5CEBA

Bd3459 predatory endopeptidase from bdellovibrio bacteriovorus, k38m form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
401
structure length
387
Chain Sequence
MVYLNSMCHMAANSKTQQIQGDDNKDDKFPLAAISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bd3459
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus (strain atcc 15356 / dsm 50701 / ncib 9529 / hd100)
molecule tags Hydrolase
total genus 134
structure length 387
sequence length 401
chains with identical sequence B
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2015-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5cebA01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 5cebA02
2X71A 4WEJA 2EXBA 2JE5A 1YLYA 2HDUA 4RX3A 4ID4A 4FCFA 3N7WA 4OP8A 5CTMA 3M2KA 1K57A 3IF5A 3D4FA 1EROA 4JXWA 5E2HA 2G2UA 1XXMA 5HL1A 5FI6A 2BG1A 1PZPA 5KSCA 1ALQA 3UDXA 1ESUA 1XP4A 4DKIA 3O88A 4IEDA 5JYPA 4GKUA 4PM8A 4S2JA 3Q7ZA 1SCWA 4UA9A 4Z9QA 1MWSA 2JC7A 1IKIA 5FATA 3HLBA 4GN2A 4KG2A 3WS4A 1KE0A 2FFFB 1K55A 3PBRA 4LV2A 2WK0A 1NY0A 2H0YA 4MNRA 1H8YA 2WAFA 4X6TA 1W8YA 1ESIA 4KZ6A 1ES5A 4BD0A 1BLCA 4P85A 2XR0A 3MXRA 3Q7VA 4JXGA 1XPBA 1BSGA 1FR1A 4OPRA 5GL9A 1K56D 4MBFA 3UPOA 4QHCA 3ZNTA 3TG9A 4PMAA 4S2LA 2XQZA 3NBLA 2H0TA 3LY4A 3FKWA 4U0XA 4BJPA 3SS4A 1K38A 4KQOA 1YLPA 1XA1A 1DJBA 3CJMA 3BLSA 4WEKA 2V2FF 4C75A 4JXVA 4UHUA 4JLFA 5DTKA 3UDFA 3MKFA 4EBPA 3HLEA 4PPRA 5EOEA 4P87A 2ZM0A 3VSKA 1NJ4A 4R4SA 1FQGA 1IYQA 3HVFA 4ZJ3A 4BQMA 1PI4A 4BL3A 1FOFA 1YLWA 2XLNA 4GB7A 4F94A 4EBLA 3HL9A 3WS2A 3RXWA 2XDMA 3M6BA 1YLZA 1Q2PA 2C6WB 4JKTA 3WS5A 2EXAA 4A5RA 2ZC7A 1FSYA 1E3UD 1EWZA 5U47A 4PM6A 1K54C 1XX2A 2A49A 3NC8A 3ZG7B 2WGWB 4DE2A 2UWXA 4UA7A 2XF3A 4R4RA 2XEPA 1U60A 1PWGA 1WYCA 3GMWA 3Q81A 2Z2LB 4WMCD 5EPHA 1ONHA 2XD1A 3DTMA 2ZMAA 3V39A 3FWLA 5EVLA 1ERMA 3C4OA 5GLDA 3WRTA 5CHUA 4K0XA 2VGKA 3BECA 3VMAA 4OPYA 4DE0A 5I94A 5J8XA 5A93A 3PBOA 4EV4A 4OH0A 4OONA 2X02A 3G35A 3I7JA 4WM9A 3WS0A 2XH9A 4KZ8A 5E2GA 1CEGA 1LL9A 2HDSA 5FQQA 1JWPA 1MWRA 4XXRA 1YT4A 4N9KA 5G18A 4QY5A 1I5QA 5DF9A 3IXHA 4ZJ1A 5F1FA 3GVBA 1I2WA 1O07A 1AXBA 4R0QA 3W4OA 4ZBEA 2ZJ9A 4Y0UA 3ISGA 3FYZA 3O3VA 2Y2JA 2WKIA 1FCOA 5A91A 2ZM8A 3MFDA 5HX9A 3ITBA 2Y2NA 5FAPA 1YMXA 1XGIA 1XGJA 3BFGA 3ZVWA 4LV3A 5AQBA 1VQQA 4PM9A 1SDNA 3A3IA 3N8SA 3C5AA 2JBFA 1RGYA 2P9VB 2WZXA 2IWCA 4WZ5A 2IWBA 4QB8A 5JYOA 4BLMA 3HLCA 2Y2PA 3BRMA 1ES2A 3S22A 4DE1A 1FCMA 3FZCA 5FAOA 2EFXA 2Y2MA 2EX9A 1PW1A 4M3KA 4S2NA 1QMFA 3V3RA 4LV1A 2I72A 1GHMA 4S2PA 4E3MA 1E25A 2Y2QA 1L0DA 5EVID 4GOGA 1HD8A 1L0EA 4UAAA 4ZTKA 1JTGA 2ZLYA 4JPMA 2DRWA 4DDSA 1YLJA 2WGWA 4O7DA 2PBYA 1NXYA 3VP2A 1IKGA 2WAEA 3N8LA 2HDQA 1BT5A 4R3JA 4NETA 4OVDA 3S1YA 1C3BA 1QMEA 2ZQCA 3FKVA 3Q1FA 1JVJA 1XKZA 1FR6A 2ZM2A 4OPZA 1BTLA 5TGFA 2PU4A 3VFHA 2Y2HA 1BULA 2Y2LA 1JTDA 1EI5A 1PWDA 4S2OA 4DXBA 2WGIA 5KZHA 3UE3A 3BYDA 3DW0A 4JF5A 4L0LA 4UA6A 1RGZA 5DTTA 1HVBA 3E2LA 1K6RA 1DJCA 5A90A 4QD4A 2Y59A 5EVIC 5FQMA 4ZJ2A 4KQQA 3SH8A 1O7EA 1SKFA 1XA7A 5FDHA 3ZG8B 2X01A 2J9OA 2OLVA 4FSFA 1FCNA 5FASA 5CHJA 3GRJA 1YLTA 5EUAA 3ZVTA 1PW8A 3S4XA 2XK1A 4E3JA 1YMSA 3IF6B 1YM1A 4MLLA 4FH2A 1CI9A 1CK3A 5AQ9A 3HUNA 3UDIA 3ZGAB 3LCEA 3G34A 4P0MA 1WE4A 3ZDJA 4H8RA 1BUEA 1ONGA 4MBKA 1TDLA 3MZEA 4OQIA 4RVAA 2J8YA 2Q9MA 1KGGA 5FAQA 5TR7A 1BZAA 3WWXA 2DCFA 2P9VA 3P98A 3IT9A 2WYXA 4DDYA 1KDWA 3VSLA 1DJAA 4E3OA 1PYYA 1RP5A 3BEBA 3N4IA 3PBNA 4FD8A 2G2WA 2XFSA 4DF6A 4NK3A 4FH4A 4XUXA 5GLCA 1Y54A 4HESA 1WYBA 2EFUA 1MXOA 3IH9A 3IXBA 2ZQAA 1LLBA 1MWUA 1MY8A 2HDRA 3LEZA 1L2SA 1YQSA 3N6IA 3BFEA 2V1ZA 3SS5A 3SS3A 3UPPA 3ZG5A 3IH8A 1JWVA 1CI8A 3MKEA 4JF6A 4LCMA 4X55A 2ZC5B 3HLGA 3P09A 1IYSA 4PM7A 1W8QA 5EE8A 4B4XA 1TEMA 4E3LA 2FFYA 3A3DA 5E43A 4X68A 2QPNA 3IWOA 2QMIA 4IVKA 3IF6C 5TFQA 1IEMA 2OLUA 4OPQA 2XFTA 1LI9A 1N4OA 1J9MA 5E2EA 1H8ZA 3CZDA 3O87A 3VFFA 4Q8IA 3MZFA 4KZ7A 3W4PA 4KZBA 5D3OA 3ZG9B 1K54A 1MWTA 3HBRA 3G2ZA 5CRFA 5GHXA 1K25A 1KE4A 3BFCA 1NYYA 5L2FA 5GHZA 2ZQ9A 5GLAA 3B3XA 5IHVA 3OPHA 3V50A 4MBHA 3QNBA 5HAQA 4ZAMA 3Q7VB 1VM1A 5F83A 1L0GA 1N9BA 4P6BA 1GA9A 1K6SA 3SH7A 4IVIA 5EOOA 2J9PA 1KE3A 1NZUA 4EQIA 2HPBA 2RCXA 2WKEA 4IBXA 1PZOA 5FQIA 4RYEA 4QU3A 5GLBA 4X69A 2ZC4B 5FI2A 1GA0A 4R1GA 4R23A 2Z2MB 4D2OA 2ZD8A 5M1AA 2C5WB 1K57C 1ZG4A 2Y2GA 5F82A 3BFDA 3IWIA 1K4FA 4BL2A 5HW3A 5AQAA 4Y0TA 5EVIB 1NYMA 4KZ4A 4E3IA 1GHIA 1M6KA 2HP9A 3OPLA 4E6XA 4OQGA 4EUZA 4BD1A 4E3NA 2B5RA 1W5DA 1PWCA 3BM6A 4WMCA 4JF4A 2EX6A 3OC2A 1CEFA 2ZQ7A 4EWFA 4DXCA 5FSRA 5CERA 1K55C 4XUZA 1JWZA 3DWKA 3IXGA 5CTNA 5E2FA 1M40A 4DE3A 1G68A 3HLFA 3MZDA 4OOLA 5FA7A 2GDNA 3HLWA 2A3UA 3EQVA 1IYPA 3PBSA 1PI5A 4GDBA 1TDGA 2P74A 4OLDA 4CJNA 2HP5A 3OCNA 3NCKA 4MEZA 2HP6A 3AGFA 3PBQA 4KZ5A 3G30A 3OPPA 3BFFA 3AGEA 4KZ9A 4R3BA 5CGWA 5FQ9A 5FQKA 3V3SA 1SHVA 3HUOA 4X53A 4ZDXA 3A3JA 3C7VA 1KVLA 1I2SA 3JYIA 3N8RA 3OCLA 3PBTA 5CGSA 1IELA 1S6RA 1RCJA 4JBFA 4EBNA 5DF8A 3G31A 5DVAA 3OPRA 2H5SA 1ERQA 4GNUA 3G4PA 3HLDA 1FSWA 3UE0A 2EX8A 3UY6A 3VP0A 3E2KA 4N1HA 4LV0A 3GR2A 1HZOA 1KVMA 2ZC3B 2OSUA 4OOYA 4BENA 5HAPA 1K4EA 3MBZA 4OQ0A 4HBUA 5FI7A 3A3EA 3HREA 3GV9A 4QY6A 2BLSA 2ZQ8A 1S0WA 1GHPA 5KSHA 3UE1A 5M19A 4KZ3A 4S2MA 2EX2A 1BLHA 2OV5A 2R9WA 3UPNA 2CC1A 4DRTA 3VP1A 3ZG0A 1IYOA 3CMZA 4GDNA 4YINA 2VGJA 4U3TA 3SH9A 2IWDA 5FQJA 1Q2QA 3BLMA 4C3QA 4OP5A 1LI0A 4YFMA 3UN7A 1KGFA 1NZOA 3HUMA 3TSGA 3UO9A 3ZHHA 4PM5A 2ZQDA 4WELA 4GD6A 4IBRA 5EVIA 3AGDA 1MBLA 4N9LA 2H10A 3ZCZA 1NRFA 1OMEA 2WGVA 4OKPA 2Y2IA 3VP3A 2WADA 2RL3A 5M18A 3ZNYA 3W8KA 1BLPA 1W79A 2E8IA 4N1XA 1L0FA 4KQRA 3NIAA 1KDSA 5CGXA 1LL5A 3OZHA 5HFOA 4WYYA 4OLGA 2J7VA 1ZG6A 1MPLA 4KZAA 2JCHA 1MKIA 3QNCA 4U0TA 3A3FA 4X56A 3NDEA 3ZFZA 3Q82A 4OOMA 1K56A 5HAIA 5CXWA 4E6WA 3DWZA 3VOZA 3W4QA 4RA7A 4JXSA 1GCEA 3PTEA 4E3KA 3G32A 3VP4A 4HEFA 5DTSA 4HBTA 1SDEA 1HTZA 5KMWA 1ES4A 1E4DA 1ZKJA 2R9XA 5BOHA 4KENB 3FV7A 1BLSA 1Z6FA 4KG6A 5CEBA 3ITAA 4LENA 4CPKA 2WKHA 4B4ZA 5CECA 5AQ7A 4C6YA 3RJUA 2Y2OA 1TVFA 1ZC2A 3IXDA 4N92A 2XGNA 2WZZA 2Y55A 4WZ5C 1PIOA 3GSGA 1LHYA 4K0WA 5HARA 1W7FA 3IHAA 2ZC6B 3M2JA 4B88A 1ES3A 3G2YA 2DNSA 3IF6A 4KG5A 4QJGA 3WS1A 3VOYA 5A92A 3O86A 4S2KA 4GZBA 4LCLA 1G6AA 3LO7A 3PAEA 4S2NC 5GHYA 2Y91A 3SOIA 3MXSA 1E3UA 3QHYA 3UNWA 2V20A 3IQAA 3LY3A 2XD5A 2Y2KA 4RX2A 3RXXA 2WUQA 2Q9NA 3NDGA 2PU2A 3EQUA 4OQHA 5F1GA 1KGEA 4S2IA 4Y0OA 3PAGA 5DF7A 3NI9A 3IWQA 3CG5A 3TOIA 4WZ4A 4GD8A 3V5MA 3IHBA 5CHMA 5EECA 3GTCA 3WRZA 3Q07A 1DY6A 3M6HA 3NY4A 4K91A 2Y4AA 1H5XA 3C4PA 3C7UA 4WBGA 4Y7PA 3GQZA 5CEDA 2QZ6A
chains in the Genus database with same CATH superfamily
