL A;  1E4D A;  1O7E A;  3TSG A;  3ZG5 A;  5FI7 A;  2WZZ A;  3ZVW A;  4F94 A;  3HVF A;  5DTT A;  1ZC2 A;  3OPR A;  2ZC7 A;  5EOO A;  1PWD A;  1WYC A;  3GMW A;  1NZU A;  4FCF A;  4WMC A;  1HD8 A;  4E6W A;  5GL9 A;  1ZKJ A;  4M3K A;  1ERO A;  4A5R A;  3NI9 A;  5AQ9 A;  2Y2K A;  2WYX A;  3W4P A;  3BEB A;  2HP9 A;  2VGJ A;  1LI9 A;  1VM1 A;  3SS4 A;  4OPQ A;  4GB7 A;  3WWX A;  3WS1 A;  4R4R A;  3PAE A;  4O7D A;  1NXY A;  4QHC A;  1JWP A;  2UWX A;  4R3B A;  2WGI A;  4BLM A;  2HDS A;  4BJP A;  3V39 A;  3LY3 A;  4KQQ A;  1ESU A;  3MKE A;  4FH2 A;  4DXB A;  4MBK A;  2Y2O A;  2Y2L A;  5JYP A;  4N9L A;  3OC2 A;  2J9P A;  2ZJ9 A;  3MZF A;  4XUX A;  1QMF A;  3ZG0 A;  3VSL A;  1PWG A;  5M18 A;  4GKU A;  1YLT A;  3ZNY A;  4U0T A;  2XGN A;  1TEM A;  3SH9 A;  1L0F A;  5GHZ A;  1MWT A;  3LO7 A;  3BRM A;  4CJN A;  5BOH A;  5JYO A;  1FCM A;  1TVF A;  3N7W A;  4C3Q A;  1MBL A;  3MFD A;  3TOI A;  1YM1 A;  3G32 A;  2ZQC A;  2DRW A;  2V20 A;  3IHA A;  2RL3 A;  4JXW A;  4E3N A;  3WS2 A;  2XFT A;  2ZQ9 A;  1YMX A;  1NRF A;  3Q07 A;  4JKT A;  3HLE A;  5F1G A;  3EQV A;  1IYS A;  3VP1 A;  1E3U D; 
#chains in the Genus database with same CATH topology
 1HLU P;  1I2S A;  1S0W A;  4LCM A;  1QME A;  2V8C A;  1T1C A;  2G2U A;  2V2F F;  5AJG A;  3K2N A;  4BQM A;  4N92 A;  5F83 A;  3T4O A;  1P9W A;  3MR0 A;  1DJB A;  4L9G A;  1GSW A;  4D2O A;  2JKT I;  5DFX A;  2JKR M;  1LLB A;  5TGF A;  3IH9 A;  3RXW A;  4S2P A;  3UE0 A;  3OPH A;  1AXB A;  1N4O A;  3BY8 A;  4WBG A;  1NWZ A;  4CPK A;  4S2N A;  4GS9 A;  4E3J A;  2L0W A;  5FQK A;  3UMD A;  4NBI A;  3LGO A;  1ESI A;  4GS9 B;  4BL2 A;  3ZQ5 A;  3C38 A;  1FCN A;  4DKI A;  3A0R A;  4HOI A;  2X01 A;  1J7G A;  2R9X A;  5HDS A;  3UPO A;  1PFL A;  1CI8 A;  5HWV A;  3IXG A;  2QKP A;  1A0K A;  3E0Y A;  4ETZ A;  3V5M A;  3T1X A;  1H8Y A;  1ONG A;  3ZNT A;  1FOF A;  2EA9 A;  3EGX C;  4PKY A;  3WRZ A;  2JBF A;  5FEG A;  3WS5 A;  2Q0O A;  4K0X A;  4EEU A;  1FCO A;  4X1L A;  2PYR A;  4Y0T A;  3GSG A;  3UB7 A;  1M6K A;  4O01 A;  3TW8 A;  3O88 A;  1W79 A;  3CZD A;  1FSY A;  5J4E A;  3U4L P;  5CEC A;  4Q0H A;  4EBL A;  3PTE A;  3V67 A;  1N9B A;  3DBA A;  2ZLY A;  4KQO A;  2Z6C A;  3GRJ A;  2WKR A;  5FI6 A;  1ZTU A;  1L2S A;  3AGD A;  2H0T A;  5HDD A;  3M6B A;  1K56 A;  3V3S A;  1SKO A;  2XK1 A;  5FQM A;  1H5X A;  3CUE A;  3DW0 A;  5L8M A;  5F69 A;  4KZ3 A;  2C6W B;  4WEK A;  5U47 A;  2HL2 A;  4NBJ A;  3UY6 A;  3KYE A;  1OJG A;  1GA9 A;  4R0Q A;  2WKP A;  2WGW A;  2W1T B;  3OZH A;  5A8B A;  1XP4 A;  4EBN A;  3BFC A;  1UWN X;  3MXR A;  1N9N A;  4LV3 A;  4HBU A;  4N1H A;  2XF3 A;  4Y0O A;  1EI5 A;  1NRJ A;  4Z9Q A;  3MBZ A;  3FWL A;  3MJQ A;  3BFF A;  3I7J A;  4NXB A;  4X1M A;  1VET B;  2HDU A;  4S2M A;  4WZ5 C;  1F5M A;  1V9Y A;  3C4P A;  4UHU A;  4X25 A;  1K57 C;  4I3A A;  4R38 A;  3N8S A;  4R1G A;  3KOC A;  5DFY A;  1NLY A;  2QHK A;  4FD8 A;  2OLV A;  3E4Q A;  5AQA A;  1V9Z A;  5DVA A;  5A93 A;  1ES4 A;  1OTA A;  4BD0 A;  3HLW A;  1JNU A;  1T18 A;  3H82 A;  4KUK A;  1TDG A;  3BFG A;  4OP5 A;  5EVI A;  3DAV A;  3LYX A;  5FI2 A;  2EX6 A;  5DKK A;  4WZ4 A;  5EVI B;  2PBY A;  4RRA A;  4X53 A;  1YAX A;  5AQB A;  3UB8 A;  3IWQ A;  4GCZ A;  