5CEBA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus, k38m form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
401
structure length
387
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLAAISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
molecule tags Hydrolase
molecule keywords Bd3459
total genus 134
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cebA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cebA02
2C6WB 2EX6A 5FQMA 4GN2A 4HBTA 4PM9A 4WZ5C 4MBFA 5GLAA 5M19A 5FATA 4N1HA 1GA9A 3HREA 4OOYA 1L0EA 4EV4A 4RA7A 1QMEA 1Y54A 2EX8A 3BLMA 1XA1A 4FCFA 4S2KA 3UDIA 3SS5A 1SDEA 2WGIA 2ZM0A 5A91A 1G68A 1XP4A 3Q07A 3UE0A 3SOIA 2ZJ9A 2Y2OA 1YLPA 2G2UA 4B88A 3V5MA 2Y2GA 2Y4AA 4OLGA 1IYOA 3GVBA 4GD6A 4MBKA 4S2PA 1PW1A 4XUXA 1YQSA 2WGVA 5TFQA 4ZDXA 4FD8A 2HDRA 4EBNA 1E25A 1PWDA 4OONA 1DJBA 1HZOA 1W8YA 2WZXA 3CMZA 4GDNA 3LY3A 1K38A 1K55C 1XKZA 2JE5A 2Y59A 5D3OA 5DTSA 5HAQA 4UA7A 3ZHHA 2JBFA 3RXWA 1SDNA 4DKIA 5CEDA 1L0GA 3LCEA 3HLEA 5CERA 1MWTA 1BLCA 2ZC6B 1EWZA 4FH4A 2ZM8A 2EXAA 3VP4A 1IYPA 3OCNA 3NY4A 3V3RA 4KZ7A 3IF6B 1ONHA 2XEPA 1BUEA 1OMEA 1FQGA 4OOLA 5DTKA 4X6TA 2XD5A 1AXBA 2ZQDA 5A92A 2WGWB 5EVLA 5GLCA 1BLPA 2Z2MB 1YLZA 3O3VA 3VP2A 1K55A 2EXBA 3ZG0A 1PI5A 3G2ZA 2X01A 4GKUA 4OQ0A 3GV9A 3PBRA 1WYCA 2UWXA 5HFOA 3SS3A 4C75A 5HAPA 3S22A 1K25A 5DF9A 5EUAA 1XPBA 3NC8A 4JBFA 3UPNA 4UA6A 4L0LA 1I2SA 1GHPA 1BTLA 3IH8A 4DE0A 2BG1A 1W5DA 3QNBA 1E3UD 3IWOA 5CRFA 4OP5A 1SCWA 4P87A 3MKFA 5BOHA 3IWIA 2V2FF 3C4PA 3ITAA 3O87A 3VSKA 5CECA 1L0FA 1ERMA 1TDGA 3FZCA 1LL9A 3N8LA 4ZJ1A 5TGFA 4B4ZA 4X55A 3VP0A 3SH7A 3O86A 1K56A 1KVLA 2Q9NA 5CHUA 1HD8A 2WAFA 4OPYA 3WS1A 4PM5A 3PTEA 5HAIA 5CXWA 3FKVA 3HLCA 4OLDA 5F1GA 3MBZA 2HP9A 4NK3A 5FDHA 4KZ5A 3IH9A 1NXYA 4WZ4A 2Y2LA 3VFHA 4MBHA 2Q9MA 2EX2A 1FOFA 2JC7A 3BFFA 4GZBA 1Q2PA 4XUZA 4U3TA 5DTTA 2DRWA 2WK0A 3PBSA 3QNCA 1YLYA 3A3IA 1IYQA 1IELA 4YINA 4OVDA 1YT4A 2ZQ9A 4QU3A 3DWKA 1MWUA 2RCXA 2GDNA 4KZAA 3OPLA 4B4XA 1M40A 1FSWA 1L0DA 3A3JA 4EQIA 1NZOA 4C3QA 4OKPA 3S1YA 2WAEA 3MZFA 3VSLA 3Q7VB 4LV3A 3UDXA 3NIAA 4C6YA 2ZD8A 1PI4A 5M18A 3DWZA 3OPHA 4LV2A 2HPBA 1EROA 4LCLA 4OPZA 4QY5A 3WWXA 2XR0A 1GHIA 5M1AA 5HX9A 3CJMA 5HARA 4OH0A 2A3UA 5DF8A 4DE2A 5KSHA 3FKWA 3G31A 3HLBA 5FSRA 4KZ9A 3MZDA 1W8QA 4E6WA 4LV1A 3OC2A 4OQGA 1JWVA 3AGEA 3CZDA 3HBRA 4JXWA 2A49A 3W4PA 1FCNA 5DF7A 3VFFA 4CPKA 2X02A 1NYYA 2HDQA 2H0TA 4KENB 3HLFA 4QD4A 1PWGA 3AGFA 1G6AA 2X71A 3Q7ZA 4S2OA 4YFMA 1BLHA 4Z9QA 4KZBA 1IYSA 1KE0A 1H5XA 1O07A 3S4XA 2C5WB 5A90A 1MY8A 4KG6A 4R0QA 3ZG5A 3Q81A 1RP5A 5TR7A 4KZ8A 4HBUA 3N7WA 1MXOA 4GDBA 2Y2NA 1DJAA 2Y2HA 4WZ5A 2ZC3B 3PBQA 2J9PA 3W8KA 3G4PA 4E3OA 1ES5A 1KGEA 1ONGA 1U60A 4E3MA 2ZC4B 3B3XA 5EOEA 5U47A 3DW0A 5FQJA 3ZG8B 1K54C 3UPPA 5FI7A 4S2JA 4S2LA 2JCHA 4D2OA 3G30A 5FAQA 2ZQ7A 5GLDA 4IBRA 1ZKJA 3LEZA 4U0XA 5EVID 5JYOA 2WKHA 4IEDA 3V50A 4P0MA 3OZHA 3MXRA 2OLVA 1DJCA 5GHXA 3IQAA 5GHYA 4WELA 5EECA 1GHMA 3HUNA 3VP1A 2XFTA 4ZJ3A 4UAAA 4E3KA 4WMCA 5E2EA 3OPPA 1K54A 4Y0UA 1SKFA 3HLWA 4PM7A 3IXDA 4HEFA 3HUMA 3PBTA 3UE3A 2OV5A 1FR1A 1LLBA 5EVIB 2H5SA 1K4FA 1VM1A 2Z2LB 1XXMA 1RGZA 2DNSA 3WS5A 5AQ9A 3G2YA 3EQVA 4OPQA 1NJ4A 2PBYA 4PPRA 5FI6A 4DRTA 3NBLA 3OPRA 3CG5A 3ZGAB 2IWDA 4MNRA 4Y0OA 5E2GA 3MXSA 2H0YA 4KG2A 5CTMA 1J9MA 2CC1A 1WE4A 4UA9A 3SS4A 4JKTA 4XXRA 2FFYA 2ZLYA 3IT9A 5G18A 3A3EA 2V20A 3PAGA 1PYYA 1JVJA 4X53A 3RJUA 4R4SA 2XQZA 5GL9A 4OQHA 1KGGA 2HP6A 3BRMA 4JLFA 1MWRA 4BENA 2VGJA 1ALQA 4WMCD 1CI9A 2P9VA 1NRFA 2PU4A 2Y91A 3Q7VA 5FQQA 2R9WA 3IF5A 1HTZA 4BQMA 4ID4A 4BD1A 5JYPA 3M6HA 2V1ZA 3BLSA 3O88A 3UN7A 3GRJA 1MPLA 5KMWA 2QZ6A 3GMWA 1M6KA 3ISGA 3UY6A 4LV0A 3TOIA 3ZFZA 2WYXA 5FQKA 1I5QA 1WYBA 3G32A 1K57C 3N4IA 5AQ7A 5EOOA 4QHCA 2XK1A 4JXGA 1YMXA 3BFDA 4F94A 1FCOA 4P85A 2ZC7A 3VMAA 3JYIA 4Y0TA 4KZ4A 2J8YA 2QMIA 5HW3A 1YLWA 1PZPA 3E2KA 2QPNA 3BFCA 2PU2A 3QHYA 4E3NA 3DTMA 4LCMA 3LO7A 1EI5A 1C3BA 3P09A 3Q1FA 2G2WA 3I7JA 3IXGA 1BULA 2H10A 2XD1A 3MKEA 4R3BA 1YMSA 3IXHA 4KZ6A 3HLDA 4X56A 3HL9A 2VGKA 4IBXA 4ZJ2A 3C5AA 3ITBA 1PW8A 4KQQA 5KSCA 5CHMA 4KZ3A 1CI8A 3A3DA 4ZBEA 4PM6A 4U0TA 2EX9A 5GLBA 1IKIA 3G34A 1XX2A 4S2MA 4NETA 3A3FA 4WM9A 4DE1A 4S2IA 2WZZA 1ZG4A 3BFEA 4MLLA 5FASA 4RX2A 4UHUA 1NY0A 1ESIA 1L2SA 2OSUA 5F83A 3UDFA 2Y2QA 2B5RA 1IEMA 2Y2MA 5J8XA 1E4DA 3FWLA 3E2LA 2WKIA 5F82A 3BEBA 2RL3A 3FYZA 2R9XA 1CEFA 1IKGA 4M3KA 3TG9A 4N9KA 5CGXA 4R1GA 5CEBA 1KGFA 4P6BA 3UPOA 4RX3A 3IF6A 4GD8A 2J9OA 2XDMA 3Q82A 3UE1A 3ZVWA 4FSFA 2BLSA 2ZC5B 4OP8A 3ZNTA 4DE3A 3C4OA 5L2FA 1BSGA 1ESUA 1MKIA 4KQRA 4KQOA 1K6RA 3GR2A 2HDSA 4O7DA 1RCJA 5HL1A 1RGYA 4JPMA 4N92A 4WEKA 1ES4A 3UNWA 4DXCA 4DDSA 3ZG7B 4N1XA 2EFXA 4K0XA 4R4RA 5CTNA 1S6RA 2ZM2A 1KVMA 4BLMA 4BJPA 1K6SA 4MEZA 4WBGA 4GOGA 1JTGA 5IHVA 1BLSA 1YM1A 3ZG9B 2IWCA 2ZQ8A 4S2NA 5EE8A 4X69A 3BECA 4OOMA 5EVIA 3C7VA 2E8IA 3C7UA 4WEJA 4QJGA 1XGIA 1GA0A 3BFGA 3NI9A 1CEGA 4PMAA 3ZDJA 1H8YA 3IWQA 1JWZA 3ZCZA 3GQZA 1KE4A 3WRZA 5A93A 5FQIA 4EBLA 4IVIA 1NZUA 2IWBA 1TEMA 1LI0A 2WKEA 3AGDA 3PBOA 4Q8IA 3ZVTA 2XLNA 4E3IA 3SH8A 4EBPA 3M2KA 4K0WA 3OCLA 3W4QA 1MBLA 1W79A 4DDYA 2I72A 5E2FA 3GTCA 1MWSA 2XF3A 4N9LA 2Y2PA 3P98A 5FA7A 1XGJA 1LHYA 5AQAA 4EWFA 4QY6A 2J7VA 5CHJA 2Y2IA 2ZMAA 4GNUA 1DY6A 3WS2A 3NDGA 2EFUA 5AQBA 2HP5A 1ES2A 5GHZA 1O7EA 3D4FA 4R23A 1KDSA 2FFFB 2Y2KA 3M6BA 4R3JA 3VP3A 4JF5A 1ZC2A 4IVKA 4BD0A 1S0WA 1ERQA 1YLJA 3IF6C 4GB7A 1NYMA 5FQ9A 3GSGA 3HUOA 4RYEA 4FH2A 5CGWA 5EPHA 3FV7A 1FR6A 3PBNA 4JXSA 5FI2A 3HLGA 2P74A 2ZQCA 4KG5A 1K57A 3IXBA 1CK3A 5I94A 3W4OA 1H8ZA 4HESA 3RXXA 1PIOA 2HDUA 3MZEA 2WGWA 1K56D 2Y2JA 3G35A 3HVFA 5KZHA 1JWPA 2XH9A 4ZTKA 1K4EA 4K91A 3N6IA 1ZG6A 1TVFA 3EQUA 5EVIC 1VQQA 3TSGA 4BL3A 5F1FA 4H8RA 2XGNA 3NCKA 4RVAA 1E3UA 4S2NC 4LENA 4Y7PA 2WUQA 1LI9A 5E43A 3WS0A 4ZAMA 4E6XA 1I2WA 1KE3A 4QB8A 3N8SA 4X68A 3M2JA 5FAOA 3VOYA 4E3LA 1HVBA 4WYYA 3BYDA 4E3JA 3N8RA 1JTDA 1N4OA 4OQIA 5FAPA 3ZNYA 4JXVA 1FSYA 1ES3A 4PM8A 2XFSA 1YLTA 4BL2A 1PWCA 1BZAA 1XA7A 3WRTA 4A5RA 1SHVA 2P9VB 2ZQAA 5E2HA 3UO9A 1Z6FA 1GCEA 1Q2QA 1BT5A 1W7FA 2WADA 3PAEA 4CJNA 3WS4A 5DVAA 4JF6A 4OPRA 2OLUA 4JF4A 3IHAA 3VOZA 2DCFA 3IHBA 3LY4A 2Y55A 3MFDA 3V3SA 1FCMA 1PZOA 3SH9A 4DF6A 3NDEA 3V39A 1QMFA 1N9BA 3BM6A 5CGSA 4DXBA 4EUZA 1TDLA 1LL5A 1KDWA
chains in the Genus database with same CATH superfamily