2GX5A 4WEJA 3A0SA 1Y28A 2HDUA 3DBAA 4OP8A 1ZTUA 3TRCA 2BTFP 3IF5A 1EROA 5E2HA 5HL1A 1OJGA 1PFLA 5HZHA 4BBVA 1PZPA 5KSCA 4DKIA 3KO6A 4GKUA 4S2JA 1SCWA 1MWSA 4ETZA 2INWA 1BYWA 2FFFB 4LGWA 4MNRA 2WAFA 4X25A 2W0NA 4NBIA 4JXGA 2VEAA 1FR1A 3OLOA 4QHCA 5J7EA 2PYRA 4S2LA 4DMZA 3NBLA 2H0TA 3LY4A 4BJPA 4U0XA 4KQOA 1YLPA 4FOFA 4UHUA 3T4TA 3HLEA 2QKPA 3LGOA 2V1AA 3F1PB 1NJ4A 3LFVA 3T4OA 2M1CA 1YLWA 4EBLA 4GS9B 1J3WA 3GECA 3WS2A 2C6WB 4JKTA 2JKTI 2ZC7A 1E3UD 4PM6A 2YKHA 1XX2A 5MC7A 2UWXA 4UA7A 3VE3A 1PWGA 1OTDA 4HP9A 5HWWA 1OTBA 1ONHA 1XFNA 3FWLA 2W3FA 3NHQA 3WRTA 2M7UA 4K0XA 2VGKA 5A93A 2W1RA 2X02A 4NG2A 4WM9A 3WS0A 2XH9A 2O0YA 4ZRRA 5DJTA 2W3EA 3MF0A 4N9KA 5G18A 4QY5A 5DF9A 3TJZC 4ZBEA 2ZJ9A 4Y0UA 3O3VA 2WKIA 4Y3IA 2PYPA 1F9IA 2Y2NA 3UMEA 3A0RA 5DKKA 4UQIM 2JBFA 1RGYA 2WZXA 4QB8A 4I39A 5AVFA 5FAOA 1DP8A 2JN7A 3LIFA 1JNUA 3KSIA 1E25A 5TBMA 3NECA 4JPMA 4RR7A 4S02A 2WGWA 2PBYA 1VETA 3S7QA 2WAEA 1DRMA 4NETA 4OVDA 1QMEA 2ZQCA 4HNBA 3CHWP 4Z1WA 1FR6A 3T12B 4OPZA 1BTLA 2PU4A 3VFHA 2VV7A 3P01A 1JTDA 4E04A 5DTTA 1LL8A 4NEED 5A90A 4QWOA 5FQMA 4ZJ2A 3SH8A 5HD3A 3GRJA 1D1JA 4FH2A 4RRQA 3HUNA 3F1OA 1H0MA 3PD4A 1ONGA 3MZEA 4OQIA 4RVAA 1WA9A 5FAQA 4G3KA 1DJAA 4RRGA 1RP5A 2HL0A 3D72A 4DF6A 4GLQA 4Y17A 4HESA 2EFUA 3IH9A 2ZQAA 1L2SA 3SS5A 3UPPA 4LCMA 4X55A 1CI8A 3C38A 4JF6A 3HLGA 1IYSA 3A3DA 2ACGA 4NXGA 4IVKA 3IF6C 2ZBBA 3T1QB 2XFTA 1N4OA 4Q8IA 1OT6A 3MZFA 4KZBA 5D3OA 3S7OA 3HBRA 3G2ZA 1KE4A 5L2FA 5GHZA 5GLAA 3QNBA 5F83A 4IVIA 5EOOA 2J9PA 4FTXA 1ACFA 3P7NA 4IBXA 5FQIA 5HWTA 4RRFA 2ZC4B 3LR4A 4R23A 3CAXA 4D2OA 5EFWA 2VGLS 5J4EA 1ZG4A 2Y2GA 3UB5P 2B95A 1OTIA 1YSQA 3HJIA 2HP9A 1NLYA 2P08A 4E6XA 5LBRA 4PHTA 5FL3A 4WMCA 3CUEC 1S4SA 5CERA 5HWVA 1K0KA 4Y13A 3DWKA 1M40A 5FA7A 3EQVA 1TDGA 2P74A 4OLDA 3NCKA 4MEZA 3PBQA 3V3SA 5FQ9A 3CWFA 5FQKA 3HUOA 4X53A 3QP1A 4ZDXA 3B33A 4WN5A 3MJQA 3CLOA 5CGSA 3T4SA 3PD5A 4HJ4A 5DF8A 4HJ3A 3G4PA 4CLCD 3R7WA 4EQ1A 1HZOA 4M4XA 4QPRA 2Q0OA 3D9YA 3HREA 2BLSA 1S0WA 3DTEA 3UE1A 2EX2A 2R9WA 1YAXA 3NOUC 1IYOA 4GDNA 1NWZA 4YINA 5EV0A 4EXOA 2NUPC 3SH9A 3KSFA 4YFMA 1KGFA 1D06A 3UO9A 2ZQDA 4D60A 2QYBA 5EVIA 3AGDA 2RL3A 3KO5A 3W8KA 4KQRA 2HF6A 1OTEA 1LT0A 2J7VA 4R38A 5J61A 3KSGA 3QNCA 1MKIA 3NULA 3NDEA 3GDIA 4OOMA 1K56A 5CXWA 3DWZA 1VETB 4II7A 4RA7A 2PT7A 4RRLA 3E4OA 4E3KA 3VP4A 1XJ4A 3IX3A 3QP5A 2V0UA 4I5SA 3KSHA 1BLSA 2H28A 3ITAA 2WKHA 5AQ7A 4C6YA 3RJUA 2Y2OA 1TVFA 4N92A 2WZZA 3GSGA 1W7FA 3L7HA 2VA0A 3G2YA 4QJGA 4KG5A 3VOYA 1Y2QA 3LO7A 3PAEA 3LIAA 5GHYA 3MXSA 3UNWA 1W63M 3RXXA 2Q9NA 1KOUA 3NDGA 4BWIA 1KGEA 2XA7S 4NBJA 2PD8A 2LB9A 3GTCA 4ETXA 3WRZA 2J3WA 3NY4A 4JGQA 4WBGA 4Y7PA 2QZ6A 3IBRA 3RTYA 2EXBA 2A2LA 4ID4A 4FCFA 5CTMA 1K57A 3BWLA 2G2UA 2PR6A 3R4KA 2BG1A 3KYEA 1ESUA 1SKOA 4UA9A 2JC7A 4KG2A 1K55A 4EEPA 2H0YA 1W8YA 1BLCA 2BASA 2QJ5A 4P85A 3Q7VA 1XPBA 2EA9A 1BSGA 2Y79A 1ODVA 3TG9A 3LR0A 4AFIA 3SS4A 2VGLM 5F5YA 4BBUA 3CJMA 2J80A 2W3DA 3UDFA 1YSPA 3EOIA 2O9AA 4PPRA 5EOEA 4CLCC 4P87A 3H7WB 3VSKA 4R4SA 4L9GA 1FQGA 1PRQA 4BQMA 1PI4A 1FOFA 4GB7A 1Z09A 2XDMA 1FSYA 5U47A 1K54C 3CI6A 2A49A 5IT5A 4DE2A 2XF3A 3CITA 1U60A 1WYCA 2ZMAA 3V39A 5FEFA 1LSXA 3LIBA 5CHUA 5I94A 3EGXC 4EV4A 4OH0A 2EWVA 1H8MA 5L09A 3TE8A 1LL9A 4NKPA 2L4RA 3IXHA 4ZJ1A 3T4JA 2D02A 3UMDA 1I2WA 5G4YA 1S1ZA 3ISGA 3UB7A 5L07A 4LFUA 5F68A 3MFDA 3PHYA 3K2NA 3W2ZA 5AQBA 1VQQA 4WZ5A 2IWBA 5JYOA 4ME4A 1ES2A 2HJEA 1FCMA 4S0LA 4ARZA 3FZCA 1MZUA 2EFXA 2Y2MA 1PW1A 4M3KA 3A0VA 1QMFA 4Q0JA 4LV1A 4HOIA 4E3MA 4CLCB 2VK3A 3MQQA 3HJKA 4ZTKA 4R3AA 4UAAA 1JTGA 1YLJA 4O7DA 4ESPA 1NXYA 1TS8A 3N8LA 2W1TA 1BT5A 1N9NA 4R3JA 1JVJA 1LSWA 1XKZA 2ZM2A 2B18A 2Y2HA 1BULA 4WLAA 1EI5A 3QP8A 3MMHA 3BYDA 3DW0A 4UA6A 3LR5A 4QD4A 3MQOA 3KO7A 4DJ2A 4KQQA 1O7EA 2X01A 2J9OA 3EEHA 2FZ0A 4IUKA 3ZQ5A 1UWNX 4JGPA 2XK1A 1YM1A 2WKPA 1CK3A 2JKTM 4B93A 2XA7M 4P0MA 1WE4A 4MBKA 1MC0A 2NUTC 3H82A 2J8YA 5HDSA 2P9VA 3E98A 2WYXA 3VSLA 2ZMFA 2JKGA 4E3OA 1PYYA 3N4IA 3PBNA 4Q0IA 4FH4A 4XUXA 1Y54A 3LEZA 1YQSA 3SS3A 2V1ZA 4PAUA 3IH8A 3MKEA 5EE8A 2D01A 1TEMA 2M7VA 4YWZA 1DP6A 5TFQA 2OLUA 4OPQA 3LMUA 1J9MA 4KZ7A 1V9YA 2AVXA 2GJ3A 2ZL1A 4Q0HA 2G7UA 5CRFA 5GHXA 1STZA 3T1RA 4O8GA 5DFXA 3OPHA 4ZAMA 3Q7VB 1N9BA 1GA9A 1L3LA 1MKMA 1NZUA 4EQIA 5GLBA 2XSSA 3C2WA 5FI2A 5M1AA 3TW8A 5DJUA 3F1NB 3U2AA 4MN6A 1GHIA 3MSHA 3OPLA 4EUZA 1FIKA 2B5RA 1PWCA 4RRBA 2I9VA 3BM6A 3OC2A 1CEFA 2ZQ7A 4EWFA 5AJGA 4DE3A 3MZDA 4OOLA 2GDNA 4R6LA 2K31A 1PI5A 4GDBA 3T4QA 3OPPA 1NLZA 1SHVA 4IJGA 3A3JA 4KUOA 3C7VA 3N8RA 4X1LA 5DVAA 1FSWA 5HPFA 2EX8A 4HHDA 2HGVA 3VP0A 4N1HA 3CPTA 1K4EA 3LYXA 4HBUA 3FG8A 1CQAA 1TS7A 2CC1A 3VP1A 3ZG0A 2IA2A 2W3HA 3CMZA 3BJNA 3DTIA 2VGJA 4U3TA 4MDZA 4DJ3A 1Q2QA 4C3QA 3UN7A 3TSGA 4WELA 4IBRA 4N9LA 2H10A 1OTAA 1NRFA 2Y2IA 1W63Q 1W79A 3MR0A 4RRAA 4ARZB 1KDSA 3OZHA 1G28A 4KZAA 1YKDA 4JXSA 1X0OA 3G32A 4JGRA 1HTZA 3OOVA 2QHKA 1ES4A 1E4DA 2R9XA 4KENB 1T1BA 4KUKA 1P97A 1LSVA 3S7PA 2Y8HA 3IXDA 2VJWA 2Y55A 3G6OA 1ES3A 3LEQA 3KX0X 5A92A 1AWIA 4LCLA 2Y91A 3LY3A 4KQDA 2XD5A 2Y2KA 1T1AA 4EESA 4S2IA 3ZYTA 4Y0OA 2L0WA 3NI9A 3H82B 3IWQA 3CG5A 4WZ4A 3PYPA 3KNFA 4RR8A 2OKVA 3Q07A 1DY6A 4IUHA 3IBJA 3C7UA 2ZC6B 2X71A 1EW0A 2JE5A 4RX3A 3BY8A 3D4FA 3U4LP 3SZTA 4JXWA 4F3LA 3VV4A 3UDXA 4CQHA 4IEDA 5JYPA 1PNEA 4Z9QA 1KE0A 3PBRA 3K3DA 4X6TA 1UGUA 4KZ6A 5HD5A 2ZL1B 2XR0A 3MXRA 1K56D 4B9OA 4EERA 3ZNTA 3KOBA 3KO9A 1S67L 4RRMA 1XA1A 1DJBA 3BLSA 4WEKA 1GSXA 3MKFA 4EBPA 4H6JA 1XJ2A 4I3JA 3HVFA 5FDSA 4HH2A 4BL3A 2O9CA 1T1CA 4RRDA 3M6BA 1YLZA 4WF0A 3BW6A 3V67A 4HI4A 4GHIA 3JVVA 5TBMB 3NC8A 2WGWB 4R4RA 2XEPA 4BBTA 2Z2LB 1P9RA 2XD1A 3DTMA 5EVLA 3BECA 4DE0A 4OPYA 5AVEA 5FEGA 1YPRA 3G35A 2KLIA 4HQAA 3I7JA 2JKRM 2ZOHA 2HDSA 1MWRA 4XXRA 1YT4A 2K2NA 1O07A 3W4OA 2W27A 5HPIA 2JKRI 4RR6A 4WUJA 1FCOA 4EEUA 4X1MA 1YMXA 3F1OB 1XGIA 1XGJA 2V0WA 3BFGA 3ZVWA 4PM9A 3N8SA 3C5AA 2O9BA 3F1PA 2PAVP 4BLMA 3HLCA 2Y2PA 3BRMA 5I5LA 1HLUP 4S2NA 3D3OA 3HCYA 3V3RA 2I72A 1GHMA 4S2PA 2XROA 1N9LA 2KX6A 2Y2QA 4GOGA 1HD8A 1L0EA 2JHEA 5IU1A 4RQ9A 4DDSA 3K3CA 1OPXA 1IKGA 4HY8A 4RRCA 2OWJA 3FKVA 1T19A 3T4KA 2Z6CA 3MFXA 1S1YA 4I3AA 4DXBA 2WGIA 5KZHA 3UE3A 1RGZA 5HDDA 1HVBA 3E2LA 1K6RA 1XJ3A 5EVIC 5L8MA 2CMNA 5FDHA 1SKFA 1XA7A 3BQAA 4I38A 3ZG8B 2OLVA 4FSFA 1P9WA 1FCNA 3S7NA 5FASA 4E3JA 3T50A 3MXQA 4MLLA 1CI9A 3UDIA 3LCEA 3G34A 4H8RA 3EWKA 1TDLA 3LIEA 2Q9MA 5TR7A 1BZAA 1GSWA 4YNRA 3WWXA 2DCFA 4NXEA 3P98A 4DDYA 1H3QA 1F5MA 3BEBA 4FD8A 4NK3A 1FILA 1TD5A 1WYBA 1MXOA 3N6IA 2HDRA 3BFEA 4R70A 4L9FA 3EEAA 2ZC5B 3P09A 4PM7A 3MQ0A 4B4XA 1TC5A 4CLCE 4E3LA 2FFYA 5E43A 2QPNA 3IWOA 4EETB 4F3LB 1IEMA 5HSQA 5E2EA 3CZDA 3O87A 3W4PA 3R7WB 3ZG9B 1K25A 5EVEA 3BFCA 2E8JA 2ZQ9A 3B3XA 5IHVA 4MBHA 5HAQA 1VM1A 3IX4A 2V8FA 4P6BA 1K6SA 3SH7A 2WKEA 4QU3A 4X69A 2Z2MB 2ZD8A 1K57C 2HL2A 5F82A 5HW3A 5EVIB 1TS6A 1M6KA 4E3IA 4H6JB 1S66L 3H9WA 1W5DA 3DTKA 3FC7A 2EX6A 4EW7A 2A24A 3RH8B 1K55C 1JWZA 3IXGA 5E2FA 1G68A 3HLFA 5EM1A 4GHIB 3DAVA 4HP4A 3OCNA 3LI9A 3AGFA 4GCZA 4KZ5A 3E4PA 4KZ9A 4R3BA 2HV1A 3OCLA 1IELA 1S6RA 3JPUA 4XT2A 3G31A 4EBNA 3OPRA 1ERQA 4HH3A 3KOCA 4NXFA 4LV0A 1VB6A 2MJ6A 2OSUA 2V1BA 2KOIA 4G3VA 4OOYA 4QY6A 5KSHA 1GHPA 2O99A 3PXPA 1BLHA 3UPNA 4O01A 5FQJA 3BLMA 4OP5A 1LI0A 3NJAA 3ZHHA 3ZCZA 2PBDP 2HL1A 1OMEA 2WGVA 4OKPA 5M18A 3T1SA 3ZNYA 3IS2A 2J3TC 1BLPA 4N1XA 2P7JA 1L0FA 3NIAA 3ICYA 1LL5A 5HFOA 4BMWA 2JCHA 4X56A 4MMNA 3Q82A 1SKOB 3LIDA 2HJ9C 3RFBA 3VOZA 1GCEA 4I3IA 3KO4A 4HEFA 2DMWA 4HIAA 1SDEA 2WKQA 2FH5A 5KMWA 1ZKJA 3FPVA 5BOHA 4Y2FA 4GJ4A 4LENA 4CPKA 5HDCA 1UWPX 3BY9A 3B42A 4WZ5C 1ZC2A 2B02A 2XGNA 1GSVA 1PIOA 2K7SA 1LHYA 4K0WA 5HARA 4P6ZS 5KIZA 4FUWA 3FPWA 3IF6A 3QP4A 4UEYA 3O86A 4S2KA 1G6AA 3BQ8A 3SOIA 