3EEH A;  4XUZ A;  4HES A;  5E43 A;  5EPH A;  3FKV A;  5FA7 A;  4I5S A;  2PAV P;  3HLD A;  2H28 A;  2JE5 A;  2Z2L B;  3T4T A;  1VB6 A;  4NK3 A;  1STZ A;  2K31 A;  2WGV A;  3TG9 A;  2Y2J A;  2ZC3 B;  1JVJ A;  3QNB A;  3HLB A;  4ID4 A;  1T19 A;  3OBF A;  5LBR A;  1XJ4 A;  1TS8 A;  3MZE A;  5CGX A;  3HRE A;  3RH8 B;  4LEN A;  2BG1 A;  2EWV A;  1NLZ A;  2V8F A;  2W1R A;  1L3L A;  1MC0 A;  4R3A A;  1RP5 A;  3UB5 P;  5CED A;  2A2L A;  2IWD A;  3T4S A;  2JC7 A;  1K54 A;  2M1C A;  2HL1 A;  5F68 A;  4DN0 A;  4KZ6 A;  2QJ5 A;  2XA7 M;  1EW0 A;  3PBO A;  3RTY A;  2VV6 A;  5EVE A;  5KIZ A;  5EM0 A;  1PZP A;  4OOY A;  2ZBB A;  2DMW A;  1ES2 A;  3ITA A;  3QP8 A;  3ICY A;  3NDG A;  1OPX A;  2AVX A;  1SDE A;  5HWT A;  1NZO A;  3KNF A;  3S7O A;  3T1S A;  1Q2Q A;  2A24 A;  3C4O A;  3LCE A;  1RGY A;  3F1P A;  5FQI A;  4E3K A;  3GVB A;  1GCE A;  2DNS A;  5EVL A;  4LV0 A;  3BFE A;  1CJF A;  1ODV A;  4X56 A;  5GLA A;  4LFU A;  1NYY A;  3T4L A;  3CI6 A;  2FFF B;  2WKE A;  4S2N C;  1GHM A;  3VE3 A;  2VGK A;  4DXC A;  5FAO A;  1K56 D;  3V50 A;  1L0G A;  4QY5 A;  4GZB A;  3PBS A;  2PU4 A;  3IX3 A;  4MLL A;  3ZG5 A;  3TSG A;  2WZZ A;  2G7U A;  5DTT A;  2ZC7 A;  3R7W B;  4RRG A;  4FCF A;  1WYC A;  4WMC A;  4E6W A;  3NI9 A;  5AQ9 A;  3KOB A;  1LI9 A;  1VM1 A;  4MN5 A;  4O7D A;  1JWP A;  2PT7 A;  4R3B A;  2W3E A;  4BLM A;  4BJP A;  4FH2 A;  2Y2O A;  1F2K A;  1J3W A;  3OC2 A;  4XUX A;  1QMF A;  2YKH A;  1PWG A;  3O5Y A;  3MQO A;  2XGN A;  3SH9 A;  4K08 A;  2E8J A;  3LO7 A;  3BRM A;  1OTB A;  3N7W A;  3G32 A;  2ZQC A;  5J61 A;  2V20 A;  2XFT A;  3KNP A;  1YMX A;  3IS2 A;  1LT0 A;  2Y2Q A;  2L4R A;  2DCF A;  1G6A A;  3VP3 A;  3NCK A;  3IS2 B;  4BBV A;  4GD6 A;  4GW9 A;  3NOP C;  4UA6 A;  3KSG A;  1XGJ A;  3CMZ A;  4PHT A;  1YLW A;  4DF6 A;  4QB8 A;  4JGR A;  3GV9 A;  3OPP A;  3E2L A;  5EVI D;  5D3O A;  4IUK A;  2VA0 A;  5FDS A;  1BLH A;  2ZQD A;  3H7W A;  1IKI A;  2PYP A;  4XT2 A;  4R6L A;  4ZAM A;  5KSH A;  3E4O A;  2HPB A;  3H7W B;  4N9K A;  2KDK A;  3NC8 A;  4XT2 B;  3DTI A;  3A0S A;  3GR2 A;  1K38 A;  4E3O A;  3IWO A;  3SH7 A;  3B3X A;  2XRO A;  3KO7 A;  3BLM A;  4JGO A;  1KVL A;  2O0Y A;  3E4P A;  2M7U A;  3D3O A;  4OQI A;  2WAE A;  1LL5 A;  1Z09 A;  3BY9 A;  4CLC A;  3PHY A;  1MWU A;  4P6Z S;  1G28 A;  1FIL A;  4JXV A;  3LEZ A;  2PD7 A;  3SZT A;  2XR0 A;  4CLC B;  3C7U A;  2ZOH A;  3ZG8 B;  2K7S A;  1PI5 A;  3MS6 A;  1KE0 A;  1N9O A;  4RR7 A;  4RX3 A;  3NOT C;  4X69 A;  4ESP A;  3QP2 A;  1X0O A;  3DTK A;  3PR6 A;  4LV1 A;  4JPM A;  4B88 A;  4FOF A;  3UE3 A;  2PBD P;  3SS3 A;  3OPL A;  5HPI A;  3IWI A;  4OQH A;  4EWF A;  2Q9N A;  3HJI A;  3M2K A;  1MPL A;  4EEP A;  4RRI A;  1ES3 A;  4RRH A;  2JHE A;  5DJU A;  3ZHH A;  4RA7 A;  4K91 A;  3B47 A;  3IHB A;  5CX7 A;  3IF6 B;  4MBF A;  2WKI A;  1JWV A;  1T1B A;  5EFW A;  3V3R A;  4OOL A;  5FQJ A;  2OAQ 1;  4RRJ A;  4NET A;  1HZO A;  3TE8 A;  5CGS A;  4ARZ B;  2OV5 A;  4P6B A;  3IXH A;  3VE4 A;  3PD3 A;  2W0N A;  3UN7 A;  3KO6 A;  5AVE A;  3RJU A;  3QP6 A;  3O87 A;  3C2W A;  3LR3 A;  4NG2 A;  4DJ3 A;  1PNE A;  5A92 A;  2NUT C;  4R4S A;  1K54 C;  1VEU B;  4B4Z A;  3DWZ A;  3MMH A;  3CLO A;  3PD2 A;  1E3U A;  1ERQ A;  5M1A A;  2WKH A;  5E2E A;  2OWH A;  1PW1 A;  1I2W A;  2L1M A;  4WMC D;  4PPR A;  4U3T A;  4IJG A;  5HL1 A;  2QJ7 A;  3EWK A;  4JF5 A;  2JCH A;  4FTX A;  3D4F A;  2Y55 A;  3HCY A;  1CEG A;  3KYZ A;  5IU1 A;  2J8Y A;  4X6T A;  4IBR A;  4GHI B;  1UWP X;  3CG5 A;  1EWZ A;  3EOI A;  1D7E A;  1K25 A;  4KG2 A;  5KZH A;  5IT5 A;  3PBN A;  4MDZ A;  2HDR A;  3CJM A;  3LEQ A;  2OSU A;  4EU0 A;  4MN7 A;  1GA0 A;  1OTD A;  4HJ3 A;  2W3H A;  5CGW A;  1MXO A;  1TS7 A;  1W8Y A;  4LRX C;  3BQ8 A;  3UDF A;  2X02 A;  3T4Q A;  1YQS A;  3FPV A;  1TS0 A;  3E2K A;  2ZQ8 A;  3IX8 A;  2EX9 A;  5HAQ A;  2WKQ A;  4JBF A;  4E6X A;  3FKW A;  4B93 A;  2P08 A;  3D9Y A;  4NEE D;  5KMW A;  1TDL A;  2ZMA A;  3LI9 A;  3KSH A;  2VZW A;  3FV7 A;  1H8Z A;  2EFU A;  3GDI A;  5HAI A;  1YSQ A;  4RX2 A;  4HP9 A;  1IYP A;  3CPT B;  5HZH A;  4GDB A;  2HGV A;  2W1T A;  2PHY A;  3KOD A;  4RRQ A;  3FC7 A;  2EFX A;  4WF0 A;  5FAS A;  5HW3 A;  2V1Z A;  4LV2 A;  5HX9 A;  2EX8 A;  4EES A;  2Y8H A;  3W2Z A;  3P01 A;  3AGE A;  3LIE A;  5EE8 A;  1VET A;  4KG6 A;  4EV4 A;  3QP4 A;  1IEM A;  4II7 A;  2ZM0 A;  3IXD A;  3S1Y A;  1O07 A;  3NDE A;  4CLC D;  2RCX A;  4Y7P A;  3MQQ A;  4PKY G;  5HAR A;  2KLI A;  3ZG7 B;  2GDN A;  2XFS A;  5E2G A;  1LSX A;  3LIC A;  3KSI A;  3HBR A;  3BM6 A;  3CHW P;  1XJ3 A;  1XGI A;  3HLC A;  4K0W A;  3MF0 A;  2Y59 A;  4NXG A;  3NIA A;  4HNB A;  4HY8 A;  1W7F A;  3W4O A;  3ZDJ A;  2J80 A;  4RYE A;  4P87 A;  3A3I A;  2QZ6 A;  3G2Z A;  1BLC A;  4YNR A;  4S02 A;  5A91 A;  3LMV A;  5GHX A;  3ITB A;  2BAS A;  4ZJ1 A;  4GNU A;  1E25 A;  2HL0 A;  1LSV A;  1W5D A;  1K55 A;  3ZCZ A;  3A3E A;  4H8R A;  4UQI M;  2ZM2 A;  1E4D A;  1O7E A;  4S0L A;  4F94 A;  1ZC2 A;  1HD8 A;  1OT9 A;  4GLQ A;  1ERO A;  4BWI A;  3W4P A;  5L10 A;  2HP9 A;  2VGJ A;  3SS4 A;  2JKT M;  3WWX A;  2V1B A;  4R4R A;  3PAE A;  2WGI A;  2HDS A;  3V39 A;  2J3W A;  5HD5 A;  2Y2L A;  2VKS A;  1G5U A;  3ZG0 A;  3JVV A;  5FL3 A;  1P97 A;  4O8G A;  5EM1 A;  2GX5 A;  4AFI A;  4LLO B;  1L0F A;  1XJ6 A;  1TVF A;  1YM1 A;  2DRW A;  2RL3 A;  3LID A;  3Q07 A;  4Z1W A;  1Y2Q A;  5F1G A;  1E3U D;  1ERM A;  4Q0I A;  4PM7 A;  1H0M A;  3BW6 A;  4EUV A;  4KG5 A;  3C30 A;  3HUM A;  2NUP C;  3PD4 A;  2PD8 A;  5FSR A;  2WUQ A;  4S0K A;  4DE3 A;  5CRF A;  3F1O A;  3S7P A;  2Z2M B;  3VV4 A;  1FR1 A;  2CMN A;  4HHD A;  5I5L A;  2Y2P A;  3N4I A;  3HUO A;  1DP8 A;  2IWC A;  1IEL A;  3F1O B;  2R9W A;  2EX2 A;  1KDW A;  1ZG6 A;  1S67 L;  3DTM A;  4NXF A;  1KE3 A;  4DMZ A;  2ZD8 A;  4JF6 A;  4FH4 A;  1XKZ A;  4OPR A;  5HD3 A;  5MC7 A;  1LL8 A;  2BLS A;  2R78 A;  3KX0 X;  2YKF A;  2IWB A;  4KZ9 A;  2VEA A;  4S2I A;  1KGE A;  4LGW A;  1IYQ A;  3P09 A;  3S4X A;  1KE4 A;  1JTG A;  3NJA A;  3LIA A;  2PR5 A;  2XD5 A;  2Q9M A;  3B33 A;  4UEY A;  4GJ4 A;  1CI9 A;  3U2A A;  2W3D A;  2HZ5 A;  2JKR I;  4Y15 A;  3EQU A;  3Q81 A;  4DDS A;  1NJ4 A;  1CF0 A;  3R7W A;  1G68 A;  2XQZ A;  3PYP A;  4RRB A;  3KYQ A;  3UDX A;  5G4Y A;  5HAP A;  4KQR A;  4WM9 A;  3RFB A;  1XPB A;  2XH9 A;  4IBX A;  5FEF A;  2XA7 S;  3N8R A;  4Q8I A;  1DRM A;  3WS0 A;  3L9K A;  3UNW A;  5K5B A;  1FSW A;  4BD1 A;  2WK0 A;  1L0E A;  4DE2 A;  1S66 L;  4X55 A;  