3V39A

Bd3459, a predatory peptidoglycan endopeptidase from bdellovibrio bacteriovorus
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
402
structure length
402
Chain Sequence
MKVYLNSMCHMAANSKTQQIQGDDNKDDKFPLASISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLAEEKPMIGGTTPKYDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D-alanyl-D-alanine carboxypeptidase
publication title Specialized peptidoglycan hydrolases sculpt the intra-bacterial niche of predatory Bdellovibrio and increase population fitness.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
total genus 139
structure length 402
sequence length 402
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v39A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 3v39A02
5CHUA 4HBTA 4GD6A 4B4ZA 1PI4A 5DF8A 1NXYA 3IF5A 3MZDA 3OZHA 5EOEA 1FCNA 2Z2MB 4WBGA 3ZDJA 1FCOA 5HL1A 1W5DA 2Y55A 5FDHA 1RGYA 1FR1A 3FV7A 1ES2A 4LV2A 2X01A 3A3JA 4N92A 2A3UA 2H5SA 2XD5A 3BEBA 5DTSA 3N8LA 1YLJA 4UA9A 4OOLA 5GHYA 1WYBA 5AQ7A 4C6YA 4KZBA 2Y2LA 1G6AA 1KGEA 4GDBA 1JTDA 4ZTKA 4GZBA 5GL9A 3HUOA 5HW3A 4WYYA 4GNUA 3LY4A 3CJMA 3S22A 1PZPA 5M18A 3G4PA 4S2KA 1E3UD 1ES3A 1I2WA 2Y2PA 3OPRA 4K0WA 4PM7A 5FQ9A 5EVLA 2OLUA 2ZC4B 1KGGA 3O87A 1TDGA 1Z6FA 1FCMA 3HVFA 4QY6A 2ZM8A 4S2NA 3UY6A 3HBRA 2XFSA 4OPZA 4R23A 3G30A 5DF7A 2JC7A 4PM6A 2XQZA 2OLVA 5EVIB 3HLGA 4PM9A 3NC8A 4LV3A 4PM5A 3E2KA 4BD1A 1KVLA 2WADA 5FA7A 2FFFB 4P87A 2A49A 4N9LA 1Y54A 4KZ7A 4K0XA 4KZ4A 1LI0A 5EE8A 1SKFA 5JYPA 1KE4A 4QD4A 5TGFA 4ZDXA 3UO9A 1ALQA 3W8KA 2G2WA 2DCFA 1DJCA 2IWCA 4S2OA 3ZNTA 3B3XA 3PBNA 4N9KA 1JWVA 5FQIA 1LHYA 2Y2OA 1N4OA 1YM1A 3HLDA 1K57A 1KE3A 1PIOA 4KZ6A 1CI8A 3S1YA 4QY5A 3PBOA 1XGJA 2XK1A 1YLYA 4DF6A 5KSCA 4ZJ1A 3TG9A 3TOIA 1GCEA 1MPLA 4P0MA 3V50A 2HDRA 4C3QA 5M19A 4LCLA 4R3JA 1JWPA 1YLTA 5HX9A 4JF6A 4OP8A 3A3DA 3PBSA 5EOOA 2HDQA 1L0FA 5G18A 1PW1A 2Y59A 3IT9A 3MKEA 2B5RA 3IQAA 4OOYA 4JBFA 3ZG0A 4O7DA 3NCKA 1K4EA 3NBLA 3E2LA 2QZ6A 4MBHA 3RXWA 3FKVA 4WEKA 4Q8IA 3AGFA 2ZM0A 1W8QA 3HLCA 4S2NC 5E2EA 4DXBA 2WK0A 1M6KA 2EX8A 4X56A 2GDNA 2C5WB 3DW0A 4R4SA 2Z2LB 2XEPA 3SH8A 4GN2A 1YMXA 1TEMA 3BFCA 4X55A 1PWDA 3BRMA 5FQQA 1ZC2A 1HTZA 2EXBA 4X68A 4NK3A 4KENB 1WYCA 2OSUA 3O3VA 2WAEA 4EV4A 1S6RA 2ZC5B 2X02A 2ZQ7A 4OPRA 1MWTA 4K91A 3NDEA 1XKZA 2ZQCA 1DJBA 1ESUA 4S2PA 1JTGA 4S2LA 1J9MA 4UA7A 4GKUA 4CPKA 1IYQA 2Q9NA 5TFQA 3BLSA 2XLNA 3IXHA 4JF5A 4OLDA 3VSKA 5CERA 4FSFA 5HARA 4FD8A 1ES4A 1NZUA 3D4FA 4OOMA 1LI9A 3MFDA 5GLAA 4OQIA 4OKPA 4KZ3A 3FYZA 3N8RA 3W4QA 1XA1A 4DE3A 4EBNA 1IELA 1K57C 4E3LA 3QNCA 5AQAA 4IBRA 3SH7A 2ZC3B 5A90A 1ZG6A 3PBRA 3UN7A 1FSWA 3QNBA 2QPNA 4KZ8A 4MEZA 5F1GA 2Y91A 5J8XA 5DTKA 1YT4A 2ZM2A 3NIAA 5EUAA 4QU3A 1YLPA 3BFEA 3IF6A 1K55A 3CZDA 3IXBA 3SOIA 3IXGA 3G2ZA 2WGVA 1EROA 3NDGA 4WMCD 1L0EA 4DDYA 4E3JA 1TVFA 2EFUA 4JF4A 5FI7A 3ZG7B 5CHJA 2PU2A 3Q1FA 3O88A 5TR7A 1K54A 3UE3A 3W4PA 2ZQAA 1VM1A 2XR0A 2Y2NA 3Q07A 5EVID 4YINA 1I2SA 2XFTA 3N8SA 4KG5A 1CEGA 4RVAA 1NY0A 3LO7A 2VGKA 4WELA 2HDUA 3G31A 1K6RA 2ZLYA 3OPLA 3ZG5A 3DWKA 1MY8A 2WUQA 3N4IA 4DE1A 4MNRA 1ONHA 3OCLA 2WGWB 2H0TA 2Y2HA 2QMIA 5HAQA 1LL9A 4D2OA 3MZEA 3FWLA 3S4XA 3ITBA 4R4RA 4RYEA 1NRFA 1XXMA 4ZJ2A 4BL3A 1JVJA 2HDSA 4JXSA 4U3TA 5FQMA 2HP5A 3ZHHA 3IWQA 4IEDA 3IH8A 1H8YA 5M1AA 3GV9A 3RXXA 3VP0A 3GMWA 2ZC6B 5GLDA 3VMAA 2J9PA 3G2YA 3Q7VB 4X53A 3W4OA 5CTNA 1XPBA 1K38A 3ZCZA 4WMCA 1FOFA 5HFOA 5DTTA 5EECA 1QMEA 4BJPA 1Q2QA 4UAAA 1YLWA 4R1GA 5E2FA 3VOYA 1BLSA 1K6SA 4OH0A 4XUZA 4H8RA 4KZ5A 5EVIA 2HPBA 1AXBA 1K56D 3LCEA 3TSGA 5D3OA 3A3IA 3BFGA 4FCFA 3PAGA 5DF9A 3Q82A 3RJUA 3WS0A 3WWXA 4XUXA 2WKIA 3VSLA 1DJAA 3EQVA 3IF6C 4A5RA 1K55C 2ZMAA 4MBFA 3VP3A 1NZOA 2J8YA 5FSRA 1IYOA 1MWRA 1YLZA 3V39A 3ZFZA 1XX2A 1TDLA 5F82A 5CTMA 5FAPA 1BZAA 2J7VA 4NETA 4OPYA 1K54C 3M6BA 3BLMA 3VFFA 4OQGA 1PWCA 3C7UA 4JXWA 2OV5A 1SDNA 3M2JA 2V2FF 3HUNA 5CHMA 1NJ4A 2EXAA 2H0YA 4ZJ3A 2VGJA 1ERQA 4JKTA 5F83A 1MBLA 3ITAA 1XP4A 1SDEA 2ZC7A 3UDIA 3PAEA 4LV0A 1I5QA 1W7FA 3ZVTA 4E3IA 2Y2QA 4KQQA 3BFFA 3HREA 2WZXA 1MWUA 3DTMA 1NYYA 2IWBA 4E3MA 1BLCA 5E43A 1K56A 3WS4A 2H10A 3PBQA 4HEFA 5A92A 1GHMA 3C7VA 3WS2A 5KMWA 3IHBA 3IWOA 1MWSA 5F1FA 4B88A 2XH9A 4U0TA 3LY3A 1CK3A 1PWGA 4KG2A 1MXOA 3UPPA 3C5AA 3N6IA 1RCJA 4GOGA 2P9VB 1O7EA 4S2MA 3JYIA 4DDSA 3OPHA 3WRTA 2ZQ9A 3M6HA 2PBYA 2WGIA 4X6TA 3C4PA 4JLFA 4OVDA 5EVIC 4JXGA 3VFHA 4RX2A 2XF3A 2XGNA 1BLPA 4F94A 2WKEA 2XD1A 1YMSA 2BG1A 3HLWA 4S2JA 3N7WA 5EPHA 1H8ZA 1VQQA 2E8IA 3CG5A 5FAOA 1BSGA 3OC2A 1FR6A 3SS4A 4GB7A 1PYYA 3ZVWA 1LLBA 1GHPA 3G34A 2HP6A 1YQSA 1L0DA 3FKWA 5AQ9A 1EWZA 1FSYA 1H5XA 4HBUA 3BFDA 5GHXA 4HESA 1BUEA 2DRWA 3AGEA 1E4DA 4Y7PA 1S0WA 1CI9A 5FQJA 3NY4A 4PM8A 2RCXA 4KG6A 3G32A 2JBFA 1BTLA 2DNSA 4QHCA 3OPPA 4R3BA 3VP2A 4GDNA 1KDWA 1KGFA 5CEBA 5FASA 1EI5A 4OONA 4S2IA 3DWZA 1GA9A 4U0XA 4P85A 3ZG9B 5FQKA 4E6XA 4EUZA 2V20A 1NYMA 3A3FA 3MKFA 4IBXA 2WYXA 1IEMA 3BYDA 4IVKA 2WKHA 2ZQDA 2WZZA 4E3OA 1N9BA 4FH2A 4E3KA 4QB8A 3ISGA 3QHYA 4PMAA 1SHVA 4B4XA 1HZOA 3V3RA 3IH9A 3GQZA 