2C6WB 2EX6A 4NXBA 5FQMA 4HBTA 4WZ5C 5M19A 1GA9A 3P01A 1J3WA 4RR8A 4EV4A 4RRAA 2KX6A 3UDIA 1SDEA 2WGIA 2ZM0A 1G68A 1XP4A 3Q07A 1V9ZA 1YLPA 2G2UA 3V5MA 3PD4A 2VKSA 4OLGA 1IYOA 4S2PA 2KDKA 2WGVA 4O8GA 1E25A 1PWDA 4OONA 1HZOA 5IU1A 4GS9B 3CMZA 3LY3A 4D60A 1K38A 5DTSA 2L1MA 5D3OA 3ZHHA 4DKIA 1PFLA 1MWTA 2ZC6B 1S1ZA 3VP4A 3NY4A 4KZ7A 1LSVA 3IF6B 3T4JA 1UWNX 1OMEA 3MF0A 2WGWB 5EVLA 2Z2MB 2XA7S 3ZQ5A 3ZG0A 5IS1A 3B42A 4GS9A 4ESPA 3QP5A 3PBRA 4B9OA 3S22A 1XPBA 4DE0A 3QNBA 4EXOA 3IWOA 1SCWA 4P87A 3MKFA 5BOHA 3LR3A 3C8CA 1L0FA 4B4ZA 3VP0A 3O86A 1HD8A 4DN0A 4PM5A 3PTEA 4OLDA 3MBZA 1NXYA 1X0OA 2QKPA 4WZ4A 4MBHA 2EX2A 5F5YA 2DRWA 1YT4A 3P7NA 2W3DA 3OPLA 1FSWA 1L0DA 2H28A 4EQIA 3PHYA 3S1YA 4HY8A 3MZFA 3VSLA 1OJ5A 3MSHA 3Q7VB 4LV3A 3HJKA 3DWZA 4LV2A 1EROA 2PHYA 2PYPA 4OPZA 3WWXA 1GHIA 5M1AA 4F3LA 4DE2A 3PD3A 3FKWA 3G31A 3F1PB 3T4OA 3MZDA 3DAVA 2HZ5A 3AGEA 1ZHHB 3CZDA 3HBRA 1FCNA 5DF7A 2X02A 3KNFA 5EFWA 3SW1A 3HLFA 4QD4A 3AGFA 3Q7ZA 4Z9QA 5A90A 3ZG5A 3C30A 4GDBA 1DJAA 2Y2HA 3PBQA 1ES5A 5IT5A 3DW0A 1HLUP 1K54C 5FI7A 4S2LA 1VEUB 4D2OA 1ZKJA 3LIEA 5JYOA 3BY9A 2M7UA 2OLVA 4WELA 3LIFA 2UV0E 1VETB 3OLOA 4WMCA 5AJGA 4Y0UA 4HEFA 3HUMA 4NBJA 4HIAA 1T1CA 4S03A 1FR1A 2I9VA 2XSSA 3WS5A 5FI6A 2PBYA 3VE3A 4DRTA 2IWDA 4MNRA 1UGUA 2CC1A 4HP4A 1DP6A 3SS4A 5F68A 2ZLYA 3IT9A 3A3EA 1YAXA 2ZL1B 3RJUA 4R4SA 2B95A 1KGGA 3BRMA 3S7NA 5HPIA 4ID4A 4EETB 3M6HA 3BLSA 3EOIA 5KMWA 2WYXA 5FQKA 3G32A 5FDSA 3KSHA 1YMXA 3R7WA 4KZ4A 1A0KA 3E2KA 3DBAA 4S0JA 1KOUA 1C3BA 5HSQA 1BULA 3OBFA 1S66L 3MKEA 1YMSA 2V8CA 3JVUA 4KZ6A 4X56A 4BBTA 3T4LA 4RR7A 4KQQA 1CI8A 4ZBEA 2GNXA 4U0TA 4R6LA 3G34A 4NETA 1F98A 1ZG4A 3BFEA 4MLLA 4GCZA 1ESIA 2INWA 2Y2QA 2B5RA 1IEMA 4WL9A 2QJ7A 3FWLA 4Q0IA 3BEBA 4XT2B 3FYZA 3NULA 5FEFA 1IKGA 4HOIA 4N9KA 3T4QA 4RX3A 4FOFA 4GD8A 2HF6A 3PXPA 3ZVWA 2ZC5B 2HGVA 1GSVA 1ESUA 3LIBA 3GR2A 2V0UA 3BQ8A 1RCJA 5HL1A 2ACGA 1G28A 2XRNA 3V67A 3LR4A 4DDSA 3CITA 1H0MA 4NXEA 4BLMA 4BJPA 4WBGA 1YKDA 4ARZA 4EERA 5IHVA 2ZQ8A 3FPWA 4X69A 3F1PA 1XJ3A 1ODVA 1XGIA 3E4QA 1OTIA 3BFGA 4NKPA 3KO5A 5TBMB 2Z6CA 1JWZA 1KE4A 3QP4A 4HH2A 4IVIA 2P04A 2OAQ1 4EBPA 3M2KA 4RQ9A 3FPVA 4Y3IA 1MBLA 1W79A 3GTCA 4MN7A 3C38A 4N9LA 4R38A 3F1NA 1XGJA 1LHYA 2ZMAA 2VV8A 5AQBA 3F1OB 5GHZA 2FFFB 3M6BA 4JF5A 3EEAA 1ZC2A 1ERQA 1YLJA 3IF6C 5FQ9A 4I3IA 3GSGA 5HDSA 2PAVP 3CUEC 5CGWA 5EPHA 2ZQCA 3IXBA 1YPRA 1PIOA 2HDUA 2Y2JA 5KZHA 2XH9A 1F2KA 4K91A 1ZG6A 1TVFA 3EQUA 4KQDA 4H8RA 2JKTI 2HKZA 4Y7PA 3WS0A 1LI9A 1VEUA 1KE3A 4E3LA 3MQQA 4E3JA 1P9WA 5TBMA 4OQIA 5FAPA 3ZNYA 1LT0A 4JXVA 1IFQA 4BL2A 1BZAA 1N9OA 3UO9A 5J4EA 1GCEA 1BT5A 1W7FA 3T4TA 4RRFA 4JF6A 4OPRA 2OLUA 4JF4A 3IHAA 2JN7A 1Y28A 3NDEA 3V39A 1N9BA 5DKLA 5G4YA 4PM9A 4MBFA 5GLAA 5FATA 1L0EA 2EX8A 1Y54A 2BTFP 2V8FA 4S2KA 3IBRA 5A91A 2ZL1A 3UE0A 3SOIA 1D1JA 2Y2OA 2O99A 4DMZA 2Y4AA 4GD6A 3CPTA 4HP9A 2HDRA 4EBNA 1FILA 4WUJA 4L9GA 4ETXA 3PR6A 5HAQA 2Y59A 4UA7A 1S4SA 1L0GA 5CERA 1VETA 4RRJA 2M7VA 1L3LA 3EWKA 1ONHA 2EWWA 2XROA 1FQGA 4OOLA 4X6TA 4EQ1A 1AXBA 2ZQDA 5A92A 5GLCA 1BLPA 3NHQA 3O3VA 3VP2A 4CLCC 1XJ2A 1WYCA 4HJ3A 4C75A 1K25A 3UB6A 5EUAA 3PD5A 3LIAA 3D9YA 4UA6A 2OOLA 3IH8A 3BQAA 1E3UD 5F69A 4EUVA 3IWIA 2V2FF 5CECA 2Q0OA 1ERMA 3FZCA 3N8LA 2W27A 5G4ZA 3MR0A 2JKRI 1KVLA 3WS1A 2WAFA 3CI6A 1OT9A 2K2NA 5HAIA 5CXWA 3FKVA 5F1GA 4FTXA 4H6JA 4KZ5A 3VFHA 2Q9MA 4EU0A 1FOFA 3BFFA 3R4KA 1MKMA 1Q2PA 4XUZA 4U3TA 3QNCA 2PRFA 1IYQA 1IELA 4UQIM 1MWUA 3FG8A 2QWSA 1M40A 3A3JA 5A8BA 1NZOA 3H9WA 1EW0A 3MMHA 4OKPA 4C3QA 2HV1A 4R70A 3UDXA 3NIAA 5EM0A 4C6YA 5M18A 1AWIA 1T1BA 3KX0X 2HPBA 4QY5A 4ARZB 2XR0A 3E0YA 4AFIA 3CJMA 1W8QA 4E6WA 3NJAA 4OQGA 1JWVA 3JPUA 1F5MA 3UB5P 1W63Q 3IBJA 2H0TA 4KENB 4YFMA 1NLZA 1IYSA 1O07A 2JHEA 2C5WB 4R0QA 4I3JA 3H82B 5TR7A 4HBUA 1MXOA 2Y2NA 4WZ5A 2ZC3B 4CLCE 2J9PA 2YKHA 1KGEA 1OTEA 3B3XA 3E4PA 3ZG8B 3UPPA 5FAQA 2ZQ7A 4YOFA 3VE4A 3H7WB 2WKHA 2WKQA 2KLIA 4P0MA 2V1BA 4Y15A 5HDCA 2J3TC 5EECA 1LSWA 2J80A 4ZJ3A 4UAAA 5E2EA 3HLWA 4PM7A 4RRCA 3PBTA 5DJUA 3UE3A 1G6OA 4BBUA 5L10A 4GHIA 3KYZA 1XXMA 4OPQA 3NBLA 3ZGAB 4Y0OA 5E2GA 3NOUC 1WE4A 1TS6A 2FFYA 5G18A 2P7JA 5LBRA 2V20A 3LI9A 1PYYA 2W1RA 3D72A 3MFXA 2HP6A 1H8MA 1MWRA 4WMCD 1CI9A 1NRFA 3CPTB 4Q0JA 3IF5A 1HTZA 4BQMA 3UMDA 2V1AA 2ZOHA 3GRJA 4IUHA 1MPLA 2QZ6A 1M6KA 4S0LA 3ZFZA 1WYBA 3N4IA 4X1LA 5EOOA 2XK1A 3JYIA 1S1YA 4I5SA 5AVEA 2QMIA 1D06A 5HW3A 1YLWA 3QHYA 2O9AA 1EI5A 3Q1FA 4LFUA 3PYPA 4MCWA 3HLDA 4GW9A 3NOPC 4MN5A 3LI8A 3F1OA 4DE1A 2WZZA 5FASA 1NY0A 1L2SA 5F83A 3UDFA 3MQ0A 2Y2MA 1E4DA 3LFVA 3E2LA 4II7A 4HQAA 1TC5A 4ETZA 4R1GA 3UPOA 5L07A 2AVXA 2JKRM 1OJGA 2BLSA 2JKGA 3QP6A 1G5UA 3W2ZA 1BSGA 4KQRA 2XA7M 4Y2FA 4JPMA 2A2LA 2DBOA 2O9BA 4N1XA 2WKRA 2ZM2A 4GOGA 4NBIA 5J61A 4L9EA 3ZG9B 4S2NA 5EE8A 2PBDP 3BECA 4OOMA 2E8IA 4WEJA 3LMUA 3A0SA 1CEGA 3IWQA 2PT7A 3U4LP 1TF1A 4HNBA 5FQIA 2O0YA 4EBLA 1NZUA 1TS8A 1LI0A 2GZAA 4Z1WA 3T4KA 3AGDA 4Q8IA 4GLQA 4RRGA 4K0WA 2PDRA 2I72A 1MWSA 2XF3A 4LLOB 3CHWP 1F9IA 4QY6A 2J7VA 5CHJA 2Y2IA 4GNUA 1XJ4A 3NDGA 3KSFA 2DMWA 3K3DA 2L0WA 1O7EA 3D4FA 4RR6A 4GHIB 4IVKA 4RRKA 2BASA 1Z09A 1DRMA 2JKTM 3FV7A 1FR6A 3PBNA 4JXSA 2P74A 4KG5A 2PD8A 5DJTA 5J3WA 2WGWA 5EVIC 3TSGA 2XGNA 3NCKA 4RVAA 1E3UA 4LENA 2WUQA 2G7UA 3LIDA 2R78A 1I2WA 4QB8A 3KODA 3M2JA 3CUEA 3VOYA 2HL0A 1LL8A 2P08A 2ZMVA 3N8RA 1ES3A 4IHQA 1OTAA 1YLTA 2GX5A 2KOIA 5EV0A 1XA7A 4A5RA 2ZQAA 2FZ0A 2WADA 4CJNA 2LB9A 5DVAA 4PAUA 1GSWA 2DCFA 3IHBA 3LY4A 3V3SA 5TJJA 3SH9A 4DF6A 4EUZA 4P85A 1KDWA 3L9KA 4GN2A 3HREA 4OOYA 5HZHA 4RA7A 3BLMA 2QHKA 3TW8A 3SS5A 1OT6A 5K5BA 4MMNA 3FC7A 4B88A 2Y2GA 5EM1A 3GVBA 4MBKA 1PW1A 4XUXA 1YQSA 4ZDXA 4I3AA 3B33A 1D7EA 2WZXA 3MXQA 1XKZA 3VOLA 2JBFA 3RXWA 4EEUA 5FEGA 3LCEA 3HLEA 2ZM8A 2EXAA 2A24A 3OCNA 3V3RA 2A24B 2XEPA 3UB9A 5DTKA 2XD5A 4X1MA 1YLZA 1K55A 3G2ZA 4NG2A 4GKUA 1VB6A 4OQ0A 5HFOA 3SS3A 5HAPA 5DF9A 1T18A 2PYRA 1BTLA 5AVFA 2BG1A 1W5DA 5CRFA 2D01A 2D02A 4PHTA 1LL9A 2OWHA 4X55A 2K31A 1K56A 2Q9NA 3LMVA 4WF0A 4OPYA 1NLYA 4ME4A 2HP9A 4O01A 2Y2LA 5HWWA 4L9FA 4NXGA 2WK0A 1YLYA 3A3IA 2VV7A 4YINA 2ZQ9A 3DWKA 2RCXA 2VX8A 2HJ9C 4KZAA 4S0KA 3UMEA 2ZD8A 1PI4A 5C5KA 1P0ZA 1P9RA 2K7SA 5HX9A 4O0PA 4G3WA 4OH0A 2A3UA 5DF8A 3HLBA 5FSRA 4KZ9A 4CLCA 3OC2A 1PRQA 3LR0A 5HD5A 3W4PA 4M4XA 3R7WB 4MN6A 4CPKA 3EEHA 3D3OA 1OPXA 4JGPA 4YNRA 1PWGA 2X71A 2W3EA 3UB8A 4KG6A 3Q81A 2JKFA 3EGXC 1RP5A 3GDIA 1YSPA 3N7WA 3W8KA 5I5LA 3G4PA 3KYQA 4E3MA 2ZC4B 3T4SA 5FQJA 2JCHA 5GLDA 4IBRA 1CF0A 2VEAA 4U0XA 3V50A 3OZHA 2W3HA 3MXRA 4X25A 3H7WA 5GHYA 3KYEA 4EW7A 2QYBA 4PKYA 1GHMA 1GSXA 2XFTA 3T1XA 4HH3A 3OPPA 1SKFA 3LYXA 2GJ3A 2OV5A 1T1AA 1LLBA 5EVIB 2H5SA 1VM1A 1WA9A 1RGZA 2DNSA 5FL3A 3VV4A 5AQ9A 1NJ4A 2WKPA 3MXSA 2H0YA 5CTMA 3BY8A 4UA9A 1FIKA 3PAGA 1JVJA 1N9LA 5GL9A 1ALQA 2VGLM 3BWLA 2Y91A 3Q7VA 5FQQA 4BD1A 2V1ZA 2YKFA 3GMWA 3ISGA 3UY6A 4LV0A 3MJQA 5AQ7A 4RRIA 4JXGA 1OTBA 4K08A 1FCOA 2ZC7A 3VMAA 2J8YA 4Q0HA 1PZPA 2QPNA 3S7PA 3B47A 1CQAA 3DTMA 3QP1A 4I39A 3LO7A 4LRXC 3P09A 4Y5FA 2G2WA 2NUPC 3I7JA 2XD1A 4R3BA 3IXHA 4DJ2A 3HL9A 2VGKA 4IBXA 4Y17A 4ZJ2A 1PW8A 5CHMA 3BJNA 3A3DA 3ZYTA 2EX9A 1IKIA 3MS6A 4S2MA 3A3FA 4S2IA 4P6ZM 4RX2A 2VLGA 3LICA 5F82A 2RL3A 2MJ6A 1CEFA 4LRZE 5HL6A 4M3KA 5CGXA 4P6BA 3IF6A 2J9OA 4FSFA 3ZNTA 5MC7A 3O5YA 5L2FA 1MKIA 1H3QA 1K6RA 3RTYA 2HDSA 4O7DA 3KNPA 1PNEA 4N92A 4DXCA 2B02A 2PR5A 2EFXA 4K0XA 1S6RA 1KVMA 1Y2QA 3L7HA 3IX3A 2IWCA 2W1TB 2J3TD 2FH5A 2EA9A 3C7UA 1XJ6A 3HCYA 1GA0A 3NI9A 1T19A 3ZDJA 3DTKA 3RH8B 3ZCZA 3WRZA 2HJEA 5A93A 1JKEA 1TEMA 3ZVTA 4E3IA 1BYWA 3SH8A 3HJIA 3KO7A 2CMNA 4RR9A 2Y8HA 5E2FA 4PKYG 4FUWA 2Y2PA 3P98A 5FA7A 5AQAA 4F3LB 1DP8A 2W3FA 1DY6A 5L09A 3IS2B 2HP5A 1ES2A 2VJWA 1CJFA 2Y2KA 3VP3A 4HI4A 4GB7A 4FH2A 2IA2A 5FI2A 3HLGA 1K57A 3F1NB 2OAP1 1CK3A 3W4OA 4RRLA 3CWFA 3RXXA 3ICYA 3G35A 1K56D 3HVFA 1JWPA 3N6IA 4HJ4A 4BL3A 1VQQA 5F1FA 3T1QB 4S2NC 1W63M 1VHMA 4JGQA 