5CEB A;  3SOI A;  5GLC A;  2ZC4 B;  2P74 A;  4OPY A;  3NBL A;  1VHM A;  4L9E A;  4BMW A;  2QMI A;  4BBU A;  2UV0 E;  4JF4 A;  1PZO A;  4JGP A;  1ES5 A;  4OP8 A;  4EXO A;  3VOL A;  2LB9 A;  4DRT A;  5E2H A;  1TC5 A;  4HIA A;  1ZHH B;  3K3D A;  4WZ5 A;  3L7H A;  2ZOI A;  4WEL A;  3IBJ A;  2OOL A;  2W27 A;  1S6R A;  1RCJ A;  3OCN A;  1W8Q A;  3ZFZ A;  2A49 A;  3IQA A;  2Y2I A;  2P9V B;  1PYY A;  1GSX A;  4L0L A;  2H0Y A;  4S03 A;  2QPN A;  3QNC A;  3CWF A;  1LI0 A;  3PBT A;  3CUE C;  4ZJ2 A;  1NY0 A;  2B5R A;  3S22 A;  3NY4 A;  4OKP A;  1KVM A;  1YSP A;  5CHU A;  3VP4 A;  3MFX A;  5FQ9 A;  1PW8 A;  4KUO A;  2CC1 A;  2OKV A;  4S2J A;  4S2L A;  3LMU A;  3KO5 A;  1YLP A;  3QHY A;  3UME A;  2GNX A;  3IT9 A;  3LMT A;  4PAU A;  4U0X A;  1UGU A;  4DE1 A;  3F1N B;  3Q7Z A;  1BYW A;  3O3V A;  2VJW A;  4YIN A;  5F82 A;  1ALQ A;  1BZA A;  2EXB A;  2VGL M;  3NOU C;  5G4Z A;  2INW A;  2OLU A;  4RR8 A;  3G31 A;  2HP6 A;  4OLD A;  3LUQ A;  4HQA A;  3VOY A;  1WYB A;  4RR9 A;  1P0Z A;  3H9W A;  4YFM A;  5HPF A;  3UPP A;  4CLC E;  4S2O A;  3UO9 A;  4RVA A;  1L0D A;  4XXR A;  3Q7V B;  1XX2 A;  1G6O A;  2VK3 A;  4H6J A;  3PD5 A;  2XSS A;  3O86 A;  3K3C A;  3S7N A;  4H6J B;  4EER A;  2V9A A;  3PBQ A;  4Y0U A;  5DTS A;  4KZ8 A;  5FAT A;  2O9C A;  2XEP A;  5EVI C;  1K4F A;  3W8K A;  1BUE A;  1C3B A;  4GDN A;  2EWW A;  3CIT A;  2E8I A;  4KQD A;  3HLG A;  3FG8 A;  5TJJ A;  4EQ1 A;  2XD1 A;  4MN6 A;  4P0M A;  2ZMV A;  3IF6 A;  1K55 C;  4C75 A;  2ZC6 B;  4RRK A;  3JYI A;  4DE0 A;  3FPW A;  2PRF A;  4UAA A;  3SS5 A;  5HSQ A;  3OLO A;  5TR7 A;  4ZBE A;  5L2F A;  4ARZ A;  1OTI A;  2P04 A;  4S0J A;  3ULF A;  1Y54 A;  1YMS A;  3UPN A;  3LR0 A;  4OLG A;  3ZVT A;  2LB5 A;  1W63 M;  2Y2N A;  4O0P A;  5M19 A;  2VGL S;  4EBP A;  1H8M A;  3N8L A;  4E3L A;  1XXM A;  5J7E A;  3VFH A;  1VEU A;  3IX4 A;  4MNR A;  3M6H A;  4YWZ A;  1WE4 A;  3EGD C;  2ZQA A;  3VP0 A;  3WRT A;  2O9A A;  3DTE A;  1VQQ A;  5DKL A;  3HLF A;  4QWO A;  4WUJ A;  1PRQ A;  4ZDX A;  1XA1 A;  1OME A;  3A3D A;  1DJC A;  3OOV A;  4GD8 A;  4E3M A;  2H5S A;  3C5A A;  1OT6 A;  2FZ0 A;  3G6O A;  2WAF A;  4GHI A;  1BUL A;  2HDQ A;  5EEC A;  1F9I A;  2IA2 A;  1RGZ A;  3A3F A;  4GOG A;  1IFQ A;  1BT5 A;  2HJ9 C;  1U60 A;  1H3Q A;  3IH8 A;  4E3I A;  1DP6 A;  3VOZ A;  4I3J A;  3T1Q B;  4QU3 A;  4E04 A;  1BLS A;  5EV0 A;  1P9R A;  3LR5 A;  3UB6 A;  3HL9 A;  1YPR A;  4ZTK A;  1MKI A;  3Q1F A;  1OJ5 A;  2G2W A;  1IYO A;  3KSF A;  4JGQ A;  4OON A;  3C7V A;  4HJ6 A;  3NUL A;  3QP1 A;  5EOO A;  1PWD A;  3T4J A;  1NZU A;  2OAP 1;  2O99 A;  4A5R A;  3UE6 A;  2Y2K A;  2WYX A;  3A0V A;  4OPQ A;  2VX8 A;  2V1A A;  3WS1 A;  4QHC A;  3SW1 A;  4RRF A;  3BJN A;  3C8C A;  2KOI A;  4WL9 A;  5JYP A;  4N9L A;  1Y4O A;  3VSL A;  4G3K A;  3CPT A;  3BWL A;  5M18 A;  3ZNY A;  4U0T A;  4R70 A;  1MKM A;  5HDC A;  4CJN A;  1W63 Q;  5BOH A;  5JYO A;  4C3Q A;  1MBL A;  3T4K A;  2QYB A;  3TOI A;  3IHA A;  4JXW A;  3WS2 A;  1NRF A;  2PR6 A;  3GEC A;  4JKT A;  2M7V A;  1S4S A;  3EQV A;  1SKO B;  4OOM A;  5HWW A;  1Y28 A;  3G2Y A;  4HBT A;  2W3F A;  3VP2 A;  5J8X A;  4EQI A;  1FR6 A;  1PWC A;  5F1F A;  4R23 A;  1ACF A;  4NXE A;  1K6S A;  3IBR