1NRJA 1E3UA 3QHYA 3KO3A 2V20A 3IQAA 2WUQA 2PU2A 1S4RA 4OQHA 2PDRA 2JKFA 3LI8A 4EUVA 4GD8A 3V5MA 3IHBA 5CHMA 5EECA 2Y4AA 3GQZA 1I2SA 1YLYA 3N7WA 3M2KA 2HKZA 2VX8A 1XXMA 3SW1A 5FI6A 3IX8A 1ALQA 1XP4A 3O88A 4PM8A 2UV0E 4LRZE 3Q7ZA 3O5YA 1XFQA 1IKIA 3CUEA 1TS0A 5FATA 3HLBA 4GN2A 2Z6DA 3WS4A 4LV2A 1P0ZA 2WK0A 1NY0A 2WKRA 1H8YA 4RRJA 1ESIA 4RRKA 4BD0A 1ES5A 3PD3A 2QJ7A 4L9EA 5GL9A 4OPRA 3KODA 4MBFA 3UPOA 4PMAA 3E4QA 2XQZA 4DN0A 3FKWA 1K38A 2P04A 4C75A 2V2FF 4JXVA 4JLFA 5DTKA 1G5UA 1T18A 3LICA 2ZM0A 3VE4A 1IYQA 4ZJ3A 5J3WA 2XLNA 4F94A 3HL9A 3RXWA 1Q2PA 3WS5A 2EXAA 4A5RA 3C8CA 2W3GA 3KYQA 1Y4OA 1EWZA 3KNPA 2A24B 4MN7A 2PRFA 3ZG7B 1VEUA 3QP6A 2W1TB 3Q81A 3GMWA 5EPHA 4WMCD 1ERMA 3C4OA 5GLDA 4EU0A 3VMAA 5K5BA 5J8XA 3PBOA 4OONA 5EM0A 4O0PA 4KZ8A 5E2GA 1CEGA 4XT2B 3B47A 5FQQA 1JWPA 4K08A 4LLOB 1I5QA 5F1FA 3GVBA 4R0QA 1AXBA 2OOLA 3FYZA 2Y2JA 5A91A 2ZM8A 5HX9A 3ITBA 3UB9A 5FAPA 4MCWA 1OJ5A 4LV3A 1SDNA 3A3IA 3C30A 3PD2A 3H7WA 2P9VB 2IWCA 4PKYG 3S22A 3JVUA 1XJ6A 4DE1A 4S0IA 2EWWA 2EX9A 3UB8A 3IS2B 4GW9A 1L0DA 1DP9A 5EVID 2ZLYA 2DRWA 2VV6A 2VLGA 3VP2A 2HDQA 3S1YA 1C3BA 3Q1FA 1V9ZA 5A8BA 5TGFA 3UB6A 2Y2LA 1N9OA 1PWDA 4S2OA 4JF5A 4L0LA 2GZAA 4P6ZM 1DJCA 2Y59A 2GNXA 3MS6A 5CHJA 3EGDC 3KYZA 1YLTA 5EUAA 3ZVTA 1PW8A 3S4XA 1YMSA 3IF6B 5AQ9A 3ZGAB 5L10A 3ZDJA 1BUEA 4LPZA 1KGGA 1OT9A 2DBOA 3IT9A 1KDWA 5G4ZA 4YOFA 2XRNA 2G2WA 2XFSA 1CJFA 5GLCA 1F98A 3NOPC 3IXBA 1LLBA 1MWUA 1MY8A 4CLCA 3E0YA 3ZG5A 1JWVA 1W8QA 4RRHA 4X68A 2QMIA 1LI9A 3VFFA 1H8ZA 2OWHA 1K54A 1MWTA 2R78A 3CPTB 1IFQA 1NYYA 3LMVA 3V50A 2L1MA 1L0GA 4PKYA 3LUQA 1KE3A 2HPBA 1G6OA 2RCXA 1PZOA 4RYEA 1F2KA 1GA0A 4R1GA 4HJ6A 2C5WB 3BFDA 3IWIA 1K4FA 4BL2A 5AQAA 3T4LA 4Y0TA 1NYMA 4KZ4A 4GS9A 4OQGA 4BD1A 4E3NA 3PR6A 3L9KA 4JF4A 1IOUA 4DXCA 5FSRA 2V8CA 4XUZA 5CTNA 1TF1A 3HLWA 2A3UA 3PBSA 1IYPA 2YKFA 4CJNA 2HP5A 1VHMA 2HP6A 3G30A 1VEUB 3AGEA 3BFFA 5CGWA 3QP2A 1KVLA 2KDKA 3JYIA 3PBTA 5F6AA 1RCJA 4JBFA 2H5SA 4GNUA 4RR9A 1A0KA 3HLDA 3LR3A 3UE0A 2OAP1 3UY6A 3E2KA 5CX7A 5DFYA 3GR2A 4S03A 1KVMA 2ZC3B 4BENA 2J3TD 5HAPA 3MBZA 5IS1A 4OQ0A 5FI7A 1J7GA 3A3EA 5DKLA 3GV9A 2ZQ8A 5M19A 4KZ3A 4S2MA 2OV5A 4MN5A 4DRTA 1CF0A 2IWDA 1NZOA 3HUMA 5HL6A 4PM5A 4UQIS 4GD6A 3F1NA 3NOTC 1MBLA 4S0JA 3VP3A 2WADA 2ZOIA 4G3WA 2PD7A 5C5KA 4Y15A 2E8IA 4S0KA 4RRIA 5CGXA 4WYYA 4OLGA 1ZG6A 1MPLA 4U0TA 3A3FA 3ZFZA 3LMTA 4LRYC 2OAQ1 5HAIA 2PHYA 4E6WA 3OBFA 2VZWA 1D7EA 3W4QA 4JGOA 3PTEA 5DTSA 4HBTA 4NXBA 2ZMVA 3FV7A 1JKEA 3T1XA 1Z6FA 4KG6A 5CEBA 2HZ5A 3ULFA 4B4ZA 5CECA 1ZHHB 4IHQA 3IHAA 3M2JA 4B88A 2DNSA 3WS1A 4GZBA 4S2NC 2LB5A 2V9AA 4RX2A 3UE6A 3VOLA 5F69A 2VKSA 2PR5A 3EQUA 5F1GA 3PAGA 5DF7A 4WL9A 2VV8A 3TOIA 4Y5FA 5TJJA 2QWSA 3M6HA 4K91A 1SZVA 3C4PA 1H5XA 5CEDA 4LRXC 4RRRA
chains in the Genus database with same CATH topology
2X71A 4WEJA 2EXBA 2JE5A 1YLYA 2HDUA 4RX3A 4ID4A 4FCFA 3N7WA 4OP8A 5CTMA 3M2KA 2HKZA 1K57A 3IF5A 3D4FA 1EROA 4JXWA 5E2HA 2G2UA 1XXMA 5HL1A 5FI6A 2BG1A 1PZPA 5KSCA 1ALQA 3UDXA 1ESUA 1XP4A 4DKIA 3O88A 4IEDA 5JYPA 4GKUA 4PM8A 4S2JA 3Q7ZA 1SCWA 4UA9A 4Z9QA 1MWSA 2JC7A 1IKIA 5FATA 3HLBA 4GN2A 4KG2A 3WS4A 1KE0A 2FFFB 1K55A 3PBRA 4LV2A 2WK0A 1NY0A 2H0YA 4MNRA 1H8YA 2WAFA 4X6TA 1W8YA 4RRJA 1ESIA 4RRKA 4KZ6A 1ES5A 4BD0A 1BLCA 3PD3A 4P85A 2XR0A 3MXRA 3Q7VA 4JXGA 4NBIA 1XPBA 1BSGA 1FR1A 4OPRA 5GL9A 3KODA 1K56D 4MBFA 3UPOA 4QHCA 3ZNTA 3TG9A 4PMAA 4S2LA 2XQZA 3KOBA 3NBLA 2H0TA 3LY4A 3KO9A 3FKWA 4U0XA 4BJPA 3SS4A 1K38A 4KQOA 1YLPA 4RRMA 1XA1A 1DJBA 3CJMA 3BLSA 4WEKA 2V2FF 4C75A 4JXVA 4UHUA 4JLFA 5DTKA 3UDFA 3MKFA 4EBPA 3HLEA 4PPRA 5EOEA 4P87A 2ZM0A 3VSKA 1NJ4A 4R4SA 1FQGA 1IYQA 3HVFA 4ZJ3A 4BQMA 1PI4A 4BL3A 1FOFA 1YLWA 2XLNA 4GB7A 4F94A 4EBLA 3HL9A 3WS2A 4RRDA 3RXWA 2XDMA 3M6BA 1YLZA 1Q2PA 2C6WB 4JKTA 3WS5A 2EXAA 4A5RA 2ZC7A 1FSYA 1E3UD 1EWZA 5U47A 3KNPA 4PM6A 1K54C 1XX2A 2A49A 3NC8A 3ZG7B 2WGWB 4DE2A 2UWXA 4UA7A 2XF3A 4R4RA 2XEPA 1U60A 1PWGA 1WYCA 3GMWA 3Q81A 2Z2LB 4WMCD 5EPHA 1ONHA 2XD1A 3DTMA 2ZMAA 3V39A 3FWLA 5EVLA 1ERMA 3C4OA 5GLDA 3WRTA 5CHUA 4K0XA 2VGKA 3BECA 3VMAA 4OPYA 4DE0A 5I94A 5J8XA 5A93A 3PBOA 4EV4A 4OH0A 4OONA 2X02A 3G35A 3I7JA 4WM9A 3WS0A 2XH9A 4KZ8A 5E2GA 1CEGA 1LL9A 2HDSA 5FQQA 1JWPA 1MWRA 4XXRA 1YT4A 4N9KA 5G18A 4QY5A 1I5QA 5DF9A 3IXHA 4ZJ1A 5F1FA 3GVBA 1I2WA 1O07A 1AXBA 4R0QA 3W4OA 4ZBEA 2ZJ9A 4Y0UA 3ISGA 4RR6A 3FYZA 3O3VA 2Y2JA 2WKIA 1FCOA 5A91A 2ZM8A 3MFDA 5HX9A 3ITBA 2Y2NA 5FAPA 1YMXA 1XGIA 1XGJA 3BFGA 3ZVWA 4LV3A 5AQBA 1VQQA 4PM9A 1SDNA 3A3IA 3N8SA 3C5AA 3PD2A 2JBFA 1RGYA 2P9VB 2WZXA 2IWCA 4WZ5A 2IWBA 4QB8A 5JYOA 4BLMA 3HLCA 2Y2PA 3BRMA 1ES2A 3S22A 4DE1A 1FCMA 4S0LA 3FZCA 5FAOA 2EFXA 2Y2MA 4S0IA 2EX9A 1PW1A 4M3KA 4S2NA 1QMFA 3V3RA 4LV1A 2I72A 1GHMA 4S2PA 4E3MA 1E25A 2Y2QA 1L0DA 5EVID 4GOGA 1HD8A 1L0EA 4UAAA 4ZTKA 1JTGA 2ZLYA 4JPMA 4RR7A 2DRWA 4DDSA 1YLJA 4S02A 2WGWA 4O7DA 2PBYA 1NXYA 3VP2A 1IKGA 2WAEA 3N8LA 2HDQA 1BT5A 4R3JA 4NETA 4OVDA 3S1YA 1C3BA 1QMEA 4RRCA 2ZQCA 3FKVA 3Q1FA 1JVJA 1XKZA 1FR6A 2ZM2A 4OPZA 1BTLA 5TGFA 2PU4A 3VFHA 2Y2HA 1BULA 2Y2LA 1JTDA 1EI5A 1PWDA 4S2OA 4DXBA 2WGIA 5KZHA 3UE3A 3BYDA 3DW0A 4JF5A 4L0LA 4UA6A 1RGZA 5DTTA 1HVBA 3E2LA 1K6RA 1DJCA 5A90A 4QD4A 2Y59A 5EVIC 3KO7A 5FQMA 4ZJ2A 4KQQA 3SH8A 1O7EA 1SKFA 1XA7A 5FDHA 3ZG8B 2X01A 2J9OA 2OLVA 4FSFA 1FCNA 5FASA 5CHJA 3GRJA 1YLTA 5EUAA 3ZVTA 1PW8A 3S4XA 2XK1A 4E3JA 1YMSA 3IF6B 1YM1A 4MLLA 4FH2A 1CI9A 1CK3A 5AQ9A 3HUNA 3UDIA 3ZGAB 4RRQA 3LCEA 3PD4A 3G34A 4P0MA 1WE4A 3ZDJA 4H8RA 1BUEA 1ONGA 4MBKA 1TDLA 3MZEA 4OQIA 4RVAA 2J8YA 2Q9MA 1KGGA 5FAQA 5TR7A 1BZAA 3WWXA 2DCFA 2P9VA 2DBOA 3P98A 3IT9A 2WYXA 4DDYA 1KDWA 3VSLA 1DJAA 4RRGA 4E3OA 1PYYA 1RP5A 3BEBA 3N4IA 3PBNA 4FD8A 2G2WA 2HL0A 2XFSA 4DF6A 4NK3A 4FH4A 4XUXA 5GLCA 1Y54A 4HESA 1WYBA 2EFUA 1MXOA 3IH9A 3IXBA 2ZQAA 1LLBA 1MWUA 1MY8A 2HDRA 3LEZA 1L2SA 1YQSA 3N6IA 3BFEA 2V1ZA 3SS5A 3SS3A 3UPPA 3ZG5A 3IH8A 1JWVA 1CI8A 3MKEA 4JF6A 4LCMA 4X55A 2ZC5B 3HLGA 3P09A 1IYSA 4PM7A 1W8QA 5EE8A 4B4XA 1TC5A 1TEMA 4RRHA 4E3LA 2FFYA 3A3DA 5E43A 4X68A 2QPNA 3IWOA 2QMIA 4IVKA 3IF6C 5TFQA 1IEMA 2OLUA 4OPQA 2XFTA 1LI9A 1N4OA 1J9MA 5E2EA 1H8ZA 3CZDA 3O87A 3VFFA 4Q8IA 3LMUA 3MZFA 4KZ7A 3W4PA 4KZBA 5D3OA 3ZG9B 1K54A 1MWTA 3HBRA 3G2ZA 5CRFA 5GHXA 1K25A 1KE4A 3BFCA 1NYYA 3LMVA 5L2FA 5GHZA 2ZQ9A 5GLAA 3B3XA 5IHVA 3OPHA 3V50A 4MBHA 3QNBA 5HAQA 4ZAMA 3Q7VB 1VM1A 5F83A 1L0GA 1N9BA 4P6BA 1GA9A 1K6SA 3SH7A 4IVIA 5EOOA 2J9PA 1KE3A 1NZUA 4EQIA 2HPBA 2RCXA 2WKEA 4IBXA 1PZOA 5FQIA 4RYEA 4QU3A 5GLBA 4X69A 4RRFA 2ZC4B 5FI2A 1GA0A 4R1GA 4R23A 2Z2MB 4D2OA 2ZD8A 5M1AA 2C5WB 1K57C 2HL2A 1ZG4A 2Y2GA 5F82A 3BFDA 3IWIA 1K4FA 4BL2A 5HW3A 5AQAA 4Y0TA 5EVIB 1NYMA 4KZ4A 4E3IA 1GHIA 1M6KA 2HP9A 3OPLA 4E6XA 4OQGA 4EUZA 4BD1A 4E3NA 2B5RA 1W5DA 1PWCA 4RRBA 3BM6A 4WMCA 4JF4A 2EX6A 3OC2A 1CEFA 2ZQ7A 4EWFA 4DXCA 5FSRA 5CERA 1K55C 4XUZA 1JWZA 3DWKA 3IXGA 5CTNA 5E2FA 1M40A 4DE3A 1G68A 3HLFA 3MZDA 4OOLA 5FA7A 2GDNA 3HLWA 2A3UA 3EQVA 1IYPA 3PBSA 1PI5A 4GDBA 1TDGA 2P74A 4OLDA 4CJNA 2HP5A 3OCNA 3NCKA 4MEZA 2HP6A 3AGFA 3PBQA 4KZ5A 3G30A 3OPPA 3BFFA 3AGEA 4KZ9A 4R3BA 5CGWA 5FQ9A 5FQKA 3V3SA 1SHVA 3HUOA 4X53A 4ZDXA 3A3JA 