2OKVA 4RRHA 4X68A 2NUTC 1HVBA 1V9YA 3BYDA 1JTDA 1FSYA 3KOBA 4PM8A 2M1CA 4WN5A 3KSGA 2XFSA 2O9CA 3G6OA 4EEPA 2VGLS 3WRTA 1SHVA 2P9VB 5E2HA 1Q2QA 3PAEA 4XT2A 3WS4A 3IS2A 3VOZA 1UWPX 2Y55A 4EESA 1PZOA 3BM6A 4JGOA 3CLOA 1NRJA 3OOVA 4N1HA 1XFNA 3KOCA 1QMEA 1XA1A 4FCFA 4UEYA 2ZJ9A 2J3WA 3EGDC 4I38A 3NOTC 3S7OA 2VZWA 2W1TA 5TFQA 4P6ZS 4FD8A 1DJBA 1W8YA 4IJGA 1DP9A 4GDNA 4IUKA 1ACFA 1K55C 2JE5A 1J7GA 1SDNA 5CEDA 1BLCA 1EWZA 4FH4A 1IYPA 1STZA 1BUEA 2B18A 1S67L 2E8JA 2Y79A 2EXBA 1PI5A 2X01A 3GV9A 2UWXA 4RRBA 3NC8A 4JBFA 5DFYA 3UPNA 5J7EA 4L0LA 1I2SA 1GHPA 4OP5A 3TE8A 3C4PA 3O87A 3ITAA 3VSKA 1TDGA 4ZJ1A 5TGFA 5DKKA 4G3VA 3SH7A 3UE6A 5CHUA 3NECA 4QWOA 3HLCA 4E04A 4NK3A 3A0VA 5FDHA 5HDDA 3IH9A 4CLCB 3TJZC 2JC7A 4GZBA 5DTTA 3PBSA 4OVDA 3LR5A 4QU3A 2GDNA 4B4XA 2WAEA 4S02A 1P97A 3OPHA 4LGWA 3QP2A 2VK3A 1IOUA 4LCLA 3K2NA 2Z6DA 5HARA 4NXFA 5DFXA 5KSHA 4LV1A 4DJ3A 4JXWA 4RRRA 2A49A 4B93A 3VFFA 1K0KA 4JGRA 1NYYA 4WLAA 2HDQA 4MDZA 1G6AA 4S2OA 1BLHA 4KZBA 1KE0A 1H5XA 3S4XA 4CQHA 3MQOA 1MY8A 2HL2A 4KZ8A 2PR6A 1JNUA 3BW6A 2QJ5A 4E3OA 2VV6A 1ONGA 1U60A 5EOEA 5U47A 2W0NA 3DTEA 3IX4A 5KIZA 4S2JA 3G30A 4G3KA 4GJ4A 3LEZA 5EVID 4IEDA 5L8MA 1DJCA 5GHXA 3IQAA 3LMTA 3HUNA 3VP1A 3T1RA 4RRMA 4E3KA 4KUOA 3DTIA 1K54A 1ZTUA 3IXDA 1NWZA 2ZBBA 2VA0A 1K4FA 3JVVA 2Z2LB 3G2YA 3EQVA 4PPRA 3OPRA 3CG5A 1S4RA 4KG2A 1J9MA 1SZVA 4JKTA 4XXRA 5HPFA 4X53A 2XQZA 4OQHA 3C2WA 3IX8A 4JLFA 4NEED 4BENA 2VGJA 2P9VA 2PU4A 2R9WA 2PD7A 5JYPA 3O88A 3UN7A 3PD2A 4HHDA 3E98A 3TOIA 1I5QA 1K57C 1TD5A 4QHCA 1LSXA 2ZOIA 3BFDA 4F94A 4Y0TA 4RRQA 2OWJA 3BFCA 2PU2A 4E3NA 4LCMA 3T50A 4KUKA 3K3CA 3E4OA 3KO4A 3IXGA 2H10A 4BBVA 2V9AA 3C5AA 3ITBA 5KSCA 4KZ3A 4PM6A 5GLBA 4RRDA 1XX2A 5HWVA 4WM9A 4CLCD 4UHUA 2OSUA 5J8XA 2WKIA 2R9XA 3CAXA 4H6JB 3TG9A 2W3GA 5CEBA 1KGFA 2XDMA 3Q82A 3KO3A 3UE1A 4OP8A 3LEQA 4DE3A 3C4OA 4KQOA 5EVEA 1MZUA 5HD3A 2ZMFA 1RGYA 4Y13A 4BWIA 4WEKA 1ES4A 1YSQA 3UNWA 3ZG7B 1SKOB 4R4RA 5CTNA 1MC0A 1N9NA 1K6SA 4MEZA 1JTGA 1BLSA 1YM1A 3A0RA 3UB7A 3QP8A 5EVIA 3C7VA 3KO9A 4QJGA 4LPZA 1OTDA 4PMAA 1H8YA 1TS7A 1XFQA 2LB5A 3GQZA 2IWBA 3GECA 3S7QA 2WKEA 4LRYC 3PBOA 2XLNA 3T1SA 3OCLA 3W4QA 2V0WA 4BMWA 2L4RA 4QPRA 3T12B 4DDYA 1TS0A 4EWFA 5HWTA 3WS2A 2EFUA 2EWVA 4R23A 1KDSA 4R3JA 3TRCA 5CX7A 4BD0A 1S0WA 1NYMA 3HUOA 4RYEA 1Y4OA 3ULFA 3LUQA 1SKOA 5I94A 1H8ZA 4HESA 3MZEA 3KO6A 4ZTKA 1K4EA 3U2AA 5E43A 4ZAMA 4E6XA 3N8SA 4R3AA 5FAOA 4WYYA 4YWZA 1N4OA 4S0IA 3LGOA 2HL1A 4UQIS 1PWCA 5F6AA 3RFBA 3H82A 1Z6FA 4HJ6A 4ZRRA 3SZTA 3MFDA 3KSIA 1FCMA 1QMFA 5CGSA 4DXBA 1TDLA 1LL5A
chains in the Genus database with same CATH topology
2C6WB 2EX6A 5FQMA 4GN2A 4HBTA 4PM9A 4WZ5C 4MBFA 5GLAA 5M19A 5FATA 4N1HA 1GA9A 3KOCA 4RR8A 3HREA 4OOYA 1L0EA 4EV4A 4RA7A 1QMEA 1Y54A 2EX8A 4RRAA 3BLMA 1XA1A 4FCFA 4S2KA 3UDIA 3SS5A 1SDEA 2WGIA 2ZM0A 5A91A 1G68A 1XP4A 3Q07A 3UE0A 3SOIA 2ZJ9A 2Y2OA 1YLPA 2G2UA 4B88A 3V5MA 3PD4A 2Y2GA 2Y4AA 4OLGA 1IYOA 3GVBA 4GD6A 4MBKA 4S2PA 1PW1A 4XUXA 1YQSA 2WGVA 5TFQA 4ZDXA 4FD8A 2HDRA 4EBNA 1E25A 1PWDA 4OONA 1DJBA 1HZOA 1W8YA 2WZXA 3CMZA 4GDNA 3LY3A 1K38A 1K55C 1XKZA 2JE5A 2Y59A 5D3OA 5DTSA 5HAQA 1J7GA 4UA7A 3ZHHA 2JBFA 3RXWA 1SDNA 4DKIA 5CEDA 1L0GA 3LCEA 3HLEA 5CERA 1MWTA 1BLCA 2ZC6B 1EWZA 4FH4A 2ZM8A 2EXAA 3VP4A 1IYPA 3OCNA 3NY4A 3V3RA 4KZ7A 4RRJA 3IF6B 1ONHA 2XEPA 1BUEA 1OMEA 1FQGA 4OOLA 5DTKA 4X6TA 2XD5A 1AXBA 2ZQDA 5A92A 2WGWB 5EVLA 5GLCA 1BLPA 2Z2MB 1YLZA 3O3VA 3VP2A 1K55A 2EXBA 3ZG0A 1PI5A 3G2ZA 2X01A 4GKUA 4OQ0A 3GV9A 3PBRA 1WYCA 2UWXA 5HFOA 3SS3A 4C75A 5HAPA 3S22A 1K25A 4RRBA 5DF9A 5EUAA 1XPBA 3PD5A 3NC8A 4JBFA 3UPNA 4UA6A 4L0LA 1I2SA 1GHPA 1BTLA 3IH8A 4DE0A 2BG1A 1W5DA 3QNBA 1E3UD 3IWOA 5CRFA 4OP5A 1SCWA 4P87A 3MKFA 5BOHA 3IWIA 2V2FF 3C4PA 3ITAA 3O87A 3VSKA 5CECA 1L0FA 1ERMA 1TDGA 3FZCA 1LL9A 3N8LA 4ZJ1A 5TGFA 4B4ZA 4X55A 3VP0A 3SH7A 3O86A 1K56A 1KVLA 2Q9NA 3LMVA 5CHUA 1HD8A 2WAFA 4OPYA 3WS1A 4PM5A 3PTEA 5HAIA 5CXWA 3FKVA 3HLCA 4OLDA 5F1GA 3MBZA 2HP9A 4NK3A 5FDHA 4KZ5A 3IH9A 1NXYA 4WZ4A 2Y2LA 3VFHA 4MBHA 2Q9MA 2EX2A 1FOFA 2JC7A 3BFFA 4GZBA 1Q2PA 4XUZA 4U3TA 5DTTA 2DRWA 2WK0A 3PBSA 3QNCA 1YLYA 3A3IA 1IYQA 1IELA 4YINA 4OVDA 1YT4A 2ZQ9A 4QU3A 3DWKA 1MWUA 2RCXA 2GDNA 4KZAA 3OPLA 4B4XA 1M40A 1FSWA 1L0DA 3A3JA 4EQIA 1NZOA 4C3QA 4S0KA 4OKPA 3S1YA 2WAEA 3MZFA 4S02A 3VSLA 3Q7VB 4LV3A 3UDXA 3NIAA 4C6YA 2ZD8A 1PI4A 5M18A 3DWZA 3OPHA 4LV2A 2HPBA 1EROA 4LCLA 4OPZA 4QY5A 3WWXA 2XR0A 1GHIA 5M1AA 5HX9A 3CJMA 5HARA 4OH0A 2A3UA 5DF8A 4DE2A 5KSHA 3PD3A 3FKWA 3G31A 3HLBA 5FSRA 4KZ9A 3MZDA 1W8QA 4E6WA 4LV1A 3OC2A 4OQGA 1JWVA 3AGEA 3CZDA 3HBRA 4JXWA 4RRRA 2A49A 3W4PA 1FCNA 5DF7A 3VFFA 4CPKA 2X02A 3KNFA 1NYYA 2HDQA 2H0TA 4KENB 3HLFA 4QD4A 1PWGA 3AGFA 1G6AA 2X71A 3Q7ZA 4S2OA 4YFMA 1BLHA 4Z9QA 4KZBA 1IYSA 1KE0A 1H5XA 1O07A 3S4XA 2C5WB 5A90A 1MY8A 4KG6A 4R0QA 3ZG5A 3Q81A 2HL2A 1RP5A 5TR7A 4KZ8A 4HBUA 3N7WA 1MXOA 4GDBA 2Y2NA 1DJAA 2Y2HA 4WZ5A 2ZC3B 3PBQA 2J9PA 3W8KA 3G4PA 4E3OA 1ES5A 1KGEA 1ONGA 1U60A 4E3MA 2ZC4B 3B3XA 5EOEA 5U47A 3DW0A 5FQJA 3ZG8B 1K54C 3UPPA 5FI7A 4S2JA 4S2LA 2JCHA 4D2OA 3G30A 5FAQA 2ZQ7A 5GLDA 4IBRA 1ZKJA 3LEZA 4U0XA 5EVID 5JYOA 2WKHA 4IEDA 3V50A 4P0MA 3OZHA 3MXRA 2OLVA 1DJCA 5GHXA 3IQAA 5GHYA 4WELA 5EECA 3LMTA 1GHMA 3HUNA 3VP1A 2XFTA 4ZJ3A 4RRMA 4UAAA 4E3KA 4WMCA 5E2EA 3OPPA 1K54A 4Y0UA 1SKFA 3HLWA 4PM7A 4RRCA 3IXDA 4HEFA 3HUMA 4NBJA 3PBTA 3UE3A 2OV5A 4S03A 1FR1A 1LLBA 5EVIB 2H5SA 1K4FA 1VM1A 2Z2LB 1XXMA 1RGZA 2DNSA 3WS5A 5AQ9A 3G2YA 3EQVA 4OPQA 1NJ4A 2PBYA 4PPRA 5FI6A 4DRTA 3NBLA 3OPRA 3CG5A 3ZGAB 2IWDA 4MNRA 4Y0OA 5E2GA 3MXSA 2H0YA 4KG2A 5CTMA 1J9MA 2CC1A 1WE4A 4UA9A 3SS4A 4JKTA 4XXRA 2FFYA 2ZLYA 3IT9A 5G18A 3A3EA 2V20A 3PAGA 1PYYA 1JVJA 4X53A 3RJUA 4R4SA 2XQZA 5GL9A 4OQHA 1KGGA 2HP6A 3BRMA 4JLFA 1MWRA 4BENA 2VGJA 1ALQA 4WMCD 1CI9A 2P9VA 1NRFA 2PU4A 2Y91A 3Q7VA 5FQQA 2R9WA 3IF5A 1HTZA 4BQMA 4ID4A 4BD1A 5JYPA 3M6HA 2V1ZA 3BLSA 3O88A 3UN7A 3PD2A 3GRJA 1MPLA 5KMWA 2QZ6A 3GMWA 1M6KA 3ISGA 3UY6A 4LV0A 3TOIA 3ZFZA 4S0LA 2WYXA 5FQKA 1I5QA 1WYBA 3G32A 1K57C 3N4IA 5AQ7A 4RRIA 5EOOA 4QHCA 2XK1A 4JXGA 1YMXA 3BFDA 4F94A 1FCOA 4P85A 2ZC7A 3VMAA 3JYIA 4Y0TA 4KZ4A 2J8YA 4RRQA 2QMIA 5HW3A 1YLWA 1PZPA 3E2KA 2QPNA 3BFCA 2PU2A 3QHYA 4S0JA 4E3NA 3DTMA 4LCMA 3LO7A 1EI5A 1C3BA 3P09A 3Q1FA 3KO4A 2G2WA 3I7JA 3IXGA 1BULA 2H10A 2XD1A 3MKEA 4R3BA 1YMSA 3IXHA 4KZ6A 3HLDA 4X56A 3HL9A 2VGKA 4IBXA 4ZJ2A 4RR7A 3C5AA 3ITBA 1PW8A 4KQQA 5KSCA 5CHMA 4KZ3A 1CI8A 3A3DA 4ZBEA 4PM6A 4U0TA 2EX9A 5GLBA 1IKIA 4RRDA 3G34A 1XX2A 4S2MA 4NETA 3A3FA 4WM9A 4DE1A 4S2IA 2WZZA 1ZG4A 3BFEA 4MLLA 5FASA 4RX2A 4UHUA 1NY0A 1ESIA 1L2SA 2OSUA 5F83A 3UDFA 2Y2QA 2B5RA 1IEMA 2Y2MA 5J8XA 1E4DA 3FWLA 3E2LA 2WKIA 5F82A 3BEBA 2RL3A 3FYZA 2R9XA 1CEFA 1TC5A 1IKGA 4M3KA 3TG9A 4N9KA 5CGXA 4R1GA 5CEBA 1KGFA 4P6BA 3UPOA 4RX3A 3IF6A 4GD8A 2J9OA 2XDMA 3Q82A 3KO3A 3UE1A 3ZVWA 4FSFA 2BLSA 2ZC5B 4OP8A 3ZNTA 4DE3A 3C4OA 5L2FA 1BSGA 1ESUA 1MKIA 4KQRA 4KQOA 1K6RA 3GR2A 2HDSA 4O7DA 3KNPA 1RCJA 5HL1A 1RGYA 4JPMA 4N92A 4WEKA 1ES4A 2DBOA 3UNWA 4DXCA 4DDSA 3ZG7B 4N1XA 2EFXA 4K0XA 4R4RA 5CTNA 1S6RA 2ZM2A 1KVMA 