A;  4ETX A;  1FQG A;  3FZC A;  3NHQ A;  1CQA A;  1LSW A;  4WN5 A;  5GHY A;  4ZJ3 A;  4S2K A;  1KDS A;  2WGW B;  3BQA A;  2P7J A;  5CTM A;  3G34 A;  4QY6 A;  3E98 A;  5I94 A;  4YOF A;  3VMA A;  2PDR A;  1SCW A;  4KZA A;  1K0K A;  3ZGA B;  4IVI A;  2PU2 A;  3D72 A;  3FYZ A;  3IF5 A;  3M2J A;  2QWS A;  1J9M A;  3T12 B;  4I3I A;  4GN2 A;  1M40 A;  1D06 A;  4EUZ A;  1SKF A;  2X71 A;  1T1A A;  5FAQ A;  4BBT A;  3DWK A;  3T1R A;  3P98 A;  4JXG A;  1N9L A;  4FUW A;  1I5Q A;  5TBM A;  2XRN A;  3MQ0 A;  3TRC A;  2HJE A;  4UA9 A;  5FDH A;  4B9O A;  3H82 B;  4IVK A;  5E2F A;  4IHQ A;  5TBM B;  2WZX A;  1PIO A;  4OH0 A;  4B4X A;  4FSF A;  5L07 A;  1AWI A;  4RRC A;  1XJ2 A;  4Q0J A;  3W4Q A;  2Y4A A;  2Y2G A;  4JLF A;  2J9O A;  5IHV A;  3T50 A;  1KGF A;  1CK3 A;  3MXQ A;  4IED A;  4CLC C;  3S7Q A;  3HJK A;  2ZC5 B;  3LR4 A;  5F6A A;  2K2N A;  3VSK A;  4PM9 A;  4MEZ A;  1D1J A;  4KZB A;  1JKE A;  3P7N A;  5EOE A;  1DJA A;  4BL3 A;  4EW7 A;  2MJ6 A;  2OWJ A;  4WYY A;  3ZYT A;  1GHP A;  1XFN A;  2J3T D;  1S1Y A;  1YLY A;  1YKD A;  2JKF A;  3BLS A;  1ZG4 A;  2ACG A;  4Y5F A;  4X68 A;  1DY6 A;  2C5W B;  3VFF A;  4QPR A;  3MSH A;  3QP5 A;  2D02 A;  2JN7 A;  2ZM8 A;  5DF7 A;  4UA7 A;  1GHI A;  3MKF A;  1HTZ A;  4PM5 A;  2VV8 A;  4BEN A;  2FH5 A;  5EUA A;  3TJZ C;  1HVB A;  5L09 A;  4HEF A;  3IF6 C;  5AVF A;  5FQQ A;  3UB9 A;  1DP9 A;  4I38 A;  4C6Y A;  1ONH A;  5AQ7 A;  4UQI S;  3G30 A;  4Y17 A;  3OCL A;  4EET B;  5GLD A;  3G35 A;  4PM8 A;  2A3U A;  4F3L A;  4IUH A;  1MZU A;  1S1Z A;  3A3J A;  5KSC A;  3KO4 A;  4NKP A;  2A24 B;  4L9F A;  2HKZ A;  4F3L B;  5FAP A;  5F5Y A;  2Y91 A;  1YLJ A;  4HH2 A;  3F1P B;  2B95 A;  3B42 A;  1YLZ A;  2D01 A;  3MXS A;  1LL9 A;  4MBH A;  1Q2P A;  2VV7 A;  3G4P A;  2WAD A;  3PXP A;  5DF8 A;  3UDI A;  4LRZ E;  1PI4 A;  2H10 A;  1S4R A;  3KO3 A;  2HV1 A;  2J3T C;  3Q82 A;  4RRD A;  1TS6 A;  2B02 A;  2XLN A;  3UE1 A;  2XDM A;  5TFQ A;  5CHJ A;  2V0U A;  5DF9 A;  5DJT A;  2EXA A;  3LY4 A;  4QD4 A;  3WS4 A;  4MMN A;  3ZG9 B;  4LCL A;  3IXB A;  5DTK A;  5CXW A;  1SDN A;  4KZ7 A;  3LFV A;  4HH3 A;  1TF1 A;  5GLB A;  3HUN A;  3JPU A;  4LPZ A;  3AGF A;  1JTD A;  4DJ2 A;  1IKG A;  3SH8 A;  4Y2F A;  1K4E A;  2Y2H A;  2I9V A;  3BYD A;  2GJ3 A;  1BTL A;  4QJG A;  4RRM A;  1NYM A;  4P6Z M;  5CTN A;  3MZD A;  2I72 A;  2J7V A;  4G3V A;  2P9V A;  3NEC A;  1K57 A;  1LHY A;  4KEN B;  4KZ5 A;  3CAX A;  2HP5 A;  5CHM A;  4WEJ A;  3BFD A;  5CER A;  1TD5 A;  2Y2M A;  4RRR A;  4HJ4 A;  5IS1 A;  1CEF A;  4DDY A;  3LIB A;  4HP4 A;  4RR6 A;  4Y13 A;  4S0I A;  4PMA A;  3GQZ A;  5HL6 A;  5J3W A;  3GTC A;  4I39 A;  4D60 A;  1Z6F A;  5HFO A;  3F1N A;  4LRY C;  4N1X A;  4OVD A;  1IOU A;  3PAG A;  4OQ0 A;  3PBR A;  2DBO A;  3ISG A;  5G18 A;  4ZRR A;  1MWR A;  3RXX A;  1XA7 A;  4P85 A;  4PM6 A;  1KOU A;  4WLA A;  1K6R A;  1BSG A;  1JWZ A;  4JXS A;  1WA9 A;  2BTF P;  3Q7V A;  1FIK A;  4OQG A;  1SHV A;  3N6I A;  2KX6 A;  4OPZ A;  3BEC A;  4RQ9 A;  2ZMF A;  1KGG A;  5A90 A;  1YT4 A;  2Y79 A;  1MY8 A;  1MWS A;  2Z6D A;  2ZQ7 A;  4R3J A;  1BLP A;  2W3G A;  5C5K A;  3JVU A;  4MCW A;  2FFY A;  4KZ4 A;  3LI8 A;  1XFQ A;  5FI7 A;  3ZVW A;  3HVF A;  3OPR A;  