3V39A

Bd3459, a predatory peptidoglycan endopeptidase from bdellovibrio bacteriovorus
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
402
structure length
402
Chain Sequence
MKVYLNSMCHMAANSKTQQIQGDDNKDDKFPLASISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLAEEKPMIGGTTPKYDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanyl-D-alanine carboxypeptidase
publication title Specialized peptidoglycan hydrolases sculpt the intra-bacterial niche of predatory Bdellovibrio and increase population fitness.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 139
structure length 402
sequence length 402
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v39A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 3v39A02
1TVFA 4XUXA 1E25A 1JTGA 3UNWA 4DRTA 5DTSA 1J9MA 1LHYA 2WGWB 5A91A 3N8SA 2WKIA 2VGJA 4N1XA 5CXWA 2EX9A 5CGXA 2WADA 3W4OA 4BLMA 4EV4A 4KZ6A 3ISGA 3MKEA 3TOIA 3ZG0A 4OONA 3G32A 2WZXA 4BL3A 2HP9A 1Z6FA 2PU2A 1HZOA 2Y2GA 2ZQ9A 3IF6B 3QHYA 3N4IA 3SS4A 3UPNA 4EBNA 4P0MA 2EFUA 5HAQA 2JC7A 2XD1A 1YT4A 4QU3A 1QMEA 3S22A 3ZVWA 4EBPA 2ZC6B 1PWDA 4KG5A 1K6RA 2C5WB 4GNUA 1IKGA 4N1HA 1YLZA 1K57A 3MFDA 4L0LA 3IF5A 4JPMA 3OPHA 4U0XA 1YMSA 1KDWA 3ZHHA 3ZG7B 2ZJ9A 2WK0A 4IVIA 3GRJA 3ZNTA 5CEDA 1BTLA 5FQJA 4WZ5C 2WKHA 3HUOA 3UDFA 1H5XA 2DNSA 3JYIA 2Y2HA 4QHCA 4KZ5A 2B5RA 3IH9A 5E2HA 5FI2A 4BD1A 5CEBA 3FWLA 4OPZA 2UWXA 2XGNA 3OC2A 4EBLA 5DTKA 4F94A 4E3OA 3ZDJA 1ESIA 3BLSA 1L0FA 2OSUA 1L0EA 5L2FA 3VP0A 4PPRA 1IEMA 4LENA 1JWPA 4KQQA 4JF4A 1RGZA 4S2NC 2ZC4B 2HP6A 2XFSA 1VM1A 4C75A 4DXCA 2FFFB 3Q82A 2IWDA 5M19A 3WS0A 3VSLA 3ZVTA 1XGIA 4LV1A 1W5DA 3MZFA 2ZQCA 1MY8A 1NY0A 5EUAA 3GSGA 3ITAA 4JF6A 1SKFA 1IELA 3DWZA 4O7DA 4UA9A 5FSRA 2OV5A 4S2LA 2WAEA 5FASA 3EQVA 5EVIC 1KVLA 4X53A 2WGVA 3FV7A 3BYDA 4QD4A 1CI9A 3BFEA 5FA7A 1K56A 2HDUA 4OLDA 3SS3A 5CTMA 3A3JA 3HBRA 4R4SA 3CG5A 1BLCA 4KZAA 5JYOA 3G30A 1FQGA 1G6AA 4ZJ2A 3Q7VA 3UDIA 1DJCA 2HDRA 1I2WA 1MWTA 4JXGA 3ZG8B 4JXVA 4DDYA 1VQQA 5HW3A 1DJAA 1LLBA 3WS4A 1ONHA 3HREA 3ZGAB 4ZTKA 2X02A 5I94A 4OQIA 3E2KA 4IBXA 3IXDA 3OPRA 4X6TA 3BFDA 1O07A 3N7WA 1JVJA 4WMCA 4R3JA 1EI5A 3N6IA 2H5SA 3ZFZA 1K6SA 2G2WA 1TDLA 3BM6A 3W8KA 4DE1A 1G68A 1K54C 1DJBA 4R0QA 5CHMA 1XP4A 1KDSA 4K0WA 4OQHA 4R4RA 2JBFA 4Y0UA 3G35A 3PBNA 4JKTA 1SDNA 1K55C 4S2OA 3A3IA 5FAPA 5F83A 3IQAA 1KE4A 1YQSA 5HAPA 1ZC2A 5EVIB 3ZG9B 2JE5A 4LV3A 5DF8A 4DXBA 3Q1FA 4Z9QA 5FI6A 3G31A 1HVBA 4E6XA 4OH0A 2WGIA 4LV0A 3P98A 4KG2A 5GLBA 2XD5A 4R23A 1XGJA 3P09A 3DTMA 1K57C 3OZHA 1RGYA 4GDBA 3G2YA 1AXBA 3VOYA 4IVKA 3FZCA 4E3KA 4QY6A 3UE1A 1I5QA 4HBUA 4Y0TA 1NXYA 5M18A 1SCWA 2J9PA 3IHAA 3Q07A 3M2JA 5GLCA 4KZ8A 5GLAA 3WS5A 1EROA 5A92A 4Y0OA 5BOHA 3N8LA 2XQZA 2Y91A 3LCEA 1PW8A 2H0TA 2ZMAA 2OLUA 1ERMA 2EXBA 2RL3A 5J8XA 2DCFA 2WGWA 5DVAA 3ZCZA 2V20A 5FAOA 3NDEA 2IWBA 5GLDA 5CRFA 1CK3A 1MWUA 4PMAA 4EQIA 3QNCA 4WELA 4R3BA 1JWVA 3CZDA 3VFHA 1WYCA 3G4PA 4P87A 1BLHA 3DWKA 4GD8A 1IYPA 1DY6A 2Z2LB 3M2KA 3IF6A 1PW1A 1ZKJA 2FFYA 5E2FA 3PAEA 3VFFA 4KZ9A 5CGSA 3NDGA 1PZOA 4E3NA 3C7VA 3AGFA 1SDEA 4S2KA 3IH8A 4JXSA 4MBFA 1RP5A 2Y59A 3E2LA 4N9LA 1LL9A 4JLFA 2RCXA 3N8RA 3V5MA 3ZNYA 3LY3A 3UE0A 3UDXA 1BT5A 3VP1A 1MWRA 1FCMA 1OMEA 4B4XA 3V3RA 1C3BA 3S4XA 5FQIA 3V39A 4RA7A 1PI5A 2E8IA 4E3LA 4OOLA 4ZDXA 4PM6A 1YMXA 2XH9A 3OCLA 3GVBA 4MEZA 3OPLA 2Y55A 2PBYA 5FATA 1FSYA 2C6WB 3WRTA 4QY5A 3SOIA 5EECA 5GHXA 1FSWA 5U47A 3LEZA 1ZG6A 3RJUA 5KMWA 3SH7A 4BJPA 4OQGA 3RXXA 3BRMA 2XK1A 3VSKA 3B3XA 1YLTA 3HLWA 5EOOA 1H8YA 3MBZA 3NCKA 2BLSA 4PM8A 1XKZA 3BFFA 3HLFA 5GL9A 5HAIA 3IXGA 3A3DA 2Y2MA 3DW0A 1S0WA 3VOZA 5KZHA 1M6KA 1YLJA 4OPYA 3EQUA 1PWCA 5KSHA 1ERQA 2EXAA 4GD6A 3PBSA 3MKFA 3FYZA 4FCFA 4OOYA 1CEFA 4FSFA 2XDMA 5HARA 1Q2QA 1TDGA 4C3QA 1NZOA 3NBLA 1MBLA 3G34A 2WUQA 3OPPA 2Y2QA 4WYYA 1YM1A 4KZ7A 3IWIA 4OOMA 5FI7A 1QMFA 5F1GA 3ITBA 1KE3A 4NK3A 3BFCA 3C4PA 1YLPA 4RX3A 2Q9NA 4ZBEA 1E3UA 3UPPA 4E3IA 1FR6A 1NYMA 2ZM2A 4K91A 4KZBA 1KVMA 2P9VB 4QJGA 1K56D 3Q7VB 3HUMA 4LV2A 3BECA 3W4QA 3LY4A 2P74A 4IEDA 3Q81A 1GHPA 1RCJA 3D4FA 4GZBA 4MBHA 4OPRA 3UE3A 2WKEA 3OCNA 1XPBA 3NY4A 2Y2OA 4S2NA 4JXWA 2J9OA 1PZPA 3C7UA 1GHMA 1YLYA 3PBOA 4IBRA 2H10A 4OLGA 4WMCD 2XF3A 3TSGA 3VP2A 5A93A 2EFXA 4RVAA 1CI8A 2ZQ8A 4A5RA 3UPOA 1IYQA 4GOGA 3UN7A 5AQ7A 2BG1A 1ALQA 5JYPA 2WZZA 3BEBA 2WYXA 2Y2IA 3BFGA 4GB7A 5G18A 3O3VA 5TFQA 4D2OA 5HL1A 4PM9A 5FQMA 2A49A 1ES4A 2DRWA 3PBQA 4DF6A 4FH4A 5EVIA 3PBTA 3V50A 3ZG5A 4BL2A 4BD0A 2ZM0A 2IWCA 1ES5A 5HFOA 3W4PA 4DE3A 4CJNA 4X56A 5FAQA 4E6WA 3HLCA 4HEFA 3O87A 2QPNA 1BULA 1ES2A 2G2UA 3CJMA 4GKUA 4MBKA 4WZ4A 5AQAA 1ESUA 3TG9A 1W8QA 4E3MA 5TR7A 3PAGA 4U3TA 4N92A 2X71A 1XX2A 5HX9A 3FKWA 3IWQA 3QNBA 3IT9A 3I7JA 1HD8A 4LCLA 3CMZA 4S2PA 4XXRA 4KQRA 3SH9A 1JWZA 1PYYA 4ZAMA 3VMAA 2XEPA 3MZEA 4BENA 1NJ4A 2Y2JA 4HBTA 2HDQA 4WEJA 1GCEA 1K54A 1FR1A 4YFMA 2I72A 4R1GA 2XFTA 3S1YA 1EWZA 1KE0A 1KGFA 1W79A 1NYYA 2ZQ7A 1H8ZA 1K55A 3GMWA 1MXOA 4Y7PA 3HUNA 1W7FA 2XLNA 1GA9A 5FDHA 3M6BA 3WWXA 3NIAA 4JBFA 3Q7ZA 1ONGA 3IXHA 3LO7A 2ZC5B 3HLBA 4KQOA 4NETA 4OPQA 2X01A 3V3SA 4UHUA 4OKPA 4PM5A 1K25A 2HP5A 1K38A 5F82A 1E4DA 2J7VA 2R9XA 4FD8A 4ID4A 1ES3A 2ZC3B 4ZJ1A 2XR0A 4MLLA 2ZM8A 2ZLYA 1Q2PA 4HESA 5CECA 4CPKA 5E2GA 1XA1A 3HL9A 3HLGA 4C6YA 5EE8A 5DF9A 1PI4A 3A3EA 4DDSA 1BUEA 2OLVA 5E43A 5F1FA 2Y2KA 4UAAA 5FQ9A 4PM7A 2Z2MB 3GR2A 4WEKA 1JTDA 2Y2PA 5CHJA 1IYSA 2R9WA 1MKIA 4YINA 3C4OA 2Y4AA 1L0GA 1W8YA 3WS2A 1NZUA 2Q9MA 1L0DA 3MXRA 4OP8A 4B88A 4KZ4A 3RXWA 4KZ3A 2ZQDA 5EVLA 3UY6A 5E2EA 1KGGA 1WYBA 1BLSA 1GHIA 1LI0A 4LCMA 4E3JA 1S6RA 4UA7A 2GDNA 1GA0A 1Y54A 5AQ9A 4GN2A 4XUZA 3VP4A 4EUZA 5FQKA 5CERA 4Q8IA 2QZ6A 1IKIA 1MPLA 2HPBA 4P85A 4RX2A 4OVDA 1L2SA 1LI9A 3UO9A 4WZ5A 2CC1A 1XA7A 3G2ZA 3HVFA 5AQBA 3O86A 1LL5A 3IWOA 3PBRA 4KENB 4S2IA 5CTNA 4DE2A 4EWFA 3PTEA 1CEGA 2VGKA 3O88A 5CHUA 1SHVA 2EX2A 5DF7A 1O7EA 2Y2LA 2A3UA 5GHZA 3WS1A 4P6BA 1MWSA 4N9KA 5KSCA 3MZDA 1WE4A 4X68A 3BLMA 3GTCA 1NRFA 2EX6A 1E3UD 2P9VA 3A3FA 4GDNA 4K0XA 4S2MA 2V1ZA 4MNRA 4BQMA 2H0YA 5GHYA 1PIOA 4U0TA 1U60A 1N4OA 4KG6A 5D3OA 2Y2NA 3WRZA 4X55A 3VP3A 3FKVA 4S2JA 4WBGA 1K4FA 1HTZA 4WM9A 2QMIA 3AGDA 4QB8A 1PWGA 1FOFA 3C5AA 1I2SA 1N9BA 3HLDA 4JF5A 3IHBA 3HLEA 3IF6C 2V2FF 3SH8A 1IYOA 4H8RA 2ZQAA 4RYEA 5TGFA 5IHVA 1BSGA 2HDSA 4DE0A 1XXMA 1FCNA 1BZAA 3AGEA 5CGWA 4ZJ3A 1K4EA 3SS5A 5FQQA 3IXBA 3NI9A 4OQ0A 5EPHA 4X69A 3MXSA 1FCOA 1M40A 2EX8A 3GV9A 4FH2A 1YLWA 1BLPA 5EVID 5M1AA 1TEMA 3NC8A 5A90A 3M6HA 3GQZA 4B4ZA 4UA6A 1KGEA 1ZG4A 2ZD8A 4OP5A 4DKIA 2J8YA 5EOEA 2JCHA 2PU4A 2WAFA 4M3KA 2ZC7A 5DTTA
chains in the Genus database with same CATH superfamily
1JTGA 4GCZA 1J9MA 2WKIA 2VGJA 4N1XA 2EX9A 5CGXA 4BBTA 3G32A 1W63Q 2HP9A 4G3KA 4P0MA 5HAQA 1PNEA 4QU3A 3ZVWA 1QMEA 5J4EA 3LMVA 4KG5A 1K6RA 2C5WB 3LR0A 1OT9A 1YLZA 2PD8A 3H82A 2WK0A 3QP8A 3GRJA 5CEDA 5FQJA 4WZ5C 3HUOA 3UDFA 3KYEA 4GHIB 5HD5A 3EGDC 4EBLA 5DTKA 4GS9A 3TE8A 1L0FA 1L0EA 5L2FA 3FC7A 3BQAA 4PPRA 1IEMA 4LENA 1JWPA 4NBIA 2V1BA 4KQQA 1RGZA 2HP6A 4BBUA 4DXCA 2FFFB 3WS0A 3KO7A 3ZVTA 1ZTUA 5G4ZA 3GSGA 3ITAA 4JF6A 3LR4A 4S0JA 4O7DA 5FSRA 5EVIC 4IJGA 3FV7A 1CI9A 1K56A 4OLDA 5CTMA 3G30A 1FQGA 1G6AA 4ZJ2A 3Q7VA 3UDIA 1VQQA 5IU1A 1LLBA 2JKRM 3ZGAB 2QKPA 4OQIA 3E2KA 4WF0A 3PD3A 1O07A 4KUKA 2YKHA 4YWZA 1JVJA 2O9CA 3H9WA 1K6SA 1TDLA 4MN5A 5DKLA 2QYBA 3KO6A 1DJBA 4R0QA 1KDSA 4K0WA 4OQHA 3G35A 5F83A 2K7SA 1OTEA 1KE4A 1YQSA 5HAPA 1YSPA 5EVIB 5AVFA 4DJ3A 4LV3A 4Z9QA 3G31A 2WGIA 4NG2A 4LV0A 2GJ3A 1XGJA 3G2YA 4IVKA 3T4TA 4E3KA 4IUKA 4QY6A 1I5QA 1VEUA 1NXYA 5M18A 1X0OA 5GLCA 5LBRA 3M2JA 1EROA 5HWWA 2Y8HA 3CPTA 3IX3A 1PW8A 2OLUA 4JGQA 2QJ7A 4YNRA 5DVAA 3TJZC 3P7NA 3F1PB 2IWBA 5EM0A 5GLDA 1CK3A 4EQIA 3QNCA 3CZDA 4P87A 3DWKA 2FFYA 5DJUA 5E2FA 2J80A 3VFFA 4KZ9A 1HLUP 1T1AA 4S2KA 3S7NA 3IH8A 4N9LA 2RCXA 3MFXA 3ZNYA 2O0YA 3JPUA 4I5SA 1FCMA 4RRMA 2V0UA 3D9YA 4Y17A 3V39A 2B02A 1PI5A 2KX6A 2XH9A 3OCLA 2C6WB 4NXFA 2L0WA 5GHXA 3LEZA 1ZG6A 4ETXA 5KMWA 3SH7A 4HH3A 4BJPA 3LIEA 3MBZA 3BJNA 3BFFA 4ME4A 4OPYA 4IHQA 1PWCA 4OOYA 4FSFA 3PR6A 1NZOA 4I39A 2G7UA 2WUQA 2Y2QA 1OJ5A 4O0PA 3ITBA 4NK3A 4RX3A 3UPPA 2PDRA 3E4PA 1NYMA 2ZM2A 4K91A 2P9VB 5HSQA 3LY4A 4IEDA 4MBHA 1XJ6A 4ESPA 3IX8A 3PHYA 4RR6A 2J9OA 3IS2A 1PZPA 1YLYA 2XF3A 1S1YA 3UPOA 3IBJA 4EETB 3BQ8A 5AQ7A 2P7JA 5JYPA 4E6XA 4D2OA 5G18A 2VK3A 2CMNA 2A49A 4JGPA 4I3AA 3PBQA 3G6OA 2HGVA 2PHYA 4FH4A 4RRHA 1T1BA 4X56A 2VV8A 2Z6DA 4MBKA 1W8QA 1XFNA 4N92A 4S02A 1XX2A 3IX4A 4S0LA 3IT9A 1HD8A 3T1QB 3CMZA 4KQRA 2FH5A 3SH9A 1PYYA 2R78A 3MZEA 2Y2JA 5F6AA 3DTEA 1GCEA 4YFMA 4R1GA 1KE0A 1W79A 2ZQ7A 1H8ZA 1MXOA 1VB6A 4Y7PA 2HL2A 1W7FA 1GA9A 4OPQA 3HLBA 2X01A 4PM5A 4RRQA 2HP5A 1K38A 2ZC3B 2XR0A 3LEQA 3MJQA 4CLCE 1IYSA 3KO5A 3WS2A 3KNFA 5HWVA 3MXRA 4OP8A 2VZWA 2ZQDA 3H7WA 3UY6A 5DFYA 1BLSA 4UEYA 1LSXA 4LCMA 1D1JA 1GA0A 1Y54A 3VP4A 3NJAA 1IKIA 3R4KA 2IA2A 3HVFA 4EESA 3IWOA 3PBRA 3PTEA 1CEGA 5CHUA 1SHVA 1LSVA 2W1TA 2DBOA 2O9AA 2EX6A 4KUOA 4BMWA 4GDNA 2V1ZA 5DKKA 1N4OA 3WRZA 3KSFA 4X55A 1HTZA 2PR6A 2QMIA 3C8CA 1CF0A 4JF5A 3IHBA 3IF6C 1XFQA 2HL1A 2HDSA 3LIDA 3EGXC 4ZJ3A 1K4EA 3IXBA 4OQ0A 4X69A 1FCOA 4Y3IA 5EVID 4ARZB 1TEMA 5DFXA 4B4ZA 5TBMB 4HQAA 1KGEA 4HJ6A 5DTTA 1TVFA 3L7HA 4XUXA 4KQDA 4HP9A 4DRTA 2WGWB 1LHYA 3VV4A 5CXWA 3NHQA 4BLMA 3KOCA 4EV4A 3MKEA 3E98A 4OONA 2WZXA 1Z6FA 3IF6B 1TC5A 3N4IA 4EBNA 4EBPA 2EWWA 4CQHA 3KYZA 4JPMA 3OPHA 4I3IA 1KDWA 5C5KA 3ZNTA 1BTLA 4HY8A 1H5XA 2DNSA 2M7VA 2B5RA 3FWLA 4F94A 4E3OA 1ESIA 1V9ZA 4C75A 3Q82A 4HHDA 4GJ4A 1XGIA 4LV1A 4M4XA 2DMWA 2W0NA 3B33A 4UQIM 4UA9A 2OV5A 4S2LA 5A8BA 1KVLA 3KX0X 4I38A 2PRFA 4X53A 1Y28A 2HDUA 1SKOA 3A3JA 4R4SA 5JYOA 5HW3A 2HDRA 4JXGA 1MWTA 3TRCA 4NBJA 4ZTKA 3T1SA 5EM1A 4IBXA 3IXDA 4X6TA 4RQ9A 5HL6A 3N6IA 2G2WA 3B42A 2OKVA 5L8MA 4RRJA 1XP4A 3MQOA 3DTIA 4R4RA 3F1NB 1K55C 3A3IA 5FAPA 3LI8A 3EWKA 1ZC2A 4FTXA 5DF8A 4EQ1A 3MS6A 4EU0A 1H8MA 4KG2A 3KO9A 3CUEA 4R23A 3KNPA 3P09A 3OZHA 5I5LA 2ZMVA 3FZCA 2J3TC 3UE1A 1F5MA 2VV7A 4HBUA 2W27A 1J7GA 4KZ8A 3WS5A 5BOHA 4D60A 2H0TA 1J3WA 2A24B 1ERMA 2RL3A 3ZCZA 4RR7A 2ZL1B 4HH2A 3T4OA 1G5UA 5CRFA 4WL9A 5J3WA 1BLHA 2VGLS 2Z2LB 3M2KA 3BY8A 1A0KA 2JKTI 4JXSA 3CITA 3E2LA 1LL9A 5FL3A 1BT5A 3LMUA 4B4XA 3V3RA 4K08A 4GHIA 4PHTA 3E0YA 4RA7A 4E3LA 4ZDXA 5FATA 1FSYA 4LGWA 2J3WA 3BRMA 3HLWA 2AVXA 1H8YA 2L4RA 2BLSA 3RFBA 2W3EA 3HLFA 3LYXA 5HAIA 2Y2MA 1YLJA 2OAQ1 5KSHA 1ERQA 3O5YA 4GD6A 3MKFA 3SZTA 5HARA 2PYPA 2YKFA 1Q2QA 1MBLA 1OT6A 5FI7A 2XA7S 1QMFA 5F1GA 3BFCA 3C4PA 1YLPA 2Q9NA 4E3IA 4KZBA 1KVMA 3Q7VB 2KLIA 2ZBBA 2O9BA 2H28A 3FG8A 4LLOB 1XPBA 3LICA 2Y2OA 3FPVA 2INWA 1GHMA 3PBOA 4IBRA 1GSVA 4WMCD 3VP2A 2EFXA 3R7WB 2ZQ8A 1IYQA 2ZOIA 1ALQA 4LRYC 3BEBA 1F2KA 3O3VA 1TD5A 4CLCD 5FQMA 1OTAA 2EWVA 2ZOHA 5EVIA 3PBTA 4BL2A 4BD0A 2ZM0A 3W4PA 3PD5A 4CJNA 4HEFA 3UMDA 1ES2A 5HWTA 5HX9A 3FKWA 3IWQA 2XSSA 4LCLA 4NXGA 1H3QA 1JWZA 3VMAA 2K31A 2XEPA 3A0SA 4ZRRA 4DMZA 5EV0A 2XFTA 4RR8A 3F1PA 4E04A 4Y2FA 3GMWA 2NUPC 3HJIA 2JKGA 4JBFA 2VV6A 3Q7ZA 3IXHA 3UB8A 4NETA 3BWLA 4KQOA 2QHKA 4UHUA 4OKPA 4YOFA 1K25A 3CI6A 2R9XA 4FD8A 2ZLYA 4HESA 4CPKA 5E2GA 1XA1A 1UGUA 3D72A 1PI4A 4G3WA 1BUEA 2OLVA 3LGOA 5F1FA 4WEKA 2Y2PA 5CHJA 4YINA 3C4OA 2Y4AA 1W8YA 1NZUA 1L0DA 4B88A 2NUTC 3RXWA 4KZ3A 3W2ZA 5E2EA 3RH8B 4DJ2A 1S6RA 4UA7A 4XUZA 1W63M 2V1AA 5CERA 4Q8IA 2OOLA 3T50A 1VHMA 2VGLM 3ZQ5A 1XA7A 2HV1A 4KENB 5CTNA 1NWZA 2VGKA 2D02A 1O7EA 2A3UA 3WS1A 4N9KA 3GECA 3MSHA 1WE4A 2P9VA 1E3UD 4K0XA 2H0YA 1PIOA 1U60A 4S0KA 5D3OA 4S2JA 3IBRA 4X1LA 1EW0A 4Q0HA 3C5AA 1I2SA 1PFLA 1MZUA 2V8FA 4I3JA 3DBAA 3HLEA 1IYOA 5TGFA 1BSGA 3FPWA 3AGEA 3SS5A 2HJEA 3QP4A 3VE4A 4DN0A 3GV9A 1BLPA 2VX8A 2K2NA 3QP2A 2W1RA 1DP9A 2OAP1 4DKIA 2XA7M 2PU4A 3OOVA 2QWSA 1UWPX 3KSGA 1E25A 3UNWA 3HCYA 2HJ9C 5HPIA 2WADA 4KZ6A 3ISGA 4UQIS 2V0WA 3ZG0A 2BTFP 4HOIA 5CX7A 2JC7A 2XD1A 3E4QA 1PWDA 3S7PA 2M7UA 4GNUA 3UB7A 4N1HA 3MFDA 1K57A 4L0LA 3C2WA 5HD3A 4U0XA 1YMSA 3ZHHA 3ZG7B 4IVIA 4RRIA 3P01A 3JYIA 2Y2HA 4KZ5A 1GSXA 5E2HA 4BD1A 3PD2A 4F3LB 4OPZA 2XGNA 3OC2A 2J3TD 2JHEA 3ZDJA 3BLSA 4G3VA 2OSUA 1IOUA 3LIAA 4S2NC 2ZC4B 4CLCC 1VM1A 2PT7A 3OBFA 2IWDA 1NLZA 1W5DA 3MZFA 1MY8A 5IT5A 1NY0A 3C38A 5EUAA 4X1MA 1JNUA 3LIBA 3T4KA 1IELA 4H6JB 2JKTM 2WAEA 5FASA 2I9VA 3K2NA 4LFUA 4QD4A 5HPFA 1YPRA 3HBRA 3CG5A 4KZAA 1G28A 1I2WA 2HL0A 3BW6A 1ONHA 4JGRA 4MDZA 5I94A 3BFDA 3F1OB 3N7WA 4CLCB 4WMCA 4R3JA 2VKSA 2H5SA 2P04A 1TS6A 3BM6A 3W8KA 1K54C 1BYWA 4Y0UA 1SDNA 4XT2B 3KSIA 4DXBA 5FI6A 1HVBA 4OH0A 3P98A 2XD5A 1JKEA 3DTMA 3D3OA 1RGYA 2OWHA 1WA9A 5F69A 4ARZA 1SCWA 3Q07A 5A92A 2B95A 4Y0OA 5TBMA 3N8LA 1S4RA 3LCEA 4FOFA 5J8XA 2WGWA 2V20A 1MWUA 4R3BA 2QJ5A 1V9YA 4HIAA 3G4PA 4QWOA 1MKMA 3ULFA 3IF6A 1PW1A 3S7QA 1ZKJA 4B93A 3DAVA 5CGSA 3NDGA 4E3NA 3C7VA 4R6LA 3UB6A 1RP5A 2Y59A 4JLFA 3N8RA 3LY3A 1N9OA 3UE0A 3UDXA 5FDSA 3T4JA 1OMEA 4RRKA 2E8JA 4EXOA 3TW8A 3S4XA 5FQIA 4S03A 3CHWP 2E8IA 4HNBA 4PM6A 4MEZA 2Y55A 2PBYA 4RRGA 1LSWA 5HDCA 3UB9A 5EECA 3CAXA 1VETB 3K3DA 3RXXA 2KOIA 3B3XA 4S0IA 1YLTA 5EOOA 5EVEA 3MQQA 4PM8A 1XKZA 2PAVP 3IXGA 3VOZA 1S0WA 5KZHA 4EEUA 3EQUA 3PBSA 3FYZA 1CEFA 2XDMA 1Y4OA 4C3QA 3NBLA 1P9RA 5MC7A 2PD7A 3OPPA 4NXBA 1YM1A 4OOMA 3IWIA 4JGOA 1KE3A 2L1MA 1E3UA 3K3CA 2GZAA 3UMEA 3JVUA 1N9LA 5HDSA 4QJGA 4HJ4A 3PYPA 3HUMA 3V67A 4L9GA 1GSWA 3W4QA 4RRLA 2P74A 1GHPA 1RCJA 2VJWA 3OCNA 4ETZA 3T4QA 3C7UA 4OLGA 2OWJA 4IUHA 2W3GA 3TSGA 3VOLA 4GOGA 2BG1A 3MQ0A 1S67L 2WZZA 3BFGA 2Y2IA 5HL1A 3F1NA 4PM9A 3NECA 5F68A 3NOPC 3V50A 5J7EA 3LR3A 5HZHA 2IWCA 1ES5A 5HFOA 4DE3A 5FAQA 4E6WA 1NLYA 1TS8A 3O87A 4WZ4A 5AQAA 3TG9A 1ESUA 2PR5A 3KSHA 5TR7A 3PAGA 4U3TA 1S1ZA 2JN7A 2W3HA 2HKZA 2X71A 3U4LP 3SW1A 3I7JA 1KOUA 3LFVA 1NJ4A 2HDQA 1G6OA 4EERA 2A24A 2P08A 2I72A 2W3FA 3S1YA 1YAXA 1EWZA 2ZL1A 4L9EA 4Z1WA 1KGFA 3QP5A 1K55A 1TS0A 4LRXC 2XLNA 3MF0A 5FDHA 4RRDA 3NIAA 1ONGA 3V3SA 3H82B 2ZC5B 1T18A 2WKRA 4ID4A 1ES3A 4MN7A 3DTKA 1Q2PA 4GS9B 3HLGA 1YSQA 5EE8A 4DDSA 5FQ9A 1D7EA 4PM7A 2Z2MB 1TF1A 3LI9A 4FUWA 1ACFA 4E3JA 4BBVA 2GDNA 5AQ9A 4Y5FA 4EUZA 3MMHA 4EEPA 4P85A 4RX2A 5HDDA 2HPBA 1LI9A 4WZ5A 2CC1A 3G2ZA 3O86A 1LL5A 4S2IA 3O88A 2EX2A 4P6BA 1MWSA 5KSCA 3C30A 3MZDA 4X68A 4X25A 1N9NA 4S2MA 4MNRA 5GHYA 3KO4A 4U0TA 5K5BA 1FILA 5FEFA 3VP3A 4WBGA 1P9WA 4WM9A 3AGDA 1PWGA 1FOFA 3HLDA 3R7WA 2V2FF 3CWFA 4Y15A 5J61A 