1GA0A 1K4FA 5CRFA 4BENA 1G68A 1ONGA 4PPRA 3WRZA 2WAFA 4FH4A 3ZG8B 3ZNYA 4N1HA 4EWFA 1ZG4A 5KSHA 2G2UA 2EX9A 4WZ5A 3SS5A 2CC1A 5GLCA 1ERMA 3BECA 2Y2IA 3UDXA 3IXDA 3SS3A 1BULA 1RP5A 5E2GA 2UWXA 1ES5A 2Y2GA 3LEZA 4EQIA 1SCWA 5I94A 1FQGA 4OPQA 1HD8A 1XA7A 1MKIA 3NI9A 4MLLA 3WS1A 1K25A 1OMEA 2C6WB 2WGWA 4ZBEA 3WS5A 3MXSA 4BLMA 1PZOA 5L2FA 4EBPA 2IWDA 4KZAA 4MBKA 5U47A 1WE4A 3UPNA 4DE0A 4OQHA 3MBZA 1IYPA 2J9OA 3VP1A 1BLHA 1RGZA 4JPMA 1M40A 5IHVA 2JE5A 1KE0A 3Q7VA 3HUMA 4WZ4A 2ZJ9A 2XDMA 2Q9MA 3Q7ZA 4P6BA 4N1XA 4DKIA 5GLBA 4WM9A 3ZGAB 2EX2A 3I7JA 4L0LA 2I72A 4DXCA 4KQOA 1L0GA 3AGDA 1GHIA 1W79A 3A3EA 1PI5A 3GR2A 3OCNA 3GSGA 4GD8A 3CMZA 3PTEA 4Y0TA 3SH9A 2P74A 4BQMA 1E3UA 3VP4A 4E3NA 1U60A 2FFYA 2PU4A 3HLFA 3IWIA 1ZKJA 4IVIA 5FAQA 3UNWA 4EBLA 5JYOA 5FI2A 5A91A 4Y0UA 2X71A 5CGSA 2Y2MA 4LCMA 4RA7A 3VOZA 4C75A 4DE2A 4YFMA 2RL3A 2ZD8A 1BT5A 4LV1A 2ZQ8A 2R9WA 5CGWA 4BL2A 3GVBA 1Q2PA 1PW8A 5HAIA 2R9XA 1HVBA 4ZAMA 1ESIA 4QJGA 1KDSA 3MZFA 4WZ5C 1O07A 1IKGA 4X69A 4ID4A 5E2HA 4M3KA 4OLGA 5DVAA 4LENA 1L2SA 3G35A 5FATA 4R0QA 5CXWA 2BLSA 5GHZA 4E6WA 4JXVA 2EFXA 4UHUA 1IKIA 3O86A 4DRTA 5KZHA 4WEJA 4OP5A 3HLEA 2Y4AA 3HL9A 1W8YA 1E25A 2HP9A 4UA6A 5FI6A 1IYSA 3HLBA 3UE0A 3V5MA 4Z9QA 1QMFA 1DY6A 1C3BA 5A93A 3P98A 4OQ0A 3Q81A 5HAPA 3EQUA 1XGIA 4XXRA 5CGXA 5AQBA 1LL5A 1JWZA 3GRJA 3MXRA 4KQRA 3PBTA 4Y0OA 3M2KA 3C4OA 3UE1A 3FZCA 3IHAA 2V1ZA 3IF6B 4RX3A 3UDFA 5CECA 2JCHA 5CEDA 2Y2KA 3BM6A 4CJNA 2P9VA 5BOHA 3UPOA 4BD0A 2Y2JA 1KVMA 3V3SA 3P09A 2EX6A 4KZ9A 3GTCA 1CEFA
chains in the Genus database with same CATH superfamily
5CHUA 4HOIA 5DF8A 1NXYA 4IHQA 3MR0A 3IF5A 3T1RA 2Z2MB 4WBGA 4EXOA 5FDHA 1RGYA 1UWNX 2X01A 3U2AA 4S0KA 5F68A 1WYBA 3KSIA 4O01A 2Y2LA 1G6AA 1KGEA 4EEPA 4ZTKA 5GL9A 3LY4A 5DKKA 1PZPA 4Q0HA 3KODA 3OPRA 4PM7A 4NBIA 5HL6A 3RH8B 4M4XA 3UY6A 3HBRA 2BTFP 3G30A 4L9GA 5TJJA 2OLVA 4BBVA 3HLGA 3NC8A 3LIFA 3E2KA 4BD1A 1KVLA 2WADA 3KSHA 1Y28A 4O8GA 4P87A 1OTIA 1Y54A 4X25A 3C30A 5EE8A 1SKFA 5JYPA 1KE4A 5TGFA 4ZDXA 3UO9A 4ZRRA 2B18A 4S2OA 4CLCC 3EGXC 5FQIA 1LHYA 2Y2OA 3HJKA 1YM1A 1K57A 4KZ6A 3KYEA 3PBOA 3LMTA 2HDRA 3CI6A 4G3KA 2B5RA 3IQAA 5L8MA 3LUQA 4RRHA 3NBLA 3E2LA 4WUJA 3FKVA 3R4KA 4DXBA 2WK0A 2EX8A 4DJ3A 4RQ9A 2HL1A 3DW0A 2Z2LB 1JNUA 2O9CA 4RRIA 2ZBBA 4NK3A 2OSUA 3O3VA 3VOLA 4RRKA 2ZQ7A 4K91A 1JTGA 4R70A 4UA7A 1IYQA 3NOTC 4OLDA 1ES4A 3MFXA 2PDRA 3MFDA 4OKPA 3T1QB 4RRJA 3N8RA 2INWA 4DE3A 4MN5A 1IELA 4EBNA 3QNCA 4IBRA 1ZG6A 3PBRA 4AFIA 3UN7A 5J7EA 1FSWA 3QNBA 5DTKA 4PKYA 1YT4A 4PHTA 3NIAA 3T12B 5EUAA 1Y4OA 3BFEA 3SOIA 3BW6A 3IXGA 1ZHHB 2V0WA 1PRQA 4E3JA 2EFUA 5MC7A 2I9VA 3T50A 3R7WA 5EVID 1I2SA 1CEGA 4QWOA 4HJ4A 4ME4A 1K6RA 1F9IA 2PR6A 3EWKA 4DE1A 4Y13A 1ONHA 3OCLA 4YNRA 4RYEA 4ZJ2A 4BL3A 4I5SA 4JXSA 2JKTM 3CPTB 2G7UA 3ZHHA 3G2YA 3ZCZA 4WMCA 3T1SA 5DTTA 1Q2QA 4UEYA 4ETXA 4UAAA 1YLWA 3V67A 4RRCA 4R3AA 5D3OA 3ICYA 4FCFA 3EQVA 3IF6C 4A5RA 2ZMAA 2J8YA 1MWRA 1YLZA 3V39A 3ZFZA 1TDLA 3F1OB 1GSXA 1K54C 3M6BA 3NECA 5DKLA 4JXWA 2OV5A 2VA0A 3F1NA 1ERQA 1S1YA 4JKTA 2HKZA 1V9YA 3E4PA 3KNPA 4GS9A 4LV0A 2ZOIA 4EU0A 1TS8A 4PAUA 1BLCA 5E43A 1K56A 3WS4A 3ZQ5A 1GHMA 3C7VA 1MWSA 2XH9A 1PWGA 1MXOA 2A2LA 3C5AA 3N6IA 5EFWA 1O7EA 2JHEA 2ZL1B 5AJGA 4X6TA 4F94A 1YMSA 3HLWA 3N7WA 3GDIA 2E8IA 3OC2A 2OAQ1 1PYYA 3ZVWA 1LLBA 4F3LB 1GHPA 2HP6A 1LSWA 2B95A 4HIAA 1S4RA 3ZYTA 4QHCA 3OPPA 1VHMA 3VP2A 1KDWA 1KGFA 3DWZA 4BBUA 4EUZA 3A3FA 3MKFA 2OWJA 3QHYA 1SHVA 1HZOA 1GA0A 4BENA 4EWFA 3ZNYA 4BMWA 3BECA 3SS3A 5E2GA 2YKHA 2Y2GA 4EQIA 5HSQA 4OPQA 2OOLA 3NI9A 3WS1A 2V1BA 3MXSA 4BLMA 2IWDA 5U47A 2J9OA 1BLHA 2FH5A 5IHVA 1F98A 2JE5A 3KYZA 2ZJ9A 4P6BA 4N1XA 1TC5A 3ZGAB 1TD5A 2HZ5A 4DXCA 4CQHA 4KQOA 1L0GA 1VEUA 1GHIA 1W79A 4GD8A 2L4RA 3PTEA 5HWTA 3HLFA 2PU4A 3IWIA 3IS2A 5FAQA 2EA9A 1IOUA 5A91A 3LR0A 4Y0UA 3D9YA 5CGSA 2Y2MA 4LCMA 4RA7A 4C75A 2YKFA 4DE2A 4YFMA 2ZQ8A 2HJEA 1Q2PA 1J7GA 1LSXA 5L07A 4B93A 3FPWA 4QPRA 1O07A 1IKGA 4CLCD 4HH3A 4JXVA 4UHUA 1IKIA 1T19A 2L0WA 4GW9A 4WEJA 4OP5A 3HLEA 2KLIA 4Z9QA 4OQ0A 4ETZA 3H7WB 3EQUA 3DAVA 3GRJA 4Y0OA 3C4OA 3FPVA 2QHKA 3EOIA 1A0KA 2P9VA 1LL8A 5KIZA 3GTCA 5J61A 4H6JB 3IX8A 4HBTA 2LB9A 2VK3A 1PI4A 3O5YA 2W3FA 2Z6DA 3MZDA 5EOEA 3ZDJA 3H7WA 5HL1A 4LV2A 4N92A 5HPFA 1KOUA 4IUHA 5GHYA 2HJ9C 4C6YA 3K2NA 2XRNA 4GDBA 1JTDA 4WYYA 2VZWA 5M18A 1E3UD 2QJ5A 5LBRA 4HY8A 2V0UA 4QY6A 4S03A 4OPZA 4R23A 5EVIB 4GHIA 4LV3A 4PM5A 3T4LA 1S4SA 4JGPA 1FIKA 5FA7A 5TBMB 4N9LA 4JGOA 3C2WA 4KZ4A 2AVXA 4QD4A 1ALQA 1MC0A 3PBNA 1JWVA 1KE3A 3S1YA 4QY5A 3UB9A 1XGJA 1YLYA 2A24A 3F1PA 3TG9A 1GCEA 5M19A 4LCLA 4R3JA 3E0YA 5HX9A 4RRBA 4OP8A 1L3LA 2HV1A 3LIEA 1P9WA 3MKEA 1W63Q 4OOYA 3GECA 3ZG0A 1K4EA 3LGOA 4X56A 2C5WB 3SH8A 1TEMA 3BFCA 3LR4A 4X55A 3BRMA 5FQQA 1OTAA 2X02A 4Z1WA 1YSQA 2ZQCA 4I3AA 3S7PA 4EETB 2Q9NA 2W3HA 3VSKA 5CERA 4FSFA 1NZUA 1LI9A 4OQIA 1XA1A 3PR6A 4E3LA 3MJQA 1K57C 1F5MA 3SH7A 2ZC3B 3T4QA 3UE6A 2QPNA 2EWVA 3C8CA 2GX5A 2KDKA 5EM0A 2NUTC 3IXBA 4RRGA 2W1TB 1TVFA 2OWHA 5TR7A 3Q07A 1Z09A 2XFTA 1G6OA 4RVAA 2VJWA 2HDUA 3G31A 