1GSV A;  3GMW A;  5GL9 A;  1ZKJ A;  4M3K A;  4CQH A;  1SZV A;  2GZA A;  3BEB A;  3EEA A;  2O9B A;  4GB7 A;  1NXY A;  4HI4 A;  2UWX A;  3LIF A;  2B18 A;  3LY3 A;  4KQQ A;  1ESU A;  3MKE A;  4DXB A;  3KO9 A;  4MBK A;  1F98 A;  2JKG A;  1OTE A;  2J9P A;  2ZJ9 A;  3MZF A;  4ME4 A;  2V0W A;  4GKU A;  1YLT A;  1TEM A;  4Y3I A;  4M4X A;  5GHZ A;  1MWT A;  4RRL A;  1FCM A;  2ZL1 A;  3R4K A;  3MFD A;  2HF6 A;  4E3N A;  2ZQ9 A;  2VLG A;  3HLE A;  2ZL1 B;  4G3W A;  1IYS A;  3VP1 A; 
#chains in the Genus database with same CATH homology
 1ERM A;  2Y2Q A;  1I2S A;  1S0W A;  4LCM A;  4OOM A;  2DCF A;  1G6A A;  1QME A;  4PM7 A;  2V2F F;  2G2U A;  3VP3 A;  3NCK A;  4BQM A;  4GD6 A;  4N92 A;  4KG5 A;  5F83 A;  3HUM A;  1DJB A;  3PD4 A;  3G2Y A;  4HBT A;  4D2O A;  4UA6 A;  5FSR A;  3VP2 A;  5J8X A;  4EQI A;  2WUQ A;  4S0K A;  4DE3 A;  1FR6 A;  5CRF A;  1LLB A;  1PWC A;  1XGJ A;  3CMZ A;  5TGF A;  5F1F A;  1YLW A;  2Z2M B;  4R23 A;  4DF6 A;  1K6S A;  3IH9 A;  3RXW A;  4QB8 A;  4S2P A;  1FQG A;  1FR1 A;  3UE0 A;  3FZC A;  3GV9 A;  1AXB A;  1N4O A;  2Y2P A;  3E2L A;  3OPP A;  3OPH A;  4WBG A;  5EVI D;  3N4I A;  3HUO A;  5D3O A;  5GHY A;  4CPK A;  2IWC A;  1IEL A;  4S2N A;  4ZJ3 A;  2R9W A;  4S2K A;  2EX2 A;  1KDS A;  2WGW B;  1KDW A;  4E3J A;  1BLH A;  1ZG6 A;  3G34 A;  4QY6 A;  2ZQD A;  5CTM A;  5FQK A;  4NBI A;  3DTM A;  1KE3 A;  1IKI A;  2ZD8 A;  5I94 A;  1ESI A;  4JF6 A;  4FH4 A;  1XKZ A;  4OPR A;  3VMA A;  4ZAM A;  5KSH A;  4BL2 A;  2HPB A;  1SCW A;  4KZA A;  4N9K A;  3NC8 A;  2BLS A;  1FCN A;  2IWB A;  4DKI A;  3ZGA B;  4IVI A;  4KZ9 A;  2PU2 A;  4S2I A;  1KGE A;  2X01 A;  1J7G A;  3GR2 A;  3FYZ A;  1K38 A;  2R9X A;  1IYQ A;  3P09 A;  3S4X A;  3IF5 A;  4E3O A;  1KE4 A;  3M2J A;  3UPO A;  1JTG A;  1CI8 A;  3IXG A;  1J9M A;  3IWO A;  3SH7 A;  4GN2 A;  1M40 A;  2XD5 A;  3V5M A;  3B3X A;  2Q9M A;  4EUZ A;  1H8Y A;  1ONG A;  1SKF A;  2X71 A;  1FOF A;  3BLM A;  3ZNT A;  3KO7 A;  1CI9 A;  5FAQ A;  3WRZ A;  1KVL A;  2JBF A;  3DWK A;  3WS5 A;  3P98 A;  4JXG A;  3EQU A;  4K0X A;  3Q81 A;  2WAE A;  1NJ4 A;  4OQI A;  1I5Q A;  4DDS A;  1G68 A;  1LL5 A;  1FCO A;  4UA9 A;  2XQZ A;  5FDH A;  1MWU A;  4Y0T A;  4RRB A;  3GSG A;  3UDX A;  4IVK A;  5HAP A;  4KQR A;  4JXV A;  5E2F A;  3LEZ A;  4WM9 A;  2WZX A;  1PIO A;  4OH0 A;  1M6K A;  2XR0 A;  1XPB A;  2XH9 A;  4B4X A;  4IBX A;  3C7U A;  3O88 A;  1W79 A;  3CZD A;  3N8R A;  4FSF A;  3ZG8 B;  1FSY A;  4Q8I A;  3WS0 A;  1PI5 A;  1KE0 A;  3UNW A;  4RRC A;  5CEC A;  3W4Q A;  2Y4A A;  4RX3 A;  1FSW A;  4RR7 A;  4BD1 A;  2WK0 A;  2Y2G A;  4X69 A;  4JLF A;  4EBL A;  1L0E A;  2J9O A;  4DE2 A;  3PTE A;  5IHV A;  1KGF A;  4X55 A;  5CEB A;  1N9B A;  2ZLY A;  4KQO A;  1CK3 A;  3GRJ A;  3SOI A;  4LV1 A;  5GLC A;  4IED A;  4JPM A;  5FI6 A;  4B88 A;  3UE3 A;  2ZC4 B;  2P74 A;  4OPY A;  1L2S A;  3SS3 A;  3NBL A;  3AGD A;  2H0T A;  2ZC5 B;  3OPL A;  3VSK A;  4PM9 A;  4MEZ A;  3M6B A;  3IWI A;  4OQH A;  2QMI A;  4KZB A;  4EWF A;  1JKE A;  2Q9N A;  4JF4 A;  3M2K A;  5EOE A;  1MPL A;  1K56 A;  1PZO A;  1DJA A;  3V3S A;  4BL3 A;  1ES5 A;  2XK1 A;  4OP8 A;  5FQM A;  4WYY A;  4RRI A;  1H5X A;  1ES3 A;  4RRH A;  1GHP A;  4DRT A;  3DW0 