4GLQA 3SH8A 4H8RA 5AVEA 4DE0A 1XXMA 3OLOA 4R70A 1BZAA 3A0VA 5CGWA 4RRAA 5FQQA 5EPHA 3MXSA 1VEUB 1YLWA 5M1AA 3JVVA 5A90A 3GQZA 4UA6A 1ZG4A 2ZD8A 5EOEA 1TS7A 2WAFA 3CPTB 4Q0JA 4M3KA 4R3AA 5DTSA 5FEGA 1P97A 5A91A 1L3LA 3N8SA 4RRRA 3W4OA 3NULA 3TOIA 4BL3A 2PU2A 1HZOA 2Y2GA 2ZQ9A 3QHYA 5TJJA 3SS4A 3UPNA 2EFUA 4RR9A 1DP6A 1YT4A 3S22A 2ZC6B 2PBDP 1P0ZA 1F98A 1DP8A 1IKGA 5IS1A 5EFWA 3IF5A 4P6ZS 2ZJ9A 2WKHA 4QHCA 2M1CA 3IH9A 5FI2A 5CEBA 2UWXA 3VP0A 3A0RA 4JF4A 2XFSA 4II7A 1Z09A 2UV0E 5M19A 2GX5A 3VSLA 4NEED 3LIFA 3L9KA 2ZQCA 3UE6A 1SKFA 3DWZA 3LUQA 2Y79A 1YKDA 5F5YA 3QP1A 3EQVA 1S66L 2WGVA 3BYDA 3BFEA 5FA7A 4R38A 3SS3A 2V8CA 3VE3A 1BLCA 1DRMA 4DDYA 1DJCA 3ZG8B 4JXVA 2Q0OA 1DJAA 3WS4A 3HREA 5L10A 3U2AA 3T1XA 2X02A 2D01A 3OPRA 3KOBA 3EEHA 3KO3A 3IS2B 4HP4A 3T1RA 1EI5A 3ZFZA 4DE1A 1G68A 5CHMA 4AFIA 2JBFA 3PBNA 4JKTA 1OJGA 4S2OA 3ZYTA 1CJFA 3IQAA 2LB9A 3ZG9B 2JE5A 3Q1FA 4PAUA 2ZMFA 2JKFA 3T4SA 3LR5A 5GLBA 1STZA 4EW7A 1K57C 4GDBA 1AXBA 3VOYA 3NOUC 3T4LA 4Y0TA 2J9PA 3IHAA 5GLAA 2XQZA 2Y91A 4MN6A 2WKQA 2ZMAA 1LT0A 2EXBA 2DCFA 4WUJA 2ACGA 5FAOA 3NDEA 4NXEA 3MR0A 4PMAA 1FIKA 4WELA 1JWVA 3VFHA 3KODA 1WYCA 1OTBA 4GD8A 1IYPA 1DY6A 3CLOA 2W3DA 3PAEA 3QP6A 1ZHHB 1PZOA 2MJ6A 5AJGA 3AGFA 1SDEA 4MBFA 2BASA 3V5MA 3VP1A 1MWRA 1IFQA 4Q0IA 1C3BA 2Z6CA 3GDIA 1OTIA 2JKRI 4OOLA 4F3LA 1H0MA 1YMXA 5KIZA 3GVBA 3OPLA 1UWNX 3WRTA 4QY5A 3SOIA 3H7WB 1FSWA 5U47A 3RJUA 4OQGA 2XK1A 1XJ4A 3VSKA 2EA9A 3NCKA 5GL9A 3A3DA 3DW0A 3S7OA 5G4YA 1M6KA 2EXAA 4FCFA 3RTYA 1TDGA 4H6JA 2LB5A 3G34A 4WYYA 4KZ7A 2W1TB 4P6ZM 4ZBEA 1FR6A 3BY9A 1K56D 4LV2A 3BECA 3Q81A 3D4FA 4GZBA 3UE3A 4OPRA 2WKEA 4WLAA 4O8GA 3E4OA 4QPRA 3NY4A 4S2NA 3EEAA 4JXWA 3F1OA 3HJKA 4CLCA 4Y13A 2H10A 3KYQA 5L09A 5A93A 4RVAA 1CI8A 4A5RA 3UN7A 2V9AA 1XJ2A 1CQAA 4HI4A 4GB7A 5TFQA 2WYXA 2VEAA 3T12B 1ES4A 2DRWA 4XT2A 4DF6A 3ZG5A 3ICYA 1AWIA 4BWIA 3HLCA 4WN5A 1D06A 1BULA 2G2UA 2QPNA 3CJMA 4GKUA 4E3MA 4L9FA 4MMNA 3UB5P 3QNBA 4HJ3A 1OPXA 4S2PA 4XXRA 4ZAMA 4BENA 3EOIA 4HBTA 2HZ5A 3MXQA 4WEJA 1K54A 1FR1A 4O01A 1SZVA 3LMTA 1S4SA 1NYYA 4RRBA 3HUNA 3PXPA 3M6BA 3B47A 1F9IA 3WWXA 3LO7A 1T19A 2GNXA 2VA0A 5F82A 1E4DA 4RRFA 2J7VA 1PRQA 4ZJ1A 4MLLA 2ZM8A 3PD4A 5CECA 3HL9A 4C6YA 5DF9A 3A3EA 5E43A 2XRNA 2Y2KA 4UAAA 1K0KA 4LPZA 3GR2A 1JTDA 2XROA 2R9WA 1MKIA 5DJTA 1L0GA 2Q9MA 1LL8A 1XJ3A 4KZ4A 5EVLA 1VETA 1KGGA 1WYBA 1GHIA 1LI0A 4LRZE 2B18A 4GN2A 5FQKA 2A2LA 2QZ6A 1MPLA 4OVDA 1L2SA 3UO9A 5AQBA 4GW9A 1SKOB 4DE2A 4EWFA 3CUEC 4MCWA 2VLGA 4PKYG 5DF7A 4NKPA 1OTDA 1T1CA 2Y2LA 5GHZA 4PKYA 2PYRA 3BLMA 1NRFA 3GTCA 3A3FA 5L07A 4BQMA 4B9OA 4RRCA 4KG6A 4EUVA 2Y2NA 2HF6A 3FKVA 1K4FA 2O99A 2KDKA 4QB8A 1N9BA 1Y2QA 3NOTC 1ODVA 2ZQAA 4RYEA 5IHVA 1MC0A 1FCNA 2WKPA 3NI9A 1M40A 2EX8A 4FH2A 2FZ0A 3NC8A 3M6HA 4OP5A 2J8YA 2JCHA 2ZC7A 1NRJA
chains in the Genus database with same CATH topology
1TVFA 4XUXA 1E25A 1JTGA 3UNWA 4DRTA 5DTSA 1J9MA 1LHYA 2WGWB 5A91A 3N8SA 2WKIA 4RRRA 2VGJA 4N1XA 5CXWA 2EX9A 5CGXA 2WADA 3W4OA 4BLMA 3KOCA 4EV4A 4KZ6A 3ISGA 3MKEA 3TOIA 3ZG0A 4OONA 3G32A 2WZXA 4BL3A 2HP9A 1Z6FA 2PU2A 1HZOA 2Y2GA 2ZQ9A 3IF6B 3QHYA 1TC5A 3N4IA 3SS4A 3UPNA 4EBNA 4P0MA 2EFUA 5HAQA 4RR9A 2JC7A 2XD1A 1YT4A 4QU3A 1QMEA 3S22A 3ZVWA 4EBPA 2ZC6B 1PWDA 3LMVA 4KG5A 1K6RA 2C5WB 4GNUA 1IKGA 4N1HA 1YLZA 1K57A 3MFDA 4L0LA 3IF5A 4JPMA 3OPHA 4U0XA 1YMSA 1KDWA 3ZHHA 3ZG7B 2ZJ9A 2WK0A 4IVIA 3GRJA 3ZNTA 5CEDA 1BTLA 5FQJA 4WZ5C 4RRIA 2WKHA 3HUOA 3UDFA 1H5XA 2DNSA 3JYIA 2Y2HA 4QHCA 4KZ5A 2B5RA 3IH9A 5E2HA 5FI2A 4BD1A 5CEBA 3PD2A 3FWLA 4OPZA 2UWXA 2XGNA 3OC2A 4EBLA 5DTKA 4F94A 4E3OA 3ZDJA 1ESIA 3BLSA 1L0FA 2OSUA 1L0EA 5L2FA 3VP0A 4PPRA 1IEMA 4LENA 1JWPA 4NBIA 4KQQA 4JF4A 1RGZA 4S2NC 2ZC4B 2HP6A 2XFSA 1VM1A 4C75A 4DXCA 2FFFB 3Q82A 2IWDA 5M19A 3WS0A 3KO7A 3VSLA 3ZVTA 1XGIA 4LV1A 1W5DA 3MZFA 2ZQCA 1MY8A 1NY0A 5EUAA 3GSGA 3ITAA 4JF6A 4S0JA 1SKFA 1IELA 3DWZA 4O7DA 4UA9A 5FSRA 2OV5A 4S2LA 2WAEA 5FASA 3EQVA 5EVIC 1KVLA 4X53A 2WGVA 3FV7A 3BYDA 4QD4A 1CI9A 3BFEA 5FA7A 1K56A 2HDUA 4OLDA 3SS3A 5CTMA 3A3JA 3HBRA 4R4SA 3CG5A 1BLCA 4KZAA 5JYOA 3G30A 1FQGA 1G6AA 4ZJ2A 3Q7VA 3UDIA 1DJCA 2HDRA 1I2WA 1MWTA 4JXGA 3ZG8B 4JXVA 4DDYA 1VQQA 5HW3A 2HL0A 4NBJA 1DJAA 1LLBA 3WS4A 1ONHA 3HREA 3ZGAB 4ZTKA 2X02A 5I94A 4OQIA 3E2KA 4IBXA 3IXDA 3OPRA 4X6TA 3KOBA 3BFDA 3PD3A 1O07A 3N7WA 3KO3A 1JVJA 4WMCA 4R3JA 1EI5A 3N6IA 2H5SA 3ZFZA 1K6SA 2G2WA 1TDLA 3BM6A 3W8KA 4DE1A 1G68A 2OKVA 1K54C 4RRJA 1DJBA 4R0QA 5CHMA 1XP4A 1KDSA 4K0WA 4OQHA 4R4RA 2JBFA 4Y0UA 3G35A 3PBNA 4JKTA 1SDNA 1K55C 4S2OA 3A3IA 5FAPA 5F83A 3IQAA 1KE4A 1YQSA 5HAPA 1ZC2A 5EVIB 3ZG9B 2JE5A 4LV3A 5DF8A 4DXBA 3Q1FA 4Z9QA 5FI6A 3G31A 1HVBA 4E6XA 4OH0A 2WGIA 4LV0A 3P98A 4KG2A 5GLBA 3KO9A 2XD5A 4R23A 3KNPA 1XGJA 3P09A 3DTMA 1JKEA 1K57C 3OZHA 1RGYA 4GDBA 3G2YA 1AXBA 3VOYA 4IVKA 3FZCA 4E3KA 4QY6A 3UE1A 1I5QA 4HBUA 4Y0TA 1NXYA 5M18A 1J7GA 1SCWA 2J9PA 3IHAA 3Q07A 3M2JA 5GLCA 4KZ8A 5GLAA 3WS5A 1EROA 5A92A 4Y0OA 5BOHA 3N8LA 2XQZA 2Y91A 3LCEA 1PW8A 2H0TA 2ZMAA 2OLUA 1ERMA 2EXBA 2RL3A 5J8XA 2DCFA 2WGWA 5DVAA 3ZCZA 4RR7A 2V20A 5FAOA 3NDEA 2IWBA 5GLDA 5CRFA 1CK3A 1MWUA 4PMAA 4EQIA 3QNCA 4WELA 4R3BA 1JWVA 3CZDA 3VFHA 3KODA 1WYCA 3G4PA 4P87A 1BLHA 3DWKA 4GD8A 1IYPA 1DY6A 2Z2LB 3M2KA 3IF6A 1PW1A 1ZKJA 2FFYA 5E2FA 3PAEA 3VFFA 4KZ9A 5CGSA 3NDGA 1PZOA 4E3NA 3C7VA 3AGFA 1SDEA 4S2KA 3IH8A 4JXSA 4MBFA 1RP5A 2Y59A 3E2LA 4N9LA 1LL9A 4JLFA 2RCXA 3N8RA 3V5MA 3ZNYA 3LY3A 3UE0A 3UDXA 1BT5A 3VP1A 3LMUA 1MWRA 1FCMA 1OMEA 4B4XA 4RRMA 3V3RA 1C3BA 4RRKA 3S4XA 5FQIA 4S03A 3V39A 4RA7A 1PI5A 2E8IA 4E3LA 4OOLA 4ZDXA 4PM6A 1YMXA 2XH9A 3OCLA 3GVBA 4MEZA 3OPLA 2Y55A 2PBYA 5FATA 4RRGA 1FSYA 2C6WB 3WRTA 4QY5A 3SOIA 5EECA 5GHXA 1FSWA 5U47A 3LEZA 1ZG6A 3RJUA 5KMWA 3SH7A 4BJPA 4OQGA 3RXXA 3BRMA 2XK1A 3VSKA 3B3XA 4S0IA 1YLTA 3HLWA 5EOOA 1H8YA 3MBZA 3NCKA 2BLSA 4PM8A 1XKZA 3BFFA 3HLFA 5GL9A 5HAIA 3IXGA 3A3DA 2Y2MA 3DW0A 1S0WA 3VOZA 5KZHA 1M6KA 1YLJA 4OPYA 3EQUA 1PWCA 5KSHA 1ERQA 2EXAA 4GD6A 3PBSA 3MKFA 3FYZA 4FCFA 4OOYA 1CEFA 4FSFA 2XDMA 5HARA 1Q2QA 1TDGA 4C3QA 1NZOA 3NBLA 1MBLA 3G34A 2WUQA 3OPPA 2Y2QA 4WYYA 1YM1A 4KZ7A 3IWIA 4OOMA 5FI7A 1QMFA 5F1GA 3ITBA 1KE3A 4NK3A 3BFCA 3C4PA 1YLPA 4RX3A 2Q9NA 4ZBEA 1E3UA 3UPPA 4E3IA 1FR6A 1NYMA 2ZM2A 4K91A 4KZBA 1KVMA 2P9VB 4QJGA 1K56D 3Q7VB 3HUMA 4LV2A 3BECA 3W4QA 4RRLA 3LY4A 2P74A 4IEDA 3Q81A 1GHPA 1RCJA 3D4FA 4GZBA 4MBHA 4OPRA 3UE3A 2WKEA 3OCNA 1XPBA 3NY4A 2Y2OA 4S2NA 4JXWA 4RR6A 2J9OA 1PZPA 3C7UA 1GHMA 1YLYA 3PBOA 4IBRA 2H10A 4OLGA 4WMCD 2XF3A 3TSGA 3VP2A 5A93A 2EFXA 4RVAA 1CI8A 2ZQ8A 4A5RA 3UPOA 1IYQA 4GOGA 3UN7A 5AQ7A 2BG1A 1ALQA 5JYPA 2WZZA 3BEBA 2WYXA 2Y2IA 3BFGA 4GB7A 5G18A 3O3VA 5TFQA 4D2OA 5HL1A 4PM9A 5FQMA 2A49A 1ES4A 2DRWA 3PBQA 4DF6A 4FH4A 4RRHA 5EVIA 3PBTA 3V50A 3ZG5A 4BL2A 4BD0A 2ZM0A 2IWCA 1ES5A 5HFOA 3W4PA 4DE3A 3PD5A 4CJNA 4X56A 5FAQA 4E6WA 3HLCA 4HEFA 3O87A 2QPNA 1BULA 1ES2A 2G2UA 3CJMA 4GKUA 4MBKA 4WZ4A 5AQAA 1ESUA 3TG9A 1W8QA 4E3MA 5TR7A 3PAGA 4U3TA 4N92A 4S02A 2HKZA 2X71A 1XX2A 5HX9A 3FKWA 3IWQA 3QNBA 4S0LA 3IT9A 3I7JA 1HD8A 4LCLA 3CMZA 4S2PA 4XXRA 4KQRA 3SH9A 1JWZA 1PYYA 4ZAMA 3VMAA 2XEPA 3MZEA 4BENA 1NJ4A 