2ZLYA 4EW7A 4MDZA 3ZG5A 1UGUA 3DWKA 4S02A 1MY8A 1BYWA 2WGWB 1ODVA 3UB6A 3ITBA 4R4RA 1NRFA 1JVJA 2HDSA 5FQMA 2HP5A 4IEDA 3IH8A 1H8YA 2ZC6B 5GLDA 3Q7VB 3B33A 4HP4A 2QYBA 4LGWA 1QMEA 4CLCE 3PYPA 1K6SA 2P08A 2D01A 3TSGA 3KO5A 3PAGA 5DF9A 4ARZB 3WS0A 3WWXA 3KSGA 1YKDA 1XX2A 5IU1A 5CTMA 1BZAA 4OPYA 4OQGA 3UMEA 3M2JA 2V2FF 3HUNA 5CHMA 3LMUA 1NJ4A 2JKTI 4ZJ3A 4ARZA 1MBLA 4NEED 1VETB 2ZMFA 3LMVA 2W3GA 2ZC7A 3UDIA 3S7OA 3PAEA 2K31A 3ZVTA 4E3IA 1XJ4A 2Y2QA 4KQQA 1OTBA 1G5UA 2WZXA 1MWUA 1H8MA 2H10A 3PBQA 2CMNA 4U0TA 3UB7A 3UPPA 2D02A 3VE3A 2WGIA 3C4PA 3DBAA 3VFHA 4RX2A 2JKGA 3FC7A 4HQAA 4CLCB 1VQQA 3CG5A 4GB7A 3G34A 4BBTA 1YQSA 3FKWA 5AQ9A 1FSYA 2J3TC 3BFDA 5GHXA 1BUEA 2DRWA 3AGEA 4DN0A 4Y7PA 1CI9A 3NY4A 4PM8A 2RCXA 3UMDA 2JBFA 2ACGA 3PD4A 2VX8A 3LFVA 4GDNA 5FASA 1S66L 4OONA 4R6LA 1GA9A 4P85A 3ZG9B 4E6XA 4IBXA 3QP4A 4IVKA 2ZQDA 5HDCA 4E3OA 4FH2A 3MQ0A 3ISGA 4PMAA 1OT9A 5DFYA 5KSHA 2G2UA 2EX9A 4WZ5A 3EEHA 5GLCA 3MQQA 2UWXA 3LEZA 5I94A 1HD8A 1XA7A 1FILA 3KO6A 2O99A 4NXFA 3KX0X 4EBPA 4L9EA 3QP2A 3CUEA 3UPNA 4DE0A 3CPTA 4FTXA 4OQHA 1IYPA 3VP1A 2VV7A 4JPMA 1M40A 1P9RA 1KE0A 2Q9MA 3D72A 4DKIA 4L0LA 4GCZA 3AGDA 3GSGA 3U4LP 3JPUA 4Y0TA 3SH9A 2P74A 4BQMA 1E3UA 3VP4A 4E3NA 2PD8A 1U60A 5JYOA 1ZKJA 4IVIA 3PHYA 3RTYA 4EBLA 3VOZA 2RL3A 5CGWA 1OPXA 3GVBA 1PW8A 1H3QA 5HAIA 5FEFA 4ZAMA 1ESIA 3F1OA 2OAP1 5E2HA 5J3WA 5FATA 2BLSA 5GHZA 2EFXA 4DRTA 5KZHA 1DP8A 4RRFA 2Y4AA 3HL9A 1E25A 2HP9A 3V5MA 1QMFA 5A93A 3P98A 5FEGA 4KUKA 5HAPA 1XGIA 5CGXA 5G4ZA 1JWZA 3MXRA 4KQRA 4II7A 3UE1A 3IHAA 3IF6B 4RX3A 4FUWA 1T1BA 4BD0A 2Y2JA 3P09A 2EX6A 2ZL1A 3IXHA 4B4ZA 2KX6A 2PR5A 3OZHA 3KO3A 1FCOA 1T1AA 4WL9A 1W5DA 1ES2A 4F3LA 2R78A 3BEBA 1YLJA 4UA9A 4G3WA 4GJ4A 5A8BA 4GZBA 3KOCA 5HW3A 4GNUA 3MXQA 4HJ3A 3G4PA 1ES3A 5EVLA 1CF0A 2OLUA 2ZC4B 4RR9A 1TDGA 1Z6FA 1FCMA 2ZM8A 4S2NA 3QP6A 2XFSA 5DF7A 4RRMA 4PM9A 1CEFA 2LB5A 4MN6A 2A49A 2Y8HA 5AVFA 4K0XA 2XROA 1LI0A 3LIAA 3CHWP 3EGDC 3CAXA 2IWCA 2PBDP 1N4OA 3DTIA 3HLDA 1CI8A 4KQDA 3BQAA 4DF6A 3T4SA 4ZJ1A 3TOIA 1MPLA 4P0MA 5DJUA 3B47A 4C3QA 3CLOA 1JWPA 2PHYA 3A3DA 3PBSA 2HDQA 1L0FA 1PW1A 2Y59A 1W63M 4JBFA 3NCKA 3TRCA 3OOVA 3BJNA 4RRQA 2K2NA 4WEKA 4Q8IA 3AGFA 2ZM0A 1W8QA 3HLCA 3KO9A 2GDNA 3PXPA 4R4SA 4UQIM 1TF1A 4GN2A 3HCYA 1PWDA 1HTZA 2EXBA 4X68A 4KENB 1WYCA 4EV4A 4OPRA 1VB6A 4MCWA 4S2PA 1ESUA 4S2LA 4CPKA 5TFQA 3H9WA 2XLNA 4JF5A 4FD8A 3KSFA 4KZ3A 3H82B 4NXBA 2HL2A 2DMWA 5J8XA 3LIBA 4MEZA 5K5BA 1YLPA 1K55A 2HF6A 4WMCD 2WGVA 3NDGA 3G6OA 5I5LA 4JF4A 2V1AA 4I38A 5CHJA 1J3WA 3JVVA 4H6JA 3UE3A 2Y2NA 2XR0A 4YINA 3N8SA 4KG5A 1NY0A 4EERA 2VGKA 1SKOB 2GZAA 4I3IA 4EQ1A 3K3DA 3TE8A 3OPLA 2W1RA 2WUQA 3N4IA 2H0TA 5HAQA 4D2OA 2VLGA 1XXMA 5EVEA 4U3TA 4O0PA 5M1AA 3GMWA 3VMAA 4RR7A 1FOFA 2B02A 5L10A 3RFBA 5E2FA 4S0LA 4OH0A 4KUOA 4H8RA 5EVIA 2HPBA 1AXBA 1K56D 3A3IA 3BFGA 2J80A 4XUXA 2WKIA 5TBMA 4P6ZM 1XJ6A 1DJAA 4IJGA 4MBFA 3VP3A 5L09A 2O9BA 5F82A 4L9FA 5F6AA 5FAPA 3BLMA 3VFFA 1PWCA 3C7UA 4UQIS 3P01A 5F83A 1XP4A 3IX3A 1PFLA 1SDEA 1DP6A 3JVUA 1W7FA 4X1MA 1CQAA 3BFFA 3HREA 1ACFA 5J4EA 2IWBA 1S67L 3NOUC 1YPRA 3T4TA 5HDSA 5HWWA 3IHBA 3IWOA 5F1FA 2VV6A 1RCJA 1F2KA 4GOGA 4S2MA 3JYIA 4DDSA 3OPHA 4Y17A 3WRTA 2ZQ9A 2PBYA 4IUKA 2JN7A 2XGNA 3BWLA 2XD1A 1TS7A 1NWZA 4HHDA 1D06A 1FR6A 3SS4A 1UWPX 1TS0A 1LT0A 4B9OA 1L0DA 1EWZA 1H5XA 2O9AA 4HBUA 1T1CA 5F69A 1E4DA 1OJGA 2ZMVA 5FQJA 1XFNA 4LRXC 2JKRM 2UV0E 3G32A 1BTLA 2DNSA 4R38A 5CEBA 2QKPA 2W3DA 5FQKA 5AVEA 2V20A 1NYMA 3LI9A 2XA7M 1IEMA 3BYDA 2WZZA 2EWWA 1DRMA 3E4QA 4E3KA 2PD7A 3KO7A 3LICA 4B4XA 3MS6A 2W1TA 3V3RA 2IA2A 3GQZA 3LR3A 5CRFA 1G68A 4PPRA 3ZG8B 2WAFA 1ZG4A 5EV0A 3NJAA 3SS5A 4HH2A 1ERMA 3UDXA 3IXDA 1ES5A 1SCWA 2FZ0A 1FQGA 4MLLA 1K25A 2C6WB 2WGWA 4ZBEA 1OTDA 1PNEA 3WS5A 4P6ZS 4DMZA 1XJ3A 4RR8A 4KZAA 3QP8A 1WE4A 1RGZA 2VGLM 3Q7VA 3IBJA 3Q7ZA 5GLBA 4WM9A 2I72A 5HWVA 2Y79A 4HNBA 2V9AA 3GR2A 1PI5A 3CITA 3UNWA 2FFYA 4ESPA 2L1MA 2ZD8A 4LV1A 1BT5A 4X1LA 4LRZE 4BL2A 3A0SA 4QJGA 3OBFA 3MMHA 4WZ5C 3QP1A 4X69A 4NXEA 4OLGA 4LENA 1L2SA 4EUVA 5FDSA 1OT6A 4R0QA 5CXWA 4E6WA 2JKFA 1VETA 3L9KA 2OKVA 4YOFA 3MF0A 1OJ5A 3O86A 4UA6A 5FI6A 3UE0A 3HLBA 3CUEC 2WKRA 1C3BA 5F5YA 2K7SA 3Q81A 4I39A 3LR5A 1LL5A 4NG2A 4FOFA 4LLOB 3E4OA 3UDFA 5CECA 3BM6A 3UPOA 5BOHA 3DTKA 1KVMA 3TJZC 4KZ9A 2VV8A 1YAXA 2VKSA 2XA7S 4GD6A 3R7WB 4CLCA 5FL3A 1FCNA 2Y55A 2GNXA 3MQOA 5IS1A 1D7EA 1FR1A 5HDDA 3FV7A 1MZUA 4HJ6A 3A3JA 3P7NA 2A3UA 3L7HA 2H5SA 2XD5A 2PT7A 4Y3IA 5DTSA 3N8LA 4OOLA 5AQ7A 4KZBA 3LIDA 4LFUA 3HUOA 4JGRA 2W27A 3KNFA 3CJMA 3S22A 4S2KA 1I2WA 2Y2PA 4K0WA 5FQ9A 1KGGA 4LRYC 3O87A 1DP9A 1XJ2A 3HVFA 3PD2A 2VGLS 2NUPC 3B42A 2JC7A 4PM6A 2XQZA 1ZTUA 2MJ6A 1IFQA 1EW0A 3FG8A 2FFFB 2WKPA 5G4YA 4KZ7A 2V8FA 1NLZA 3W8KA 2G2WA 2DCFA 1DJCA 3KYQA 3ZNTA 3B3XA 4N9KA 3F1NB 1PIOA 2XK1A 4K08A 5KSCA 4GS9B 3V50A 1T18A 1YLTA 1Y2QA 4Q0IA 3T1XA 4JF6A 5EOOA 5G18A 3A0RA 3IT9A 3OLOA 4O7DA 2QWSA 3C38A 2QZ6A 4MBHA 3RXWA 3A0VA 1V9ZA 2W0NA 4S2NC 5E2EA 3QP5A 1M6KA 4WF0A 4E04A 2XEPA 1YMXA 2M7UA 2VEAA 1ZC2A 3LYXA 2DBOA 