3C7VA 1KVLA 1I2SA 3JYIA 3N8RA 3OCLA 3PBTA 5CGSA 1IELA 1S6RA 3PD5A 1RCJA 4JBFA 4EBNA 5DF8A 3G31A 5DVAA 3OPRA 2H5SA 1ERQA 4GNUA 3G4PA 4RR9A 3KOCA 3HLDA 1FSWA 3UE0A 2EX8A 3UY6A 3VP0A 3E2KA 4N1HA 4LV0A 4S03A 3GR2A 1HZOA 1KVMA 2ZC3B 2OSUA 4OOYA 4BENA 5HAPA 1K4EA 3MBZA 4OQ0A 4HBUA 5FI7A 1J7GA 3A3EA 3HREA 3GV9A 4QY6A 2BLSA 2ZQ8A 1S0WA 1GHPA 5KSHA 3UE1A 5M19A 4KZ3A 4S2MA 2EX2A 1BLHA 2OV5A 2R9WA 3UPNA 2CC1A 4DRTA 3VP1A 3ZG0A 1IYOA 3CMZA 4GDNA 4YINA 2VGJA 4U3TA 3SH9A 2IWDA 5FQJA 1Q2QA 3BLMA 4C3QA 4OP5A 1LI0A 4YFMA 3UN7A 1KGFA 1NZOA 3HUMA 3TSGA 3UO9A 3ZHHA 4PM5A 2ZQDA 4WELA 4GD6A 4IBRA 5EVIA 3AGDA 1MBLA 4N9LA 2H10A 3ZCZA 2HL1A 1NRFA 4S0JA 1OMEA 2WGVA 4OKPA 2Y2IA 3VP3A 2WADA 2RL3A 5M18A 3ZNYA 3KO5A 3W8KA 1BLPA 1W79A 2E8IA 4N1XA 4RRAA 1L0FA 4KQRA 4S0KA 3NIAA 1KDSA 4RRIA 5CGXA 1LL5A 3OZHA 5HFOA 4WYYA 4OLGA 2J7VA 1ZG6A 1MPLA 5J61A 4KZAA 2JCHA 1MKIA 3QNCA 4U0TA 3A3FA 4X56A 3NDEA 3ZFZA 3LMTA 3Q82A 4OOMA 1K56A 5HAIA 5CXWA 4E6WA 3DWZA 3VOZA 3W4QA 4RA7A 4JXSA 1GCEA 4RRLA 3PTEA 4E3KA 3G32A 3VP4A 3KO4A 4HEFA 5DTSA 4HBTA 1SDEA 1HTZA 5KMWA 1ES4A 1E4DA 1ZKJA 2R9XA 5BOHA 4KENB 3FV7A 1JKEA 1BLSA 1Z6FA 4KG6A 5CEBA 3ITAA 4LENA 4CPKA 2WKHA 4B4ZA 5CECA 5AQ7A 4C6YA 3RJUA 2Y2OA 1TVFA 1ZC2A 3IXDA 4N92A 2XGNA 2WZZA 2Y55A 4WZ5C 1PIOA 3GSGA 1LHYA 4K0WA 5HARA 1W7FA 3IHAA 2ZC6B 3M2JA 4B88A 1ES3A 3G2YA 2DNSA 3IF6A 4KG5A 4QJGA 3WS1A 3VOYA 1Y2QA 5A92A 3O86A 4S2KA 4GZBA 4LCLA 1G6AA 3LO7A 3PAEA 4S2NC 5GHYA 2Y91A 3SOIA 3MXSA 1E3UA 3QHYA 3KO3A 3UNWA 2V20A 3IQAA 3LY3A 2XD5A 2Y2KA 4RX2A 3RXXA 2WUQA 2Q9NA 3NDGA 2PU2A 3EQUA 4OQHA 5F1GA 1KGEA 4S2IA 4Y0OA 3PAGA 5DF7A 3NI9A 4NBJA 3IWQA 3CG5A 3TOIA 4WZ4A 4GD8A 3V5MA 3KNFA 3IHBA 5CHMA 5EECA 4RR8A 3GTCA 2OKVA 3WRZA 3Q07A 1DY6A 3M6HA 3NY4A 4K91A 2Y4AA 1H5XA 3C4PA 3C7UA 4WBGA 4Y7PA 3GQZA 5CEDA 2QZ6A 4RRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X71 A;  4WEJ A;  2EXB A;  2JE5 A;  1YLY A;  2HDU A;  4RX3 A;  4ID4 A;  4FCF A;  3N7W A;  4OP8 A;  5CTM A;  3M2K A;  1K57 A;  3IF5 A;  3D4F A;  1ERO A;  4JXW A;  5E2H A;  2G2U A;  1XXM A;  5HL1 A;  5FI6 A;  2BG1 A;  1PZP A;  5KSC A;  1ALQ A;  3UDX A;  1ESU A;  1XP4 A;  4DKI A;  3O88 A;  4IED A;  5JYP A;  4GKU A;  4PM8 A;  4S2J A;  3Q7Z A;  1SCW A;  4UA9 A;  4Z9Q A;  1MWS A;  2JC7 A;  1IKI A;  5FAT A;  3HLB A;  4GN2 A;  4KG2 A;  3WS4 A;  1KE0 A;  2FFF B;  1K55 A;  3PBR A;  4LV2 A;  2WK0 A;  1NY0 A;  2H0Y A;  4MNR A;  1H8Y A;  2WAF A;  4X6T A;  1W8Y A;  1ESI A;  4KZ6 A;  1ES5 A;  4BD0 A;  1BLC A;  4P85 A;  2XR0 A;  3MXR A;  3Q7V A;  4JXG A;  1XPB A;  1BSG A;  1FR1 A;  4OPR A;  5GL9 A;  1K56 D;  4MBF A;  3UPO A;  4QHC A;  3ZNT A;  3TG9 A;  4PMA A;  4S2L A;  2XQZ A;  3NBL A;  2H0T A;  3LY4 A;  3FKW A;  4U0X A;  4BJP A;  3SS4 A;  1K38 A;  4KQO A;  1YLP A;  1XA1 A;  1DJB A;  3CJM A;  3BLS A;  4WEK A;  2V2F F;  4C75 A;  4JXV A;  4UHU A;  4JLF A;  5DTK A;  3UDF A;  3MKF A;  4EBP A;  3HLE A;  4PPR A;  5EOE A;  4P87 A;  2ZM0 A;  3VSK A;  1NJ4 A;  4R4S A;  1FQG A;  1IYQ A;  3HVF A;  4ZJ3 A;  4BQM A;  1PI4 A;  4BL3 A;  1FOF A;  1YLW A;  2XLN A;  4GB7 A;  4F94 A;  4EBL A;  3HL9 A;  3WS2 A;  3RXW A;  2XDM A;  3M6B A;  1YLZ A;  1Q2P A;  2C6W B;  4JKT A;  3WS5 A;  2EXA A;  4A5R A;  2ZC7 A;  1FSY A;  1E3U D;  1EWZ A;  5U47 A;  4PM6 A;  1K54 C;  1XX2 A;  2A49 A;  3NC8 A;  3ZG7 B;  2WGW B;  4DE2 A;  2UWX A;  4UA7 A;  2XF3 A;  4R4R A;  2XEP A;  1U60 A;  1PWG A;  1WYC A;  3GMW A;  3Q81 A;  2Z2L B;  4WMC D;  5EPH A;  1ONH A;  2XD1 A;  3DTM A;  2ZMA A;  3V39 A;  3FWL A;  5EVL A;  1ERM A;  3C4O A;  5GLD A;  3WRT A;  5CHU A;  4K0X A;  2VGK A;  3BEC A;  3VMA A;  4OPY A;  4DE0 A;  5I94 A;  5J8X A;  5A93 A;  3PBO A;  4EV4 A;  4OH0 A;  4OON A;  2X02 A;  3G35 A;  3I7J A;  4WM9 A;  3WS0 A;  2XH9 A;  4KZ8 A;  5E2G A;  1CEG A;  1LL9 A;  2HDS A;  5FQQ A;  1JWP A;  1MWR A;  4XXR A;  1YT4 A;  4N9K A;  5G18 A;  4QY5 A;  1I5Q A;  5DF9 A;  3IXH A;  4ZJ1 A;  5F1F A;  3GVB A;  1I2W A;  1O07 A;  1AXB A;  4R0Q A;  3W4O A;  4ZBE A;  2ZJ9 A;  4Y0U A;  3ISG A;  3FYZ A;  3O3V A;  2Y2J A;  2WKI A;  1FCO A;  5A91 A;  2ZM8 A;  3MFD A;  5HX9 A;  3ITB A;  2Y2N A;  5FAP A;  1YMX A;  1XGI A;  1XGJ A;  3BFG A;  3ZVW A;  4LV3 A;  5AQB A;  1VQQ A;  4PM9 A;  1SDN A;  3A3I A;  3N8S A;  3C5A A;  2JBF A;  1RGY A;  2P9V B;  2WZX A;  2IWC A;  4WZ5 A;  2IWB A;  4QB8 A;  5JYO A;  4BLM A;  3HLC A;  2Y2P A;  3BRM A;  1ES2 A;  3S22 A;  4DE1 A;  1FCM A;  3FZC A;  5FAO A;  2EFX A;  2Y2M A;  2EX9 A;  1PW1 A;  4M3K A;  4S2N A;  1QMF A;  3V3R A;  4LV1 A;  2I72 A;  1GHM A;  4S2P A;  4E3M A;  1E25 A;  2Y2Q A;  1L0D A;  5EVI D;  4GOG A;  1HD8 A;  1L0E A;  4UAA A;  4ZTK A;  1JTG A;  2ZLY A;  4JPM A;  2DRW A;  4DDS A;  1YLJ A;  2WGW A;  4O7D A;  2PBY A;  1NXY A;  3VP2 A;  1IKG A;  2WAE A;  3N8L A;  2HDQ A;  1BT5 A;  4R3J A;  4NET A;  4OVD A;  3S1Y A;  1C3B A;  1QME A;  2ZQC A;  3FKV A;  3Q1F A;  1JVJ A;  1XKZ A;  1FR6 A;  2ZM2 A;  4OPZ A;  1BTL A;  5TGF A;  2PU4 A;  3VFH A;  2Y2H A;  1BUL A;  2Y2L A;  1JTD A;  1EI5 A;  1PWD A;  4S2O A;  4DXB A;  2WGI A;  5KZH A;  3UE3 A;  3BYD A;  3DW0 A;  4JF5 A;  4L0L A;  4UA6 A;  1RGZ A;  5DTT A;  1HVB A;  3E2L A;  1K6R A;  1DJC A;  5A90 A;  4QD4 A;  2Y59 A;  5EVI C;  5FQM A;  4ZJ2 A;  4KQQ A;  3SH8 A;  1O7E A;  1SKF A;  1XA7 A;  5FDH A;  3ZG8 B;  2X01 A;  2J9O A;  2OLV A;  4FSF A;  1FCN A;  5FAS A;  5CHJ A;  3GRJ A;  1YLT A;  5EUA A;  3ZVT A;  1PW8 A;  3S4X A;  2XK1 A;  4E3J A;  1YMS A;  3IF6 B;  1YM1 A;  4MLL A;  4FH2 A;  1CI9 A;  1CK3 A;  5AQ9 A;  3HUN A;  3UDI A;  3ZGA B;  3LCE A;  3G34 A;  4P0M A;  1WE4 A;  3ZDJ A;  4H8R A;  1BUE A;  1ONG A;  4MBK A;  1TDL A;  3MZE A;  4OQI A;  4RVA A;  2J8Y A;  2Q9M A;  1KGG A;  5FAQ A;  5TR7 A;  1BZA A;  3WWX A;  2DCF A;  2P9V A;  3P98 A;  3IT9 A;  2WYX A;  4DDY A;  1KDW A;  3VSL A;  1DJA A;  4E3O A;  1PYY A;  1RP5 A;  3BEB A;  3N4I A;  3PBN A;  4FD8 A;  2G2W A;  2XFS A;  4DF6 A;  4NK3 A;  4FH4 A;  4XUX A;  5GLC A;  1Y54 A;  4HES A;  1WYB A;  2EFU A;  1MXO A;  3IH9 A;  3IXB A;  2ZQA A;  1LLB A;  1MWU A;  1MY8 A;  2HDR A;  3LEZ A;  1L2S A;  1YQS A;  3N6I A;  3BFE A;  2V1Z A;  3SS5 A;  3SS3 A;  3UPP A;  3ZG5 A;  3IH8 A;  1JWV A;  1CI8 A;  3MKE A;  4JF6 A;  4LCM A;  4X55 A;  2ZC5 B;  3HLG A;  3P09 A;  1IYS A;  4PM7 A;  1W8Q A;  5EE8 A;  4B4X A;  1TEM A;  4E3L A;  2FFY A;  3A3D A;  5E43 A;  4X68 A;  2QPN A;  3IWO A;  2QMI A;  4IVK A;  3IF6 C;  5TFQ A;  1IEM A;  2OLU A;  4OPQ A;  2XFT A;  1LI9 A;  1N4O A;  1J9M A;  5E2E A;  1H8Z A;  3CZD A;  3O87 A;  3VFF A;  4Q8I A;  3MZF A;  4KZ7 A;  3W4P A;  4KZB A;  5D3O A;  3ZG9 B;  1K54 A;  1MWT A;  3HBR A;  3G2Z A;  5CRF A;  5GHX A;  1K25 A;  1KE4 A;  3BFC A;  1NYY A;  5L2F A;  5GHZ A;  2ZQ9 A;  5GLA A;  3B3X A;  5IHV A;  3OPH A;  3V50 A;  4MBH A;  3QNB A;  5HAQ A;  4ZAM A;  3Q7V B;  1VM1 A;  5F83 A;  1L0G A;  1N9B A;  4P6B A;  1GA9 A;  1K6S A;  3SH7 A;  4IVI A;  5EOO A;  2J9P A;  1KE3 A;  1NZU A;  4EQI A;  2HPB A;  2RCX A;  2WKE A;  4IBX A;  1PZO A;  5FQI A;  4RYE A;  4QU3 A;  5GLB A;  4X69 A;  2ZC4 B;  