2Y2JA 4HBTA 2HDQA 4WEJA 1GCEA 1K54A 1FR1A 3LMTA 4YFMA 2I72A 4R1GA 2XFTA 3S1YA 1EWZA 4RR8A 1KE0A 1KGFA 1W79A 1NYYA 2ZQ7A 1H8ZA 1K55A 3GMWA 4RRBA 1MXOA 4Y7PA 3HUNA 2HL2A 1W7FA 2XLNA 1GA9A 5FDHA 3M6BA 3WWXA 4RRDA 3NIAA 4JBFA 3Q7ZA 1ONGA 3IXHA 3LO7A 2ZC5B 3HLBA 4KQOA 4NETA 4OPQA 2X01A 3V3SA 4UHUA 4OKPA 4PM5A 4RRQA 1K25A 2HP5A 1K38A 5F82A 1E4DA 4RRFA 2J7VA 2R9XA 4FD8A 4ID4A 1ES3A 2ZC3B 4ZJ1A 2XR0A 4MLLA 2ZM8A 3PD4A 2ZLYA 1Q2PA 4HESA 5CECA 4CPKA 5E2GA 1XA1A 3HL9A 3HLGA 4C6YA 5EE8A 5DF9A 1PI4A 3A3EA 4DDSA 1BUEA 2OLVA 5E43A 5F1FA 2Y2KA 4UAAA 5FQ9A 4PM7A 2Z2MB 3GR2A 4WEKA 1JTDA 2Y2PA 5CHJA 1IYSA 2R9WA 1MKIA 4YINA 3C4OA 2Y4AA 1L0GA 1W8YA 3WS2A 3KO5A 3KNFA 1NZUA 2Q9MA 1L0DA 3MXRA 4OP8A 4B88A 4KZ4A 3RXWA 4KZ3A 2ZQDA 5EVLA 3UY6A 5E2EA 1KGGA 1WYBA 1BLSA 1GHIA 1LI0A 4LCMA 4E3JA 1S6RA 4UA7A 2GDNA 1GA0A 1Y54A 5AQ9A 4GN2A 4XUZA 3VP4A 4EUZA 5FQKA 5CERA 4Q8IA 2QZ6A 1IKIA 1MPLA 2HPBA 4P85A 4RX2A 4OVDA 1L2SA 1LI9A 3UO9A 4WZ5A 2CC1A 1XA7A 3G2ZA 3HVFA 5AQBA 3O86A 1LL5A 3IWOA 3PBRA 4KENB 4S2IA 5CTNA 4DE2A 4EWFA 3PTEA 1CEGA 2VGKA 3O88A 5CHUA 1SHVA 2EX2A 5DF7A 1O7EA 2Y2LA 2A3UA 5GHZA 3WS1A 4P6BA 1MWSA 4N9KA 5KSCA 2DBOA 3MZDA 1WE4A 4X68A 3BLMA 3GTCA 1NRFA 2EX6A 1E3UD 2P9VA 3A3FA 4GDNA 4K0XA 4S2MA 2V1ZA 4MNRA 4BQMA 2H0YA 5GHYA 1PIOA 3KO4A 4U0TA 4RRCA 1U60A 4S0KA 1N4OA 4KG6A 5D3OA 2Y2NA 3WRZA 4X55A 3VP3A 3FKVA 4S2JA 4WBGA 1K4FA 1HTZA 4WM9A 2QMIA 3AGDA 4QB8A 1PWGA 1FOFA 3C5AA 1I2SA 1N9BA 1Y2QA 3HLDA 4JF5A 3IHBA 3HLEA 3IF6C 2V2FF 5J61A 3SH8A 1IYOA 4H8RA 2HL1A 2ZQAA 4RYEA 5TGFA 5IHVA 1BSGA 2HDSA 4DE0A 1XXMA 1FCNA 1BZAA 3AGEA 5CGWA 4ZJ3A 4RRAA 1K4EA 3SS5A 5FQQA 3IXBA 3NI9A 4OQ0A 5EPHA 4X69A 3MXSA 1FCOA 1M40A 2EX8A 3GV9A 4FH2A 1YLWA 1BLPA 5EVID 5M1AA 1TEMA 3NC8A 5A90A 3M6HA 3GQZA 4B4ZA 4UA6A 1KGEA 1ZG4A 2ZD8A 4OP5A 4DKIA 2J8YA 5EOEA 2JCHA 2PU4A 2WAFA 4M3KA 2ZC7A 5DTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVF A;  4XUX A;  1E25 A;  1JTG A;  3UNW A;  4DRT A;  5DTS A;  1J9M A;  1LHY A;  2WGW B;  5A91 A;  3N8S A;  2WKI A;  2VGJ A;  4N1X A;  5CXW A;  2EX9 A;  5CGX A;  2WAD A;  3W4O A;  4BLM A;  4EV4 A;  4KZ6 A;  3ISG A;  3MKE A;  3TOI A;  3ZG0 A;  4OON A;  3G32 A;  2WZX A;  4BL3 A;  2HP9 A;  1Z6F A;  2PU2 A;  1HZO A;  2Y2G A;  2ZQ9 A;  3IF6 B;  3QHY A;  3N4I A;  3SS4 A;  3UPN A;  4EBN A;  4P0M A;  2EFU A;  5HAQ A;  2JC7 A;  2XD1 A;  1YT4 A;  4QU3 A;  1QME A;  3S22 A;  3ZVW A;  4EBP A;  2ZC6 B;  1PWD A;  4KG5 A;  1K6R A;  2C5W B;  4GNU A;  1IKG A;  4N1H A;  1YLZ A;  1K57 A;  3MFD A;  4L0L A;  3IF5 A;  4JPM A;  3OPH A;  4U0X A;  1YMS A;  1KDW A;  3ZHH A;  3ZG7 B;  2ZJ9 A;  2WK0 A;  4IVI A;  3GRJ A;  3ZNT A;  5CED A;  1BTL A;  5FQJ A;  4WZ5 C;  2WKH A;  3HUO A;  3UDF A;  1H5X A;  2DNS A;  3JYI A;  2Y2H A;  4QHC A;  4KZ5 A;  2B5R A;  3IH9 A;  5E2H A;  5FI2 A;  4BD1 A;  5CEB A;  3FWL A;  4OPZ A;  2UWX A;  2XGN A;  3OC2 A;  4EBL A;  5DTK A;  4F94 A;  4E3O A;  3ZDJ A;  1ESI A;  3BLS A;  1L0F A;  2OSU A;  1L0E A;  5L2F A;  3VP0 A;  4PPR A;  1IEM A;  4LEN A;  1JWP A;  4KQQ A;  4JF4 A;  1RGZ A;  4S2N C;  2ZC4 B;  2HP6 A;  2XFS A;  1VM1 A;  4C75 A;  4DXC A;  2FFF B;  3Q82 A;  2IWD A;  5M19 A;  3WS0 A;  3VSL A;  3ZVT A;  1XGI A;  4LV1 A;  1W5D A;  3MZF A;  2ZQC A;  1MY8 A;  1NY0 A;  5EUA A;  3GSG A;  3ITA A;  4JF6 A;  1SKF A;  1IEL A;  3DWZ A;  4O7D A;  4UA9 A;  5FSR A;  2OV5 A;  4S2L A;  2WAE A;  5FAS A;  3EQV A;  5EVI C;  1KVL A;  4X53 A;  2WGV A;  3FV7 A;  3BYD A;  4QD4 A;  1CI9 A;  3BFE A;  5FA7 A;  1K56 A;  2HDU A;  4OLD A;  3SS3 A;  5CTM A;  3A3J A;  3HBR A;  4R4S A;  3CG5 A;  1BLC A;  4KZA A;  5JYO A;  3G30 A;  1FQG A;  1G6A A;  4ZJ2 A;  3Q7V A;  3UDI A;  1DJC A;  2HDR A;  1I2W A;  1MWT A;  4JXG A;  3ZG8 B;  4JXV A;  4DDY A;  1VQQ A;  5HW3 A;  1DJA A;  1LLB A;  3WS4 A;  1ONH A;  3HRE A;  3ZGA B;  4ZTK A;  2X02 A;  5I94 A;  4OQI A;  3E2K A;  4IBX A;  3IXD A;  3OPR A;  4X6T A;  3BFD A;  1O07 A;  3N7W A;  1JVJ A;  4WMC A;  4R3J A;  1EI5 A;  3N6I A;  2H5S A;  3ZFZ A;  1K6S A;  2G2W A;  1TDL A;  3BM6 A;  3W8K A;  4DE1 A;  1G68 A;  1K54 C;  1DJB A;  4R0Q A;  5CHM A;  1XP4 A;  1KDS A;  4K0W A;  4OQH A;  4R4R A;  2JBF A;  4Y0U A;  3G35 A;  3PBN A;  4JKT A;  1SDN A;  1K55 C;  4S2O A;  3A3I A;  5FAP A;  5F83 A;  3IQA A;  1KE4 A;  1YQS A;  5HAP A;  1ZC2 A;  5EVI B;  3ZG9 B;  2JE5 A;  4LV3 A;  5DF8 A;  4DXB A;  3Q1F A;  4Z9Q A;  5FI6 A;  3G31 A;  1HVB A;  4E6X A;  4OH0 A;  2WGI A;  4LV0 A;  3P98 A;  4KG2 A;  5GLB A;  2XD5 A;  4R23 A;  1XGJ A;  3P09 A;  3DTM A;  1K57 C;  3OZH A;  1RGY A;  4GDB A;  3G2Y A;  1AXB A;  3VOY A;  4IVK A;  3FZC A;  4E3K A;  4QY6 A;  3UE1 A;  1I5Q A;  4HBU A;  4Y0T A;  1NXY A;  5M18 A;  1SCW A;  2J9P A;  3IHA A;  3Q07 A;  3M2J A;  5GLC A;  4KZ8 A;  5GLA A;  3WS5 A;  1ERO A;  5A92 A;  4Y0O A;  5BOH A;  3N8L A;  2XQZ A;  2Y91 A;  3LCE A;  1PW8 A;  2H0T A;  2ZMA A;  2OLU A;  1ERM A;  2EXB A;  2RL3 A;  5J8X A;  2DCF A;  2WGW A;  5DVA A;  3ZCZ A;  2V20 A;  5FAO A;  3NDE A;  2IWB A;  5GLD A;  5CRF A;  1CK3 A;  1MWU A;  4PMA A;  4EQI A;  3QNC A;  4WEL A;  4R3B A;  1JWV A;  3CZD A;  3VFH A;  1WYC A;  3G4P A;  4P87 A;  1BLH A;  3DWK A;  4GD8 A;  1IYP A;  1DY6 A;  2Z2L B;  3M2K A;  3IF6 A;  1PW1 A;  1ZKJ A;  2FFY A;  5E2F A;  3PAE A;  3VFF A;  4KZ9 A;  5CGS A;  3NDG A;  1PZO A;  4E3N A;  3C7V A;  3AGF A;  1SDE A;  4S2K A;  3IH8 A;  4JXS A;  4MBF A;  1RP5 A;  2Y59 A;  3E2L A;  4N9L A;  1LL9 A;  4JLF A;  2RCX A;  3N8R A;  3V5M A;  3ZNY A;  3LY3 A;  3UE0 A;  3UDX A;  1BT5 A;  3VP1 A;  1MWR A;  1FCM A;  1OME A;  4B4X A;  3V3R A;  1C3B A;  3S4X A;  5FQI A;  3V39 A;  4RA7 A;  1PI5 A;  2E8I A;  4E3L A;  4OOL A;  4ZDX A;  4PM6 A;  1YMX A;  2XH9 A;  3OCL A;  3GVB A;  4MEZ A;  3OPL A;  2Y55 A;  2PBY A;  5FAT A;  1FSY A;  2C6W B;  3WRT A;  4QY5 A;  3SOI A;  5EEC A;  5GHX A;  1FSW A;  5U47 A;  3LEZ A;  1ZG6 A;  3RJU A;  5KMW A;  3SH7 A;  4BJP A;  4OQG A;  3RXX A;  3BRM A;  2XK1 A;  3VSK A;  3B3X A;  1YLT A;  3HLW A;  5EOO A;  1H8Y A;  3MBZ A;  3NCK A;  2BLS A;  4PM8 A;  1XKZ A;  3BFF A;  3HLF A;  5GL9 A;  5HAI A;  3IXG A;  3A3D A;  2Y2M A;  3DW0 A;  1S0W A;  3VOZ A;  5KZH A;  1M6K A;  1YLJ A;  4OPY A;  3EQU A;  1PWC A;  5KSH A;  1ERQ A;  2EXA A;  4GD6 A;  3PBS A;  3MKF A;  3FYZ A;  4FCF A;  4OOY A;  1CEF A;  4FSF A;  2XDM A;  5HAR A;  1Q2Q A;  1TDG A;  4C3Q A;  1NZO A;  3NBL A;  1MBL A;  3G34 A;  2WUQ A;  3OPP A;  2Y2Q A;  4WYY A;  1YM1 A;  4KZ7 A;  3IWI A;  4OOM A;  5FI7 A;  1QMF A;  5F1G A;  3ITB A;  1KE3 A;  4NK3 A;  3BFC A;  3C4P A;  1YLP A;  4RX3 A;  2Q9N A;  4ZBE A;  1E3U A;  3UPP A;  4E3I A;  1FR6 A;  1NYM A;  2ZM2 A;  4K91 A;  4KZB A;  1KVM A;  2P9V B;  4QJG A;  1K56 D;  3Q7V B;  3HUM A;  4LV2 A;  3BEC A;  3W4Q A;  3LY4 A;  2P74 A;  4IED A;  3Q81 A;  1GHP A;  1RCJ A;  3D4F A;  4GZB A;  4MBH A;  4OPR A;  3UE3 A;  2WKE A;  3OCN A;  1XPB A;  3NY4 A;  2Y2O A;  4S2N A;  4JXW A;  2J9O A;  1PZP A;  3C7U A;  1GHM A;  1YLY A;  3PBO A;  4IBR A;  2H10 A;  4OLG A;  4WMC D;  2XF3 A;  3TSG A;  3VP2 A;  5A93 A;  2EFX A;  4RVA A;  1CI8 