2WAEA 1S6RA 2ZC5B 1MWTA 3D3OA 3NDEA 1XKZA 1DJBA 2E8JA 1J9MA 4GKUA 3TW8A 3BLSA 4XT2B 5HARA 5HZHA 3D4FA 4OOMA 5GLAA 4BWIA 4Y15A 4MN7A 3FYZA 5CX7A 3W4QA 5AQAA 1TS6A 5A90A 5F1GA 4KZ8A 3SW1A 4RR6A 2Y91A 4I3JA 2ZM2A 4S0JA 4QU3A 1S1ZA 1D1JA 3CZDA 3IF6A 5HD5A 3G2ZA 1EROA 4XT2A 1L0EA 4DDYA 1JKEA 2M1CA 3ZG7B 5FI7A 2PU2A 3Q1FA 3O88A 2GJ3A 3UB8A 4Y2FA 5IT5A 3DTEA 2XSSA 1AWIA 1K54A 3W4PA 2ZQAA 1VM1A 3SZTA 1LSVA 3LO7A 4WELA 4PKYG 1MKMA 3W2ZA 4MNRA 2Y2HA 4RRLA 2QMIA 1LL9A 3MZEA 3FWLA 3S4XA 3IWQA 3GV9A 3RXXA 3VP0A 2J9PA 4X53A 3W4OA 5CTNA 1XPBA 1K38A 2P04A 4YWZA 3HJIA 2PRFA 5HFOA 5EECA 4BJPA 4D60A 1VEUB 1NRJA 1N9OA 4R1GA 3VOYA 1BLSA 4XUZA 4NXGA 4KZ5A 3CWFA 3LCEA 3IS2B 3Q82A 3RJUA 4Q0JA 2HGVA 3LEQA 3VSLA 2P7JA 1K55C 1NZOA 5FSRA 1IYOA 3NULA 2PYPA 4RRRA 2J7VA 4NETA 3NHQA 1SDNA 4EEUA 2EXAA 2H0YA 2VGJA 3UB5P 3ITAA 4HP9A 1HLUP 1NLYA 1I5QA 4RRAA 3VV4A 3DTMA 4E3MA 1NYYA 4MMNA 3K3CA 5A92A 4HEFA 1WA9A 3WS2A 5KMWA 4B88A 3PD5A 3LY3A 1CK3A 4G3VA 4KG2A 5EM1A 2P9VB 1GSWA 2O0YA 3M6HA 4JLFA 4OVDA 5EVIC 4JXGA 2XF3A 1BLPA 2WKEA 2WKQA 4JGQA 2BG1A 4S2JA 1SZVA 5EPHA 1H8ZA 5FAOA 1BSGA 4LPZA 4HESA 1S0WA 5C5KA 5DJTA 4KG6A 4WLAA 3H82A 4R3BA 4S0IA 1EI5A 4RRDA 4S2IA 3KOBA 4U0XA 2Q0OA 2WYXA 2WKHA 4NBJA 1N9BA 4QB8A 2Z6CA 4WN5A 2M7VA 4GHIB 2J3TD 2H28A 3IX4A 3BQ8A 3IH9A 1K4FA 3S7NA 1ONGA 3WRZA 4FH4A 4N1HA 1G28A 2CC1A 4GLQA 2Y2IA 1SKOA 1BULA 1RP5A 1N9LA 3T4JA 1MKIA 1OMEA 1OTEA 1PZOA 5L2FA 1P97A 4MBKA 3E98A 5HD3A 3S7QA 2JKRI 2PAVP 3EEAA 3LI8A 3MBZA 2A24B 3F1PB 3HUMA 4WZ4A 4Y5FA 2XDMA 2EX2A 3I7JA 3VE4A 3A3EA 3OCNA 3T4KA 3CMZA 3ULFA 5DFXA 3KO4A 1STZA 5FI2A 1K0KA 2X71A 2R9WA 4NKPA 3BY8A 2R9XA 1HVBA 2ZOHA 5HPIA 1KDSA 3MZFA 1H0MA 4EESA 1X0OA 4ID4A 2J3WA 1XFQA 4M3KA 5DVAA 3T4OA 3G35A 1P0ZA 1YSPA 2HL0A 2QJ7A 1W8YA 1IYSA 3PD3A 1DY6A 2V8CA 3NOPC 3BY9A 4XXRA 5AQBA 3MSHA 1GSVA 2PYRA 3PBTA 3IBRA 3M2KA 3FZCA 2V1ZA 4DJ2A 5CEDA 2JCHA 2Y2KA 4HI4A 4CJNA 1N9NA 1CJFA 3V3SA 2BASA 2W3EA 2KOIA
chains in the Genus database with same CATH topology
5CHUA 4HBTA 4GD6A 4B4ZA 1PI4A 5DF8A 1NXYA 3IF5A 3MZDA 3OZHA 5EOEA 1FCNA 2Z2MB 4WBGA 3ZDJA 3KO3A 1FCOA 5HL1A 1W5DA 2Y55A 5FDHA 1RGYA 1FR1A 3FV7A 1ES2A 4LV2A 2X01A 3A3JA 4N92A 2A3UA 2H5SA 2XD5A 3BEBA 5DTSA 4S0KA 3N8LA 1YLJA 4UA9A 4OOLA 5GHYA 1WYBA 5AQ7A 4C6YA 4KZBA 2Y2LA 1G6AA 1KGEA 4GDBA 1JTDA 4ZTKA 4GZBA 5GL9A 3HUOA 5HW3A 3KOCA 4WYYA 4GNUA 3KNFA 3LY4A 3CJMA 3S22A 1PZPA 5M18A 3G4PA 4S2KA 3KODA 1E3UD 1ES3A 1I2WA 2Y2PA 3OPRA 4K0WA 4PM7A 4NBIA 5FQ9A 5EVLA 2OLUA 2ZC4B 1KGGA 4RR9A 3O87A 1TDGA 1Z6FA 1FCMA 3HVFA 3PD2A 4QY6A 2ZM8A 4S2NA 3UY6A 3HBRA 2XFSA 4OPZA 4R23A 4S03A 3G30A 5DF7A 2JC7A 4PM6A 2XQZA 2OLVA 5EVIB 4RRMA 3HLGA 4PM9A 3NC8A 4LV3A 4PM5A 3E2KA 4BD1A 1KVLA 2WADA 5FA7A 2FFFB 4P87A 2A49A 4N9LA 1Y54A 4KZ7A 4K0XA 4KZ4A 1LI0A 5EE8A 1SKFA 5JYPA 1KE4A 4QD4A 5TGFA 4ZDXA 3UO9A 1ALQA 3W8KA 2G2WA 2DCFA 1DJCA 2IWCA 4S2OA 3ZNTA 3B3XA 3PBNA 4N9KA 1JWVA 5FQIA 1LHYA 2Y2OA 1N4OA 1YM1A 3HLDA 1K57A 1KE3A 1PIOA 4KZ6A 1CI8A 3S1YA 4QY5A 3PBOA 3LMTA 1XGJA 2XK1A 1YLYA 4DF6A 5KSCA 4ZJ1A 3TG9A 3TOIA 1GCEA 1MPLA 4P0MA 3V50A 2HDRA 4C3QA 5M19A 4LCLA 4R3JA 1JWPA 1YLTA 1Y2QA 5HX9A 4RRBA 4JF6A 4OP8A 3A3DA 3PBSA 5EOOA 2HDQA 1L0FA 5G18A 1PW1A 2Y59A 3IT9A 3MKEA 2B5RA 3IQAA 4OOYA 4JBFA 3ZG0A 4O7DA 3NCKA 4RRHA 1K4EA 4RRQA 3NBLA 3E2LA 2QZ6A 4MBHA 3RXWA 3FKVA 4WEKA 4Q8IA 3AGFA 2ZM0A 1W8QA 3HLCA 4S2NC 5E2EA 4DXBA 3KO9A 2WK0A 1M6KA 2EX8A 4X56A 2GDNA 2C5WB 3DW0A 4R4SA 2HL1A 2Z2LB 2XEPA 3SH8A 4GN2A 1YMXA 1TEMA 3BFCA 4X55A 1PWDA 3BRMA 5FQQA 1ZC2A 4RRIA 1HTZA 2EXBA 4X68A 4NK3A 4KENB 1WYCA 2OSUA 3O3VA 2DBOA 2WAEA 4EV4A 1S6RA 2ZC5B 4RRKA 2X02A 2ZQ7A 4OPRA 1MWTA 4K91A 3NDEA 1XKZA 2ZQCA 1DJBA 1ESUA 4S2PA 1JTGA 4S2LA 1J9MA 4UA7A 4GKUA 4CPKA 1IYQA 2Q9NA 5TFQA 3BLSA 2XLNA 3IXHA 4JF5A 4OLDA 3VSKA 5CERA 4FSFA 5HARA 4FD8A 1ES4A 1NZUA 3D4FA 4OOMA 1LI9A 3MFDA 5GLAA 4OQIA 4OKPA 4RRJA 4KZ3A 3FYZA 3N8RA 3W4QA 1XA1A 4DE3A 4EBNA 1IELA 1K57C 4E3LA 3QNCA 5AQAA 4IBRA 3SH7A 2HL2A 2ZC3B 5A90A 1ZG6A 3PBRA 3UN7A 1FSWA 3QNBA 2QPNA 4KZ8A 4MEZA 5F1GA 2Y91A 5J8XA 5DTKA 4RR6A 1YT4A 2ZM2A 3NIAA 4S0JA 5EUAA 4QU3A 1YLPA 3BFEA 3IF6A 1K55A 3CZDA 3IXBA 3SOIA 3IXGA 3G2ZA 2WGVA 1EROA 3NDGA 4WMCD 1L0EA 4DDYA 1JKEA 4RRGA 4E3JA 1TVFA 2EFUA 4JF4A 5FI7A 3ZG7B 5CHJA 2PU2A 3Q1FA 3O88A 5TR7A 1K54A 3UE3A 3W4PA 2ZQAA 1VM1A 2XR0A 2Y2NA 3Q07A 5EVID 4YINA 1I2SA 2XFTA 3N8SA 4KG5A 1CEGA 4RVAA 1NY0A 3LO7A 2VGKA 4WELA 2HDUA 3G31A 1K6RA 2ZLYA 3OPLA 3ZG5A 3DWKA 4S02A 1MY8A 2WUQA 3N4IA 4DE1A 4MNRA 1ONHA 3OCLA 2WGWB 2H0TA 2Y2HA 2QMIA 5HAQA 4RRLA 1LL9A 4D2OA 3MZEA 3FWLA 3S4XA 3ITBA 4R4RA 4RYEA 1NRFA 1XXMA 4ZJ2A 4BL3A 1JVJA 2HDSA 4JXSA 4U3TA 5FQMA 2HP5A 3ZHHA 3IWQA 4IEDA 3IH8A 1H8YA 5M1AA 3GV9A 3RXXA 3VP0A 3GMWA 2ZC6B 5GLDA 3VMAA 2J9PA 3G2YA 3Q7VB 4X53A 3W4OA 5CTNA 1XPBA 4RR7A 1K38A 3ZCZA 4WMCA 1FOFA 5HFOA 5DTTA 5EECA 1QMEA 4BJPA 1Q2QA 4UAAA 1YLWA 4R1GA 5E2FA 3VOYA 1BLSA 1K6SA 4S0LA 4OH0A 4RRCA 4XUZA 4H8RA 4KZ5A 5EVIA 2HPBA 1AXBA 1K56D 3LCEA 3TSGA 5D3OA 3A3IA 3BFGA 4FCFA 3KO5A 3PAGA 5DF9A 