5FI2 A;  1GA0 A;  4R1G A;  4R23 A;  2Z2M B;  4D2O A;  2ZD8 A;  5M1A A;  2C5W B;  1K57 C;  1ZG4 A;  2Y2G A;  5F82 A;  3BFD A;  3IWI A;  1K4F A;  4BL2 A;  5HW3 A;  5AQA A;  4Y0T A;  5EVI B;  1NYM A;  4KZ4 A;  4E3I A;  1GHI A;  1M6K A;  2HP9 A;  3OPL A;  4E6X A;  4OQG A;  4EUZ A;  4BD1 A;  4E3N A;  2B5R A;  1W5D A;  1PWC A;  3BM6 A;  4WMC A;  4JF4 A;  2EX6 A;  3OC2 A;  1CEF A;  2ZQ7 A;  4EWF A;  4DXC A;  5FSR A;  5CER A;  1K55 C;  4XUZ A;  1JWZ A;  3DWK A;  3IXG A;  5CTN A;  5E2F A;  1M40 A;  4DE3 A;  1G68 A;  3HLF A;  3MZD A;  4OOL A;  5FA7 A;  2GDN A;  3HLW A;  2A3U A;  3EQV A;  1IYP A;  3PBS A;  1PI5 A;  4GDB A;  1TDG A;  2P74 A;  4OLD A;  4CJN A;  2HP5 A;  3OCN A;  3NCK A;  4MEZ A;  2HP6 A;  3AGF A;  3PBQ A;  4KZ5 A;  3G30 A;  3OPP A;  3BFF A;  3AGE A;  4KZ9 A;  4R3B A;  5CGW A;  5FQ9 A;  5FQK A;  3V3S A;  1SHV A;  3HUO A;  4X53 A;  4ZDX A;  3A3J A;  3C7V A;  1KVL A;  1I2S A;  3JYI A;  3N8R A;  3OCL A;  3PBT A;  5CGS A;  1IEL A;  1S6R A;  1RCJ A;  4JBF A;  4EBN A;  5DF8 A;  3G31 A;  5DVA A;  3OPR A;  2H5S A;  1ERQ A;  4GNU A;  3G4P A;  3HLD A;  1FSW A;  3UE0 A;  2EX8 A;  3UY6 A;  3VP0 A;  3E2K A;  4N1H A;  4LV0 A;  3GR2 A;  1HZO A;  1KVM A;  2ZC3 B;  2OSU A;  4OOY A;  4BEN A;  5HAP A;  1K4E A;  3MBZ A;  4OQ0 A;  4HBU A;  5FI7 A;  3A3E A;  3HRE A;  3GV9 A;  4QY6 A;  2BLS A;  2ZQ8 A;  1S0W A;  1GHP A;  5KSH A;  3UE1 A;  5M19 A;  4KZ3 A;  4S2M A;  2EX2 A;  1BLH A;  2OV5 A;  2R9W A;  3UPN A;  2CC1 A;  4DRT A;  3VP1 A;  3ZG0 A;  1IYO A;  3CMZ A;  4GDN A;  4YIN A;  2VGJ A;  4U3T A;  3SH9 A;  2IWD A;  5FQJ A;  1Q2Q A;  3BLM A;  4C3Q A;  4OP5 A;  1LI0 A;  4YFM A;  3UN7 A;  1KGF A;  1NZO A;  3HUM A;  3TSG A;  3UO9 A;  3ZHH A;  4PM5 A;  2ZQD A;  4WEL A;  4GD6 A;  4IBR A;  5EVI A;  3AGD A;  1MBL A;  4N9L A;  2H10 A;  3ZCZ A;  1NRF A;  1OME A;  2WGV A;  4OKP A;  2Y2I A;  3VP3 A;  2WAD A;  2RL3 A;  5M18 A;  3ZNY A;  3W8K A;  1BLP A;  1W79 A;  2E8I A;  4N1X A;  1L0F A;  4KQR A;  3NIA A;  1KDS A;  5CGX A;  1LL5 A;  3OZH A;  5HFO A;  4WYY A;  4OLG A;  2J7V A;  1ZG6 A;  1MPL A;  4KZA A;  2JCH A;  1MKI A;  3QNC A;  4U0T A;  3A3F A;  4X56 A;  3NDE A;  3ZFZ A;  3Q82 A;  4OOM A;  1K56 A;  5HAI A;  5CXW A;  4E6W A;  3DWZ A;  3VOZ A;  3W4Q A;  4RA7 A;  4JXS A;  1GCE A;  3PTE A;  4E3K A;  3G32 A;  3VP4 A;  4HEF A;  5DTS A;  4HBT A;  1SDE A;  1HTZ A;  5KMW A;  1ES4 A;  1E4D A;  1ZKJ A;  2R9X A;  5BOH A;  4KEN B;  3FV7 A;  1BLS A;  1Z6F A;  4KG6 A;  5CEB A;  3ITA A;  4LEN A;  4CPK A;  2WKH A;  4B4Z A;  5CEC A;  5AQ7 A;  4C6Y A;  3RJU A;  2Y2O A;  1TVF A;  1ZC2 A;  3IXD A;  4N92 A;  2XGN A;  2WZZ A;  2Y55 A;  4WZ5 C;  1PIO A;  3GSG A;  1LHY A;  4K0W A;  5HAR A;  1W7F A;  3IHA A;  2ZC6 B;  3M2J A;  4B88 A;  1ES3 A;  3G2Y A;  2DNS A;  3IF6 A;  4KG5 A;  4QJG A;  3WS1 A;  3VOY A;  5A92 A;  3O86 A;  4S2K A;  4GZB A;  4LCL A;  1G6A A;  3LO7 A;  3PAE A;  4S2N C;  5GHY A;  2Y91 A;  3SOI A;  3MXS A;  1E3U A;  3QHY A;  3UNW A;  2V20 A;  3IQA A;  3LY3 A;  2XD5 A;  2Y2K A;  4RX2 A;  3RXX A;  2WUQ A;  2Q9N A;  3NDG A;  2PU2 A;  3EQU A;  4OQH A;  5F1G A;  1KGE A;  4S2I A;  4Y0O A;  3PAG A;  5DF7 A;  3NI9 A;  3IWQ A;  3CG5 A;  3TOI A;  4WZ4 A;  4GD8 A;  3V5M A;  3IHB A;  5CHM A;  5EEC A;  3GTC A;  3WRZ A;  3Q07 A;  1DY6 A;  3M6H A;  3NY4 A;  4K91 A;  2Y4A A;  1H5X A;  3C4P A;  3C7U A;  4WBG A;  4Y7P A;  3GQZ A;  5CED A;  2QZ6 A; 
#chains in the Genus database with same CATH topology
 2GX5 A;  4WEJ A;  3A0S A;  1Y28 A;  2HDU A;  3DBA A;  4OP8 A;  1ZTU A;  3TRC A;  2BTF P;  3IF5 A;  1ERO A;  5E2H A;  5HL1 A;  1OJG A;  1PFL A;  5HZH A;  4BBV A;  1PZP A;  5KSC A;  4DKI A;  3KO6 A;  4GKU A;  4S2J A;  1SCW A;  1MWS A;  4ETZ A;  2INW A;  1BYW A;  2FFF B;  4LGW A;  4MNR A;  2WAF A;  4X25 A;  2W0N A;  4NBI A;  4JXG A;  2VEA A;  1FR1 A;  3OLO A;  4QHC A;  5J7E A;  2PYR A;  4S2L A;  4DMZ A;  3NBL A;  2H0T A;  3LY4 A;  4BJP A;  4U0X A;  4KQO A;  1YLP A;  4FOF A;  4UHU A;  3T4T A;  3HLE A;  2QKP A;  3LGO A;  2V1A A;  3F1P B;  1NJ4 A;  3LFV A;  3T4O A;  2M1C A;  1YLW A;  4EBL A;  4GS9 B;  1J3W A;  3GEC A;  3WS2 A;  2C6W B;  4JKT A;  2JKT I;  2ZC7 A;  1E3U D;  4PM6 A;  2YKH A;  1XX2 A;  5MC7 A;  2UWX A;  4UA7 A;  3VE3 A;  1PWG A;  1OTD A;  4HP9 A;  5HWW A;  1OTB A;  1ONH A;  1XFN A;  3FWL A;  2W3F A;  3NHQ A;  3WRT A;  2M7U A;  4K0X A;  2VGK A;  5A93 A;  2W1R A;  2X02 A;  4NG2 A;  4WM9 A;  3WS0 A;  2XH9 A;  2O0Y A;  4ZRR A;  5DJT A;  2W3E A;  3MF0 A;  4N9K A;  5G18 A;  4QY5 A;  5DF9 A;  3TJZ C;  4ZBE A;  2ZJ9 A;  4Y0U A;  3O3V A;  2WKI A;  4Y3I A;  2PYP A;  1F9I A;  2Y2N A;  3UME A;  3A0R A;  5DKK A;  4UQI M;  2JBF A;  1RGY A;  2WZX A;  4QB8 A;  4I39 A;  5AVF A;  5FAO A;  1DP8 A;  2JN7 A;  3LIF A;  1JNU A;  3KSI A;  1E25 A;  5TBM A;  3NEC A;  4JPM A;  4RR7 A;  4S02 A;  2WGW A;  2PBY A;  1VET A;  3S7Q A;  2WAE A;  1DRM A;  4NET A;  4OVD A;  1QME A;  2ZQC A;  4HNB A;  3CHW P;  4Z1W A;  1FR6 A;  3T12 B;  4OPZ A;  1BTL A;  2PU4 A;  3VFH A;  2VV7 A;  3P01 A;  1JTD A;  4E04 A;  5DTT A;  1LL8 A;  4NEE D;  5A90 A;  4QWO A;  5FQM A;  4ZJ2 A;  3SH8 A;  5HD3 A;  3GRJ A;  1D1J A;  4FH2 A;  4RRQ A;  3HUN A;  3F1O A;  1H0M A;  3PD4 A;  1ONG A;  3MZE A;  4OQI A;  4RVA A;  1WA9 A;  5FAQ A;  4G3K A;  1DJA A;  4RRG A;  1RP5 A;  2HL0 A;  3D72 A;  4DF6 A;  4GLQ A;  4Y17 A;  4HES A;  2EFU A;  3IH9 A;  2ZQA A;  1L2S A;  3SS5 A;  3UPP A;  4LCM A;  4X55 A;  1CI8 A;  3C38 A;  4JF6 A;  3HLG A;  1IYS A;  3A3D A;  2ACG A;  4NXG A;  4IVK A;  3IF6 C;  2ZBB A;  3T1Q B;  2XFT A;  1N4O A;  4Q8I A;  1OT6 A;  3MZF A;  4KZB A;  5D3O A;  3S7O A;  3HBR A;  3G2Z A;  1KE4 A;  5L2F A;  5GHZ A;  5GLA A;  3QNB A;  5F83 A;  4IVI A;  5EOO A;  2J9P A;  4FTX A;  1ACF A;  3P7N A;  4IBX A;  5FQI A;  5HWT A;  4RRF A;  2ZC4 B;  3LR4 A;  4R23 A;  3CAX A;  4D2O A;  5EFW A;  2VGL S;  5J4E A;  1ZG4 A;  2Y2G A;  3UB5 P;  2B95 A;  1OTI A;  1YSQ A;  3HJI A;  2HP9 A;  1NLY A;  2P08 A;  4E6X A;  5LBR A;  4PHT A;  5FL3 A;  4WMC A;  3CUE C;  1S4S A;  5CER A;  5HWV A;  1K0K A;  4Y13 A;  3DWK A;  1M40 A;  5FA7 A;  3EQV A;  1TDG A;  2P74 A;  4OLD A;  3NCK A;  4MEZ A;  3PBQ A;  3V3S A;  5FQ9 A;  3CWF A;  5FQK A;  3HUO A;  4X53 A;  3QP1 A;  4ZDX A;  3B33 A;  4WN5 A;  3MJQ A;  3CLO A;  5CGS A;  3T4S A;  3PD5 A;  4HJ4 A;  5DF8 A;  4HJ3 A;  3G4P A;  4CLC D;  3R7W A;  4EQ1 A;  1HZO A;  4M4X A;  4QPR A;  2Q0O A;  3D9Y A;  3HRE A;  2BLS A;  1S0W A;  3DTE A;  3UE1 A;  2EX2 A;  2R9W A;  1YAX A;  3NOU C;  1IYO A;  4GDN A;  1NWZ A;  4YIN A;  5EV0 A;  4EXO A;  2NUP C;  3SH9 A;  3KSF A;  4YFM A;  1KGF A;  1D06 A;  3UO9 A;  2ZQD A;  4D60 A;  2QYB A;  5EVI A;  3AGD A;  2RL3 A;  3KO5 A;  3W8K A;  4KQR A;  2HF6 A;  1OTE A;  1LT0 A;  2J7V A;  4R38 A;  5J61 A;  3KSG A;  3QNC A;  1MKI A;  3NUL A;  3NDE A;  3GDI A;  4OOM A;  1K56 A;  5CXW A;  3DWZ A;  1VET B;  4II7 A;  4RA7 A;  2PT7 A;  4RRL A;  3E4O A;  4E3K A;  3VP4 A;  1XJ4 A;  3IX3 A;  3QP5 A;  2V0U A;  4I5S A;  3KSH A;  1BLS A;  2H28 A;  3ITA A;  2WKH A;  5AQ7 A;  