4BLMA 4BJPA 1K6SA 4MEZA 1Y2QA 4WBGA 4GOGA 4NBIA 5J61A 1JTGA 5IHVA 1BLSA 1YM1A 3ZG9B 2IWCA 2ZQ8A 4S2NA 5EE8A 4X69A 3BECA 4OOMA 5EVIA 3C7VA 3KO9A 2E8IA 3C7UA 4WEJA 4QJGA 3LMUA 1XGIA 1GA0A 3BFGA 3NI9A 1CEGA 4PMAA 3ZDJA 1H8YA 3KO5A 3IWQA 1JWZA 3ZCZA 3GQZA 1KE4A 3WRZA 5A93A 5FQIA 4EBLA 4IVIA 1NZUA 2IWBA 1TEMA 1JKEA 1LI0A 2WKEA 3AGDA 3PBOA 4Q8IA 3ZVTA 2XLNA 4E3IA 3SH8A 4EBPA 3M2KA 3KO7A 4RRGA 4K0WA 4RR9A 3OCLA 3W4QA 1MBLA 1W79A 4DDYA 2I72A 5E2FA 3GTCA 1MWSA 2XF3A 4N9LA 2Y2PA 3P98A 5FA7A 1XGJA 1LHYA 5AQAA 4EWFA 4QY6A 2J7VA 5CHJA 2Y2IA 2ZMAA 4GNUA 1DY6A 3WS2A 3NDGA 2EFUA 5AQBA 2HP5A 1ES2A 5GHZA 1O7EA 3D4FA 4R23A 1KDSA 2FFFB 2Y2KA 3M6BA 4R3JA 3VP3A 4RR6A 4JF5A 1ZC2A 4IVKA 4RRKA 4BD0A 1S0WA 1ERQA 1YLJA 3IF6C 4GB7A 1NYMA 5FQ9A 3GSGA 3HUOA 4RYEA 4FH2A 5CGWA 5EPHA 3FV7A 1FR6A 3PBNA 4JXSA 5FI2A 3HLGA 2P74A 2ZQCA 4KG5A 1K57A 3IXBA 1CK3A 5I94A 3W4OA 1H8ZA 4HESA 4RRLA 3RXXA 1PIOA 2HDUA 3MZEA 2WGWA 1K56D 2Y2JA 3G35A 3HVFA 5KZHA 1JWPA 2XH9A 4ZTKA 1K4EA 4K91A 3N6IA 1ZG6A 1TVFA 3EQUA 5EVIC 1VQQA 3TSGA 4BL3A 5F1FA 4H8RA 2HKZA 2XGNA 3NCKA 4RVAA 1E3UA 4S2NC 4LENA 4Y7PA 2WUQA 1LI9A 5E43A 3WS0A 4ZAMA 4E6XA 1I2WA 1KE3A 4QB8A 3N8SA 4X68A 2OKVA 3KODA 3M2JA 4RRHA 5FAOA 3VOYA 4E3LA 2HL0A 1HVBA 4WYYA 3BYDA 4E3JA 3N8RA 1JTDA 1N4OA 4S0IA 4OQIA 5FAPA 3ZNYA 4JXVA 1FSYA 3KOBA 1ES3A 4PM8A 2XFSA 1YLTA 2HL1A 4BL2A 1PWCA 1BZAA 1XA7A 3WRTA 4A5RA 1SHVA 2P9VB 2ZQAA 5E2HA 3UO9A 1Z6FA 1GCEA 1Q2QA 1BT5A 1W7FA 2WADA 3PAEA 4RRFA 4CJNA 3WS4A 5DVAA 4JF6A 4OPRA 2OLUA 4JF4A 3IHAA 3VOZA 2DCFA 3IHBA 3LY4A 2Y55A 3MFDA 3V3SA 1FCMA 1PZOA 3SH9A 4DF6A 3NDEA 3V39A 1QMFA 1N9BA 3BM6A 5CGSA 4DXBA 4EUZA 1TDLA 1LL5A 1KDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6W B;  2EX6 A;  5FQM A;  4GN2 A;  4HBT A;  4PM9 A;  4WZ5 C;  4MBF A;  5GLA A;  5M19 A;  5FAT A;  4N1H A;  1GA9 A;  3HRE A;  4OOY A;  1L0E A;  4EV4 A;  4RA7 A;  1QME A;  1Y54 A;  2EX8 A;  3BLM A;  1XA1 A;  4FCF A;  4S2K A;  3UDI A;  3SS5 A;  1SDE A;  2WGI A;  2ZM0 A;  5A91 A;  1G68 A;  1XP4 A;  3Q07 A;  3UE0 A;  3SOI A;  2ZJ9 A;  2Y2O A;  1YLP A;  2G2U A;  4B88 A;  3V5M A;  2Y2G A;  2Y4A A;  4OLG A;  1IYO A;  3GVB A;  4GD6 A;  4MBK A;  4S2P A;  1PW1 A;  4XUX A;  1YQS A;  2WGV A;  5TFQ A;  4ZDX A;  4FD8 A;  2HDR A;  4EBN A;  1E25 A;  1PWD A;  4OON A;  1DJB A;  1HZO A;  1W8Y A;  2WZX A;  3CMZ A;  4GDN A;  3LY3 A;  1K38 A;  1K55 C;  1XKZ A;  2JE5 A;  2Y59 A;  5D3O A;  5DTS A;  5HAQ A;  4UA7 A;  3ZHH A;  2JBF A;  3RXW A;  1SDN A;  4DKI A;  5CED A;  1L0G A;  3LCE A;  3HLE A;  5CER A;  1MWT A;  1BLC A;  2ZC6 B;  1EWZ A;  4FH4 A;  2ZM8 A;  2EXA A;  3VP4 A;  1IYP A;  3OCN A;  3NY4 A;  3V3R A;  4KZ7 A;  3IF6 B;  1ONH A;  2XEP A;  1BUE A;  1OME A;  1FQG A;  4OOL A;  5DTK A;  4X6T A;  2XD5 A;  1AXB A;  2ZQD A;  5A92 A;  2WGW B;  5EVL A;  5GLC A;  1BLP A;  2Z2M B;  1YLZ A;  3O3V A;  3VP2 A;  1K55 A;  2EXB A;  3ZG0 A;  1PI5 A;  3G2Z A;  2X01 A;  4GKU A;  4OQ0 A;  3GV9 A;  3PBR A;  1WYC A;  2UWX A;  5HFO A;  3SS3 A;  4C75 A;  5HAP A;  3S22 A;  1K25 A;  5DF9 A;  5EUA A;  1XPB A;  3NC8 A;  4JBF A;  3UPN A;  4UA6 A;  4L0L A;  1I2S A;  1GHP A;  1BTL A;  3IH8 A;  4DE0 A;  2BG1 A;  1W5D A;  3QNB A;  1E3U D;  3IWO A;  5CRF A;  4OP5 A;  1SCW A;  4P87 A;  3MKF A;  5BOH A;  3IWI A;  2V2F F;  3C4P A;  3ITA A;  3O87 A;  3VSK A;  5CEC A;  1L0F A;  1ERM A;  1TDG A;  3FZC A;  1LL9 A;  3N8L A;  4ZJ1 A;  5TGF A;  4B4Z A;  4X55 A;  3VP0 A;  3SH7 A;  3O86 A;  1K56 A;  1KVL A;  2Q9N A;  5CHU A;  1HD8 A;  2WAF A;  4OPY A;  3WS1 A;  4PM5 A;  3PTE A;  5HAI A;  5CXW A;  3FKV A;  3HLC A;  4OLD A;  5F1G A;  3MBZ A;  2HP9 A;  4NK3 A;  5FDH A;  4KZ5 A;  3IH9 A;  1NXY A;  4WZ4 A;  2Y2L A;  3VFH A;  4MBH A;  2Q9M A;  2EX2 A;  1FOF A;  2JC7 A;  3BFF A;  4GZB A;  1Q2P A;  4XUZ A;  4U3T A;  5DTT A;  2DRW A;  2WK0 A;  3PBS A;  3QNC A;  1YLY A;  3A3I A;  1IYQ A;  1IEL A;  4YIN A;  4OVD A;  1YT4 A;  2ZQ9 A;  4QU3 A;  3DWK A;  1MWU A;  2RCX A;  2GDN A;  4KZA A;  3OPL A;  4B4X A;  1M40 A;  1FSW A;  1L0D A;  3A3J A;  4EQI A;  1NZO A;  4C3Q A;  4OKP A;  3S1Y A;  2WAE A;  3MZF A;  3VSL A;  3Q7V B;  4LV3 A;  3UDX A;  3NIA A;  4C6Y A;  2ZD8 A;  1PI4 A;  5M18 A;  3DWZ A;  3OPH A;  4LV2 A;  2HPB A;  1ERO A;  4LCL A;  4OPZ A;  4QY5 A;  3WWX A;  2XR0 A;  1GHI A;  5M1A A;  5HX9 A;  3CJM A;  5HAR A;  4OH0 A;  2A3U A;  5DF8 A;  4DE2 A;  5KSH A;  3FKW A;  3G31 A;  3HLB A;  5FSR A;  4KZ9 A;  3MZD A;  1W8Q A;  4E6W A;  4LV1 A;  3OC2 A;  4OQG A;  1JWV A;  3AGE A;  3CZD A;  3HBR A;  4JXW A;  2A49 A;  3W4P A;  1FCN A;  5DF7 A;  3VFF A;  4CPK A;  2X02 A;  1NYY A;  2HDQ A;  2H0T A;  4KEN B;  3HLF A;  4QD4 A;  1PWG A;  3AGF A;  1G6A A;  2X71 A;  3Q7Z A;  4S2O A;  4YFM A;  1BLH A;  4Z9Q A;  4KZB A;  1IYS A;  1KE0 A;  1H5X A;  1O07 A;  3S4X A;  2C5W B;  5A90 A;  1MY8 A;  4KG6 A;  4R0Q A;  3ZG5 A;  3Q81 A;  1RP5 A;  5TR7 A;  4KZ8 A;  4HBU A;  3N7W A;  1MXO A;  4GDB A;  2Y2N A;  1DJA A;  2Y2H A;  4WZ5 A;  2ZC3 B;  3PBQ A;  2J9P A;  3W8K A;  3G4P A;  4E3O A;  1ES5 A;  1KGE A;  1ONG A;  1U60 A;  4E3M A;  2ZC4 B;  3B3X A;  5EOE A;  5U47 A;  3DW0 A;  5FQJ A;  3ZG8 B;  1K54 C;  3UPP A;  5FI7 A;  4S2J A;  4S2L A;  2JCH A;  4D2O A;  3G30 A;  5FAQ A;  2ZQ7 A;  5GLD A;  4IBR A;  1ZKJ A;  3LEZ A;  4U0X A;  5EVI D;  5JYO A;  2WKH A;  4IED A;  3V50 A;  4P0M A;  3OZH A;  3MXR A;  2OLV A;  1DJC A;  5GHX A;  3IQA A;  5GHY A;  4WEL A;  5EEC A;  1GHM A;  3HUN A;  3VP1 A;  2XFT A;  4ZJ3 A;  4UAA A;  4E3K A;  4WMC A;  5E2E A;  3OPP A;  1K54 A;  4Y0U A;  1SKF A;  3HLW A;  4PM7 A;  3IXD A;  4HEF A;  3HUM A;  3PBT A;  3UE3 A;  2OV5 A;  1FR1 A;  1LLB A;  5EVI B;  2H5S A;  1K4F A;  1VM1 A;  2Z2L B;  1XXM A;  1RGZ A;  2DNS A;  3WS5 A;  5AQ9 A;  3G2Y A;  3EQV A;  4OPQ A;  1NJ4 A;  2PBY A;  4PPR A;  5FI6 A;  4DRT A;  3NBL A;  3OPR A;  3CG5 A;  3ZGA B;  2IWD A;  4MNR A;  4Y0O A;  5E2G A;  3MXS A;  2H0Y A;  4KG2 A;  5CTM A;  1J9M A;  2CC1 A;  1WE4 A;  4UA9 A;  3SS4 A;  4JKT A;  4XXR A;  2FFY A;  2ZLY A;  3IT9 A;  5G18 A;  3A3E A;  2V20 A;  3PAG A;  1PYY A;  1JVJ A;  4X53 A;  3RJU A;  4R4S A;  2XQZ A;  5GL9 A;  4OQH A;  1KGG A;  2HP6 A;  3BRM A;  4JLF A;  1MWR A;  4BEN A;  2VGJ A;  1ALQ A;  4WMC D;  1CI9 A;  2P9V A;  1NRF A;  2PU4 A;  2Y91 A;  3Q7V A;  5FQQ A;  2R9W A;  3IF5 A;  1HTZ A;  4BQM A;  4ID4 A;  4BD1 A;  5JYP A;  3M6H A;  2V1Z A;  3BLS A;  3O88 A;  3UN7 A;  3GRJ A;  1MPL A;  5KMW A;  2QZ6 A;  3GMW A;  1M6K A;  3ISG A;  3UY6 A;  4LV0 A;  3TOI A;  3ZFZ A;  2WYX A;  5FQK A;  1I5Q A;  1WYB A;  3G32 A;  1K57 C;  3N4I A;  5AQ7 A;  5EOO A;  4QHC A;  2XK1 A;  4JXG A;  1YMX A;  3BFD A;  4F94 A;  1FCO A;  4P85 A;  2ZC7 A;  3VMA A;  3JYI A;  4Y0T A;  4KZ4 A;  2J8Y A;  2QMI A;  5HW3 A;  1YLW A;  1PZP A;  3E2K A;  2QPN A;  3BFC A;  2PU2 A;  3QHY A;  4E3N A;  3DTM A;  4LCM A;  3LO7 A;  1EI5 A;  1C3B A;  3P09 A;  3Q1F A;  2G2W A;  3I7J A;  3IXG A;  1BUL A;  2H10 A;  2XD1 A;  3MKE A;  4R3B A;  1YMS A;  3IXH A;  4KZ6 A;  3HLD A;  4X56 A;  3HL9 A;  2VGK A;  4IBX