3Q82A 3RJUA 3WS0A 3WWXA 4XUXA 2WKIA 3VSLA 1DJAA 3EQVA 3IF6C 4A5RA 1K55C 2ZMAA 4MBFA 3VP3A 1NZOA 2J8YA 5FSRA 1IYOA 1MWRA 1YLZA 3V39A 3ZFZA 1XX2A 1TDLA 5F82A 5CTMA 4RRRA 5FAPA 1BZAA 2J7VA 4NETA 4OPYA 1K54C 3M6BA 3BLMA 3VFFA 4OQGA 1PWCA 3C7UA 4JXWA 2OV5A 1SDNA 3M2JA 2V2FF 3HUNA 5CHMA 3LMUA 1NJ4A 2EXAA 2H0YA 4ZJ3A 2VGJA 1ERQA 4JKTA 2HKZA 5F83A 1MBLA 3LMVA 3ITAA 1XP4A 1SDEA 2ZC7A 3KNPA 3UDIA 3PAEA 4LV0A 1I5QA 4RRAA 1W7FA 3ZVTA 4E3IA 2Y2QA 4KQQA 3BFFA 3HREA 2WZXA 1MWUA 3DTMA 1NYYA 2IWBA 4E3MA 1BLCA 5E43A 1K56A 3WS4A 2H10A 3PBQA 4HEFA 5A92A 1GHMA 3C7VA 3WS2A 5KMWA 3IHBA 3IWOA 1MWSA 5F1FA 4B88A 3PD5A 2XH9A 4U0TA 3LY3A 1CK3A 1PWGA 4KG2A 1MXOA 3UPPA 3C5AA 3N6IA 1RCJA 4GOGA 2P9VB 1O7EA 4S2MA 3JYIA 4DDSA 3OPHA 3WRTA 2ZQ9A 3M6HA 2PBYA 2WGIA 4X6TA 3C4PA 4JLFA 4OVDA 5EVIC 4JXGA 3VFHA 4RX2A 2XF3A 2XGNA 1BLPA 4F94A 2WKEA 2XD1A 1YMSA 2BG1A 3HLWA 4S2JA 5J61A 3N7WA 5EPHA 1H8ZA 1VQQA 2E8IA 3CG5A 5FAOA 1BSGA 3OC2A 1FR6A 3SS4A 4GB7A 1PYYA 3ZVWA 1LLBA 1GHPA 3G34A 2HP6A 1YQSA 1L0DA 3FKWA 5AQ9A 1EWZA 1FSYA 1H5XA 4HBUA 3BFDA 5GHXA 4HESA 1BUEA 2DRWA 3AGEA 1E4DA 4Y7PA 1S0WA 1CI9A 5FQJA 3NY4A 4PM8A 2RCXA 4KG6A 3G32A 2JBFA 1BTLA 2DNSA 4QHCA 3OPPA 4R3BA 3PD4A 4S0IA 3VP2A 4GDNA 1KDWA 1KGFA 5CEBA 5FASA 1EI5A 4RRDA 4OONA 4S2IA 3KOBA 3DWZA 1GA9A 4U0XA 4P85A 3ZG9B 5FQKA 4E6XA 4EUZA 2V20A 1NYMA 3A3FA 3MKFA 4IBXA 2WYXA 1IEMA 3BYDA 4IVKA 2WKHA 2ZQDA 4NBJA 2WZZA 4E3OA 1N9BA 4FH2A 4E3KA 4QB8A 3KO7A 3ISGA 3QHYA 4PMAA 1SHVA 4B4XA 1HZOA 3V3RA 3IH9A 3GQZA 1GA0A 1K4FA 5CRFA 4BENA 1G68A 1ONGA 4PPRA 3WRZA 2WAFA 4FH4A 3ZG8B 3ZNYA 4N1HA 4EWFA 1ZG4A 5KSHA 2G2UA 2EX9A 4WZ5A 3SS5A 2CC1A 5GLCA 1ERMA 3BECA 2Y2IA 3UDXA 3IXDA 3SS3A 1BULA 1RP5A 5E2GA 2UWXA 1ES5A 2Y2GA 3LEZA 4EQIA 1SCWA 5I94A 1FQGA 4OPQA 1HD8A 1XA7A 1MKIA 3NI9A 4MLLA 3WS1A 1K25A 1OMEA 2C6WB 2WGWA 4ZBEA 3WS5A 3MXSA 4BLMA 1PZOA 5L2FA 4EBPA 2IWDA 4RR8A 4KZAA 4MBKA 5U47A 1WE4A 3UPNA 4DE0A 4OQHA 3MBZA 1IYPA 2J9OA 3VP1A 1BLHA 1RGZA 4JPMA 1M40A 5IHVA 2JE5A 1KE0A 3Q7VA 3HUMA 4WZ4A 2ZJ9A 2XDMA 2Q9MA 3Q7ZA 4P6BA 4N1XA 4DKIA 5GLBA 4WM9A 3ZGAB 1TC5A 2EX2A 3I7JA 4L0LA 2I72A 4DXCA 4KQOA 1L0GA 3AGDA 1GHIA 1W79A 3A3EA 1PI5A 3GR2A 3OCNA 3GSGA 4GD8A 3CMZA 3PTEA 4Y0TA 3SH9A 2P74A 4BQMA 3KO4A 1E3UA 3VP4A 4E3NA 1U60A 2FFYA 2PU4A 3HLFA 3IWIA 1ZKJA 4IVIA 5FAQA 3UNWA 4EBLA 5JYOA 5FI2A 5A91A 4Y0UA 2X71A 5CGSA 2Y2MA 4LCMA 4RA7A 3VOZA 4C75A 4DE2A 4YFMA 2RL3A 2ZD8A 1BT5A 4LV1A 2ZQ8A 2R9WA 5CGWA 4BL2A 3GVBA 1Q2PA 1J7GA 1PW8A 5HAIA 2R9XA 1HVBA 4ZAMA 1ESIA 4QJGA 1KDSA 3MZFA 4WZ5C 1O07A 1IKGA 4X69A 4ID4A 5E2HA 4M3KA 4OLGA 5DVAA 4LENA 1L2SA 3G35A 5FATA 4R0QA 5CXWA 2BLSA 5GHZA 4E6WA 4JXVA 2EFXA 4UHUA 2OKVA 1IKIA 3O86A 4DRTA 5KZHA 4WEJA 2HL0A 4OP5A 4RRFA 3HLEA 2Y4AA 3HL9A 1W8YA 1E25A 2HP9A 4UA6A 5FI6A 1IYSA 3HLBA 3UE0A 3V5MA 4Z9QA 3PD3A 1QMFA 1DY6A 1C3BA 5A93A 3P98A 4OQ0A 3Q81A 5HAPA 3EQUA 1XGIA 4XXRA 5CGXA 5AQBA 1LL5A 1JWZA 3GRJA 3MXRA 4KQRA 3PBTA 4Y0OA 3M2KA 3C4OA 3UE1A 3FZCA 3IHAA 2V1ZA 3IF6B 4RX3A 3UDFA 5CECA 2JCHA 5CEDA 2Y2KA 3BM6A 4CJNA 2P9VA 5BOHA 3UPOA 4BD0A 2Y2JA 1KVMA 3V3SA 3P09A 2EX6A 4KZ9A 3GTCA 1CEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHU A;  4HBT A;  4GD6 A;  4B4Z A;  1PI4 A;  5DF8 A;  1NXY A;  3IF5 A;  3MZD A;  3OZH A;  5EOE A;  1FCN A;  2Z2M B;  4WBG A;  3ZDJ A;  1FCO A;  5HL1 A;  1W5D A;  2Y55 A;  5FDH A;  1RGY A;  1FR1 A;  3FV7 A;  1ES2 A;  4LV2 A;  2X01 A;  3A3J A;  4N92 A;  2A3U A;  2H5S A;  2XD5 A;  3BEB A;  5DTS A;  3N8L A;  1YLJ A;  4UA9 A;  4OOL A;  5GHY A;  1WYB A;  5AQ7 A;  4C6Y A;  4KZB A;  2Y2L A;  1G6A A;  1KGE A;  4GDB A;  1JTD A;  4ZTK A;  4GZB A;  5GL9 A;  3HUO A;  5HW3 A;  4WYY A;  4GNU A;  3LY4 A;  3CJM A;  3S22 A;  1PZP A;  5M18 A;  3G4P A;  4S2K A;  1E3U D;  1ES3 A;  1I2W A;  2Y2P A;  3OPR A;  4K0W A;  4PM7 A;  5FQ9 A;  5EVL A;  2OLU A;  2ZC4 B;  1KGG A;  3O87 A;  1TDG A;  1Z6F A;  1FCM A;  3HVF A;  4QY6 A;  2ZM8 A;  4S2N A;  3UY6 A;  3HBR A;  2XFS A;  4OPZ A;  4R23 A;  3G30 A;  5DF7 A;  2JC7 A;  4PM6 A;  2XQZ A;  2OLV A;  5EVI B;  3HLG A;  4PM9 A;  3NC8 A;  4LV3 A;  4PM5 A;  3E2K A;  4BD1 A;  1KVL A;  2WAD A;  5FA7 A;  2FFF B;  4P87 A;  2A49 A;  4N9L A;  1Y54 A;  4KZ7 A;  4K0X A;  4KZ4 A;  1LI0 A;  5EE8 A;  1SKF A;  5JYP A;  1KE4 A;  4QD4 A;  5TGF A;  4ZDX A;  3UO9 A;  1ALQ A;  3W8K A;  2G2W A;  2DCF A;  1DJC A;  2IWC A;  4S2O A;  3ZNT A;  3B3X A;  3PBN A;  4N9K A;  1JWV A;  5FQI A;  1LHY A;  2Y2O A;  1N4O A;  1YM1 A;  3HLD A;  1K57 A;  1KE3 A;  1PIO A;  4KZ6 A;  1CI8 A;  3S1Y A;  4QY5 A;  3PBO A;  1XGJ A;  2XK1 A;  1YLY A;  4DF6 A;  5KSC A;  4ZJ1 A;  3TG9 A;  3TOI A;  1GCE A;  1MPL A;  4P0M A;  3V50 A;  2HDR A;  4C3Q A;  5M19 A;  4LCL A;  4R3J A;  1JWP A;  1YLT A;  5HX9 A;  4JF6 A;  4OP8 A;  3A3D A;  3PBS A;  5EOO A;  2HDQ A;  1L0F A;  5G18 A;  1PW1 A;  2Y59 A;  3IT9 A;  3MKE A;  2B5R A;  3IQA A;  4OOY A;  4JBF A;  3ZG0 A;  4O7D A;  3NCK A;  1K4E A;  3NBL A;  3E2L A;  2QZ6 A;  4MBH A;  3RXW A;  3FKV A;  4WEK A;  4Q8I A;  3AGF A;  