4C6Y A;  3RJU A;  2Y2O A;  1TVF A;  4N92 A;  2WZZ A;  3GSG A;  1W7F A;  3L7H A;  2VA0 A;  3G2Y A;  4QJG A;  4KG5 A;  3VOY A;  1Y2Q A;  3LO7 A;  3PAE A;  3LIA A;  5GHY A;  3MXS A;  3UNW A;  1W63 M;  3RXX A;  2Q9N A;  1KOU A;  3NDG A;  4BWI A;  1KGE A;  2XA7 S;  4NBJ A;  2PD8 A;  2LB9 A;  3GTC A;  4ETX A;  3WRZ A;  2J3W A;  3NY4 A;  4JGQ A;  4WBG A;  4Y7P A;  2QZ6 A;  3IBR A;  3RTY A;  2EXB A;  2A2L A;  4ID4 A;  4FCF A;  5CTM A;  1K57 A;  3BWL A;  2G2U A;  2PR6 A;  3R4K A;  2BG1 A;  3KYE A;  1ESU A;  1SKO A;  4UA9 A;  2JC7 A;  4KG2 A;  1K55 A;  4EEP A;  2H0Y A;  1W8Y A;  1BLC A;  2BAS A;  2QJ5 A;  4P85 A;  3Q7V A;  1XPB A;  2EA9 A;  1BSG A;  2Y79 A;  1ODV A;  3TG9 A;  3LR0 A;  4AFI A;  3SS4 A;  2VGL M;  5F5Y A;  4BBU A;  3CJM A;  2J80 A;  2W3D A;  3UDF A;  1YSP A;  3EOI A;  2O9A A;  4PPR A;  5EOE A;  4CLC C;  4P87 A;  3H7W B;  3VSK A;  4R4S A;  4L9G A;  1FQG A;  1PRQ A;  4BQM A;  1PI4 A;  1FOF A;  4GB7 A;  1Z09 A;  2XDM A;  1FSY A;  5U47 A;  1K54 C;  3CI6 A;  2A49 A;  5IT5 A;  4DE2 A;  2XF3 A;  3CIT A;  1U60 A;  1WYC A;  2ZMA A;  3V39 A;  5FEF A;  1LSX A;  3LIB A;  5CHU A;  5I94 A;  3EGX C;  4EV4 A;  4OH0 A;  2EWV A;  1H8M A;  5L09 A;  3TE8 A;  1LL9 A;  4NKP A;  2L4R A;  3IXH A;  4ZJ1 A;  3T4J A;  2D02 A;  3UMD A;  1I2W A;  5G4Y A;  1S1Z A;  3ISG A;  3UB7 A;  5L07 A;  4LFU A;  5F68 A;  3MFD A;  3PHY A;  3K2N A;  3W2Z A;  5AQB A;  1VQQ A;  4WZ5 A;  2IWB A;  5JYO A;  4ME4 A;  1ES2 A;  2HJE A;  1FCM A;  4S0L A;  4ARZ A;  3FZC A;  1MZU A;  2EFX A;  2Y2M A;  1PW1 A;  4M3K A;  3A0V A;  1QMF A;  4Q0J A;  4LV1 A;  4HOI A;  4E3M A;  4CLC B;  2VK3 A;  3MQQ A;  3HJK A;  4ZTK A;  4R3A A;  4UAA A;  1JTG A;  1YLJ A;  4O7D A;  4ESP A;  1NXY A;  1TS8 A;  3N8L A;  2W1T A;  1BT5 A;  1N9N A;  4R3J A;  1JVJ A;  1LSW A;  1XKZ A;  2ZM2 A;  2B18 A;  2Y2H A;  1BUL A;  4WLA A;  1EI5 A;  3QP8 A;  3MMH A;  3BYD A;  3DW0 A;  4UA6 A;  3LR5 A;  4QD4 A;  3MQO A;  3KO7 A;  4DJ2 A;  4KQQ A;  1O7E A;  2X01 A;  2J9O A;  3EEH A;  2FZ0 A;  4IUK A;  3ZQ5 A;  1UWN X;  4JGP A;  2XK1 A;  1YM1 A;  2WKP A;  1CK3 A;  2JKT M;  4B93 A;  2XA7 M;  4P0M A;  1WE4 A;  4MBK A;  1MC0 A;  2NUT C;  3H82 A;  2J8Y A;  5HDS A;  2P9V A;  3E98 A;  2WYX A;  3VSL A;  2ZMF A;  2JKG A;  4E3O A;  1PYY A;  3N4I A;  3PBN A;  4Q0I A;  4FH4 A;  4XUX A;  1Y54 A;  3LEZ A;  1YQS A;  3SS3 A;  2V1Z A;  4PAU A;  3IH8 A;  3MKE A;  5EE8 A;  2D01 A;  1TEM A;  2M7V A;  4YWZ A;  1DP6 A;  5TFQ A;  2OLU A;  4OPQ A;  3LMU A;  1J9M A;  4KZ7 A;  1V9Y A;  2AVX A;  2GJ3 A;  2ZL1 A;  4Q0H A;  2G7U A;  5CRF A;  5GHX A;  1STZ A;  3T1R A;  4O8G A;  5DFX A;  3OPH A;  4ZAM A;  3Q7V B;  1N9B A;  1GA9 A;  1L3L A;  1MKM A;  1NZU A;  4EQI A;  5GLB A;  2XSS A;  3C2W A;  5FI2 A;  5M1A A;  3TW8 A;  5DJU A;  3F1N B;  3U2A A;  4MN6 A;  1GHI A;  3MSH A;  3OPL A;  4EUZ A;  1FIK A;  2B5R A;  1PWC A;  4RRB A;  2I9V A;  3BM6 A;  3OC2 A;  1CEF A;  2ZQ7 A;  4EWF A;  5AJG A;  4DE3 A;  3MZD A;  4OOL A;  2GDN A;  4R6L A;  2K31 A;  1PI5 A;  4GDB A;  3T4Q A;  3OPP A;  1NLZ A;  1SHV A;  4IJG A;  3A3J A;  4KUO A;  3C7V A;  3N8R A;  4X1L A;  5DVA A;  1FSW A;  5HPF A;  2EX8 A;  4HHD A;  2HGV A;  3VP0 A;  4N1H A;  3CPT A;  1K4E A;  3LYX A;  4HBU A;  3FG8 A;  1CQA A;  1TS7 A;  2CC1 A;  3VP1 A;  3ZG0 A;  2IA2 A;  2W3H A;  3CMZ A;  3BJN A;  3DTI A;  2VGJ A;  4U3T A;  4MDZ A;  4DJ3 A;  1Q2Q A;  4C3Q A;  3UN7 A;  3TSG A;  4WEL A;  4IBR A;  4N9L A;  2H10 A;  1OTA A;  1NRF A;  2Y2I A;  1W63 Q;  1W79 A;  3MR0 A;  4RRA A;  4ARZ B;  1KDS A;  3OZH A;  1G28 A;  4KZA A;  1YKD A;  4JXS A;  1X0O A;  3G32 A;  4JGR A;  1HTZ A;  3OOV A;  2QHK A;  1ES4 A;  1E4D A;  2R9X A;  4KEN B;  1T1B A;  4KUK A;  1P97 A;  1LSV A;  3S7P A;  2Y8H A;  3IXD A;  2VJW A;  2Y55 A;  3G6O A;  1ES3 A;  3LEQ A;  3KX0 X;  5A92 A;  1AWI A;  4LCL A;  2Y91 A;  3LY3 A;  4KQD A;  2XD5 A;  2Y2K A;  1T1A A;  4EES A;  4S2I A;  3ZYT A;  4Y0O A;  2L0W A;  3NI9 A;  3H82 B;  3IWQ A;  3CG5 A;  4WZ4 A;  3PYP A;  3KNF A;  4RR8 A;  2OKV A;  3Q07 A;  1DY6 A;  4IUH A;  3IBJ A;  3C7U A;  2ZC6 B;  2X71 A;  1EW0 A;  2JE5 A;  4RX3 A;  3BY8 A;  3D4F A;  3U4L P;  3SZT A;  4JXW A;  4F3L A;  3VV4 A;  3UDX A;  4CQH A;  4IED A;  5JYP A;  1PNE A;  4Z9Q A;  1KE0 A;  3PBR A;  3K3D A;  4X6T A;  1UGU A;  4KZ6 A;  5HD5 A;  2ZL1 B;  2XR0 A;  3MXR A;  1K56 D;  4B9O A;  4EER A;  3ZNT A;  3KOB A;  3KO9 A;  1S67 L;  4RRM A;  1XA1 A;  1DJB A;  3BLS A;  4WEK A;  1GSX A;  3MKF A;  4EBP A;  4H6J A;  1XJ2 A;  4I3J A;  3HVF A;  5FDS A;  4HH2 A;  4BL3 A;  2O9C A;  1T1C A;  4RRD A;  3M6B A;  1YLZ A;  4WF0 A;  3BW6 A;  3V67 A;  4HI4 A;  4GHI A;  3JVV A;  5TBM B;  3NC8 A;  2WGW B;  4R4R A;  2XEP A;  4BBT A;  2Z2L B;  1P9R A;  2XD1 A;  3DTM A;  5EVL A;  3BEC A;  4DE0 A;  4OPY A;  5AVE A;  5FEG A;  1YPR A;  3G35 A;  2KLI A;  4HQA A;  3I7J A;  2JKR M;  2ZOH A;  2HDS A;  1MWR A;  4XXR A;  1YT4 A;  2K2N A;  1O07 A;  3W4O A;  2W27 A;  5HPI A;  2JKR I;  4RR6 A;  4WUJ A;  1FCO A;  4EEU A;  4X1M A;  1YMX A;  3F1O B;  1XGI A;  1XGJ A;  2V0W A;  3BFG A;  3ZVW A;  4PM9 A;  3N8S A;  3C5A A;  2O9B A;  3F1P A;  2PAV P;  4BLM A;  3HLC A;  2Y2P A;  3BRM A;  5I5L A;  1HLU P;  4S2N A;  3D3O A;  3HCY A;  3V3R A;  2I72 A;  1GHM A;  4S2P A;  2XRO A;  1N9L A;  2KX6 A;  2Y2Q A;  4GOG A;  1HD8 A;  1L0E A;  2JHE A;  5IU1 A;  4RQ9 A;  4DDS A;  3K3C A;  1OPX A;  1IKG A;  4HY8 A;  4RRC A;  2OWJ A;  3FKV A;  1T19 A;  3T4K A;  2Z6C A;  3MFX A;  1S1Y A;  4I3A A;  4DXB A;  2WGI A;  5KZH A;  3UE3 A;  1RGZ A;  5HDD A;  1HVB A;  3E2L A;  1K6R A;  1XJ3 A;  5EVI C;  5L8M A;  2CMN A;  5FDH A;  1SKF A;  1XA7 A;  3BQA A;  4I38 A;  3ZG8 B;  2OLV A;  4FSF A;  1P9W A;  1FCN A;  3S7N A;  5FAS A;  4E3J A;  3T50 A;  3MXQ A;  4MLL A;  1CI9 A;  3UDI A;  3LCE A;  3G34 A;  4H8R A;  3EWK A;  1TDL A;  3LIE A;  2Q9M A;  5TR7 A;  1BZA A;  1GSW A;  4YNR A;  3WWX A;  2DCF A;  4NXE A;  3P98 A;  4DDY A;  1H3Q A;  1F5M A;  3BEB A;  4FD8 A;  4NK3 A;  1FIL A;  1TD5 A;  1WYB A;  1MXO A;  3N6I A;  2HDR A;  3BFE A;  4R70 A;  4L9F A;  3EEA A;  2ZC5 B;  3P09 A;  4PM7 A;  3MQ0 A;  4B4X A;  1TC5 A;  4CLC E;  4E3L A;  2FFY A;  5E43 A;  2QPN A;  3IWO A;  4EET B;  4F3L B;  1IEM A;  5HSQ A;  5E2E A;  3CZD A;  3O87 A;  3W4P A;  3R7W B;  3ZG9 B;  1K25 A;  5EVE A;  3BFC A;  2E8J A;  2ZQ9 A;  3B3X A;  5IHV A;  4MBH A;  5HAQ A;  1VM1 A;  3IX4 A;  2V8F A;  4P6B A;  1K6S A;  3SH7 A;  2WKE A;  4QU3 A;  4X69 A;  2Z2M B;  2ZD8 A;  1K57 C;  2HL2 A;  5F82 A;  5HW3 A;  5EVI B;  1TS6 A;  1M6K A;  4E3I A;  4H6J B;  1S66 L;  3H9W A;  1W5D A;  3DTK A;  3FC7 A;  2EX6 A;  4EW7 A;  2A24 A;  3RH8 B;  1K55 C;  1JWZ A;  3IXG A;  5E2F A;  1G68 A;  3HLF A;  5EM1 A;  4GHI B;  3DAV A;  4HP4 A;  3OCN A;  3LI9 A;  3AGF A;  4GCZ A;  4KZ5 A;  3E4P A;  4KZ9 A;  4R3B A;  2HV1 A;  3OCL A;  1IEL A;  1S6R A;  3JPU A;  4XT2 A;  3G31 A;  4EBN A;  3OPR A;  1ERQ A;  4HH3 A;  3KOC A;  4NXF A;  4LV0 A;  1VB6 A;  2MJ6 A;  2OSU A;  2V1B A;  2KOI A;  4G3V A;  4OOY A;  4QY6 A;  5KSH A;  1GHP A;  2O99 A;  