A;  4ZJ2 A;  3C5A A;  3ITB A;  1PW8 A;  4KQQ A;  5KSC A;  5CHM A;  4KZ3 A;  1CI8 A;  3A3D A;  4ZBE A;  4PM6 A;  4U0T A;  2EX9 A;  5GLB A;  1IKI A;  3G34 A;  1XX2 A;  4S2M A;  4NET A;  3A3F A;  4WM9 A;  4DE1 A;  4S2I A;  2WZZ A;  1ZG4 A;  3BFE A;  4MLL A;  5FAS A;  4RX2 A;  4UHU A;  1NY0 A;  1ESI A;  1L2S A;  2OSU A;  5F83 A;  3UDF A;  2Y2Q A;  2B5R A;  1IEM A;  2Y2M A;  5J8X A;  1E4D A;  3FWL A;  3E2L A;  2WKI A;  5F82 A;  3BEB A;  2RL3 A;  3FYZ A;  2R9X A;  1CEF A;  1IKG A;  4M3K A;  3TG9 A;  4N9K A;  5CGX A;  4R1G A;  5CEB A;  1KGF A;  4P6B A;  3UPO A;  4RX3 A;  3IF6 A;  4GD8 A;  2J9O A;  2XDM A;  3Q82 A;  3UE1 A;  3ZVW A;  4FSF A;  2BLS A;  2ZC5 B;  4OP8 A;  3ZNT A;  4DE3 A;  3C4O A;  5L2F A;  1BSG A;  1ESU A;  1MKI A;  4KQR A;  4KQO A;  1K6R A;  3GR2 A;  2HDS A;  4O7D A;  1RCJ A;  5HL1 A;  1RGY A;  4JPM A;  4N92 A;  4WEK A;  1ES4 A;  3UNW A;  4DXC A;  4DDS A;  3ZG7 B;  4N1X A;  2EFX A;  4K0X A;  4R4R A;  5CTN A;  1S6R A;  2ZM2 A;  1KVM A;  4BLM A;  4BJP A;  1K6S A;  4MEZ A;  4WBG A;  4GOG A;  1JTG A;  5IHV A;  1BLS A;  1YM1 A;  3ZG9 B;  2IWC A;  2ZQ8 A;  4S2N A;  5EE8 A;  4X69 A;  3BEC A;  4OOM A;  5EVI A;  3C7V A;  2E8I A;  3C7U A;  4WEJ A;  4QJG A;  1XGI A;  1GA0 A;  3BFG A;  3NI9 A;  1CEG A;  4PMA A;  3ZDJ A;  1H8Y A;  3IWQ A;  1JWZ A;  3ZCZ A;  3GQZ A;  1KE4 A;  3WRZ A;  5A93 A;  5FQI A;  4EBL A;  4IVI A;  1NZU A;  2IWB A;  1TEM A;  1LI0 A;  2WKE A;  3AGD A;  3PBO A;  4Q8I A;  3ZVT A;  2XLN A;  4E3I A;  3SH8 A;  4EBP A;  3M2K A;  4K0W A;  3OCL A;  3W4Q A;  1MBL A;  1W79 A;  4DDY A;  2I72 A;  5E2F A;  3GTC A;  1MWS A;  2XF3 A;  4N9L A;  2Y2P A;  3P98 A;  5FA7 A;  1XGJ A;  1LHY A;  5AQA A;  4EWF A;  4QY6 A;  2J7V A;  5CHJ A;  2Y2I A;  2ZMA A;  4GNU A;  1DY6 A;  3WS2 A;  3NDG A;  2EFU A;  5AQB A;  2HP5 A;  1ES2 A;  5GHZ A;  1O7E A;  3D4F A;  4R23 A;  1KDS A;  2FFF B;  2Y2K A;  3M6B A;  4R3J A;  3VP3 A;  4JF5 A;  1ZC2 A;  4IVK A;  4BD0 A;  1S0W A;  1ERQ A;  1YLJ A;  3IF6 C;  4GB7 A;  1NYM A;  5FQ9 A;  3GSG A;  3HUO A;  4RYE A;  4FH2 A;  5CGW A;  5EPH A;  3FV7 A;  1FR6 A;  3PBN A;  4JXS A;  5FI2 A;  3HLG A;  2P74 A;  2ZQC A;  4KG5 A;  1K57 A;  3IXB A;  1CK3 A;  5I94 A;  3W4O A;  1H8Z A;  4HES A;  3RXX A;  1PIO A;  2HDU A;  3MZE A;  2WGW A;  1K56 D;  2Y2J A;  3G35 A;  3HVF A;  5KZH A;  1JWP A;  2XH9 A;  4ZTK A;  1K4E A;  4K91 A;  3N6I A;  1ZG6 A;  1TVF A;  3EQU A;  5EVI C;  1VQQ A;  3TSG A;  4BL3 A;  5F1F A;  4H8R A;  2XGN A;  3NCK A;  4RVA A;  1E3U A;  4S2N C;  4LEN A;  4Y7P A;  2WUQ A;  1LI9 A;  5E43 A;  3WS0 A;  4ZAM A;  4E6X A;  1I2W A;  1KE3 A;  4QB8 A;  3N8S A;  4X68 A;  3M2J A;  5FAO A;  3VOY A;  4E3L A;  1HVB A;  4WYY A;  3BYD A;  4E3J A;  3N8R A;  1JTD A;  1N4O A;  4OQI A;  5FAP A;  3ZNY A;  4JXV A;  1FSY A;  1ES3 A;  4PM8 A;  2XFS A;  1YLT A;  4BL2 A;  1PWC A;  1BZA A;  1XA7 A;  3WRT A;  4A5R A;  1SHV A;  2P9V B;  2ZQA A;  5E2H A;  3UO9 A;  1Z6F A;  1GCE A;  1Q2Q A;  1BT5 A;  1W7F A;  2WAD A;  3PAE A;  4CJN A;  3WS4 A;  5DVA A;  4JF6 A;  4OPR A;  2OLU A;  4JF4 A;  3IHA A;  3VOZ A;  2DCF A;  3IHB A;  3LY4 A;  2Y55 A;  3MFD A;  3V3S A;  1FCM A;  1PZO A;  3SH9 A;  4DF6 A;  3NDE A;  3V39 A;  1QMF A;  1N9B A;  3BM6 A;  5CGS A;  4DXB A;  4EUZ A;  1TDL A;  1LL5 A;  1KDW A; 
#chains in the Genus database with same CATH topology
 2C6W B;  2EX6 A;  4NXB A;  5FQM A;  4HBT A;  4WZ5 C;  5M19 A;  1GA9 A;  3P01 A;  1J3W A;  4RR8 A;  4EV4 A;  4RRA A;  2KX6 A;  3UDI A;  1SDE A;  2WGI A;  2ZM0 A;  1G68 A;  1XP4 A;  3Q07 A;  1V9Z A;  1YLP A;  2G2U A;  3V5M A;  3PD4 A;  2VKS A;  4OLG A;  1IYO A;  4S2P A;  2KDK A;  2WGV A;  4O8G A;  1E25 A;  1PWD A;  4OON A;  1HZO A;  5IU1 A;  4GS9 B;  3CMZ A;  3LY3 A;  4D60 A;  1K38 A;  5DTS A;  2L1M A;  5D3O A;  3ZHH A;  4DKI A;  1PFL A;  1MWT A;  2ZC6 B;  1S1Z A;  3VP4 A;  3NY4 A;  4KZ7 A;  1LSV A;  3IF6 B;  3T4J A;  1UWN X;  1OME A;  3MF0 A;  2WGW B;  5EVL A;  2Z2M B;  2XA7 S;  3ZQ5 A;  3ZG0 A;  5IS1 A;  3B42 A;  4GS9 A;  4ESP A;  3QP5 A;  3PBR A;  4B9O A;  3S22 A;  1XPB A;  4DE0 A;  3QNB A;  4EXO A;  3IWO A;  1SCW A;  4P87 A;  3MKF A;  5BOH A;  3LR3 A;  3C8C A;  1L0F A;  4B4Z A;  3VP0 A;  3O86 A;  1HD8 A;  4DN0 A;  4PM5 A;  3PTE A;  4OLD A;  3MBZ A;  1NXY A;  1X0O A;  2QKP A;  4WZ4 A;  4MBH A;  2EX2 A;  5F5Y A;  2DRW A;  1YT4 A;  3P7N A;  2W3D A;  3OPL A;  1FSW A;  1L0D A;  2H28 A;  4EQI A;  3PHY A;  3S1Y A;  4HY8 A;  3MZF A;  3VSL A;  1OJ5 A;  3MSH A;  3Q7V B;  4LV3 A;  3HJK A;  3DWZ A;  4LV2 A;  1ERO A;  2PHY A;  2PYP A;  4OPZ A;  3WWX A;  1GHI A;  5M1A A;  4F3L A;  4DE2 A;  3PD3 A;  3FKW A;  3G31 A;  3F1P B;  3T4O A;  3MZD A;  3DAV A;  2HZ5 A;  3AGE A;  1ZHH B;  3CZD A;  3HBR A;  1FCN A;  5DF7 A;  2X02 A;  3KNF A;  5EFW A;  3SW1 A;  3HLF A;  4QD4 A;  3AGF A;  3Q7Z A;  4Z9Q A;  5A90 A;  3ZG5 A;  3C30 A;  4GDB A;  1DJA A;  2Y2H A;  3PBQ A;  1ES5 A;  5IT5 A;  3DW0 A;  1HLU P;  1K54 C;  5FI7 A;  4S2L A;  1VEU B;  4D2O A;  1ZKJ A;  3LIE A;  5JYO A;  3BY9 A;  2M7U A;  2OLV A;  4WEL A;  3LIF A;  2UV0 E;  1VET B;  3OLO A;  4WMC A;  5AJG A;  4Y0U A;  4HEF A;  3HUM A;  4NBJ A;  4HIA A;  1T1C A;  4S03 A;  1FR1 A;  2I9V A;  2XSS A;  3WS5 A;  5FI6 A;  2PBY A;  3VE3 A;  4DRT A;  2IWD A;  4MNR A;  1UGU A;  2CC1 A;  4HP4 A;  1DP6 A;  3SS4 A;  5F68 A;  2ZLY A;  3IT9 A;  3A3E A;  1YAX A;  2ZL1 B;  3RJU A;  4R4S A;  2B95 A;  1KGG A;  3BRM A;  3S7N A;  5HPI A;  4ID4 A;  4EET B;  3M6H A;  3BLS A;  3EOI A;  5KMW A;  2WYX A;  5FQK A;  3G32 A;  5FDS A;  3KSH A;  1YMX A;  3R7W A;  4KZ4 A;  1A0K A;  3E2K A;  3DBA A;  4S0J A;  1KOU A;  1C3B A;  5HSQ A;  1BUL A;  3OBF A;  1S66 L;  3MKE A;  1YMS A;  2V8C A;  3JVU A;  4KZ6 A;  4X56 A;  4BBT A;  3T4L A;  4RR7 A;  4KQQ A;  1CI8 A;  4ZBE A;  2GNX A;  4U0T A;  4R6L A;  3G34 A;  4NET A;  1F98 A;  1ZG4 A;  3BFE A;  4MLL A;  4GCZ A;  1ESI A;  2INW A;  2Y2Q A;  2B5R A;  1IEM A;  4WL9 A;  2QJ7 A;  3FWL A;  4Q0I A;  3BEB A;  4XT2 B;  3FYZ A;  3NUL A;  5FEF A;  1IKG A;  4HOI A;  4N9K A;  3T4Q A;  4RX3 A;  4FOF A;  4GD8 A;  2HF6 A;  3PXP A;  3ZVW A;  2ZC5 B;  2HGV A;  1GSV A;  1ESU A;  3LIB A;  3GR2 A;  2V0U A;  3BQ8 A;  1RCJ A;  5HL1 A;  2ACG A;  1G28 A;  2XRN A;  3V67 A;  3LR4 A;  4DDS A;  3CIT A;  1H0M A;  4NXE A;  4BLM A;  4BJP A;  4WBG A;  1YKD A;  4ARZ A;  4EER A;  5IHV A;  2ZQ8 A;  3FPW A;  4X69 A;  3F1P A;  1XJ3 A;  1ODV A;  1XGI A;  3E4Q A;  1OTI A;  3BFG A;  4NKP A;  3KO5 A;  5TBM B;  2Z6C A;  1JWZ A;  1KE4 A;  3QP4 A;  4HH2 A;  4IVI A;  2P04 A;  2OAQ 1;  4EBP A;  3M2K A;  4RQ9 A;  3FPV A;  4Y3I A;  1MBL A;  1W79 A;  3GTC A;  4MN7 A;  3C38 A;  4N9L A;  4R38 A;  3F1N A;  1XGJ A;  1LHY A;  2ZMA A;  2VV8 A;  5AQB A;  3F1O B;  5GHZ A;  2FFF B;  3M6B A;  4JF5 A;  3EEA A;  1ZC2 A;  1ERQ A;  1YLJ A;  3IF6 C;  5FQ9 A;  4I3I A;  3GSG A;  5HDS A;  2PAV P;  3CUE C;  5CGW A;  5EPH A;  2ZQC A;  3IXB A;  1YPR A;  1PIO A;  2HDU A;  2Y2J A;  5KZH A;  2XH9 A;  1F2K A;  4K91 A;  1ZG6 A;  1TVF A;  3EQU A;  4KQD A;  4H8R