A;  2ZQ8 A;  4A5R A;  3UPO A;  1IYQ A;  4GOG A;  3UN7 A;  5AQ7 A;  2BG1 A;  1ALQ A;  5JYP A;  2WZZ A;  3BEB A;  2WYX A;  2Y2I A;  3BFG A;  4GB7 A;  5G18 A;  3O3V A;  5TFQ A;  4D2O A;  5HL1 A;  4PM9 A;  5FQM A;  2A49 A;  1ES4 A;  2DRW A;  3PBQ A;  4DF6 A;  4FH4 A;  5EVI A;  3PBT A;  3V50 A;  3ZG5 A;  4BL2 A;  4BD0 A;  2ZM0 A;  2IWC A;  1ES5 A;  5HFO A;  3W4P A;  4DE3 A;  4CJN A;  4X56 A;  5FAQ A;  4E6W A;  3HLC A;  4HEF A;  3O87 A;  2QPN A;  1BUL A;  1ES2 A;  2G2U A;  3CJM A;  4GKU A;  4MBK A;  4WZ4 A;  5AQA A;  1ESU A;  3TG9 A;  1W8Q A;  4E3M A;  5TR7 A;  3PAG A;  4U3T A;  4N92 A;  2X71 A;  1XX2 A;  5HX9 A;  3FKW A;  3IWQ A;  3QNB A;  3IT9 A;  3I7J A;  1HD8 A;  4LCL A;  3CMZ A;  4S2P A;  4XXR A;  4KQR A;  3SH9 A;  1JWZ A;  1PYY A;  4ZAM A;  3VMA A;  2XEP A;  3MZE A;  4BEN A;  1NJ4 A;  2Y2J A;  4HBT A;  2HDQ A;  4WEJ A;  1GCE A;  1K54 A;  1FR1 A;  4YFM A;  2I72 A;  4R1G A;  2XFT A;  3S1Y A;  1EWZ A;  1KE0 A;  1KGF A;  1W79 A;  1NYY A;  2ZQ7 A;  1H8Z A;  1K55 A;  3GMW A;  1MXO A;  4Y7P A;  3HUN A;  1W7F A;  2XLN A;  1GA9 A;  5FDH A;  3M6B A;  3WWX A;  3NIA A;  4JBF A;  3Q7Z A;  1ONG A;  3IXH A;  3LO7 A;  2ZC5 B;  3HLB A;  4KQO A;  4NET A;  4OPQ A;  2X01 A;  3V3S A;  4UHU A;  4OKP A;  4PM5 A;  1K25 A;  2HP5 A;  1K38 A;  5F82 A;  1E4D A;  2J7V A;  2R9X A;  4FD8 A;  4ID4 A;  1ES3 A;  2ZC3 B;  4ZJ1 A;  2XR0 A;  4MLL A;  2ZM8 A;  2ZLY A;  1Q2P A;  4HES A;  5CEC A;  4CPK A;  5E2G A;  1XA1 A;  3HL9 A;  3HLG A;  4C6Y A;  5EE8 A;  5DF9 A;  1PI4 A;  3A3E A;  4DDS A;  1BUE A;  2OLV A;  5E43 A;  5F1F A;  2Y2K A;  4UAA A;  5FQ9 A;  4PM7 A;  2Z2M B;  3GR2 A;  4WEK A;  1JTD A;  2Y2P A;  5CHJ A;  1IYS A;  2R9W A;  1MKI A;  4YIN A;  3C4O A;  2Y4A A;  1L0G A;  1W8Y A;  3WS2 A;  1NZU A;  2Q9M A;  1L0D A;  3MXR A;  4OP8 A;  4B88 A;  4KZ4 A;  3RXW A;  4KZ3 A;  2ZQD A;  5EVL A;  3UY6 A;  5E2E A;  1KGG A;  1WYB A;  1BLS A;  1GHI A;  1LI0 A;  4LCM A;  4E3J A;  1S6R A;  4UA7 A;  2GDN A;  1GA0 A;  1Y54 A;  5AQ9 A;  4GN2 A;  4XUZ A;  3VP4 A;  4EUZ A;  5FQK A;  5CER A;  4Q8I A;  2QZ6 A;  1IKI A;  1MPL A;  2HPB A;  4P85 A;  4RX2 A;  4OVD A;  1L2S A;  1LI9 A;  3UO9 A;  4WZ5 A;  2CC1 A;  1XA7 A;  3G2Z A;  3HVF A;  5AQB A;  3O86 A;  1LL5 A;  3IWO A;  3PBR A;  4KEN B;  4S2I A;  5CTN A;  4DE2 A;  4EWF A;  3PTE A;  1CEG A;  2VGK A;  3O88 A;  5CHU A;  1SHV A;  2EX2 A;  5DF7 A;  1O7E A;  2Y2L A;  2A3U A;  5GHZ A;  3WS1 A;  4P6B A;  1MWS A;  4N9K A;  5KSC A;  3MZD A;  1WE4 A;  4X68 A;  3BLM A;  3GTC A;  1NRF A;  2EX6 A;  1E3U D;  2P9V A;  3A3F A;  4GDN A;  4K0X A;  4S2M A;  2V1Z A;  4MNR A;  4BQM A;  2H0Y A;  5GHY A;  1PIO A;  4U0T A;  1U60 A;  1N4O A;  4KG6 A;  5D3O A;  2Y2N A;  3WRZ A;  4X55 A;  3VP3 A;  3FKV A;  4S2J A;  4WBG A;  1K4F A;  1HTZ A;  4WM9 A;  2QMI A;  3AGD A;  4QB8 A;  1PWG A;  1FOF A;  3C5A A;  1I2S A;  1N9B A;  3HLD A;  4JF5 A;  3IHB A;  3HLE A;  3IF6 C;  2V2F F;  3SH8 A;  1IYO A;  4H8R A;  2ZQA A;  4RYE A;  5TGF A;  5IHV A;  1BSG A;  2HDS A;  4DE0 A;  1XXM A;  1FCN A;  1BZA A;  3AGE A;  5CGW A;  4ZJ3 A;  1K4E A;  3SS5 A;  5FQQ A;  3IXB A;  3NI9 A;  4OQ0 A;  5EPH A;  4X69 A;  3MXS A;  1FCO A;  1M40 A;  2EX8 A;  3GV9 A;  4FH2 A;  1YLW A;  1BLP A;  5EVI D;  5M1A A;  1TEM A;  3NC8 A;  5A90 A;  3M6H A;  3GQZ A;  4B4Z A;  4UA6 A;  1KGE A;  1ZG4 A;  2ZD8 A;  4OP5 A;  4DKI A;  2J8Y A;  5EOE A;  2JCH A;  2PU4 A;  2WAF A;  4M3K A;  2ZC7 A;  5DTT A; 
#chains in the Genus database with same CATH topology
 1JTG A;  4GCZ A;  1J9M A;  2WKI A;  2VGJ A;  4N1X A;  2EX9 A;  5CGX A;  4BBT A;  3G32 A;  1W63 Q;  2HP9 A;  4G3K A;  4P0M A;  5HAQ A;  1PNE A;  4QU3 A;  3ZVW A;  1QME A;  5J4E A;  3LMV A;  4KG5 A;  1K6R A;  2C5W B;  3LR0 A;  1OT9 A;  1YLZ A;  2PD8 A;  3H82 A;  2WK0 A;  3QP8 A;  3GRJ A;  5CED A;  5FQJ A;  4WZ5 C;  3HUO A;  3UDF A;  3KYE A;  4GHI B;  5HD5 A;  3EGD C;  4EBL A;  5DTK A;  4GS9 A;  3TE8 A;  1L0F A;  1L0E A;  5L2F A;  3FC7 A;  3BQA A;  4PPR A;  1IEM A;  4LEN A;  1JWP A;  4NBI A;  2V1B A;  4KQQ A;  1RGZ A;  2HP6 A;  4BBU A;  4DXC A;  2FFF B;  3WS0 A;  3KO7 A;  3ZVT A;  1ZTU A;  5G4Z A;  3GSG A;  3ITA A;  4JF6 A;  3LR4 A;  4S0J A;  4O7D A;  5FSR A;  5EVI C;  4IJG A;  3FV7 A;  1CI9 A;  1K56 A;  4OLD A;  5CTM A;  3G30 A;  1FQG A;  1G6A A;  4ZJ2 A;  3Q7V A;  3UDI A;  1VQQ A;  5IU1 A;  1LLB A;  2JKR M;  3ZGA B;  2QKP A;  4OQI A;  3E2K A;  4WF0 A;  3PD3 A;  1O07 A;  4KUK A;  2YKH A;  4YWZ A;  1JVJ A;  2O9C A;  3H9W A;  1K6S A;  1TDL A;  4MN5 A;  5DKL A;  2QYB A;  3KO6 A;  1DJB A;  4R0Q A;  1KDS A;  4K0W A;  4OQH A;  3G35 A;  5F83 A;  2K7S A;  1OTE A;  1KE4 A;  1YQS A;  5HAP A;  1YSP A;  5EVI B;  5AVF A;  4DJ3 A;  4LV3 A;  4Z9Q A;  3G31 A;  2WGI A;  4NG2 A;  4LV0 A;  2GJ3 A;  1XGJ A;  3G2Y A;  4IVK A;  3T4T A;  4E3K A;  4IUK A;  4QY6 A;  1I5Q A;  1VEU A;  1NXY A;  5M18 A;  1X0O A;  5GLC A;  5LBR A;  3M2J A;  1ERO A;  5HWW A;  2Y8H A;  3CPT A;  3IX3 A;  1PW8 A;  2OLU A;  4JGQ A;  2QJ7 A;  4YNR A;  5DVA A;  3TJZ C;  3P7N A;  3F1P B;  2IWB A;  5EM0 A;  5GLD A;  1CK3 A;  4EQI A;  3QNC A;  3CZD A;  4P87 A;  3DWK A;  2FFY A;  5DJU A;  5E2F A;  2J80 A;  3VFF A;  4KZ9 A;  1HLU P;  1T1A A;  4S2K A;  3S7N A;  3IH8 A;  4N9L A;  2RCX A;  3MFX A;  3ZNY A;  2O0Y A;  3JPU A;  4I5S A;  1FCM A;  4RRM A;  2V0U A;  3D9Y A;  4Y17 A;  3V39 A;  2B02 A;  1PI5 A;  2KX6 A;  2XH9 A;  3OCL A;  2C6W B;  4NXF A;  2L0W A;  5GHX A;  3LEZ A;  1ZG6 A;  4ETX A;  5KMW A;  3SH7 A;  4HH3 A;  4BJP A;  3LIE A;  3MBZ A;  3BJN A;  3BFF A;  4ME4 A;  4OPY A;  4IHQ A;  1PWC A;  4OOY A;  4FSF A;  3PR6 A;  1NZO A;  4I39 A;  2G7U A;  2WUQ A;  2Y2Q A;  1OJ5 A;  4O0P A;  3ITB A;  4NK3 A;  4RX3 A;  3UPP A;  2PDR A;  3E4P A;  1NYM A;  2ZM2 A;  4K91 A;  2P9V B;  5HSQ A;  3LY4 A;  4IED A;  4MBH A;  1XJ6 A;  4ESP A;  3IX8 A;  3PHY A;  4RR6 A;  2J9O A;  3IS2 A;  1PZP A;  1YLY A;  2XF3 A;  1S1Y A;  3UPO A;  3IBJ A;  4EET B;  3BQ8 A;  5AQ7 A;  2P7J A;  5JYP A;  4E6X A;  4D2O A;  5G18 A;  2VK3 A;  2CMN A;  2A49 A;  4JGP A;  4I3A A;  3PBQ A;  3G6O A;  2HGV A;  2PHY A;  4FH4 A;  4RRH A;  1T1B A;  4X56 A;  2VV8 A;  2Z6D A;  4MBK A;  1W8Q A;  1XFN A;  4N92 A;  4S02 A;  1XX2 A;  3IX4 A;  4S0L A;  3IT9 A;  1HD8 A;  3T1Q B;  3CMZ A;  4KQR A;  2FH5 A;  3SH9 A;  1PYY A;  2R78 A;  3MZE A;  2Y2J A;  5F6A A;  3DTE A;  1GCE A;  4YFM A;  4R1G A;  1KE0 A;  1W79 A;  2ZQ7 A;  1H8Z A;  1MXO A;  1VB6 A;  4Y7P A;  2HL2 A;  1W7F A;  1GA9 A;  4OPQ A;  3HLB A;  2X01 A;  4PM5 A;  4RRQ A;  2HP5 A;  1K38 A;  2ZC3 B;  2XR0 A;  3LEQ A;  3MJQ A;  4CLC E;  1IYS A;  3KO5 A;  3WS2 A;  3KNF A;  5HWV A;  3MXR A;  4OP8 A;  2VZW A;  2ZQD A;  3H7W A;  3UY6 A;  5DFY A;  1BLS A;  4UEY A;  1LSX A;  4LCM A;  1D1J A;  1GA0 A;  1Y54 A;  3VP4 A;  3NJA A;  1IKI A;  3R4K A;  2IA2 A;  3HVF A;  4EES A;  3IWO A;  3PBR A;  3PTE A;  1CEG A;  5CHU A;  1SHV A;  1LSV A;  2W1T A;  2DBO A;  2O9A A;  2EX6 A;  4KUO A;  4BMW A;  4GDN A;  2V1Z A;  5DKK A;  1N4O A;  3WRZ A;  3KSF A;  4X55 A;  1HTZ A;  2PR6 A;  2QMI A;  3C8C A;  1CF0 