A;  3ZHH A;  4RA7 A;  4K91 A;  5E2H A;  1YLY A;  3IHB A;  3IF6 B;  4KZ3 A;  1TC5 A;  2C6W B;  4WEK A;  4MBF A;  2WKI A;  3BLS A;  1ZG4 A;  5U47 A;  1JWV A;  2HL2 A;  4X68 A;  1DY6 A;  2C5W B;  4NBJ A;  4WZ5 A;  3VFF A;  3UY6 A;  4WEL A;  2ZM8 A;  3V3R A;  5DF7 A;  4OOL A;  1GHI A;  1GA9 A;  4R0Q A;  4UA7 A;  5FQJ A;  4RRJ A;  3MKF A;  1HTZ A;  4NET A;  1HZO A;  4PM5 A;  5CGS A;  1S6R A;  1RCJ A;  2WGW A;  4BEN A;  3OCN A;  5EUA A;  2OV5 A;  1W8Q A;  3IXH A;  4P6B A;  3ZFZ A;  1HVB A;  2A49 A;  3IQA A;  2Y2I A;  2P9V B;  1PYY A;  3OZH A;  4L0L A;  2H0Y A;  1XP4 A;  4HEF A;  3PD3 A;  4S03 A;  4EBN A;  3BFC A;  2QPN A;  3IF6 C;  3QNC A;  3MXR A;  4LV3 A;  3PBT A;  1LI0 A;  5FQQ A;  4ZJ2 A;  1NY0 A;  3UN7 A;  2B5R A;  4HBU A;  2XF3 A;  1ONH A;  1EI5 A;  3NY4 A;  4N1H A;  4Y0O A;  3RJU A;  5AQ7 A;  3S22 A;  4C6Y A;  3O87 A;  4Z9Q A;  4OKP A;  3G30 A;  3MBZ A;  3FWL A;  1KVM A;  3BFF A;  3OCL A;  3I7J A;  5A92 A;  5CHU A;  5GLD A;  3G35 A;  4R4S A;  2HDU A;  4PM8 A;  3VP4 A;  4S2M A;  1K54 C;  2A3U A;  4B4Z A;  4WZ5 C;  3DWZ A;  3C4P A;  5FQ9 A;  1PW8 A;  3PD2 A;  3A3J A;  4UHU A;  1E3U A;  1K57 C;  1ERQ A;  5M1A A;  5KSC A;  2CC1 A;  2WKH A;  2OKV A;  3KO4 A;  4S2J A;  5E2E A;  1PW1 A;  1I2W A;  4S2L A;  4WMC D;  3N8S A;  4PPR A;  4U3T A;  5HL1 A;  2HKZ A;  1YLP A;  3KO5 A;  3QHY A;  5FAP A;  3IT9 A;  3LMT A;  4R1G A;  4U0X A;  2Y91 A;  3KOC A;  4JF5 A;  1YLJ A;  2JCH A;  4FD8 A;  5AQA A;  2OLV A;  4DE1 A;  5DVA A;  3D4F A;  3Q7Z A;  5A93 A;  2Y55 A;  1ES4 A;  1CEG A;  3O3V A;  1YLZ A;  4BD0 A;  3MXS A;  1LL9 A;  3HLW A;  2J8Y A;  4MBH A;  4YIN A;  5F82 A;  1BZA A;  1ALQ A;  1Q2P A;  3G4P A;  2EXB A;  4X6T A;  1TDG A;  4IBR A;  2OLU A;  3BFG A;  4OP5 A;  2WAD A;  4RR8 A;  5EVI A;  3G31 A;  2HP6 A;  4OLD A;  5FI2 A;  3CG5 A;  3VOY A;  1EWZ A;  5DF8 A;  3UDI A;  1WYB A;  4RR9 A;  2EX6 A;  1PI4 A;  2H10 A;  4YFM A;  3KO3 A;  1K25 A;  4KG2 A;  3UPP A;  5KZH A;  4WZ4 A;  5EVI B;  2PBY A;  4S2O A;  3PBN A;  4RVA A;  1L0D A;  3UO9 A;  4XXR A;  4RRA A;  3Q7V B;  3Q82 A;  4X53 A;  1XX2 A;  4RRD A;  2HDR A;  5AQB A;  3CJM A;  3IWQ A;  4XUZ A;  4HES A;  5E43 A;  2OSU A;  3PD5 A;  5EPH A;  2XLN A;  3O86 A;  3UE1 A;  2XDM A;  5TFQ A;  3FKV A;  5CHJ A;  1GA0 A;  5FA7 A;  5DF9 A;  5CGW A;  1MXO A;  1W8Y A;  2EXA A;  3LY4 A;  3PBQ A;  4Y0U A;  3HLD A;  3UDF A;  2X02 A;  4QD4 A;  5DTS A;  4KZ8 A;  5FAT A;  2JE5 A;  3WS4 A;  2XEP A;  2Z2L B;  4LCL A;  3ZG9 B;  3IXB A;  5EVI C;  1K4F A;  1YQS A;  3E2K A;  4NK3 A;  2WGV A;  5DTK A;  5CXW A;  1BUE A;  1C3B A;  1SDN A;  4GDN A;  3TG9 A;  3W8K A;  2Y2J A;  2ZC3 B;  1JVJ A;  3QNB A;  2ZQ8 A;  3HLB A;  4KZ7 A;  2EX9 A;  2E8I A;  5HAQ A;  4JBF A;  4ID4 A;  3HLG A;  4E6X A;  5GLB A;  3FKW A;  3HUN A;  3AGF A;  5KMW A;  2XD1 A;  4P0M A;  1TDL A;  2ZMA A;  3IF6 A;  1JTD A;  1K55 C;  1IKG A;  5CGX A;  3MZE A;  3SH8 A;  4C75 A;  3HRE A;  2ZC6 B;  4RRK A;  1K4E A;  2Y2H A;  3BYD A;  3JYI A;  2BG1 A;  4LEN A;  4DE0 A;  1BTL A;  3FV7 A;  1H8Z A;  2EFU A;  5HAI A;  4QJG A;  4UAA A;  3SS5 A;  5TR7 A;  4RX2 A;  4RRM A;  1RP5 A;  5CED A;  1NYM A;  4ZBE A;  1IYP A;  2IWD A;  2JC7 A;  1K54 A;  5CTN A;  5L2F A;  4GDB A;  