A;  2JKT I;  2HKZ A;  4Y7P A;  3WS0 A;  1LI9 A;  1VEU A;  1KE3 A;  4E3L A;  3MQQ A;  4E3J A;  1P9W A;  5TBM A;  4OQI A;  5FAP A;  3ZNY A;  1LT0 A;  4JXV A;  1IFQ A;  4BL2 A;  1BZA A;  1N9O A;  3UO9 A;  5J4E A;  1GCE A;  1BT5 A;  1W7F A;  3T4T A;  4RRF A;  4JF6 A;  4OPR A;  2OLU A;  4JF4 A;  3IHA A;  2JN7 A;  1Y28 A;  3NDE A;  3V39 A;  1N9B A;  5DKL A;  5G4Y A;  4PM9 A;  4MBF A;  5GLA A;  5FAT A;  1L0E A;  2EX8 A;  1Y54 A;  2BTF P;  2V8F A;  4S2K A;  3IBR A;  5A91 A;  2ZL1 A;  3UE0 A;  3SOI A;  1D1J A;  2Y2O A;  2O99 A;  4DMZ A;  2Y4A A;  4GD6 A;  3CPT A;  4HP9 A;  2HDR A;  4EBN A;  1FIL A;  4WUJ A;  4L9G A;  4ETX A;  3PR6 A;  5HAQ A;  2Y59 A;  4UA7 A;  1S4S A;  1L0G A;  5CER A;  1VET A;  4RRJ A;  2M7V A;  1L3L A;  3EWK A;  1ONH A;  2EWW A;  2XRO A;  1FQG A;  4OOL A;  4X6T A;  4EQ1 A;  1AXB A;  2ZQD A;  5A92 A;  5GLC A;  1BLP A;  3NHQ A;  3O3V A;  3VP2 A;  4CLC C;  1XJ2 A;  1WYC A;  4HJ3 A;  4C75 A;  1K25 A;  3UB6 A;  5EUA A;  3PD5 A;  3LIA A;  3D9Y A;  4UA6 A;  2OOL A;  3IH8 A;  3BQA A;  1E3U D;  5F69 A;  4EUV A;  3IWI A;  2V2F F;  5CEC A;  2Q0O A;  1ERM A;  3FZC A;  3N8L A;  2W27 A;  5G4Z A;  3MR0 A;  2JKR I;  1KVL A;  3WS1 A;  2WAF A;  3CI6 A;  1OT9 A;  2K2N A;  5HAI A;  5CXW A;  3FKV A;  5F1G A;  4FTX A;  4H6J A;  4KZ5 A;  3VFH A;  2Q9M A;  4EU0 A;  1FOF A;  3BFF A;  3R4K A;  1MKM A;  1Q2P A;  4XUZ A;  4U3T A;  3QNC A;  2PRF A;  1IYQ A;  1IEL A;  4UQI M;  1MWU A;  3FG8 A;  2QWS A;  1M40 A;  3A3J A;  5A8B A;  1NZO A;  3H9W A;  1EW0 A;  3MMH A;  4OKP A;  4C3Q A;  2HV1 A;  4R70 A;  3UDX A;  3NIA A;  5EM0 A;  4C6Y A;  5M18 A;  1AWI A;  1T1B A;  3KX0 X;  2HPB A;  4QY5 A;  4ARZ B;  2XR0 A;  3E0Y A;  4AFI A;  3CJM A;  1W8Q A;  4E6W A;  3NJA A;  4OQG A;  1JWV A;  3JPU A;  1F5M A;  3UB5 P;  1W63 Q;  3IBJ A;  2H0T A;  4KEN B;  4YFM A;  1NLZ A;  1IYS A;  1O07 A;  2JHE A;  2C5W B;  4R0Q A;  4I3J A;  3H82 B;  5TR7 A;  4HBU A;  1MXO A;  2Y2N A;  4WZ5 A;  2ZC3 B;  4CLC E;  2J9P A;  2YKH A;  1KGE A;  1OTE A;  3B3X A;  3E4P A;  3ZG8 B;  3UPP A;  5FAQ A;  2ZQ7 A;  4YOF A;  3VE4 A;  3H7W B;  2WKH A;  2WKQ A;  2KLI A;  4P0M A;  2V1B A;  4Y15 A;  5HDC A;  2J3T C;  5EEC A;  1LSW A;  2J80 A;  4ZJ3 A;  4UAA A;  5E2E A;  3HLW A;  4PM7 A;  4RRC A;  3PBT A;  5DJU A;  3UE3 A;  1G6O A;  4BBU A;  5L10 A;  4GHI A;  3KYZ A;  1XXM A;  4OPQ A;  3NBL A;  3ZGA B;  4Y0O A;  5E2G A;  3NOU C;  1WE4 A;  1TS6 A;  2FFY A;  5G18 A;  2P7J A;  5LBR A;  2V20 A;  3LI9 A;  1PYY A;  2W1R A;  3D72 A;  3MFX A;  2HP6 A;  1H8M A;  1MWR A;  4WMC D;  1CI9 A;  1NRF A;  3CPT B;  4Q0J A;  3IF5 A;  1HTZ A;  4BQM A;  3UMD A;  2V1A A;  2ZOH A;  3GRJ A;  4IUH A;  1MPL A;  2QZ6 A;  1M6K A;  4S0L A;  3ZFZ A;  1WYB A;  3N4I A;  4X1L A;  5EOO A;  2XK1 A;  3JYI A;  1S1Y A;  4I5S A;  5AVE A;  2QMI A;  1D06 A;  5HW3 A;  1YLW A;  3QHY A;  2O9A A;  1EI5 A;  3Q1F A;  4LFU A;  3PYP A;  4MCW A;  3HLD A;  4GW9 A;  3NOP C;  4MN5 A;  3LI8 A;  3F1O A;  4DE1 A;  2WZZ A;  5FAS A;  1NY0 A;  1L2S A;  5F83 A;  3UDF A;  3MQ0 A;  2Y2M A;  1E4D A;  3LFV A;  3E2L A;  4II7 A;  4HQA A;  1TC5 A;  4ETZ A;  4R1G A;  3UPO A;  5L07 A;  2AVX A;  2JKR M;  1OJG A;  2BLS A;  2JKG A;  3QP6 A;  1G5U A;  3W2Z A;  1BSG A;  4KQR A;  2XA7 M;  4Y2F A;  4JPM A;  2A2L A;  2DBO A;  2O9B A;  4N1X A;  2WKR A;  2ZM2 A;  4GOG A;  4NBI A;  5J61 A;  4L9E A;  3ZG9 B;  4S2N A;  5EE8 A;  2PBD P;  3BEC A;  4OOM A;  2E8I A;  4WEJ A;  3LMU A;  3A0S A;  1CEG A;  3IWQ A;  2PT7 A;  3U4L P;  1TF1 A;  4HNB A;  5FQI A;  2O0Y A;  4EBL A;  1NZU A;  1TS8 A;  1LI0 A;  2GZA A;  4Z1W A;  3T4K A;  3AGD A;  4Q8I A;  4GLQ A;  4RRG A;  4K0W A;  2PDR A;  2I72 A;  1MWS A;  2XF3 A;  4LLO B;  3CHW P;  1F9I A;  4QY6 A;  2J7V A;  5CHJ A;  2Y2I A;  4GNU A;  1XJ4 A;  3NDG A;  3KSF A;  2DMW A;  3K3D A;  2L0W A;  1O7E A;  3D4F A;  4RR6 A;  4GHI B;  4IVK A;  4RRK A;  2BAS A;  1Z09 A;  1DRM A;  2JKT M;  3FV7 A;  1FR6 A;  3PBN A;  4JXS A;  2P74 A;  4KG5 A;  2PD8 A;  5DJT A;  5J3W A;  2WGW A;  5EVI C;  3TSG A;  2XGN A;  3NCK A;  4RVA A;  1E3U A;  4LEN A;  2WUQ A;  2G7U A;  3LID A;  2R78 A;  1I2W A;  4QB8 A;  3KOD A;  3M2J A;  3CUE A;  3VOY A;  2HL0 A;  1LL8 A;  2P08 A;  2ZMV A;  3N8R A;  1ES3 A;  4IHQ A;  1OTA A;  1YLT A;  2GX5 A;  2KOI A;  5EV0 A;  1XA7 A;  4A5R A;  2ZQA A;  2FZ0 A;  2WAD A;  4CJN A;  2LB9 A;  5DVA A;  4PAU A;  1GSW A;  2DCF A;  3IHB A;  3LY4 A;  3V3S A;  5TJJ A;  3SH9 A;  4DF6 A;  4EUZ A;  4P85 A;  1KDW A;  3L9K A;  4GN2 A;  3HRE A;  4OOY A;  5HZH A;  4RA7 A;  3BLM A;  2QHK A;  3TW8 A;  3SS5 A;  1OT6 A;  5K5B A;  4MMN A;  3FC7 A;  4B88 A;  2Y2G A;  5EM1 A;  3GVB A;  4MBK A;  1PW1 A;  4XUX A;  1YQS A;  4ZDX A;  4I3A A;  3B33 A;  1D7E A;  2WZX A;  3MXQ A;  1XKZ A;  3VOL A;  2JBF A;  3RXW A;  4EEU A;  5FEG A;  3LCE A;  3HLE A;  2ZM8 A;  2EXA A;  2A24 A;  3OCN A;  3V3R A;  2A24 B;  2XEP A;  3UB9 A;  5DTK A;  2XD5 A;  4X1M A;  1YLZ A;  1K55 A;  3G2Z A;  4NG2 A;  4GKU A;  1VB6 A;  4OQ0 A;  5HFO A;  3SS3 A;  5HAP A;  5DF9 A;  1T18 A;  2PYR A;  1BTL A;  5AVF A;  2BG1 A;  1W5D A;  5CRF A;  2D01 A;  2D02 A;  4PHT A;  1LL9 A;  2OWH A;  4X55 A;  2K31 A;  1K56 A;  2Q9N A;  3LMV A;  4WF0 A;  4OPY A;  1NLY A;  4ME4 A;  2HP9 A;  4O01 A;  2Y2L A;  5HWW A;  4L9F A;  4NXG A;  2WK0 A;  1YLY A;  3A3I A;  2VV7 A;  4YIN A;  2ZQ9 A;  3DWK A;  2RCX A;  2VX8 A;  2HJ9 C;  4KZA A;  4S0K A;  3UME A;  2ZD8 A;  1PI4 A;  5C5K A;  1P0Z A;  1P9R A;  2K7S A;  5HX9 A;  4O0P A;  4G3W A;  4OH0 A;  2A3U A;  5DF8 A;  3HLB A;  5FSR A;  4KZ9 A;  4CLC A;  3OC2 A;  1PRQ A;  3LR0 A;  5HD5 A;  3W4P A;  4M4X A;  3R7W B;  4MN6 A;  4CPK A;  3EEH A;  3D3O A;  1OPX A;  4JGP A;  4YNR A;  1PWG A;  2X71 A;  2W3E A;  3UB8 A;  4KG6 A;  3Q81 A;  2JKF A;  3EGX C;  1RP5 A;  3GDI A;  1YSP A;  3N7W A;  3W8K A;  5I5L A;  3G4P A;  3KYQ A;  4E3M A;  2ZC4 B;  3T4S A;  5FQJ A;  2JCH A;  5GLD A;  4IBR A;  1CF0 A;  2VEA A;  4U0X A;  3V50 A;  3OZH A;  2W3H A;  3MXR A;  4X25 A;  3H7W A;  5GHY A;  3KYE A;  4EW7 A;  2QYB A;  4PKY A;  1GHM A;  1GSX A;  2XFT A;  3T1X A;  4HH3 A;  3OPP A;  1SKF A;  3LYX A;  2GJ3 A;  2OV5 A;  1T1A A;  1LLB A;  5EVI B;  2H5S A;  1VM1 A;  1WA9 A;  1RGZ A;  2DNS A;  5FL3 A;  3VV4 A;  5AQ9 A;  1NJ4 A;  2WKP A;  3MXS A;  2H0Y A;  5CTM A;  3BY8 A;  4UA9 A;  1FIK A;  3PAG A;  1JVJ A;  1N9L A;  5GL9 A;  1ALQ A;  2VGL M;  3BWL A;  2Y91 A;  3Q7V A;  5FQQ A;  4BD1 A;  2V1Z A;  2YKF A;  3GMW A;  3ISG A;  3UY6 A;  4LV0 A;  3MJQ A;  5AQ7 A;  4RRI A;  4JXG A;  1OTB A;  4K08 A;  1FCO A;  2ZC7 A;  3VMA A;  2J8Y A;  4Q0H A;  1PZP A;  2QPN A;  3S7P A;  3B47 A;  1CQA A;  3DTM A;  3QP1 A;  4I39 A;  3LO7 A;  4LRX C;  3P09 A;  4Y5F A;  2G2W A;  2NUP C;  3I7J A;  2XD1 A;  4R3B A;  3IXH A;  4DJ2 A;  3HL9 A;  2VGK A;  4IBX A;  4Y17 A;  4ZJ2 A;  1PW8 A;  5CHM A;  3BJN A;  3A3D A;  3ZYT A;  2EX9 A;  1IKI A;  3MS6 A;  4S2M A;  3A3F A;  4S2I A;  4P6Z M;  4RX2 A;  2VLG A;  3LIC A;  5F82 A;  2RL3 A;  2MJ6 A;  1CEF A;  4LRZ E;  5HL6 A;  4M3K A;  5CGX