A;  4JF5 A;  3IHB A;  3IF6 C;  1XFQ A;  2HL1 A;  2HDS A;  3LID A;  3EGX C;  4ZJ3 A;  1K4E A;  3IXB A;  4OQ0 A;  4X69 A;  1FCO A;  4Y3I A;  5EVI D;  4ARZ B;  1TEM A;  5DFX A;  4B4Z A;  5TBM B;  4HQA A;  1KGE A;  4HJ6 A;  5DTT A;  1TVF A;  3L7H A;  4XUX A;  4KQD A;  4HP9 A;  4DRT A;  2WGW B;  1LHY A;  3VV4 A;  5CXW A;  3NHQ A;  4BLM A;  3KOC A;  4EV4 A;  3MKE A;  3E98 A;  4OON A;  2WZX A;  1Z6F A;  3IF6 B;  1TC5 A;  3N4I A;  4EBN A;  4EBP A;  2EWW A;  4CQH A;  3KYZ A;  4JPM A;  3OPH A;  4I3I A;  1KDW A;  5C5K A;  3ZNT A;  1BTL A;  4HY8 A;  1H5X A;  2DNS A;  2M7V A;  2B5R A;  3FWL A;  4F94 A;  4E3O A;  1ESI A;  1V9Z A;  4C75 A;  3Q82 A;  4HHD A;  4GJ4 A;  1XGI A;  4LV1 A;  4M4X A;  2DMW A;  2W0N A;  3B33 A;  4UQI M;  4UA9 A;  2OV5 A;  4S2L A;  5A8B A;  1KVL A;  3KX0 X;  4I38 A;  2PRF A;  4X53 A;  1Y28 A;  2HDU A;  1SKO A;  3A3J A;  4R4S A;  5JYO A;  5HW3 A;  2HDR A;  4JXG A;  1MWT A;  3TRC A;  4NBJ A;  4ZTK A;  3T1S A;  5EM1 A;  4IBX A;  3IXD A;  4X6T A;  4RQ9 A;  5HL6 A;  3N6I A;  2G2W A;  3B42 A;  2OKV A;  5L8M A;  4RRJ A;  1XP4 A;  3MQO A;  3DTI A;  4R4R A;  3F1N B;  1K55 C;  3A3I A;  5FAP A;  3LI8 A;  3EWK A;  1ZC2 A;  4FTX A;  5DF8 A;  4EQ1 A;  3MS6 A;  4EU0 A;  1H8M A;  4KG2 A;  3KO9 A;  3CUE A;  4R23 A;  3KNP A;  3P09 A;  3OZH A;  5I5L A;  2ZMV A;  3FZC A;  2J3T C;  3UE1 A;  1F5M A;  2VV7 A;  4HBU A;  2W27 A;  1J7G A;  4KZ8 A;  3WS5 A;  5BOH A;  4D60 A;  2H0T A;  1J3W A;  2A24 B;  1ERM A;  2RL3 A;  3ZCZ A;  4RR7 A;  2ZL1 B;  4HH2 A;  3T4O A;  1G5U A;  5CRF A;  4WL9 A;  5J3W A;  1BLH A;  2VGL S;  2Z2L B;  3M2K A;  3BY8 A;  1A0K A;  2JKT I;  4JXS A;  3CIT A;  3E2L A;  1LL9 A;  5FL3 A;  1BT5 A;  3LMU A;  4B4X A;  3V3R A;  4K08 A;  4GHI A;  4PHT A;  3E0Y A;  4RA7 A;  4E3L A;  4ZDX A;  5FAT A;  1FSY A;  4LGW A;  2J3W A;  3BRM A;  3HLW A;  2AVX A;  1H8Y A;  2L4R A;  2BLS A;  3RFB A;  2W3E A;  3HLF A;  3LYX A;  5HAI A;  2Y2M A;  1YLJ A;  2OAQ 1;  5KSH A;  1ERQ A;  3O5Y A;  4GD6 A;  3MKF A;  3SZT A;  5HAR A;  2PYP A;  2YKF A;  1Q2Q A;  1MBL A;  1OT6 A;  5FI7 A;  2XA7 S;  1QMF A;  5F1G A;  3BFC A;  3C4P A;  1YLP A;  2Q9N A;  4E3I A;  4KZB A;  1KVM A;  3Q7V B;  2KLI A;  2ZBB A;  2O9B A;  2H28 A;  3FG8 A;  4LLO B;  1XPB A;  3LIC A;  2Y2O A;  3FPV A;  2INW A;  1GHM A;  3PBO A;  4IBR A;  1GSV A;  4WMC D;  3VP2 A;  2EFX A;  3R7W B;  2ZQ8 A;  1IYQ A;  2ZOI A;  1ALQ A;  4LRY C;  3BEB A;  1F2K A;  3O3V A;  1TD5 A;  4CLC D;  5FQM A;  1OTA A;  2EWV A;  2ZOH A;  5EVI A;  3PBT A;  4BL2 A;  4BD0 A;  2ZM0 A;  3W4P A;  3PD5 A;  4CJN A;  4HEF A;  3UMD A;  1ES2 A;  5HWT A;  5HX9 A;  3FKW A;  3IWQ A;  2XSS A;  4LCL A;  4NXG A;  1H3Q A;  1JWZ A;  3VMA A;  2K31 A;  2XEP A;  3A0S A;  4ZRR A;  4DMZ A;  5EV0 A;  2XFT A;  4RR8 A;  3F1P A;  4E04 A;  4Y2F A;  3GMW A;  2NUP C;  3HJI A;  2JKG A;  4JBF A;  2VV6 A;  3Q7Z A;  3IXH A;  3UB8 A;  4NET A;  3BWL A;  4KQO A;  2QHK A;  4UHU A;  4OKP A;  4YOF A;  1K25 A;  3CI6 A;  2R9X A;  4FD8 A;  2ZLY A;  4HES A;  4CPK A;  5E2G A;  1XA1 A;  1UGU A;  3D72 A;  1PI4 A;  4G3W A;  1BUE A;  2OLV A;  3LGO A;  5F1F A;  4WEK A;  2Y2P A;  5CHJ A;  4YIN A;  3C4O A;  2Y4A A;  1W8Y A;  1NZU A;  1L0D A;  4B88 A;  2NUT C;  3RXW A;  4KZ3 A;  3W2Z A;  5E2E A;  3RH8 B;  4DJ2 A;  1S6R A;  4UA7 A;  4XUZ A;  1W63 M;  2V1A A;  5CER A;  4Q8I A;  2OOL A;  3T50 A;  1VHM A;  2VGL M;  3ZQ5 A;  1XA7 A;  2HV1 A;  4KEN B;  5CTN A;  1NWZ A;  2VGK A;  2D02 A;  1O7E A;  2A3U A;  3WS1 A;  4N9K A;  3GEC A;  3MSH A;  1WE4 A;  2P9V A;  1E3U D;  4K0X A;  2H0Y A;  1PIO A;  1U60 A;  4S0K A;  5D3O A;  4S2J A;  3IBR A;  4X1L A;  1EW0 A;  4Q0H A;  3C5A A;  1I2S A;  1PFL A;  1MZU A;  2V8F A;  4I3J A;  3DBA A;  3HLE A;  1IYO A;  5TGF A;  1BSG A;  3FPW A;  3AGE A;  3SS5 A;  2HJE A;  3QP4 A;  3VE4 A;  4DN0 A;  3GV9 A;  1BLP A;  2VX8 A;  2K2N A;  3QP2 A;  2W1R A;  1DP9 A;  2OAP 1;  4DKI A;  2XA7 M;  2PU4 A;  3OOV A;  2QWS A;  1UWP X;  3KSG A;  1E25 A;  3UNW A;  3HCY A;  2HJ9 C;  5HPI A;  2WAD A;  4KZ6 A;  3ISG A;  4UQI S;  2V0W A;  3ZG0 A;  2BTF P;  4HOI A;  5CX7 A;  2JC7 A;  2XD1 A;  3E4Q A;  1PWD A;  3S7P A;  2M7U A;  4GNU A;  3UB7 A;  4N1H A;  3MFD A;  1K57 A;  4L0L A;  3C2W A;  5HD3 A;  4U0X A;  1YMS A;  3ZHH A;  3ZG7 B;  4IVI A;  4RRI A;  3P01 A;  3JYI A;  2Y2H A;  4KZ5 A;  1GSX A;  5E2H A;  4BD1 A;  3PD2 A;  4F3L B;  4OPZ A;  2XGN A;  3OC2 A;  2J3T D;  2JHE A;  3ZDJ A;  3BLS A;  4G3V A;  2OSU A;  1IOU A;  3LIA A;  4S2N C;  2ZC4 B;  4CLC C;  1VM1 A;  2PT7 A;  3OBF A;  2IWD A;  1NLZ A;  1W5D A;  3MZF A;  1MY8 A;  5IT5 A;  1NY0 A;  3C38 A;  5EUA A;  4X1M A;  1JNU A;  3LIB A;  3T4K A;  1IEL A;  4H6J B;  2JKT M;  2WAE A;  5FAS A;  2I9V A;  3K2N A;  4LFU A;  4QD4 A;  5HPF A;  1YPR A;  3HBR A;  3CG5 A;  4KZA A;  1G28 A;  1I2W A;  2HL0 A;  3BW6 A;  1ONH A;  4JGR A;  4MDZ A;  5I94 A;  3BFD A;  3F1O B;  3N7W A;  4CLC B;  4WMC A;  4R3J A;  2VKS A;  2H5S A;  2P04 A;  1TS6 A;  3BM6 A;  3W8K A;  1K54 C;  1BYW A;  4Y0U A;  1SDN A;  4XT2 B;  3KSI A;  4DXB A;  5FI6 A;  1HVB A;  4OH0 A;  3P98 A;  2XD5 A;  1JKE A;  3DTM A;  3D3O A;  1RGY A;  2OWH A;  1WA9 A;  5F69 A;  4ARZ A;  1SCW A;  3Q07 A;  5A92 A;  2B95 A;  4Y0O A;  5TBM A;  3N8L A;  1S4R A;  3LCE A;  4FOF A;  5J8X A;  2WGW A;  2V20 A;  1MWU A;  4R3B A;  2QJ5 A;  1V9Y A;  4HIA A;  3G4P A;  4QWO A;  1MKM A;  3ULF A;  3IF6 A;  1PW1 A;  3S7Q A;  1ZKJ A;  4B93 A;  3DAV A;  5CGS A;  3NDG A;  4E3N A;  3C7V A;  4R6L A;  3UB6 A;  1RP5 A;  2Y59 A;  4JLF A;  3N8R A;  3LY3 A;  1N9O A;  3UE0 A;  3UDX A;  5FDS A;  3T4J A;  1OME A;  4RRK A;  2E8J A;  4EXO A;  3TW8 A;  3S4X A;  5FQI A;  4S03 A;  3CHW P;  2E8I A;  4HNB A;  4PM6 A;  4MEZ A;  2Y55 A;  2PBY A;  4RRG A;  1LSW A;  5HDC A;  3UB9 A;  5EEC A;  3CAX A;  1VET B;  3K3D A;  3RXX A;  2KOI A;  3B3X A;  4S0I A;  1YLT A;  5EOO A;  5EVE A;  3MQQ A;  4PM8 A;  1XKZ A;  2PAV P;  3IXG A;  3VOZ A;  1S0W A;  5KZH A;  4EEU A;  3EQU A;  3PBS A;  3FYZ A;  1CEF A;  2XDM A;  1Y4O A;  4C3Q A;  3NBL A;  1P9R A;  5MC7 A;  2PD7 A;  3OPP A;  4NXB A;  1YM1 A;  4OOM A;  3IWI A;  4JGO A;  1KE3 A;  2L1M A;  1E3U A;  3K3C A;  2GZA A;  3UME A;  3JVU A;  1N9L A;  5HDS A;  4QJG A;  4HJ4 A;  3PYP A;  3HUM A;  3V67 A;  4L9G A;  1GSW A;  3W4Q A;  4RRL A;  2P74 A;  1GHP A;  1RCJ A;  2VJW A;  3OCN A;  4ETZ A;  3T4Q A;  3C7U A;  4OLG A;  2OWJ A;  4IUH A;  2W3G A;  3TSG A;  3VOL A;  4GOG A;  2BG1 A;  3MQ0 A;  1S67 L;  2WZZ A;  3BFG A;  2Y2I A;  5HL1 A;  3F1N A;  4PM9 A;  3NEC A;  5F68 A;  3NOP C;  3V50 A;  5J7E A;  3LR3 A;  5HZH A;  2IWC A;  1ES5 A;  5HFO A;  4DE3 A;  5FAQ A;  4E6W A;  1NLY A;  1TS8 A;  3O87 A;  4WZ4 A;  5AQA A;  3TG9 A;  1ESU A;  2PR5 A;  3KSH A;  5TR7 A;  3PAG A;  4U3T A;  1S1Z A;  2JN7 A;  2W3H A;  2HKZ A;  2X71 A;  3U4L P;  3SW1 A;  3I7J A;  1KOU A;  3LFV A;  1NJ4 A;  2HDQ A;  1G6O A;  4EER A;  2A24 A;  2P08 A;  2I72 A;  2W3F A;  3S1Y A;  1YAX A;  1EWZ A;  2ZL1 A;  4L9E A;  4Z1W A;  1KGF A;  3QP5 A;  1K55 A;  1TS0 A;  4LRX C;  2XLN A;  3MF0 A;  5FDH A;  4RRD