3PXP A;  1BLH A;  3UPN A;  4O01 A;  5FQJ A;  3BLM A;  4OP5 A;  1LI0 A;  3NJA A;  3ZHH A;  3ZCZ A;  2PBD P;  2HL1 A;  1OME A;  2WGV A;  4OKP A;  5M18 A;  3T1S A;  3ZNY A;  3IS2 A;  2J3T C;  1BLP A;  4N1X A;  2P7J A;  1L0F A;  3NIA A;  3ICY A;  1LL5 A;  5HFO A;  4BMW A;  2JCH A;  4X56 A;  4MMN A;  3Q82 A;  1SKO B;  3LID A;  2HJ9 C;  3RFB A;  3VOZ A;  1GCE A;  4I3I A;  3KO4 A;  4HEF A;  2DMW A;  4HIA A;  1SDE A;  2WKQ A;  2FH5 A;  5KMW A;  1ZKJ A;  3FPV A;  5BOH A;  4Y2F A;  4GJ4 A;  4LEN A;  4CPK A;  5HDC A;  1UWP X;  3BY9 A;  3B42 A;  4WZ5 C;  1ZC2 A;  2B02 A;  2XGN A;  1GSV A;  1PIO A;  2K7S A;  1LHY A;  4K0W A;  5HAR A;  4P6Z S;  5KIZ A;  4FUW A;  3FPW A;  3IF6 A;  3QP4 A;  4UEY A;  3O86 A;  4S2K A;  1G6A A;  3BQ8 A;  3SOI A;  1NRJ A;  1E3U A;  3QHY A;  3KO3 A;  2V20 A;  3IQA A;  2WUQ A;  2PU2 A;  1S4R A;  4OQH A;  2PDR A;  2JKF A;  3LI8 A;  4EUV A;  4GD8 A;  3V5M A;  3IHB A;  5CHM A;  5EEC A;  2Y4A A;  3GQZ A;  1I2S A;  1YLY A;  3N7W A;  3M2K A;  2HKZ A;  2VX8 A;  1XXM A;  3SW1 A;  5FI6 A;  3IX8 A;  1ALQ A;  1XP4 A;  3O88 A;  4PM8 A;  2UV0 E;  4LRZ E;  3Q7Z A;  3O5Y A;  1XFQ A;  1IKI A;  3CUE A;  1TS0 A;  5FAT A;  3HLB A;  4GN2 A;  2Z6D A;  3WS4 A;  4LV2 A;  1P0Z A;  2WK0 A;  1NY0 A;  2WKR A;  1H8Y A;  4RRJ A;  1ESI A;  4RRK A;  4BD0 A;  1ES5 A;  3PD3 A;  2QJ7 A;  4L9E A;  5GL9 A;  4OPR A;  3KOD A;  4MBF A;  3UPO A;  4PMA A;  3E4Q A;  2XQZ A;  4DN0 A;  3FKW A;  1K38 A;  2P04 A;  4C75 A;  2V2F F;  4JXV A;  4JLF A;  5DTK A;  1G5U A;  1T18 A;  3LIC A;  2ZM0 A;  3VE4 A;  1IYQ A;  4ZJ3 A;  5J3W A;  2XLN A;  4F94 A;  3HL9 A;  3RXW A;  1Q2P A;  3WS5 A;  2EXA A;  4A5R A;  3C8C A;  2W3G A;  3KYQ A;  1Y4O A;  1EWZ A;  3KNP A;  2A24 B;  4MN7 A;  2PRF A;  3ZG7 B;  1VEU A;  3QP6 A;  2W1T B;  3Q81 A;  3GMW A;  5EPH A;  4WMC D;  1ERM A;  3C4O A;  5GLD A;  4EU0 A;  3VMA A;  5K5B A;  5J8X A;  3PBO A;  4OON A;  5EM0 A;  4O0P A;  4KZ8 A;  5E2G A;  1CEG A;  4XT2 B;  3B47 A;  5FQQ A;  1JWP A;  4K08 A;  4LLO B;  1I5Q A;  5F1F A;  3GVB A;  4R0Q A;  1AXB A;  2OOL A;  3FYZ A;  2Y2J A;  5A91 A;  2ZM8 A;  5HX9 A;  3ITB A;  3UB9 A;  5FAP A;  4MCW A;  1OJ5 A;  4LV3 A;  1SDN A;  3A3I A;  3C30 A;  3PD2 A;  3H7W A;  2P9V B;  2IWC A;  4PKY G;  3S22 A;  3JVU A;  1XJ6 A;  4DE1 A;  4S0I A;  2EWW A;  2EX9 A;  3UB8 A;  3IS2 B;  4GW9 A;  1L0D A;  1DP9 A;  5EVI D;  2ZLY A;  2DRW A;  2VV6 A;  2VLG A;  3VP2 A;  2HDQ A;  3S1Y A;  1C3B A;  3Q1F A;  1V9Z A;  5A8B A;  5TGF A;  3UB6 A;  2Y2L A;  1N9O A;  1PWD A;  4S2O A;  4JF5 A;  4L0L A;  2GZA A;  4P6Z M;  1DJC A;  2Y59 A;  2GNX A;  3MS6 A;  5CHJ A;  3EGD C;  3KYZ A;  1YLT A;  5EUA A;  3ZVT A;  1PW8 A;  3S4X A;  1YMS A;  3IF6 B;  5AQ9 A;  3ZGA B;  5L10 A;  3ZDJ A;  1BUE A;  4LPZ A;  1KGG A;  1OT9 A;  2DBO A;  3IT9 A;  1KDW A;  5G4Z A;  4YOF A;  2XRN A;  2G2W A;  2XFS A;  1CJF A;  5GLC A;  1F98 A;  3NOP C;  3IXB A;  1LLB A;  1MWU A;  1MY8 A;  4CLC A;  3E0Y A;  3ZG5 A;  1JWV A;  1W8Q A;  4RRH A;  4X68 A;  2QMI A;  1LI9 A;  3VFF A;  1H8Z A;  2OWH A;  1K54 A;  1MWT A;  2R78 A;  3CPT B;  1IFQ A;  1NYY A;  3LMV A;  3V50 A;  2L1M A;  1L0G A;  4PKY A;  3LUQ A;  1KE3 A;  2HPB A;  1G6O A;  2RCX A;  1PZO A;  4RYE A;  1F2K A;  1GA0 A;  4R1G A;  4HJ6 A;  2C5W B;  3BFD A;  3IWI A;  1K4F A;  4BL2 A;  5AQA A;  3T4L A;  4Y0T A;  1NYM A;  4KZ4 A;  4GS9 A;  4OQG A;  4BD1 A;  4E3N A;  3PR6 A;  3L9K A;  4JF4 A;  1IOU A;  4DXC A;  5FSR A;  2V8C A;  4XUZ A;  5CTN A;  1TF1 A;  3HLW A;  2A3U A;  3PBS A;  1IYP A;  2YKF A;  4CJN A;  2HP5 A;  1VHM A;  2HP6 A;  3G30 A;  1VEU B;  3AGE A;  3BFF A;  5CGW A;  3QP2 A;  1KVL A;  2KDK A;  3JYI A;  3PBT A;  5F6A A;  1RCJ A;  4JBF A;  2H5S A;  4GNU A;  4RR9 A;  1A0K A;  3HLD A;  3LR3 A;  3UE0 A;  2OAP 1;  3UY6 A;  3E2K A;  5CX7 A;  5DFY A;  3GR2 A;  4S03 A;  1KVM A;  2ZC3 B;  4BEN A;  2J3T D;  5HAP A;  3MBZ A;  5IS1 A;  4OQ0 A;  5FI7 A;  1J7G A;  3A3E A;  5DKL A;  3GV9 A;  2ZQ8 A;  5M19 A;  4KZ3 A;  4S2M A;  2OV5 A;  4MN5 A;  4DRT A;  1CF0 A;  2IWD A;  1NZO A;  3HUM A;  5HL6 A;  4PM5 A;  4UQI S;  4GD6 A;  3F1N A;  3NOT C;  1MBL A;  4S0J A;  3VP3 A;  2WAD A;  2ZOI A;  4G3W A;  2PD7 A;  5C5K A;  4Y15 A;  2E8I A;  4S0K A;  4RRI A;  5CGX A;  4WYY A;  4OLG A;  1ZG6 A;  1MPL A;  4U0T A;  3A3F A;  3ZFZ A;  3LMT A;  4LRY C;  2OAQ 1;  5HAI A;  2PHY A;  4E6W A;  3OBF A;  2VZW A;  1D7E A;  3W4Q A;  4JGO A;  3PTE A;  5DTS A;  4HBT A;  4NXB A;  2ZMV A;  3FV7 A;  1JKE A;  3T1X A;  1Z6F A;  4KG6 A;  5CEB A;  2HZ5 A;  3ULF A;  4B4Z A;  5CEC A;  1ZHH B;  4IHQ A;  3IHA A;  3M2J A;  4B88 A;  2DNS A;  3WS1 A;  4GZB A;  4S2N C;  2LB5 A;  2V9A A;  4RX2 A;  3UE6 A;  3VOL A;  5F69 A;  2VKS A;  2PR5 A;  3EQU A;  5F1G A;  3PAG A;  5DF7 A;  4WL9 A;  2VV8 A;  3TOI A;  4Y5F A;  5TJJ A;  2QWS A;  3M6H A;  4K91 A;  1SZV A;  3C4P A;  1H5X A;  5CED A;  4LRX C;  4RRR A; 
#chains in the Genus database with same CATH homology
 2X71 A;  4WEJ A;  2EXB A;  2JE5 A;  1YLY A;  2HDU A;  4RX3 A;  4ID4 A;  4FCF A;  3N7W A;  4OP8 A;  5CTM A;  3M2K A;  2HKZ A;  1K57 A;  3IF5 A;  3D4F A;  1ERO A;  4JXW A;  5E2H A;  2G2U A;  1XXM A;  5HL1 A;  5FI6 A;  2BG1 A;  1PZP A;  5KSC A;  1ALQ A;  3UDX A;  1ESU A;  1XP4 A;  4DKI A;  3O88 A;  4IED A;  5JYP A;  4GKU A;  4PM8 A;  4S2J A;  3Q7Z A;  1SCW A;  4UA9 A;  4Z9Q A;  1MWS A;  2JC7 A;  1IKI A;  5FAT A;  3HLB A;  4GN2 A;  4KG2 A;  3WS4 A;  1KE0 A;  2FFF B;  1K55 A;  3PBR A;  4LV2 A;  2WK0 A;  1NY0 A;  2H0Y A;  4MNR A;  1H8Y A;  2WAF A;  4X6T A;  1W8Y A;  4RRJ A;  1ESI A;  4RRK A;  4KZ6 A;  1ES5 A;  4BD0 A;  1BLC A;  3PD3 A;  4P85 A;  2XR0 A;  3MXR A;  3Q7V A;  4JXG A;  4NBI A;  1XPB A;  1BSG A;  1FR1 A;  4OPR A;  5GL9 A;  3KOD A;  1K56 D;  4MBF A;  3UPO A;  4QHC A;  3ZNT A;  3TG9 A;  4PMA A;  4S2L A;  2XQZ A;  3KOB A;  3NBL A;  2H0T A;  3LY4 A;  3KO9 A;  3FKW A;  4U0X A;  4BJP A;  3SS4 A;  1K38 A;  4KQO A;  1YLP A;  4RRM A;  1XA1 A;  1DJB A;  3CJM A;  3BLS A;  4WEK A;  2V2F F;  4C75 A;  4JXV A;  4UHU A;  4JLF A;  5DTK A;  3UDF A;  3MKF A;  4EBP A;  3HLE A;  4PPR A;  5EOE A;  4P87 A;  2ZM0 A;  3VSK A;  1NJ4 A;  4R4S A;  1FQG A;  1IYQ A;  3HVF A;  4ZJ3 A;  4BQM A;  1PI4 A;  4BL3 A;  1FOF A;  1YLW A;  2XLN A;  4GB7 A;  4F94 A;  4EBL A;  3HL9 A;  3WS2 A;  4RRD A;  3RXW A;  2XDM A;  3M6B A;  1YLZ A;  1Q2P A;  2C6W B;  4JKT A;  3WS5 A;  2EXA A;  4A5R A;  2ZC7 A;  1FSY A;  1E3U D;  1EWZ A;  5U47 A;  3KNP A;  4PM6 A;  1K54 C;  1XX2 A;  2A49 A;  3NC8 A;  3ZG7 B;  2WGW B;  4DE2 A;  2UWX A;  4UA7 A;  2XF3 A;  4R4R A;  2XEP A;  1U60 A;  1PWG A;  1WYC A;  3GMW A;  3Q81 A;  2Z2L B;  4WMC D;  5EPH A;  1ONH A;  2XD1 A;  3DTM A;  2ZMA A;  3V39 A;  3FWL A;  5EVL A;  1ERM A;  3C4O A;  5GLD A;  3WRT A;  5CHU A;  4K0X A;  2VGK A;  3BEC A;  3VMA A;  4OPY A;  4DE0 A;  5I94 A;  5J8X A;  5A93 A;  3PBO A;  4EV4 A;  4OH0 A;  4OON A;  2X02 A;  3G35 A;  3I7J A;  4WM9 A;  3WS0 A;  2XH9 A;  4KZ8 A;  5E2G A;  1CEG A;  1LL9 A;  2HDS A;  5FQQ A;  1JWP A;  1MWR A;  4XXR A;  1YT4 A;  4N9K A;  5G18 A;  4QY5 