2ZM0 A;  1W8Q A;  3HLC A;  4S2N C;  5E2E A;  4DXB A;  2WK0 A;  1M6K A;  2EX8 A;  4X56 A;  2GDN A;  2C5W B;  3DW0 A;  4R4S A;  2Z2L B;  2XEP A;  3SH8 A;  4GN2 A;  1YMX A;  1TEM A;  3BFC A;  4X55 A;  1PWD A;  3BRM A;  5FQQ A;  1ZC2 A;  1HTZ A;  2EXB A;  4X68 A;  4NK3 A;  4KEN B;  1WYC A;  2OSU A;  3O3V A;  2WAE A;  4EV4 A;  1S6R A;  2ZC5 B;  2X02 A;  2ZQ7 A;  4OPR A;  1MWT A;  4K91 A;  3NDE A;  1XKZ A;  2ZQC A;  1DJB A;  1ESU A;  4S2P A;  1JTG A;  4S2L A;  1J9M A;  4UA7 A;  4GKU A;  4CPK A;  1IYQ A;  2Q9N A;  5TFQ A;  3BLS A;  2XLN A;  3IXH A;  4JF5 A;  4OLD A;  3VSK A;  5CER A;  4FSF A;  5HAR A;  4FD8 A;  1ES4 A;  1NZU A;  3D4F A;  4OOM A;  1LI9 A;  3MFD A;  5GLA A;  4OQI A;  4OKP A;  4KZ3 A;  3FYZ A;  3N8R A;  3W4Q A;  1XA1 A;  4DE3 A;  4EBN A;  1IEL A;  1K57 C;  4E3L A;  3QNC A;  5AQA A;  4IBR A;  3SH7 A;  2ZC3 B;  5A90 A;  1ZG6 A;  3PBR A;  3UN7 A;  1FSW A;  3QNB A;  2QPN A;  4KZ8 A;  4MEZ A;  5F1G A;  2Y91 A;  5J8X A;  5DTK A;  1YT4 A;  2ZM2 A;  3NIA A;  5EUA A;  4QU3 A;  1YLP A;  3BFE A;  3IF6 A;  1K55 A;  3CZD A;  3IXB A;  3SOI A;  3IXG A;  3G2Z A;  2WGV A;  1ERO A;  3NDG A;  4WMC D;  1L0E A;  4DDY A;  4E3J A;  1TVF A;  2EFU A;  4JF4 A;  5FI7 A;  3ZG7 B;  5CHJ A;  2PU2 A;  3Q1F A;  3O88 A;  5TR7 A;  1K54 A;  3UE3 A;  3W4P A;  2ZQA A;  1VM1 A;  2XR0 A;  2Y2N A;  3Q07 A;  5EVI D;  4YIN A;  1I2S A;  2XFT A;  3N8S A;  4KG5 A;  1CEG A;  4RVA A;  1NY0 A;  3LO7 A;  2VGK A;  4WEL A;  2HDU A;  3G31 A;  1K6R A;  2ZLY A;  3OPL A;  3ZG5 A;  3DWK A;  1MY8 A;  2WUQ A;  3N4I A;  4DE1 A;  4MNR A;  1ONH A;  3OCL A;  2WGW B;  2H0T A;  2Y2H A;  2QMI A;  5HAQ A;  1LL9 A;  4D2O A;  3MZE A;  3FWL A;  3S4X A;  3ITB A;  4R4R A;  4RYE A;  1NRF A;  1XXM A;  4ZJ2 A;  4BL3 A;  1JVJ A;  2HDS A;  4JXS A;  4U3T A;  5FQM A;  2HP5 A;  3ZHH A;  3IWQ A;  4IED A;  3IH8 A;  1H8Y A;  5M1A A;  3GV9 A;  3RXX A;  3VP0 A;  3GMW A;  2ZC6 B;  5GLD A;  3VMA A;  2J9P A;  3G2Y A;  3Q7V B;  4X53 A;  3W4O A;  5CTN A;  1XPB A;  1K38 A;  3ZCZ A;  4WMC A;  1FOF A;  5HFO A;  5DTT A;  5EEC A;  1QME A;  4BJP A;  1Q2Q A;  4UAA A;  1YLW A;  4R1G A;  5E2F A;  3VOY A;  1BLS A;  1K6S A;  4OH0 A;  4XUZ A;  4H8R A;  4KZ5 A;  5EVI A;  2HPB A;  1AXB A;  1K56 D;  3LCE A;  3TSG A;  5D3O A;  3A3I A;  3BFG A;  4FCF A;  3PAG A;  5DF9 A;  3Q82 A;  3RJU A;  3WS0 A;  3WWX A;  4XUX A;  2WKI A;  3VSL A;  1DJA A;  3EQV A;  3IF6 C;  4A5R A;  1K55 C;  2ZMA A;  4MBF A;  3VP3 A;  1NZO A;  2J8Y A;  5FSR A;  1IYO A;  1MWR A;  1YLZ A;  3V39 A;  3ZFZ A;  1XX2 A;  1TDL A;  5F82 A;  5CTM A;  5FAP A;  1BZA A;  2J7V A;  4NET A;  4OPY A;  1K54 C;  3M6B A;  3BLM A;  3VFF A;  4OQG A;  1PWC A;  3C7U A;  4JXW A;  2OV5 A;  1SDN A;  3M2J A;  2V2F F;  3HUN A;  5CHM A;  1NJ4 A;  2EXA A;  2H0Y A;  4ZJ3 A;  2VGJ A;  1ERQ A;  4JKT A;  5F83 A;  1MBL A;  3ITA A;  1XP4 A;  1SDE A;  2ZC7 A;  3UDI A;  3PAE A;  4LV0 A;  1I5Q A;  1W7F A;  3ZVT A;  4E3I A;  2Y2Q A;  4KQQ A;  3BFF A;  3HRE A;  2WZX A;  1MWU A;  3DTM A;  1NYY A;  2IWB A;  4E3M A;  1BLC A;  5E43 A;  1K56 A;  3WS4 A;  2H10 A;  3PBQ A;  4HEF A;  5A92 A;  1GHM A;  3C7V A;  3WS2 A;  5KMW A;  3IHB A;  3IWO A;  1MWS A;  5F1F A;  4B88 A;  2XH9 A;  4U0T A;  3LY3 A;  1CK3 A;  1PWG A;  4KG2 A;  1MXO A;  3UPP A;  3C5A A;  3N6I A;  1RCJ A;  4GOG A;  2P9V B;  1O7E A;  4S2M A;  3JYI A;  4DDS A;  3OPH A;  3WRT A;  2ZQ9 A;  3M6H A;  2PBY A;  2WGI A;  4X6T A;  3C4P A;  4JLF A;  4OVD A;  5EVI C;  4JXG A;  3VFH A;  4RX2 A;  2XF3 A;  2XGN A;  1BLP A;  4F94 A;  2WKE A;  2XD1 A;  1YMS A;  2BG1 A;  3HLW A;  4S2J A;  3N7W A;  5EPH A;  1H8Z A;  1VQQ A;  2E8I A;  3CG5 A;  5FAO A;  1BSG A;  3OC2 A;  1FR6 A;  3SS4 A;  4GB7 A;  1PYY A;  3ZVW A;  1LLB A;  1GHP A;  3G34 A;  2HP6 A;  1YQS A;  1L0D A;  3FKW A;  5AQ9 A;  1EWZ A;  1FSY A;  1H5X A;  4HBU A;  3BFD A;  5GHX A;  4HES A;  1BUE A;  2DRW A;  3AGE A;  1E4D A;  4Y7P A;  1S0W A;  1CI9 A;  5FQJ A;  3NY4 A;  4PM8 A;  2RCX A;  4KG6 A;  3G32 A;  2JBF A;  1BTL A;  2DNS A;  4QHC A;  3OPP A;  4R3B A;  3VP2 A;  4GDN A;  1KDW A;  1KGF A;  5CEB A;  5FAS A;  1EI5 A;  4OON A;  4S2I A;  3DWZ A;  1GA9 A;  4U0X A;  4P85 A;  3ZG9 B;  5FQK A;  4E6X A;  4EUZ A;  2V20 A;  1NYM A;  3A3F A;  3MKF A;  4IBX A;  2WYX A;  1IEM A;  3BYD A;  4IVK A;  2WKH A;  2ZQD A;  2WZZ A;  4E3O A;  1N9B A;  4FH2 A;  4E3K A;  4QB8 A;  3ISG A;  3QHY A;  4PMA A;  1SHV A;  4B4X A;  1HZO A;  3V3R A;  3IH9 A;  3GQZ A;  1GA0 A;  1K4F A;  5CRF A;  4BEN A;  1G68 A;  1ONG A;  4PPR A;  3WRZ A;  2WAF A;  4FH4 A;  3ZG8 B;  3ZNY A;  4N1H A;  4EWF A;  1ZG4 A;  5KSH A;  2G2U A;  2EX9 A;  4WZ5 A;  3SS5 A;  2CC1 A;  5GLC A;  1ERM A;  3BEC A;  2Y2I A;  3UDX A;  3IXD A;  3SS3 A;  1BUL A;  1RP5 A;  5E2G A;  2UWX A;  1ES5 A;  2Y2G A;  3LEZ A;  4EQI A;  1SCW A;  5I94 A;  1FQG A;  4OPQ A;  1HD8 A;  1XA7 A;  1MKI A;  3NI9 A;  4MLL A;  3WS1 A;  1K25 A;  1OME A;  2C6W B;  2WGW A;  4ZBE A;  3WS5 A;  3MXS A;  4BLM A;  1PZO A;  5L2F A;  4EBP