A;  3NIA A;  1ONG A;  3V3S A;  3H82 B;  2ZC5 B;  1T18 A;  2WKR A;  4ID4 A;  1ES3 A;  4MN7 A;  3DTK A;  1Q2P A;  4GS9 B;  3HLG A;  1YSQ A;  5EE8 A;  4DDS A;  5FQ9 A;  1D7E A;  4PM7 A;  2Z2M B;  1TF1 A;  3LI9 A;  4FUW A;  1ACF A;  4E3J A;  4BBV A;  2GDN A;  5AQ9 A;  4Y5F A;  4EUZ A;  3MMH A;  4EEP A;  4P85 A;  4RX2 A;  5HDD A;  2HPB A;  1LI9 A;  4WZ5 A;  2CC1 A;  3G2Z A;  3O86 A;  1LL5 A;  4S2I A;  3O88 A;  2EX2 A;  4P6B A;  1MWS A;  5KSC A;  3C30 A;  3MZD A;  4X68 A;  4X25 A;  1N9N A;  4S2M A;  4MNR A;  5GHY A;  3KO4 A;  4U0T A;  5K5B A;  1FIL A;  5FEF A;  3VP3 A;  4WBG A;  1P9W A;  4WM9 A;  3AGD A;  1PWG A;  1FOF A;  3HLD A;  3R7W A;  2V2F F;  3CWF A;  4Y15 A;  5J61 A;  4GLQ A;  3SH8 A;  4H8R A;  5AVE A;  4DE0 A;  1XXM A;  3OLO A;  4R70 A;  1BZA A;  3A0V A;  5CGW A;  4RRA A;  5FQQ A;  5EPH A;  3MXS A;  1VEU B;  1YLW A;  5M1A A;  3JVV A;  5A90 A;  3GQZ A;  4UA6 A;  1ZG4 A;  2ZD8 A;  5EOE A;  1TS7 A;  2WAF A;  3CPT B;  4Q0J A;  4M3K A;  4R3A A;  5DTS A;  5FEG A;  1P97 A;  5A91 A;  1L3L A;  3N8S A;  4RRR A;  3W4O A;  3NUL A;  3TOI A;  4BL3 A;  2PU2 A;  1HZO A;  2Y2G A;  2ZQ9 A;  3QHY A;  5TJJ A;  3SS4 A;  3UPN A;  2EFU A;  4RR9 A;  1DP6 A;  1YT4 A;  3S22 A;  2ZC6 B;  2PBD P;  1P0Z A;  1F98 A;  1DP8 A;  1IKG A;  5IS1 A;  5EFW A;  3IF5 A;  4P6Z S;  2ZJ9 A;  2WKH A;  4QHC A;  2M1C A;  3IH9 A;  5FI2 A;  5CEB A;  2UWX A;  3VP0 A;  3A0R A;  4JF4 A;  2XFS A;  4II7 A;  1Z09 A;  2UV0 E;  5M19 A;  2GX5 A;  3VSL A;  4NEE D;  3LIF A;  3L9K A;  2ZQC A;  3UE6 A;  1SKF A;  3DWZ A;  3LUQ A;  2Y79 A;  1YKD A;  5F5Y A;  3QP1 A;  3EQV A;  1S66 L;  2WGV A;  3BYD A;  3BFE A;  5FA7 A;  4R38 A;  3SS3 A;  2V8C A;  3VE3 A;  1BLC A;  1DRM A;  4DDY A;  1DJC A;  3ZG8 B;  4JXV A;  2Q0O A;  1DJA A;  3WS4 A;  3HRE A;  5L10 A;  3U2A A;  3T1X A;  2X02 A;  2D01 A;  3OPR A;  3KOB A;  3EEH A;  3KO3 A;  3IS2 B;  4HP4 A;  3T1R A;  1EI5 A;  3ZFZ A;  4DE1 A;  1G68 A;  5CHM A;  4AFI A;  2JBF A;  3PBN A;  4JKT A;  1OJG A;  4S2O A;  3ZYT A;  1CJF A;  3IQA A;  2LB9 A;  3ZG9 B;  2JE5 A;  3Q1F A;  4PAU A;  2ZMF A;  2JKF A;  3T4S A;  3LR5 A;  5GLB A;  1STZ A;  4EW7 A;  1K57 C;  4GDB A;  1AXB A;  3VOY A;  3NOU C;  3T4L A;  4Y0T A;  2J9P A;  3IHA A;  5GLA A;  2XQZ A;  2Y91 A;  4MN6 A;  2WKQ A;  2ZMA A;  1LT0 A;  2EXB A;  2DCF A;  4WUJ A;  2ACG A;  5FAO A;  3NDE A;  4NXE A;  3MR0 A;  4PMA A;  1FIK A;  4WEL A;  1JWV A;  3VFH A;  3KOD A;  1WYC A;  1OTB A;  4GD8 A;  1IYP A;  1DY6 A;  3CLO A;  2W3D A;  3PAE A;  3QP6 A;  1ZHH B;  1PZO A;  2MJ6 A;  5AJG A;  3AGF A;  1SDE A;  4MBF A;  2BAS A;  3V5M A;  3VP1 A;  1MWR A;  1IFQ A;  4Q0I A;  1C3B A;  2Z6C A;  3GDI A;  1OTI A;  2JKR I;  4OOL A;  4F3L A;  1H0M A;  1YMX A;  5KIZ A;  3GVB A;  3OPL A;  1UWN X;  3WRT A;  4QY5 A;  3SOI A;  3H7W B;  1FSW A;  5U47 A;  3RJU A;  4OQG A;  2XK1 A;  1XJ4 A;  3VSK A;  2EA9 A;  3NCK A;  5GL9 A;  3A3D A;  3DW0 A;  3S7O A;  5G4Y A;  1M6K A;  2EXA A;  4FCF A;  3RTY A;  1TDG A;  4H6J A;  2LB5 A;  3G34 A;  4WYY A;  4KZ7 A;  2W1T B;  4P6Z M;  4ZBE A;  1FR6 A;  3BY9 A;  1K56 D;  4LV2 A;  3BEC A;  3Q81 A;  3D4F A;  4GZB A;  3UE3 A;  4OPR A;  2WKE A;  4WLA A;  4O8G A;  3E4O A;  4QPR A;  3NY4 A;  4S2N A;  3EEA A;  4JXW A;  3F1O A;  3HJK A;  4CLC A;  4Y13 A;  2H10 A;  3KYQ A;  5L09 A;  5A93 A;  4RVA A;  1CI8 A;  4A5R A;  3UN7 A;  2V9A A;  1XJ2 A;  1CQA A;  4HI4 A;  4GB7 A;  5TFQ A;  2WYX A;  2VEA A;  3T12 B;  1ES4 A;  2DRW A;  4XT2 A;  4DF6 A;  3ZG5 A;  3ICY A;  1AWI A;  4BWI A;  3HLC A;  4WN5 A;  1D06 A;  1BUL A;  2G2U A;  2QPN A;  3CJM A;  4GKU A;  4E3M A;  4L9F A;  4MMN A;  3UB5 P;  3QNB A;  4HJ3 A;  1OPX A;  4S2P A;  4XXR A;  4ZAM A;  4BEN A;  3EOI A;  4HBT A;  2HZ5 A;  3MXQ A;  4WEJ A;  1K54 A;  1FR1 A;  4O01 A;  1SZV A;  3LMT A;  1S4S A;  1NYY A;  4RRB A;  3HUN A;  3PXP A;  3M6B A;  3B47 A;  1F9I A;  3WWX A;  3LO7 A;  1T19 A;  2GNX A;  2VA0 A;  5F82 A;  1E4D A;  4RRF A;  2J7V A;  1PRQ A;  4ZJ1 A;  4MLL A;  2ZM8 A;  3PD4 A;  5CEC A;  3HL9 A;  4C6Y A;  5DF9 A;  3A3E A;  5E43 A;  2XRN A;  2Y2K A;  4UAA A;  1K0K A;  4LPZ A;  3GR2 A;  1JTD A;  2XRO A;  2R9W A;  1MKI A;  5DJT A;  1L0G A;  2Q9M A;  1LL8 A;  1XJ3 A;  4KZ4 A;  5EVL A;  1VET A;  1KGG A;  1WYB A;  1GHI A;  1LI0 A;  4LRZ E;  2B18 A;  4GN2 A;  5FQK A;  2A2L A;  2QZ6 A;  1MPL A;  4OVD A;  1L2S A;  3UO9 A;  5AQB A;  4GW9 A;  1SKO B;  4DE2 A;  4EWF A;  3CUE C;  4MCW A;  2VLG A;  4PKY G;  5DF7 A;  4NKP A;  1OTD A;  1T1C A;  2Y2L A;  5GHZ A;  4PKY A;  2PYR A;  3BLM A;  1NRF A;  3GTC A;  3A3F A;  5L07 A;  4BQM A;  4B9O A;  4RRC A;  4KG6 A;  4EUV A;  2Y2N A;  2HF6 A;  3FKV A;  1K4F A;  2O99 A;  2KDK A;  4QB8 A;  1N9B A;  1Y2Q A;  3NOT C;  1ODV A;  2ZQA A;  4RYE A;  5IHV A;  1MC0 A;  1FCN A;  2WKP A;  3NI9 A;  1M40 A;  2EX8 A;  4FH2 A;  2FZ0 A;  3NC8 A;  3M6H A;  4OP5 A;  2J8Y A;  2JCH A;  2ZC7 A;  1NRJ A; 
#chains in the Genus database with same CATH homology
 1TVF A;  4XUX A;  1E25 A;  1JTG A;  3UNW A;  4DRT A;  5DTS A;  1J9M A;  1LHY A;  2WGW B;  5A91 A;  3N8S A;  2WKI A;  4RRR A;  2VGJ A;  4N1X A;  5CXW A;  2EX9 A;  5CGX A;  2WAD A;  3W4O A;  4BLM A;  3KOC A;  4EV4 A;  4KZ6 A;  3ISG A;  3MKE A;  3TOI A;  3ZG0 A;  4OON A;  3G32 A;  2WZX A;  4BL3 A;  2HP9 A;  1Z6F A;  2PU2 A;  1HZO A;  2Y2G A;  2ZQ9 A;  3IF6 B;  3QHY A;  1TC5 A;  3N4I A;  3SS4 A;  3UPN A;  4EBN A;  4P0M A;  2EFU A;  5HAQ A;  4RR9 A;  2JC7 A;  2XD1 A;  1YT4 A;  4QU3 A;  1QME A;  3S22 A;  3ZVW A;  4EBP A;  2ZC6 B;  1PWD A;  3LMV A;  4KG5 A;  1K6R A;  2C5W B;  4GNU A;  1IKG A;  4N1H A;  1YLZ A;  1K57 A;  3MFD A;  4L0L A;  3IF5 A;  4JPM A;  3OPH A;  4U0X A;  1YMS A;  1KDW A;  3ZHH A;  3ZG7 B;  2ZJ9 A;  2WK0 A;  4IVI A;  3GRJ A;  3ZNT A;  5CED A;  1BTL A;  5FQJ A;  4WZ5 C;  4RRI A;  2WKH A;  3HUO A;  3UDF A;  1H5X A;  2DNS A;  3JYI A;  2Y2H A;  4QHC A;  4KZ5 A;  2B5R A;  3IH9 A;  5E2H A;  5FI2 A;  4BD1 A;  5CEB A;  3PD2 A;  3FWL A;  4OPZ A;  2UWX A;  2XGN A;  3OC2 A;  4EBL A;  5DTK A;  4F94 A;  4E3O A;  3ZDJ A;  1ESI A;  3BLS A;  1L0F A;  2OSU A;  1L0E A;  5L2F A;  3VP0 A;  4PPR A;  1IEM A;  4LEN A;  1JWP A;  4NBI A;  4KQQ A;  4JF4 A;  1RGZ A;  4S2N C;  2ZC4 B;  2HP6 A;  2XFS A;  1VM1 A;  4C75 A;  4DXC A;  2FFF B;  3Q82 A;  2IWD A;  5M19 A;  3WS0 A;  3KO7 A;  3VSL A;  3ZVT A;  1XGI A;  4LV1 A;  1W5D A;  3MZF A;  2ZQC A;  1MY8 A;  1NY0 A;  5EUA A;  3GSG A;  3ITA A;  4JF6 A;  4S0J A;  1SKF A;  1IEL A;  3DWZ A;  4O7D A;  4UA9 A;  5FSR A;  2OV5 A;  4S2L A;  2WAE A;  5FAS A;  3EQV A;  5EVI C;  1KVL A;  4X53 A;  2WGV A;  3FV7 A;  3BYD A;  4QD4 A;  1CI9 A;  3BFE A;  5FA7 A;  1K56 A;  2HDU A;  4OLD A;  3SS3 A;  5CTM A;  3A3J A;  3HBR A;  4R4S A;  3CG5 A;  1BLC A;  4KZA A;  5JYO A;  3G30 A;  1FQG A;  1G6A A;  4ZJ2 A;  3Q7V A;  3UDI A;  1DJC A;  2HDR A;  1I2W A;  1MWT A;  4JXG A;  3ZG8 B;  4JXV A;  4DDY A;  1VQQ A;  5HW3 A;  2HL0 A;  4NBJ A;  1DJA A;  1LLB A;  3WS4 A;  1ONH A;  3HRE A;  3ZGA B;  4ZTK A;  2X02 A;  5I94 A;  4OQI A;  3E2K A;  4IBX A;  3IXD A;  3OPR A;  4X6T