A;  1I5Q A;  5DF9 A;  3IXH A;  4ZJ1 A;  5F1F A;  3GVB A;  1I2W A;  1O07 A;  1AXB A;  4R0Q A;  3W4O A;  4ZBE A;  2ZJ9 A;  4Y0U A;  3ISG A;  4RR6 A;  3FYZ A;  3O3V A;  2Y2J A;  2WKI A;  1FCO A;  5A91 A;  2ZM8 A;  3MFD A;  5HX9 A;  3ITB A;  2Y2N A;  5FAP A;  1YMX A;  1XGI A;  1XGJ A;  3BFG A;  3ZVW A;  4LV3 A;  5AQB A;  1VQQ A;  4PM9 A;  1SDN A;  3A3I A;  3N8S A;  3C5A A;  3PD2 A;  2JBF A;  1RGY A;  2P9V B;  2WZX A;  2IWC A;  4WZ5 A;  2IWB A;  4QB8 A;  5JYO A;  4BLM A;  3HLC A;  2Y2P A;  3BRM A;  1ES2 A;  3S22 A;  4DE1 A;  1FCM A;  4S0L A;  3FZC A;  5FAO A;  2EFX A;  2Y2M A;  4S0I A;  2EX9 A;  1PW1 A;  4M3K A;  4S2N A;  1QMF A;  3V3R A;  4LV1 A;  2I72 A;  1GHM A;  4S2P A;  4E3M A;  1E25 A;  2Y2Q A;  1L0D A;  5EVI D;  4GOG A;  1HD8 A;  1L0E A;  4UAA A;  4ZTK A;  1JTG A;  2ZLY A;  4JPM A;  4RR7 A;  2DRW A;  4DDS A;  1YLJ A;  4S02 A;  2WGW A;  4O7D A;  2PBY A;  1NXY A;  3VP2 A;  1IKG A;  2WAE A;  3N8L A;  2HDQ A;  1BT5 A;  4R3J A;  4NET A;  4OVD A;  3S1Y A;  1C3B A;  1QME A;  4RRC A;  2ZQC A;  3FKV A;  3Q1F A;  1JVJ A;  1XKZ A;  1FR6 A;  2ZM2 A;  4OPZ A;  1BTL A;  5TGF A;  2PU4 A;  3VFH A;  2Y2H A;  1BUL A;  2Y2L A;  1JTD A;  1EI5 A;  1PWD A;  4S2O A;  4DXB A;  2WGI A;  5KZH A;  3UE3 A;  3BYD A;  3DW0 A;  4JF5 A;  4L0L A;  4UA6 A;  1RGZ A;  5DTT A;  1HVB A;  3E2L A;  1K6R A;  1DJC A;  5A90 A;  4QD4 A;  2Y59 A;  5EVI C;  3KO7 A;  5FQM A;  4ZJ2 A;  4KQQ A;  3SH8 A;  1O7E A;  1SKF A;  1XA7 A;  5FDH A;  3ZG8 B;  2X01 A;  2J9O A;  2OLV A;  4FSF A;  1FCN A;  5FAS A;  5CHJ A;  3GRJ A;  1YLT A;  5EUA A;  3ZVT A;  1PW8 A;  3S4X A;  2XK1 A;  4E3J A;  1YMS A;  3IF6 B;  1YM1 A;  4MLL A;  4FH2 A;  1CI9 A;  1CK3 A;  5AQ9 A;  3HUN A;  3UDI A;  3ZGA B;  4RRQ A;  3LCE A;  3PD4 A;  3G34 A;  4P0M A;  1WE4 A;  3ZDJ A;  4H8R A;  1BUE A;  1ONG A;  4MBK A;  1TDL A;  3MZE A;  4OQI A;  4RVA A;  2J8Y A;  2Q9M A;  1KGG A;  5FAQ A;  5TR7 A;  1BZA A;  3WWX A;  2DCF A;  2P9V A;  2DBO A;  3P98 A;  3IT9 A;  2WYX A;  4DDY A;  1KDW A;  3VSL A;  1DJA A;  4RRG A;  4E3O A;  1PYY A;  1RP5 A;  3BEB A;  3N4I A;  3PBN A;  4FD8 A;  2G2W A;  2HL0 A;  2XFS A;  4DF6 A;  4NK3 A;  4FH4 A;  4XUX A;  5GLC A;  1Y54 A;  4HES A;  1WYB A;  2EFU A;  1MXO A;  3IH9 A;  3IXB A;  2ZQA A;  1LLB A;  1MWU A;  1MY8 A;  2HDR A;  3LEZ A;  1L2S A;  1YQS A;  3N6I A;  3BFE A;  2V1Z A;  3SS5 A;  3SS3 A;  3UPP A;  3ZG5 A;  3IH8 A;  1JWV A;  1CI8 A;  3MKE A;  4JF6 A;  4LCM A;  4X55 A;  2ZC5 B;  3HLG A;  3P09 A;  1IYS A;  4PM7 A;  1W8Q A;  5EE8 A;  4B4X A;  1TC5 A;  1TEM A;  4RRH A;  4E3L A;  2FFY A;  3A3D A;  5E43 A;  4X68 A;  2QPN A;  3IWO A;  2QMI A;  4IVK A;  3IF6 C;  5TFQ A;  1IEM A;  2OLU A;  4OPQ A;  2XFT A;  1LI9 A;  1N4O A;  1J9M A;  5E2E A;  1H8Z A;  3CZD A;  3O87 A;  3VFF A;  4Q8I A;  3LMU A;  3MZF A;  4KZ7 A;  3W4P A;  4KZB A;  5D3O A;  3ZG9 B;  1K54 A;  1MWT A;  3HBR A;  3G2Z A;  5CRF A;  5GHX A;  1K25 A;  1KE4 A;  3BFC A;  1NYY A;  3LMV A;  5L2F A;  5GHZ A;  2ZQ9 A;  5GLA A;  3B3X A;  5IHV A;  3OPH A;  3V50 A;  4MBH A;  3QNB A;  5HAQ A;  4ZAM A;  3Q7V B;  1VM1 A;  5F83 A;  1L0G A;  1N9B A;  4P6B A;  1GA9 A;  1K6S A;  3SH7 A;  4IVI A;  5EOO A;  2J9P A;  1KE3 A;  1NZU A;  4EQI A;  2HPB A;  2RCX A;  2WKE A;  4IBX A;  1PZO A;  5FQI A;  4RYE A;  4QU3 A;  5GLB A;  4X69 A;  4RRF A;  2ZC4 B;  5FI2 A;  1GA0 A;  4R1G A;  4R23 A;  2Z2M B;  4D2O A;  2ZD8 A;  5M1A A;  2C5W B;  1K57 C;  2HL2 A;  1ZG4 A;  2Y2G A;  5F82 A;  3BFD A;  3IWI A;  1K4F A;  4BL2 A;  5HW3 A;  5AQA A;  4Y0T A;  5EVI B;  1NYM A;  4KZ4 A;  4E3I A;  1GHI A;  1M6K A;  2HP9 A;  3OPL A;  4E6X A;  4OQG A;  4EUZ A;  4BD1 A;  4E3N A;  2B5R A;  1W5D A;  1PWC A;  4RRB A;  3BM6 A;  4WMC A;  4JF4 A;  2EX6 A;  3OC2 A;  1CEF A;  2ZQ7 A;  4EWF A;  4DXC A;  5FSR A;  5CER A;  1K55 C;  4XUZ A;  1JWZ A;  3DWK A;  3IXG A;  5CTN A;  5E2F A;  1M40 A;  4DE3 A;  1G68 A;  3HLF A;  3MZD A;  4OOL A;  5FA7 A;  2GDN A;  3HLW A;  2A3U A;  3EQV A;  1IYP A;  3PBS A;  1PI5 A;  4GDB A;  1TDG A;  2P74 A;  4OLD A;  4CJN A;  2HP5 A;  3OCN A;  3NCK A;  4MEZ A;  2HP6 A;  3AGF A;  3PBQ A;  4KZ5 A;  3G30 A;  3OPP A;  3BFF A;  3AGE A;  4KZ9 A;  4R3B A;  5CGW A;  5FQ9 A;  5FQK A;  3V3S A;  1SHV A;  3HUO A;  4X53 A;  4ZDX A;  3A3J A;  3C7V A;  1KVL A;  1I2S A;  3JYI A;  3N8R A;  3OCL A;  3PBT A;  5CGS A;  1IEL A;  1S6R A;  3PD5 A;  1RCJ A;  4JBF A;  4EBN A;  5DF8 A;  3G31 A;  5DVA A;  3OPR A;  2H5S A;  1ERQ A;  4GNU A;  3G4P A;  4RR9 A;  3KOC A;  3HLD A;  1FSW A;  3UE0 A;  2EX8 A;  3UY6 A;  3VP0 A;  3E2K A;  4N1H A;  4LV0 A;  4S03 A;  3GR2 A;  1HZO A;  1KVM A;  2ZC3 B;  2OSU A;  4OOY A;  4BEN A;  5HAP A;  1K4E A;  3MBZ A;  4OQ0 A;  4HBU A;  5FI7 A;  1J7G A;  3A3E A;  3HRE A;  3GV9 A;  4QY6 A;  2BLS A;  2ZQ8 A;  1S0W A;  1GHP A;  5KSH A;  3UE1 A;  5M19 A;  4KZ3 A;  4S2M A;  2EX2 A;  1BLH A;  2OV5 A;  2R9W A;  3UPN A;  2CC1 A;  4DRT A;  3VP1 A;  3ZG0 A;  1IYO A;  3CMZ A;  4GDN A;  4YIN A;  2VGJ A;  4U3T A;  3SH9 A;  2IWD A;  5FQJ A;  1Q2Q A;  3BLM A;  4C3Q A;  4OP5 A;  1LI0 A;  4YFM A;  3UN7 A;  1KGF A;  1NZO A;  3HUM A;  3TSG A;  3UO9 A;  3ZHH A;  4PM5 A;  2ZQD A;  4WEL A;  4GD6 A;  4IBR A;  5EVI A;  3AGD A;  1MBL A;  4N9L A;  2H10 A;  3ZCZ A;  2HL1 A;  1NRF A;  4S0J A;  1OME A;  2WGV A;  4OKP A;  2Y2I A;  3VP3 A;  2WAD A;  2RL3 A;  5M18 A;  3ZNY A;  3KO5 A;  3W8K A;  1BLP A;  1W79 A;  2E8I A;  4N1X A;  4RRA A;  1L0F A;  4KQR A;  4S0K A;  3NIA A;  1KDS A;  4RRI A;  5CGX A;  1LL5 A;  3OZH A;  5HFO A;  4WYY A;  4OLG A;  2J7V A;  1ZG6 A;  1MPL A;  5J61 A;  4KZA A;  2JCH A;  1MKI A;  3QNC A;  4U0T A;  3A3F A;  4X56 A;  3NDE A;  3ZFZ A;  3LMT A;  3Q82 A;  4OOM A;  1K56 A;  5HAI A;  5CXW A;  4E6W A;  3DWZ A;  3VOZ A;  3W4Q A;  4RA7 A;  4JXS A;  1GCE A;  4RRL A;  3PTE A;  4E3K A;  3G32 A;  3VP4 A;  3KO4 A;  4HEF A;  5DTS A;  4HBT A;  1SDE A;  1HTZ A;  5KMW A;  1ES4 A;  1E4D A;  1ZKJ A;  2R9X A;  5BOH A;  4KEN B;  3FV7 A;  1JKE A;  1BLS A;  1Z6F A;  4KG6 A;  5CEB A;  3ITA A;  4LEN A;  4CPK A;  2WKH A;  4B4Z A;  5CEC A;  5AQ7 A;  4C6Y A;  3RJU A;  2Y2O A;  1TVF A;  1ZC2 A;  3IXD A;  4N92 A;  2XGN A;  2WZZ A;  2Y55 A;  4WZ5 C;  1PIO A;  3GSG A;  1LHY A;  4K0W A;  5HAR A;  1W7F A;  3IHA A;  2ZC6 B;  3M2J A;  4B88 A;  1ES3 A;  3G2Y A;  2DNS A;  3IF6 A;  4KG5 A;  4QJG A;  3WS1 A;  3VOY A;  1Y2Q A;  5A92 A;  3O86 A;  4S2K A;  4GZB A;  4LCL A;  1G6A A;  3LO7 A;  3PAE A;  4S2N C;  5GHY A;  2Y91 A;  3SOI A;  3MXS A;  1E3U A;  3QHY A;  3KO3 A;  3UNW A;  2V20 A;  3IQA A;  3LY3 A;  2XD5 A;  2Y2K A;  4RX2 A;  3RXX A;  2WUQ A;  2Q9N A;  3NDG A;  2PU2 A;  3EQU A;  4OQH A;  5F1G A;  1KGE A;  4S2I A;  4Y0O A;  3PAG A;  5DF7 A;  3NI9 A;  4NBJ A;  3IWQ A;  3CG5 A;  3TOI A;  4WZ4 A;  4GD8 A;  3V5M A;  3KNF A;  3IHB A;  5CHM A;  5EEC A;  4RR8 A;  3GTC A;  2OKV A;  3WRZ A;  3Q07 A;  1DY6 A;  3M6H A;  3NY4 A;  4K91 A;  2Y4A A;  1H5X A;  3C4P A;  3C7U A;  4WBG A;  4Y7P A;  3GQZ A;  5CED A;  2QZ6 A;  4RRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...