2HL1 A;  3MZD A;  2I72 A;  2J7V A;  2P9V A;  4KZ6 A;  1K57 A;  3KOD A;  4RRQ A;  3PBO A;  1LHY A;  4S0J A;  4KEN B;  2EFX A;  5FAS A;  4KZ5 A;  3LMU A;  1Y54 A;  2HP5 A;  1YMS A;  3UPN A;  5CHM A;  4OLG A;  3ZVT A;  4WEJ A;  5HW3 A;  2V1Z A;  3BFD A;  4LV2 A;  5HX9 A;  5CER A;  1PZP A;  2EX8 A;  2Y2M A;  2Y2N A;  4OOY A;  4RRR A;  5M19 A;  4EBP A;  4E3L A;  3N8L A;  1ES2 A;  1XXM A;  3AGE A;  1CEF A;  3ITA A;  5EE8 A;  3VFH A;  4KG6 A;  4DDY A;  4MNR A;  4EV4 A;  3NDG A;  1IEM A;  4RR6 A;  1SDE A;  2ZM0 A;  3M6H A;  1NZO A;  3KNF A;  3IXD A;  1WE4 A;  3S1Y A;  1O07 A;  2ZQA A;  4S0I A;  4PMA A;  1Q2Q A;  3VP0 A;  3GQZ A;  3NDE A;  3WRT A;  3C4O A;  1VQQ A;  2RCX A;  3LCE A;  4Y7P A;  1RGY A;  3GTC A;  3HLF A;  1Z6F A;  5HFO A;  4ZDX A;  1XA1 A;  1OME A;  5FQI A;  3A3D A;  5HAR A;  4E3K A;  3GVB A;  4N1X A;  4OVD A;  3ZG7 B;  2GDN A;  1DJC A;  1GCE A;  2DNS A;  2XFS A;  3PAG A;  3PBR A;  4OQ0 A;  5E2G A;  5EVL A;  2DBO A;  4GD8 A;  3ISG A;  4LV0 A;  3HBR A;  4E3M A;  3BM6 A;  2H5S A;  1XGI A;  3C5A A;  3HLC A;  5G18 A;  4K0W A;  1MWR A;  3RXX A;  2WAF A;  3BFE A;  1BUL A;  2HDQ A;  5EEC A;  2Y59 A;  1XA7 A;  4P85 A;  4PM6 A;  3NIA A;  4X56 A;  1RGZ A;  1W7F A;  1K6R A;  3A3F A;  1BSG A;  4GOG A;  3W4O A;  1JWZ A;  5GLA A;  1BT5 A;  4JXS A;  3ZDJ A;  1U60 A;  4RYE A;  4P87 A;  3A3I A;  3Q7V A;  1NYY A;  2QZ6 A;  3IH8 A;  3G2Z A;  4OQG A;  1BLC A;  4E3I A;  1SHV A;  3N6I A;  3VOZ A;  4OPZ A;  3BEC A;  5A91 A;  3LMV A;  4S02 A;  4QU3 A;  3ITB A;  5GHX A;  2FFF B;  1BLS A;  4ZJ1 A;  1KGG A;  2WKE A;  4S2N C;  5A90 A;  1YT4 A;  1GHM A;  4GNU A;  3HL9 A;  1E25 A;  2HL0 A;  1MY8 A;  1MWS A;  2VGK A;  4DXC A;  5FAO A;  4ZTK A;  1K56 D;  1MKI A;  2ZQ7 A;  1W5D A;  4R3J A;  1BLP A;  1K55 A;  3Q1F A;  3V50 A;  1L0G A;  2G2W A;  1IYO A;  4QY5 A;  2FFY A;  3A3E A;  4GZB A;  3PBS A;  2PU4 A;  4H8R A;  3ZCZ A;  4OON A;  2ZM2 A;  4KZ4 A;  3C7V A;  4MLL A;  1E4D A;  1O7E A;  3TSG A;  3ZG5 A;  4S0L A;  5FI7 A;  2WZZ A;  3ZVW A;  4F94 A;  3HVF A;  5DTT A;  1ZC2 A;  3OPR A;  2ZC7 A;  5EOO A;  4RRG A;  1PWD A;  1WYC A;  3GMW A;  1NZU A;  4FCF A;  4WMC A;  1HD8 A;  4E6W A;  5GL9 A;  1ZKJ A;  4M3K A;  1ERO A;  4A5R A;  3NI9 A;  5AQ9 A;  2Y2K A;  2WYX A;  3W4P A;  3BEB A;  3KOB A;  2HP9 A;  2VGJ A;  1LI9 A;  1VM1 A;  3SS4 A;  4OPQ A;  4GB7 A;  3WWX A;  3WS1 A;  4R4R A;  3PAE A;  4O7D A;  1NXY A;  4QHC A;  1JWP A;  2UWX A;  4R3B A;  4RRF A;  2WGI A;  4BLM A;  2HDS A;  4BJP A;  3V39 A;  3LY3 A;  4KQQ A;  1ESU A;  3MKE A;  4FH2 A;  4DXB A;  3KO9 A;  4MBK A;  2Y2O A;  2Y2L A;  5JYP A;  4N9L A;  3OC2 A;  2J9P A;  2ZJ9 A;  3MZF A;  4XUX A;  1QMF A;  3ZG0 A;  3VSL A;  1PWG A;  5M18 A;  4GKU A;  1YLT A;  3ZNY A;  4U0T A;  2XGN A;  1TEM A;  3SH9 A;  1L0F A;  5GHZ A;  1MWT A;  3LO7 A;  4RRL A;  3BRM A;  4CJN A;  5BOH A;  5JYO A;  1FCM A;  1TVF A;  3N7W A;  4C3Q A;  1MBL A;  3MFD A;  3TOI A;  1YM1 A;  3G32 A;  2ZQC A;  2DRW A;  2V20 A;  3IHA A;  2RL3 A;  4JXW A;  4E3N A;  5J61 A;  3WS2 A;  2XFT A;  2ZQ9 A;  3KNP A;  1YMX A;  1NRF A;  3Q07 A;  4JKT A;  3HLE A;  1Y2Q A;  5F1G A;  3EQV A;  1IYS A;  3VP1 A;  1E3U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...