A;  3KOB A;  3BFD A;  3PD3 A;  1O07 A;  3N7W A;  3KO3 A;  1JVJ A;  4WMC A;  4R3J A;  1EI5 A;  3N6I A;  2H5S A;  3ZFZ A;  1K6S A;  2G2W A;  1TDL A;  3BM6 A;  3W8K A;  4DE1 A;  1G68 A;  2OKV A;  1K54 C;  4RRJ A;  1DJB A;  4R0Q A;  5CHM A;  1XP4 A;  1KDS A;  4K0W A;  4OQH A;  4R4R A;  2JBF A;  4Y0U A;  3G35 A;  3PBN A;  4JKT A;  1SDN A;  1K55 C;  4S2O A;  3A3I A;  5FAP A;  5F83 A;  3IQA A;  1KE4 A;  1YQS A;  5HAP A;  1ZC2 A;  5EVI B;  3ZG9 B;  2JE5 A;  4LV3 A;  5DF8 A;  4DXB A;  3Q1F A;  4Z9Q A;  5FI6 A;  3G31 A;  1HVB A;  4E6X A;  4OH0 A;  2WGI A;  4LV0 A;  3P98 A;  4KG2 A;  5GLB A;  3KO9 A;  2XD5 A;  4R23 A;  3KNP A;  1XGJ A;  3P09 A;  3DTM A;  1JKE A;  1K57 C;  3OZH A;  1RGY A;  4GDB A;  3G2Y A;  1AXB A;  3VOY A;  4IVK A;  3FZC A;  4E3K A;  4QY6 A;  3UE1 A;  1I5Q A;  4HBU A;  4Y0T A;  1NXY A;  5M18 A;  1J7G A;  1SCW A;  2J9P A;  3IHA A;  3Q07 A;  3M2J A;  5GLC A;  4KZ8 A;  5GLA A;  3WS5 A;  1ERO A;  5A92 A;  4Y0O A;  5BOH A;  3N8L A;  2XQZ A;  2Y91 A;  3LCE A;  1PW8 A;  2H0T A;  2ZMA A;  2OLU A;  1ERM A;  2EXB A;  2RL3 A;  5J8X A;  2DCF A;  2WGW A;  5DVA A;  3ZCZ A;  4RR7 A;  2V20 A;  5FAO A;  3NDE A;  2IWB A;  5GLD A;  5CRF A;  1CK3 A;  1MWU A;  4PMA A;  4EQI A;  3QNC A;  4WEL A;  4R3B A;  1JWV A;  3CZD A;  3VFH A;  3KOD A;  1WYC A;  3G4P A;  4P87 A;  1BLH A;  3DWK A;  4GD8 A;  1IYP A;  1DY6 A;  2Z2L B;  3M2K A;  3IF6 A;  1PW1 A;  1ZKJ A;  2FFY A;  5E2F A;  3PAE A;  3VFF A;  4KZ9 A;  5CGS A;  3NDG A;  1PZO A;  4E3N A;  3C7V A;  3AGF A;  1SDE A;  4S2K A;  3IH8 A;  4JXS A;  4MBF A;  1RP5 A;  2Y59 A;  3E2L A;  4N9L A;  1LL9 A;  4JLF A;  2RCX A;  3N8R A;  3V5M A;  3ZNY A;  3LY3 A;  3UE0 A;  3UDX A;  1BT5 A;  3VP1 A;  3LMU A;  1MWR A;  1FCM A;  1OME A;  4B4X A;  4RRM A;  3V3R A;  1C3B A;  4RRK A;  3S4X A;  5FQI A;  4S03 A;  3V39 A;  4RA7 A;  1PI5 A;  2E8I A;  4E3L A;  4OOL A;  4ZDX A;  4PM6 A;  1YMX A;  2XH9 A;  3OCL A;  3GVB A;  4MEZ A;  3OPL A;  2Y55 A;  2PBY A;  5FAT A;  4RRG A;  1FSY A;  2C6W B;  3WRT A;  4QY5 A;  3SOI A;  5EEC A;  5GHX A;  1FSW A;  5U47 A;  3LEZ A;  1ZG6 A;  3RJU A;  5KMW A;  3SH7 A;  4BJP A;  4OQG A;  3RXX A;  3BRM A;  2XK1 A;  3VSK A;  3B3X A;  4S0I A;  1YLT A;  3HLW A;  5EOO A;  1H8Y A;  3MBZ A;  3NCK A;  2BLS A;  4PM8 A;  1XKZ A;  3BFF A;  3HLF A;  5GL9 A;  5HAI A;  3IXG A;  3A3D A;  2Y2M A;  3DW0 A;  1S0W A;  3VOZ A;  5KZH A;  1M6K A;  1YLJ A;  4OPY A;  3EQU A;  1PWC A;  5KSH A;  1ERQ A;  2EXA A;  4GD6 A;  3PBS A;  3MKF A;  3FYZ A;  4FCF A;  4OOY A;  1CEF A;  4FSF A;  2XDM A;  5HAR A;  1Q2Q A;  1TDG A;  4C3Q A;  1NZO A;  3NBL A;  1MBL A;  3G34 A;  2WUQ A;  3OPP A;  2Y2Q A;  4WYY A;  1YM1 A;  4KZ7 A;  3IWI A;  4OOM A;  5FI7 A;  1QMF A;  5F1G A;  3ITB A;  1KE3 A;  4NK3 A;  3BFC A;  3C4P A;  1YLP A;  4RX3 A;  2Q9N A;  4ZBE A;  1E3U A;  3UPP A;  4E3I A;  1FR6 A;  1NYM A;  2ZM2 A;  4K91 A;  4KZB A;  1KVM A;  2P9V B;  4QJG A;  1K56 D;  3Q7V B;  3HUM A;  4LV2 A;  3BEC A;  3W4Q A;  4RRL A;  3LY4 A;  2P74 A;  4IED A;  3Q81 A;  1GHP A;  1RCJ A;  3D4F A;  4GZB A;  4MBH A;  4OPR A;  3UE3 A;  2WKE A;  3OCN A;  1XPB A;  3NY4 A;  2Y2O A;  4S2N A;  4JXW A;  4RR6 A;  2J9O A;  1PZP A;  3C7U A;  1GHM A;  1YLY A;  3PBO A;  4IBR A;  2H10 A;  4OLG A;  4WMC D;  2XF3 A;  3TSG A;  3VP2 A;  5A93 A;  2EFX A;  4RVA A;  1CI8 A;  2ZQ8 A;  4A5R A;  3UPO A;  1IYQ A;  4GOG A;  3UN7 A;  5AQ7 A;  2BG1 A;  1ALQ A;  5JYP A;  2WZZ A;  3BEB A;  2WYX A;  2Y2I A;  3BFG A;  4GB7 A;  5G18 A;  3O3V A;  5TFQ A;  4D2O A;  5HL1 A;  4PM9 A;  5FQM A;  2A49 A;  1ES4 A;  2DRW A;  3PBQ A;  4DF6 A;  4FH4 A;  4RRH A;  5EVI A;  3PBT A;  3V50 A;  3ZG5 A;  4BL2 A;  4BD0 A;  2ZM0 A;  2IWC A;  1ES5 A;  5HFO A;  3W4P A;  4DE3 A;  3PD5 A;  4CJN A;  4X56 A;  5FAQ A;  4E6W A;  3HLC A;  4HEF A;  3O87 A;  2QPN A;  1BUL A;  1ES2 A;  2G2U A;  3CJM A;  4GKU A;  4MBK A;  4WZ4 A;  5AQA A;  1ESU A;  3TG9 A;  1W8Q A;  4E3M A;  5TR7 A;  3PAG A;  4U3T A;  4N92 A;  4S02 A;  2HKZ A;  2X71 A;  1XX2 A;  5HX9 A;  3FKW A;  3IWQ A;  3QNB A;  4S0L A;  3IT9 A;  3I7J A;  1HD8 A;  4LCL A;  3CMZ A;  4S2P A;  4XXR A;  4KQR A;  3SH9 A;  1JWZ A;  1PYY A;  4ZAM A;  3VMA A;  2XEP A;  3MZE A;  4BEN A;  1NJ4 A;  2Y2J A;  4HBT A;  2HDQ A;  4WEJ A;  1GCE A;  1K54 A;  1FR1 A;  3LMT A;  4YFM A;  2I72 A;  4R1G A;  2XFT A;  3S1Y A;  1EWZ A;  4RR8 A;  1KE0 A;  1KGF A;  1W79 A;  1NYY A;  2ZQ7 A;  1H8Z A;  1K55 A;  3GMW A;  4RRB A;  1MXO A;  4Y7P A;  3HUN A;  2HL2 A;  1W7F A;  2XLN A;  1GA9 A;  5FDH A;  3M6B A;  3WWX A;  4RRD A;  3NIA A;  4JBF A;  3Q7Z A;  1ONG A;  3IXH A;  3LO7 A;  2ZC5 B;  3HLB A;  4KQO A;  4NET A;  4OPQ A;  2X01 A;  3V3S A;  4UHU A;  4OKP A;  4PM5 A;  4RRQ A;  1K25 A;  2HP5 A;  1K38 A;  5F82 A;  1E4D A;  4RRF A;  2J7V A;  2R9X A;  4FD8 A;  4ID4 A;  1ES3 A;  2ZC3 B;  4ZJ1 A;  2XR0 A;  4MLL A;  2ZM8 A;  3PD4 A;  2ZLY A;  1Q2P A;  4HES A;  5CEC A;  4CPK A;  5E2G A;  1XA1 A;  3HL9 A;  3HLG A;  4C6Y A;  5EE8 A;  5DF9 A;  1PI4 A;  3A3E A;  4DDS A;  1BUE A;  2OLV A;  5E43 A;  5F1F A;  2Y2K A;  4UAA A;  5FQ9 A;  4PM7 A;  2Z2M B;  3GR2 A;  4WEK A;  1JTD A;  2Y2P A;  5CHJ A;  1IYS A;  2R9W A;  1MKI A;  4YIN A;  3C4O A;  2Y4A A;  1L0G A;  1W8Y A;  3WS2 A;  3KO5 A;  3KNF A;  1NZU A;  2Q9M A;  1L0D A;  3MXR A;  4OP8 A;  4B88 A;  4KZ4 A;  3RXW A;  4KZ3 A;  2ZQD A;  5EVL A;  3UY6 A;  5E2E A;  1KGG A;  1WYB A;  1BLS A;  1GHI A;  1LI0 A;  4LCM A;  4E3J A;  1S6R A;  4UA7 A;  2GDN A;  1GA0 A;  1Y54 A;  5AQ9 A;  4GN2 A;  4XUZ A;  3VP4 A;  4EUZ A;  5FQK A;  5CER A;  4Q8I A;  2QZ6 A;  1IKI A;  1MPL A;  2HPB A;  4P85 A;  4RX2 A;  4OVD A;  1L2S A;  1LI9 A;  3UO9 A;  4WZ5 A;  2CC1 A;  1XA7 A;  3G2Z A;  3HVF A;  5AQB A;  3O86 A;  1LL5 A;  3IWO A;  3PBR A;  4KEN B;  4S2I A;  5CTN A;  4DE2 A;  4EWF A;  3PTE A;  1CEG A;  2VGK A;  3O88 A;  5CHU A;  1SHV A;  2EX2 A;  5DF7 A;  1O7E A;  2Y2L A;  2A3U A;  5GHZ A;  3WS1 A;  4P6B A;  1MWS A;  4N9K A;  5KSC A;  2DBO A;  3MZD A;  1WE4 A;  4X68 A;  3BLM A;  3GTC A;  1NRF A;  2EX6 A;  1E3U D;  2P9V A;  3A3F A;  4GDN A;  4K0X A;  4S2M A;  2V1Z A;  4MNR A;  4BQM A;  2H0Y A;  5GHY A;  1PIO A;  3KO4 A;  4U0T A;  4RRC A;  1U60 A;  4S0K A;  1N4O A;  4KG6 A;  5D3O A;  2Y2N A;  3WRZ A;  4X55 A;  3VP3 A;  3FKV A;  4S2J A;  4WBG A;  1K4F A;  1HTZ A;  4WM9 A;  2QMI A;  3AGD A;  4QB8 A;  1PWG A;  1FOF A;  3C5A A;  1I2S A;  1N9B A;  1Y2Q A;  3HLD A;  4JF5 A;  3IHB A;  3HLE A;  3IF6 C;  2V2F F;  5J61 A;  3SH8 A;  1IYO A;  4H8R A;  2HL1 A;  2ZQA A;  4RYE A;  5TGF A;  5IHV A;  1BSG A;  2HDS A;  4DE0 A;  1XXM A;  1FCN A;  1BZA A;  3AGE A;  5CGW A;  4ZJ3 A;  4RRA A;  1K4E A;  3SS5 A;  5FQQ A;  3IXB A;  3NI9 A;  4OQ0 A;  5EPH A;  4X69 A;  3MXS A;  1FCO A;  1M40 A;  2EX8 A;  3GV9 A;  4FH2 A;  1YLW A;  1BLP A;  5EVI D;  5M1A A;  1TEM A;  3NC8 A;  5A90 A;  3M6H A;  3GQZ A;  4B4Z A;  4UA6 A;  1KGE A;  1ZG4 A;  2ZD8 A;  4OP5 A;  4DKI A;  2J8Y A;  5EOE A;  2JCH A;  2PU4 A;  2WAF A;  4M3K A;  2ZC7 A;  5DTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...