A;  2IWD A;  4KZA A;  4MBK A;  5U47 A;  1WE4 A;  3UPN A;  4DE0 A;  4OQH A;  3MBZ A;  1IYP A;  2J9O A;  3VP1 A;  1BLH A;  1RGZ A;  4JPM A;  1M40 A;  5IHV A;  2JE5 A;  1KE0 A;  3Q7V A;  3HUM A;  4WZ4 A;  2ZJ9 A;  2XDM A;  2Q9M A;  3Q7Z A;  4P6B A;  4N1X A;  4DKI A;  5GLB A;  4WM9 A;  3ZGA B;  2EX2 A;  3I7J A;  4L0L A;  2I72 A;  4DXC A;  4KQO A;  1L0G A;  3AGD A;  1GHI A;  1W79 A;  3A3E A;  1PI5 A;  3GR2 A;  3OCN A;  3GSG A;  4GD8 A;  3CMZ A;  3PTE A;  4Y0T A;  3SH9 A;  2P74 A;  4BQM A;  1E3U A;  3VP4 A;  4E3N A;  1U60 A;  2FFY A;  2PU4 A;  3HLF A;  3IWI A;  1ZKJ A;  4IVI A;  5FAQ A;  3UNW A;  4EBL A;  5JYO A;  5FI2 A;  5A91 A;  4Y0U A;  2X71 A;  5CGS A;  2Y2M A;  4LCM A;  4RA7 A;  3VOZ A;  4C75 A;  4DE2 A;  4YFM A;  2RL3 A;  2ZD8 A;  1BT5 A;  4LV1 A;  2ZQ8 A;  2R9W A;  5CGW A;  4BL2 A;  3GVB A;  1Q2P A;  1PW8 A;  5HAI A;  2R9X A;  1HVB A;  4ZAM A;  1ESI A;  4QJG A;  1KDS A;  3MZF A;  4WZ5 C;  1O07 A;  1IKG A;  4X69 A;  4ID4 A;  5E2H A;  4M3K A;  4OLG A;  5DVA A;  4LEN A;  1L2S A;  3G35 A;  5FAT A;  4R0Q A;  5CXW A;  2BLS A;  5GHZ A;  4E6W A;  4JXV A;  2EFX A;  4UHU A;  1IKI A;  3O86 A;  4DRT A;  5KZH A;  4WEJ A;  4OP5 A;  3HLE A;  2Y4A A;  3HL9 A;  1W8Y A;  1E25 A;  2HP9 A;  4UA6 A;  5FI6 A;  1IYS A;  3HLB A;  3UE0 A;  3V5M A;  4Z9Q A;  1QMF A;  1DY6 A;  1C3B A;  5A93 A;  3P98 A;  4OQ0 A;  3Q81 A;  5HAP A;  3EQU A;  1XGI A;  4XXR A;  5CGX A;  5AQB A;  1LL5 A;  1JWZ A;  3GRJ A;  3MXR A;  4KQR A;  3PBT A;  4Y0O A;  3M2K A;  3C4O A;  3UE1 A;  3FZC A;  3IHA A;  2V1Z A;  3IF6 B;  4RX3 A;  3UDF A;  5CEC A;  2JCH A;  5CED A;  2Y2K A;  3BM6 A;  4CJN A;  2P9V A;  5BOH A;  3UPO A;  4BD0 A;  2Y2J A;  1KVM A;  3V3S A;  3P09 A;  2EX6 A;  4KZ9 A;  3GTC A;  1CEF A; 
#chains in the Genus database with same CATH topology
 5CHU A;  4HOI A;  5DF8 A;  1NXY A;  4IHQ A;  3MR0 A;  3IF5 A;  3T1R A;  2Z2M B;  4WBG A;  4EXO A;  5FDH A;  1RGY A;  1UWN X;  2X01 A;  3U2A A;  4S0K A;  5F68 A;  1WYB A;  3KSI A;  4O01 A;  2Y2L A;  1G6A A;  1KGE A;  4EEP A;  4ZTK A;  5GL9 A;  3LY4 A;  5DKK A;  1PZP A;  4Q0H A;  3KOD A;  3OPR A;  4PM7 A;  4NBI A;  5HL6 A;  3RH8 B;  4M4X A;  3UY6 A;  3HBR A;  2BTF P;  3G30 A;  4L9G A;  5TJJ A;  2OLV A;  4BBV A;  3HLG A;  3NC8 A;  3LIF A;  3E2K A;  4BD1 A;  1KVL A;  2WAD A;  3KSH A;  1Y28 A;  4O8G A;  4P87 A;  1OTI A;  1Y54 A;  4X25 A;  3C30 A;  5EE8 A;  1SKF A;  5JYP A;  1KE4 A;  5TGF A;  4ZDX A;  3UO9 A;  4ZRR A;  2B18 A;  4S2O A;  4CLC C;  3EGX C;  5FQI A;  1LHY A;  2Y2O A;  3HJK A;  1YM1 A;  1K57 A;  4KZ6 A;  3KYE A;  3PBO A;  3LMT A;  2HDR A;  3CI6 A;  4G3K A;  2B5R A;  3IQA A;  5L8M A;  3LUQ A;  4RRH A;  3NBL A;  3E2L A;  4WUJ A;  3FKV A;  3R4K A;  4DXB A;  2WK0 A;  2EX8 A;  4DJ3 A;  4RQ9 A;  2HL1 A;  3DW0 A;  2Z2L B;  1JNU A;  2O9C A;  4RRI A;  2ZBB A;  4NK3 A;  2OSU A;  3O3V A;  3VOL A;  4RRK A;  2ZQ7 A;  4K91 A;  1JTG A;  4R70 A;  4UA7 A;  1IYQ A;  3NOT C;  4OLD A;  1ES4 A;  3MFX A;  2PDR A;  3MFD A;  4OKP A;  3T1Q B;  4RRJ A;  3N8R A;  2INW A;  4DE3 A;  4MN5 A;  1IEL A;  4EBN A;  3QNC A;  4IBR A;  1ZG6 A;  3PBR A;  4AFI A;  3UN7 A;  5J7E A;  1FSW A;  3QNB A;  5DTK A;  4PKY A;  1YT4 A;  4PHT A;  3NIA A;  3T12 B;  5EUA A;  1Y4O A;  3BFE A;  3SOI A;  3BW6 A;  3IXG A;  1ZHH B;  2V0W A;  1PRQ A;  4E3J A;  2EFU A;  5MC7 A;  2I9V A;  3T50 A;  3R7W A;  5EVI D;  1I2S A;  1CEG A;  4QWO A;  4HJ4 A;  4ME4 A;  1K6R A;  1F9I A;  2PR6 A;  3EWK A;  4DE1 A;  4Y13 A;  1ONH A;  3OCL A;  4YNR A;  4RYE A;  4ZJ2 A;  4BL3 A;  4I5S A;  4JXS A;  2JKT M;  3CPT B;  2G7U A;  3ZHH A;  3G2Y A;  3ZCZ A;  4WMC A;  3T1S A;  5DTT A;  1Q2Q A;  4UEY A;  4ETX A;  4UAA A;  1YLW A;  3V67 A;  4RRC A;  4R3A A;  5D3O A;  3ICY A;  4FCF A;  3EQV A;  3IF6 C;  4A5R A;  2ZMA A;  2J8Y A;  1MWR A;  1YLZ A;  3V39 A;  3ZFZ A;  1TDL A;  3F1O B;  1GSX A;  1K54 C;  3M6B A;  3NEC A;  5DKL A;  4JXW A;  2OV5 A;  2VA0 A;  3F1N A;  1ERQ A;  1S1Y A;  4JKT A;  2HKZ A;  1V9Y A;  3E4P A;  3KNP A;  4GS9 A;  4LV0 A;  2ZOI A;  4EU0 A;  1TS8 A;  4PAU A;  1BLC A;  5E43 A;  1K56 A;  3WS4 A;  3ZQ5 A;  1GHM A;  3C7V A;  1MWS A;  2XH9 A;  1PWG A;  1MXO A;  2A2L A;  3C5A A;  3N6I A;  5EFW A;  1O7E A;  2JHE A;  2ZL1 B;  5AJG A;  4X6T A;  4F94 A;  1YMS A;  3HLW A;  3N7W A;  3GDI A;  2E8I A;  3OC2 A;  2OAQ 1;  1PYY A;  3ZVW A;  1LLB A;  4F3L B;  1GHP A;  2HP6 A;  1LSW A;  2B95 A;  4HIA A;  1S4R A;  3ZYT A;  4QHC A;  3OPP A;  1VHM A;  3VP2 A;  1KDW A;  1KGF A;  3DWZ A;  4BBU A;  4EUZ A;  3A3F A;  3MKF A;  2OWJ A;  3QHY A;  1SHV A;  1HZO A;  1GA0 A;  4BEN A;  4EWF A;  3ZNY A;  4BMW A;  3BEC A;  3SS3 A;  5E2G A;  2YKH A;  2Y2G A;  4EQI A;  5HSQ A;  4OPQ A;  2OOL A;  3NI9 A;  3WS1 A;  2V1B A;  3MXS A;  4BLM A;  2IWD A;  5U47 A;  2J9O A;  1BLH A;  2FH5 A;  5IHV A;  1F98 A;  2JE5 A;  3KYZ A;  2ZJ9 A;  4P6B A;  4N1X A;  1TC5 A;  3ZGA B;  1TD5 A;  2HZ5 A;  4DXC A;  4CQH A;  4KQO A;  1L0G A;  1VEU A;  1GHI A;  1W79 A;  4GD8 A;  2L4R A;  