A;  4P6B A;  3IF6 A;  2J9O A;  4FSF A;  3ZNT A;  5MC7 A;  3O5Y A;  5L2F A;  1MKI A;  1H3Q A;  1K6R A;  3RTY A;  2HDS A;  4O7D A;  3KNP A;  1PNE A;  4N92 A;  4DXC A;  2B02 A;  2PR5 A;  2EFX A;  4K0X A;  1S6R A;  1KVM A;  1Y2Q A;  3L7H A;  3IX3 A;  2IWC A;  2W1T B;  2J3T D;  2FH5 A;  2EA9 A;  3C7U A;  1XJ6 A;  3HCY A;  1GA0 A;  3NI9 A;  1T19 A;  3ZDJ A;  3DTK A;  3RH8 B;  3ZCZ A;  3WRZ A;  2HJE A;  5A93 A;  1JKE A;  1TEM A;  3ZVT A;  4E3I A;  1BYW A;  3SH8 A;  3HJI A;  3KO7 A;  2CMN A;  4RR9 A;  2Y8H A;  5E2F A;  4PKY G;  4FUW A;  2Y2P A;  3P98 A;  5FA7 A;  5AQA A;  4F3L B;  1DP8 A;  2W3F A;  1DY6 A;  5L09 A;  3IS2 B;  2HP5 A;  1ES2 A;  2VJW A;  1CJF A;  2Y2K A;  3VP3 A;  4HI4 A;  4GB7 A;  4FH2 A;  2IA2 A;  5FI2 A;  3HLG A;  1K57 A;  3F1N B;  2OAP 1;  1CK3 A;  3W4O A;  4RRL A;  3CWF A;  3RXX A;  3ICY A;  3G35 A;  1K56 D;  3HVF A;  1JWP A;  3N6I A;  4HJ4 A;  4BL3 A;  1VQQ A;  5F1F A;  3T1Q B;  4S2N C;  1W63 M;  1VHM A;  4JGQ A;  2OKV A;  4RRH A;  4X68 A;  2NUT C;  1HVB A;  1V9Y A;  3BYD A;  1JTD A;  1FSY A;  3KOB A;  4PM8 A;  2M1C A;  4WN5 A;  3KSG A;  2XFS A;  2O9C A;  3G6O A;  4EEP A;  2VGL S;  3WRT A;  1SHV A;  2P9V B;  5E2H A;  1Q2Q A;  3PAE A;  4XT2 A;  3WS4 A;  3IS2 A;  3VOZ A;  1UWP X;  2Y55 A;  4EES A;  1PZO A;  3BM6 A;  4JGO A;  3CLO A;  1NRJ A;  3OOV A;  4N1H A;  1XFN A;  3KOC A;  1QME A;  1XA1 A;  4FCF A;  4UEY A;  2ZJ9 A;  2J3W A;  3EGD C;  4I38 A;  3NOT C;  3S7O A;  2VZW A;  2W1T A;  5TFQ A;  4P6Z S;  4FD8 A;  1DJB A;  1W8Y A;  4IJG A;  1DP9 A;  4GDN A;  4IUK A;  1ACF A;  1K55 C;  2JE5 A;  1J7G A;  1SDN A;  5CED A;  1BLC A;  1EWZ A;  4FH4 A;  1IYP A;  1STZ A;  1BUE A;  2B18 A;  1S67 L;  2E8J A;  2Y79 A;  2EXB A;  1PI5 A;  2X01 A;  3GV9 A;  2UWX A;  4RRB A;  3NC8 A;  4JBF A;  5DFY A;  3UPN A;  5J7E A;  4L0L A;  1I2S A;  1GHP A;  4OP5 A;  3TE8 A;  3C4P A;  3O87 A;  3ITA A;  3VSK A;  1TDG A;  4ZJ1 A;  5TGF A;  5DKK A;  4G3V A;  3SH7 A;  3UE6 A;  5CHU A;  3NEC A;  4QWO A;  3HLC A;  4E04 A;  4NK3 A;  3A0V A;  5FDH A;  5HDD A;  3IH9 A;  4CLC B;  3TJZ C;  2JC7 A;  4GZB A;  5DTT A;  3PBS A;  4OVD A;  3LR5 A;  4QU3 A;  2GDN A;  4B4X A;  2WAE A;  4S02 A;  1P97 A;  3OPH A;  4LGW A;  3QP2 A;  2VK3 A;  1IOU A;  4LCL A;  3K2N A;  2Z6D A;  5HAR A;  4NXF A;  5DFX A;  5KSH A;  4LV1 A;  4DJ3 A;  4JXW A;  4RRR A;  2A49 A;  4B93 A;  3VFF A;  1K0K A;  4JGR A;  1NYY A;  4WLA A;  2HDQ A;  4MDZ A;  1G6A A;  4S2O A;  1BLH A;  4KZB A;  1KE0 A;  1H5X A;  3S4X A;  4CQH A;  3MQO A;  1MY8 A;  2HL2 A;  4KZ8 A;  2PR6 A;  1JNU A;  3BW6 A;  2QJ5 A;  4E3O A;  2VV6 A;  1ONG A;  1U60 A;  5EOE A;  5U47 A;  2W0N A;  3DTE A;  3IX4 A;  5KIZ A;  4S2J A;  3G30 A;  4G3K A;  4GJ4 A;  3LEZ A;  5EVI D;  4IED A;  5L8M A;  1DJC A;  5GHX A;  3IQA A;  3LMT A;  3HUN A;  3VP1 A;  3T1R A;  4RRM A;  4E3K A;  4KUO A;  3DTI A;  1K54 A;  1ZTU A;  3IXD A;  1NWZ A;  2ZBB A;  2VA0 A;  1K4F A;  3JVV A;  2Z2L B;  3G2Y A;  3EQV A;  4PPR A;  3OPR A;  3CG5 A;  1S4R A;  4KG2 A;  1J9M A;  1SZV A;  4JKT A;  4XXR A;  5HPF A;  4X53 A;  2XQZ A;  4OQH A;  3C2W A;  3IX8 A;  4JLF A;  4NEE D;  4BEN A;  2VGJ A;  2P9V A;  2PU4 A;  2R9W A;  2PD7 A;  5JYP A;  3O88 A;  3UN7 A;  3PD2 A;  4HHD A;  3E98 A;  3TOI A;  1I5Q A;  1K57 C;  1TD5 A;  4QHC A;  1LSX A;  2ZOI A;  3BFD A;  4F94 A;  4Y0T A;  4RRQ A;  2OWJ A;  3BFC A;  2PU2 A;  4E3N A;  4LCM A;  3T50 A;  4KUK A;  3K3C A;  3E4O A;  3KO4 A;  3IXG A;  2H10 A;  4BBV A;  2V9A A;  3C5A A;  3ITB A;  5KSC A;  4KZ3 A;  4PM6 A;  5GLB A;  4RRD A;  1XX2 A;  5HWV A;  4WM9 A;  4CLC D;  4UHU A;  2OSU A;  5J8X A;  2WKI A;  2R9X A;  3CAX A;  4H6J B;  3TG9 A;  2W3G A;  5CEB A;  1KGF A;  2XDM A;  3Q82 A;  3KO3 A;  3UE1 A;  4OP8 A;  3LEQ A;  4DE3 A;  3C4O A;  4KQO A;  5EVE A;  1MZU A;  5HD3 A;  2ZMF A;  1RGY A;  4Y13 A;  4BWI A;  4WEK A;  1ES4 A;  1YSQ A;  3UNW A;  3ZG7 B;  1SKO B;  4R4R A;  5CTN A;  1MC0 A;  1N9N A;  1K6S A;  4MEZ A;  1JTG A;  1BLS A;  1YM1 A;  3A0R A;  3UB7 A;  3QP8 A;  5EVI A;  3C7V A;  3KO9 A;  4QJG A;  4LPZ A;  1OTD A;  4PMA A;  1H8Y A;  1TS7 A;  1XFQ A;  2LB5 A;  3GQZ A;  2IWB A;  3GEC A;  3S7Q A;  2WKE A;  4LRY C;  3PBO A;  2XLN A;  3T1S A;  3OCL A;  3W4Q A;  2V0W A;  4BMW A;  2L4R A;  4QPR A;  3T12 B;  4DDY A;  1TS0 A;  4EWF A;  5HWT A;  3WS2 A;  2EFU A;  2EWV A;  4R23 A;  1KDS A;  4R3J A;  3TRC A;  5CX7 A;  4BD0 A;  1S0W A;  1NYM A;  3HUO A;  4RYE A;  1Y4O A;  3ULF A;  3LUQ A;  1SKO A;  5I94 A;  1H8Z A;  4HES A;  3MZE A;  3KO6 A;  4ZTK A;  1K4E A;  3U2A A;  5E43 A;  4ZAM A;  4E6X A;  3N8S A;  4R3A A;  5FAO A;  4WYY A;  4YWZ A;  1N4O A;  4S0I A;  3LGO A;  2HL1 A;  4UQI S;  1PWC A;  5F6A A;  3RFB A;  3H82 A;  1Z6F A;  4HJ6 A;  4ZRR A;  3SZT A;  3MFD A;  3KSI A;  1FCM A;  1QMF A;  5CGS A;  4DXB A;  1TDL A;  1LL5 A; 
#chains in the Genus database with same CATH homology
 2C6W B;  2EX6 A;  5FQM A;  4GN2 A;  4HBT A;  4PM9 A;  4WZ5 C;  4MBF A;  5GLA A;  5M19 A;  5FAT A;  4N1H A;  1GA9 A;  3KOC A;  4RR8 A;  3HRE A;  4OOY A;  1L0E A;  4EV4 A;  4RA7 A;  1QME A;  1Y54 A;  2EX8 A;  4RRA A;  3BLM A;  1XA1 A;  4FCF A;  4S2K A;  3UDI A;  3SS5 A;  1SDE A;  2WGI A;  2ZM0 A;  5A91 A;  1G68 A;  1XP4 A;  3Q07 A;  3UE0 A;  3SOI A;  2ZJ9 A;  2Y2O A;  1YLP A;  2G2U A;  4B88 A;  3V5M A;  3PD4 A;  2Y2G A;  2Y4A A;  4OLG A;  1IYO A;  3GVB A;  4GD6 A;  4MBK A;  4S2P A;  1PW1 A;  4XUX A;  1YQS A;  2WGV A;  5TFQ A;  4ZDX A;  4FD8 A;  2HDR A;  4EBN A;  1E25 A;  1PWD A;  4OON A;  1DJB A;  1HZO A;  1W8Y A;  2WZX A;  3CMZ A;  4GDN A;  3LY3 A;  1K38 A;  1K55 C;  1XKZ A;  2JE5 A;  2Y59 A;  5D3O A;  5DTS A;  5HAQ A;  1J7G A;  4UA7 A;  3ZHH A;  2JBF A;  3RXW A;  1SDN A;  4DKI A;  5CED A;  1L0G A;  3LCE A;  3HLE A;  5CER A;  1MWT A;  1BLC A;  2ZC6 B;  1EWZ A;  4FH4 A;  2ZM8 A;  2EXA A;  3VP4 A;  1IYP A;  3OCN A;  3NY4 A;  3V3R A;  4KZ7 A;  4RRJ A;  3IF6 B;  1ONH A;  2XEP A;  1BUE A;  1OME A;  1FQG A;  4OOL A;  5DTK A;  4X6T A;  2XD5 A;  1AXB A;  2ZQD A;  5A92 A;  2WGW B;  5EVL A;  5GLC A;  1BLP A;  2Z2M B;  1YLZ A;  3O3V A;  3VP2 A;  1K55 A;  2EXB A;  3ZG0 A;  1PI5 A;  3G2Z A;  2X01 A;  4GKU A;  4OQ0 A;  3GV9 A;  3PBR A;  1WYC A;  2UWX A;  5HFO A;  3SS3 A;  4C75 A;  5HAP A;  3S22 A;  1K25 A;  4RRB A;  5DF9 A;  5EUA A;  1XPB A;  3PD5 A;  3NC8 A;  4JBF A;  3UPN A;  4UA6 A;  4L0L A;  1I2S A;  1GHP A;  1BTL A;  3IH8 A;  4DE0 A;  2BG1 A;  1W5D A;  3QNB A;  1E3U D;  3IWO A;  5CRF A;  4OP5 A;  1SCW A;  4P87 A;  3MKF A;  5BOH A;  3IWI A;  2V2F F;  3C4P A;  3ITA A;  3O87 A;  3VSK A;  5CEC A;  1L0F A;  1ERM A;  1TDG A;  3FZC A;  1LL9 A;  3N8L A;  4ZJ1 A;  5TGF A;  4B4Z A;  4X55 A;  3VP0 A;  3SH7 A;  3O86 A;  1K56 A;  1KVL A;  2Q9N A;  3LMV A;  5CHU A;  1HD8 A;  2WAF A;  4OPY A;  3WS1 A;  4PM5 A;  3PTE A;  5HAI A;  5CXW A;  3FKV A;  3HLC A;  4OLD A;  5F1G A;  3MBZ A;  2HP9 A;  4NK3 A;  5FDH A;  4KZ5 A;  3IH9 A;  1NXY A;  4WZ4 A;  2Y2L A;  3VFH A;  4MBH A;  2Q9M A;  2EX2 A;  1FOF A;  2JC7 A;  3BFF A;  4GZB A;  1Q2P A;  4XUZ A;  4U3T A;  5DTT A;  2DRW A;  2WK0 A;  3PBS A;  3QNC A;  1YLY A;  3A3I A;  1IYQ A;  1IEL A;  4YIN A;  4OVD A;  1YT4 A;  2ZQ9 A;  4QU3 A;  3DWK A;  1MWU A;  2RCX A;  2GDN A;  4KZA A;  3OPL A;  4B4X A;  1M40 A;  1FSW A;  1L0D A;  3A3J A;  4EQI A;  1NZO A;  4C3Q A;  4S0K A;  4OKP A;  3S1Y A;  2WAE A;  3MZF A;  4S02 A;  3VSL A;  3Q7V B;  4LV3 A;  3UDX A;  3NIA A;  4C6Y A;  2ZD8 A;  1PI4 A;  5M18 A;  3DWZ A;  3OPH A;  4LV2 A;  2HPB A;  1ERO A;  4LCL A;  4OPZ A;  4QY5 A;  3WWX A;  2XR0 A;  1GHI A;  5M1A A;  5HX9 A;  3CJM A;  5HAR A;  4OH0 A;  2A3U A;  5DF8 A;  4DE2 A;  5KSH A;  3PD3 A;  3FKW A;  3G31 A;  3HLB A;  5FSR A;  4KZ9 A;  3MZD A;  1W8Q A;  4E6W A;  4LV1 A;  3OC2 A;  4OQG A;  1JWV A;  3AGE A;  3CZD A;  3HBR A;  4JXW A;  4RRR A;  2A49 A;  3W4P A;  1FCN A;  5DF7 A;  3VFF A;  4CPK A;  2X02 A;  3KNF A;  1NYY A;  2HDQ A;  2H0T A;  4KEN B;  3HLF A;  4QD4 A;  1PWG A;  3AGF A;  1G6A A;  2X71 A;  3Q7Z A;  4S2O A;  4YFM A;  1BLH A;  4Z9Q A;  4KZB A;  1IYS A;  1KE0 A;  1H5X A;  1O07 A;  3S4X A;  2C5W B;  5A90 A;  1MY8 A;  4KG6 A;  4R0Q A;  3ZG5 A;  3Q81 A;  2HL2 A;  1RP5 A;  5TR7 A;  4KZ8 A;  4HBU A;  3N7W A;  1MXO A;  4GDB A;  2Y2N A;  1DJA A;  2Y2H A;  4WZ5 A;  2ZC3 B;  3PBQ A;  2J9P A;  3W8K A;  3G4P A;  4E3O A;  1ES5 A;  1KGE A;  1ONG A;  1U60 A;  4E3M A;  2ZC4 B;  3B3X A;  5EOE A;  5U47 A;  3DW0 A;  5FQJ A;  3ZG8 B;  1K54 C;  3UPP A;  5FI7 A;  4S2J A;  4S2L A;  2JCH A;  4D2O A;  3G30 A;  5FAQ A;  2ZQ7 A;  5GLD A;  4IBR A;  1ZKJ A;  3LEZ A;  4U0X A;  5EVI D;  5JYO A;  2WKH A;  4IED A;  3V50 A;  4P0M A;  3OZH A;  3MXR A;  2OLV A;  1DJC A;  5GHX A;  3IQA A;  5GHY A;  4WEL A;  5EEC A;  3LMT A;  1GHM A;  3HUN A;  3VP1 A;  2XFT A;  4ZJ3 A;  4RRM A;  4UAA A;  4E3K A;  4WMC A;  5E2E A;  3OPP A;  1K54 A;  4Y0U A;  1SKF A;  3HLW A;  4PM7 A;  4RRC A;  3IXD A;  4HEF A;  3HUM A;  4NBJ A;  3PBT A;  3UE3 A;  2OV5 A;  4S03 A;  1FR1 A;  1LLB A;  5EVI B;  2H5S A;  1K4F A;  1VM1 A;  2Z2L B;  1XXM A;  1RGZ A;  2DNS A;  3WS5 A;  5AQ9 A;  3G2Y A;  3EQV A;  4OPQ A;  1NJ4 A;  2PBY A;  4PPR A;  5FI6 A;  4DRT A;  3NBL A;  3OPR A;  3CG5 A;  3ZGA B;  2IWD A;  4MNR A;  4Y0O A;  5E2G A;  3MXS A;  2H0Y A;  4KG2 A;  5CTM A;  1J9M A;  2CC1 A;  1WE4 A;  4UA9 A;  3SS4 A;  4JKT A;  4XXR A;  2FFY A;  2ZLY A;  3IT9 A;  5G18 A;  3A3E A;  2V20 A;  3PAG A;  1PYY A;  1JVJ A;  4X53 A;  3RJU A;  4R4S A;  2XQZ A;  5GL9 A;  4OQH A;  1KGG A;  2HP6 A;  3BRM A;  4JLF A;  1MWR A;  4BEN A;  2VGJ A;  1ALQ A;  4WMC D;  1CI9 A;  2P9V A;  1NRF A;  2PU4 A;  2Y91 A;  3Q7V A;  5FQQ A;  2R9W A;  3IF5 A;  1HTZ A;  4BQM A;  4ID4 A;  4BD1 A;  5JYP A;  3M6H A;  2V1Z A;  3BLS A;  3O88 A;  3UN7 A;  3PD2 A;  3GRJ A;  1MPL A;  5KMW A;  2QZ6 A;  3GMW A;  1M6K A;  3ISG A;  3UY6 A;  4LV0 A;  3TOI A;  3ZFZ A;  4S0L A;  2WYX A;  5FQK A;  1I5Q A;  1WYB A;  3G32 A;  1K57 C;  3N4I A;  5AQ7 A;  4RRI A;  5EOO A;  4QHC A;  2XK1 A;  4JXG A;  1YMX A;  3BFD A;  4F94 A;  1FCO A;  4P85 A;  2ZC7 A;  3VMA A;  3JYI A;  4Y0T A;  4KZ4 A;  2J8Y A;  4RRQ A;  2QMI A;  5HW3 A;  1YLW A;  1PZP A;  3E2K A;  2QPN A;  3BFC A;  2PU2 A;  3QHY A;  4S0J A;  4E3N A;  3DTM A;  4LCM A;  3LO7 A;  1EI5 A;  1C3B A;  3P09 A;  3Q1F A;  3KO4 A;  2G2W A;  3I7J A;  3IXG A;  1BUL A;  2H10 A;  2XD1 A;  3MKE A;  4R3B A;  1YMS A;  3IXH A;  4KZ6 A;  3HLD A;  4X56 A;  3HL9 A;  2VGK A;  4IBX A;  4ZJ2 A;  4RR7 A;  3C5A A;  3ITB A;  1PW8 A;  4KQQ A;  5KSC A;  5CHM A;  4KZ3 A;  1CI8 A;  3A3D A;  4ZBE A;  4PM6 A;  4U0T A;  2EX9 A;  5GLB A;  1IKI A;  4RRD A;  3G34 A;  1XX2 A;  4S2M A;  4NET A;  3A3F A;  4WM9 A;  4DE1 A;  4S2I A;  2WZZ A;  1ZG4 A;  3BFE A;  4MLL A;  5FAS A;  4RX2 A;  4UHU A;  1NY0 A;  1ESI A;  1L2S A;  2OSU A;  5F83 A;  3UDF A;  2Y2Q A;  2B5R A;  1IEM A;  2Y2M A;  5J8X A;  1E4D A;  3FWL A;  3E2L A;  2WKI A;  5F82 A;  3BEB A;  2RL3 A;  3FYZ A;  2R9X A;  1CEF A;  1TC5 A;  1IKG A;  4M3K A;  3TG9 A;  4N9K A;  5CGX A;  4R1G A;  5CEB A;  1KGF A;  4P6B A;  3UPO A;  4RX3 A;  3IF6 A;  4GD8 A;  2J9O A;  2XDM A;  3Q82 A;  3KO3 A;  3UE1 A;  3ZVW A;  4FSF A;  2BLS A;  2ZC5 B;  4OP8 A;  3ZNT A;  4DE3 A;  3C4O A;  5L2F A;  1BSG A;  1ESU A;  1MKI A;  4KQR A;  4KQO A;  1K6R A;  3GR2 A;  2HDS A;  4O7D A;  3KNP A;  1RCJ A;  5HL1 A;  1RGY A;  4JPM A;  4N92 A;  4WEK A;  1ES4 A;  2DBO A;  3UNW A;  4DXC A;  4DDS A;  3ZG7 B;  4N1X A;  2EFX A;  4K0X A;  4R4R A;  5CTN A;  1S6R A;  2ZM2 A;  1KVM A;  4BLM A;  4BJP A;  1K6S A;  4MEZ A;  1Y2Q A;  4WBG A;  4GOG A;  4NBI A;  5J61 A;  1JTG A;  5IHV A;  1BLS A;  1YM1 A;  3ZG9 B;  2IWC A;  2ZQ8 A;  4S2N A;  5EE8 A;  4X69 A;  3BEC A;  4OOM A;  5EVI A;  3C7V A;  3KO9 A;  2E8I A;  3C7U A;  4WEJ A;  4QJG A;  3LMU A;  1XGI A;  1GA0 A;  3BFG A;  3NI9 A;  1CEG A;  4PMA A;  3ZDJ A;  1H8Y A;  3KO5 A;  3IWQ A;  1JWZ A;  3ZCZ A;  3GQZ A;  1KE4 A;  3WRZ A;  5A93 A;  5FQI A;  4EBL A;  4IVI A;  1NZU A;  2IWB A;  1TEM A;  1JKE A;  1LI0 A;  2WKE A;  3AGD A;  3PBO A;  4Q8I A;  3ZVT A;  2XLN A;  4E3I A;  3SH8 A;  4EBP A;  3M2K A;  3KO7 A;  4RRG A;  4K0W A;  4RR9 A;  3OCL A;  3W4Q A;  1MBL A;  1W79 A;  4DDY A;  2I72 A;  5E2F A;  3GTC A;  1MWS A;  2XF3 A;  4N9L A;  2Y2P A;  3P98 A;  5FA7 A;  1XGJ A;  1LHY A;  5AQA A;  4EWF A;  4QY6 A;  2J7V A;  5CHJ A;  2Y2I A;  2ZMA A;  4GNU A;  1DY6 A;  3WS2 A;  3NDG A;  2EFU A;  5AQB A;  2HP5 A;  1ES2 A;  5GHZ A;  1O7E A;  3D4F A;  4R23 A;  1KDS A;  2FFF B;  2Y2K A;  3M6B A;  4R3J A;  3VP3 A;  4RR6 A;  4JF5 A;  1ZC2 A;  4IVK A;  4RRK A;  4BD0 A;  1S0W A;  1ERQ A;  1YLJ A;  3IF6 C;  4GB7 A;  1NYM A;  5FQ9 A;  3GSG A;  3HUO A;  4RYE A;  4FH2 A;  5CGW A;  5EPH A;  3FV7 A;  1FR6 A;  3PBN A;  4JXS A;  5FI2 A;  3HLG A;  2P74 A;  2ZQC A;  4KG5 A;  1K57 A;  3IXB A;  1CK3 A;  5I94 A;  3W4O A;  1H8Z A;  4HES A;  4RRL A;  3RXX A;  1PIO A;  2HDU A;  3MZE A;  2WGW A;  1K56 D;  2Y2J A;  3G35 A;  3HVF A;  5KZH A;  1JWP A;  2XH9 A;  4ZTK A;  1K4E A;  4K91 A;  3N6I A;  1ZG6 A;  1TVF A;  3EQU A;  5EVI C;  1VQQ A;  3TSG A;  4BL3 A;  5F1F A;  4H8R A;  2HKZ A;  2XGN A;  3NCK A;  4RVA A;  1E3U A;  4S2N C;  4LEN A;  4Y7P A;  2WUQ A;  1LI9 A;  5E43 A;  3WS0 A;  4ZAM A;  4E6X A;  1I2W A;  1KE3 A;  4QB8 A;  3N8S A;  4X68 A;  2OKV A;  3KOD A;  3M2J A;  4RRH A;  5FAO A;  3VOY A;  4E3L A;  2HL0 A;  1HVB A;  4WYY A;  3BYD A;  4E3J A;  3N8R A;  1JTD A;  1N4O A;  4S0I A;  4OQI A;  5FAP A;  3ZNY A;  4JXV A;  1FSY A;  3KOB A;  1ES3 A;  4PM8 A;  2XFS A;  1YLT A;  2HL1 A;  4BL2 A;  1PWC A;  1BZA A;  1XA7 A;  3WRT A;  4A5R A;  1SHV A;  2P9V B;  2ZQA A;  5E2H A;  3UO9 A;  1Z6F A;  1GCE A;  1Q2Q A;  1BT5 A;  1W7F A;  2WAD A;  3PAE A;  4RRF A;  4CJN A;  3WS4 A;  5DVA A;  4JF6 A;  4OPR A;  2OLU A;  4JF4 A;  3IHA A;  3VOZ A;  2DCF A;  3IHB A;  3LY4 A;  2Y55 A;  3MFD A;  3V3S A;  1FCM A;  1PZO A;  3SH9 A;  4DF6 A;  3NDE A;  3V39 A;  1QMF A;  1N9B A;  3BM6 A;  5CGS A;  4DXB A;  4EUZ A;  1TDL A;  1LL5 A;  1KDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...