3PTE A;  5HWT A;  3HLF A;  2PU4 A;  3IWI A;  3IS2 A;  5FAQ A;  2EA9 A;  1IOU A;  5A91 A;  3LR0 A;  4Y0U A;  3D9Y A;  5CGS A;  2Y2M A;  4LCM A;  4RA7 A;  4C75 A;  2YKF A;  4DE2 A;  4YFM A;  2ZQ8 A;  2HJE A;  1Q2P A;  1J7G A;  1LSX A;  5L07 A;  4B93 A;  3FPW A;  4QPR A;  1O07 A;  1IKG A;  4CLC D;  4HH3 A;  4JXV A;  4UHU A;  1IKI A;  1T19 A;  2L0W A;  4GW9 A;  4WEJ A;  4OP5 A;  3HLE A;  2KLI A;  4Z9Q A;  4OQ0 A;  4ETZ A;  3H7W B;  3EQU A;  3DAV A;  3GRJ A;  4Y0O A;  3C4O A;  3FPV A;  2QHK A;  3EOI A;  1A0K A;  2P9V A;  1LL8 A;  5KIZ A;  3GTC A;  5J61 A;  4H6J B;  3IX8 A;  4HBT A;  2LB9 A;  2VK3 A;  1PI4 A;  3O5Y A;  2W3F A;  2Z6D A;  3MZD A;  5EOE A;  3ZDJ A;  3H7W A;  5HL1 A;  4LV2 A;  4N92 A;  5HPF A;  1KOU A;  4IUH A;  5GHY A;  2HJ9 C;  4C6Y A;  3K2N A;  2XRN A;  4GDB A;  1JTD A;  4WYY A;  2VZW A;  5M18 A;  1E3U D;  2QJ5 A;  5LBR A;  4HY8 A;  2V0U A;  4QY6 A;  4S03 A;  4OPZ A;  4R23 A;  5EVI B;  4GHI A;  4LV3 A;  4PM5 A;  3T4L A;  1S4S A;  4JGP A;  1FIK A;  5FA7 A;  5TBM B;  4N9L A;  4JGO A;  3C2W A;  4KZ4 A;  2AVX A;  4QD4 A;  1ALQ A;  1MC0 A;  3PBN A;  1JWV A;  1KE3 A;  3S1Y A;  4QY5 A;  3UB9 A;  1XGJ A;  1YLY A;  2A24 A;  3F1P A;  3TG9 A;  1GCE A;  5M19 A;  4LCL A;  4R3J A;  3E0Y A;  5HX9 A;  4RRB A;  4OP8 A;  1L3L A;  2HV1 A;  3LIE A;  1P9W A;  3MKE A;  1W63 Q;  4OOY A;  3GEC A;  3ZG0 A;  1K4E A;  3LGO A;  4X56 A;  2C5W B;  3SH8 A;  1TEM A;  3BFC A;  3LR4 A;  4X55 A;  3BRM A;  5FQQ A;  1OTA A;  2X02 A;  4Z1W A;  1YSQ A;  2ZQC A;  4I3A A;  3S7P A;  4EET B;  2Q9N A;  2W3H A;  3VSK A;  5CER A;  4FSF A;  1NZU A;  1LI9 A;  4OQI A;  1XA1 A;  3PR6 A;  4E3L A;  3MJQ A;  1K57 C;  1F5M A;  3SH7 A;  2ZC3 B;  3T4Q A;  3UE6 A;  2QPN A;  2EWV A;  3C8C A;  2GX5 A;  2KDK A;  5EM0 A;  2NUT C;  3IXB A;  4RRG A;  2W1T B;  1TVF A;  2OWH A;  5TR7 A;  3Q07 A;  1Z09 A;  2XFT A;  1G6O A;  4RVA A;  2VJW A;  2HDU A;  3G31 A;  2ZLY A;  4EW7 A;  4MDZ A;  3ZG5 A;  1UGU A;  3DWK A;  4S02 A;  1MY8 A;  1BYW A;  2WGW B;  1ODV A;  3UB6 A;  3ITB A;  4R4R A;  1NRF A;  1JVJ A;  2HDS A;  5FQM A;  2HP5 A;  4IED A;  3IH8 A;  1H8Y A;  2ZC6 B;  5GLD A;  3Q7V B;  3B33 A;  4HP4 A;  2QYB A;  4LGW A;  1QME A;  4CLC E;  3PYP A;  1K6S A;  2P08 A;  2D01 A;  3TSG A;  3KO5 A;  3PAG A;  5DF9 A;  4ARZ B;  3WS0 A;  3WWX A;  3KSG A;  1YKD A;  1XX2 A;  5IU1 A;  5CTM A;  1BZA A;  4OPY A;  4OQG A;  3UME A;  3M2J A;  2V2F F;  3HUN A;  5CHM A;  3LMU A;  1NJ4 A;  2JKT I;  4ZJ3 A;  4ARZ A;  1MBL A;  4NEE D;  1VET B;  2ZMF A;  3LMV A;  2W3G A;  2ZC7 A;  3UDI A;  3S7O A;  3PAE A;  2K31 A;  3ZVT A;  4E3I A;  1XJ4 A;  2Y2Q A;  4KQQ A;  1OTB A;  1G5U A;  2WZX A;  1MWU A;  1H8M A;  2H10 A;  3PBQ A;  2CMN A;  4U0T A;  3UB7 A;  3UPP A;  2D02 A;  3VE3 A;  2WGI A;  3C4P A;  3DBA A;  3VFH A;  4RX2 A;  2JKG A;  3FC7 A;  4HQA A;  4CLC B;  1VQQ A;  3CG5 A;  4GB7 A;  3G34 A;  4BBT A;  1YQS A;  3FKW A;  5AQ9 A;  1FSY A;  2J3T C;  3BFD A;  5GHX A;  1BUE A;  2DRW A;  3AGE A;  4DN0 A;  4Y7P A;  1CI9 A;  3NY4 A;  4PM8 A;  2RCX A;  3UMD A;  2JBF A;  2ACG A;  3PD4 A;  2VX8 A;  3LFV A;  4GDN A;  5FAS A;  1S66 L;  4OON A;  4R6L A;  1GA9 A;  4P85 A;  3ZG9 B;  4E6X A;  4IBX A;  3QP4 A;  4IVK A;  2ZQD A;  5HDC A;  4E3O A;  4FH2 A;  3MQ0 A;  3ISG A;  4PMA A;  1OT9 A;  5DFY A;  5KSH A;  2G2U A;  2EX9 A;  4WZ5 A;  3EEH A;  5GLC A;  3MQQ A;  2UWX A;  3LEZ A;  5I94 A;  1HD8 A;  1XA7 A;  1FIL A;  3KO6 A;  2O99 A;  4NXF A;  3KX0 X;  4EBP A;  4L9E A;  3QP2 A;  3CUE A;  3UPN A;  4DE0 A;  3CPT A;  4FTX A;  4OQH A;  1IYP A;  3VP1 A;  2VV7 A;  4JPM A;  1M40 A;  1P9R A;  1KE0 A;  2Q9M A;  3D72 A;  4DKI A;  4L0L A;  4GCZ A;  3AGD A;  3GSG A;  3U4L P;  3JPU A;  4Y0T A;  3SH9 A;  2P74 A;  4BQM A;  1E3U A;  3VP4 A;  4E3N A;  2PD8 A;  1U60 A;  5JYO A;  1ZKJ A;  4IVI A;  3PHY A;  3RTY A;  4EBL A;  3VOZ A;  2RL3 A;  5CGW A;  1OPX A;  3GVB A;  1PW8 A;  1H3Q A;  5HAI A;  5FEF A;  4ZAM A;  1ESI A;  3F1O A;  2OAP 1;  5E2H A;  5J3W A;  5FAT A;  2BLS A;  5GHZ A;  2EFX A;  4DRT A;  5KZH A;  1DP8 A;  4RRF A;  2Y4A A;  3HL9 A;  1E25 A;  2HP9 A;  3V5M A;  1QMF A;  5A93 A;  3P98 A;  5FEG A;  4KUK A;  5HAP A;  1XGI A;  5CGX A;  5G4Z A;  1JWZ A;  3MXR A;  4KQR A;  4II7 A;  3UE1 A;  3IHA A;  3IF6 B;  4RX3 A;  4FUW A;  1T1B A;  4BD0 A;  2Y2J A;  3P09 A;  2EX6 A;  2ZL1 A;  3IXH A;  4B4Z A;  2KX6 A;  2PR5 A;  3OZH A;  3KO3 A;  1FCO A;  1T1A A;  4WL9 A;  1W5D A;  1ES2 A;  4F3L A;  2R78 A;  3BEB A;  1YLJ A;  4UA9 A;  4G3W A;  4GJ4 A;  5A8B A;  4GZB A;  3KOC A;  5HW3 A;  4GNU A;  3MXQ A;  4HJ3 A;  3G4P A;  1ES3 A;  5EVL A;  1CF0 A;  2OLU A;  2ZC4 B;  4RR9 A;  1TDG A;  1Z6F A;  1FCM A;  2ZM8 A;  4S2N A;  3QP6 A;  2XFS A;  5DF7 A;  4RRM A;  4PM9 A;  1CEF A;  2LB5 A;  4MN6 A;  2A49 A;  2Y8H A;  5AVF A;  4K0X A;  2XRO A;  1LI0 A;  3LIA A;  3CHW P;  3EGD C;  3CAX A;  2IWC A;  2PBD P;  1N4O A;  3DTI A;  3HLD A;  1CI8 A;  4KQD A;  3BQA A;  4DF6 A;  3T4S A;  4ZJ1 A;  3TOI A;  1MPL A;  4P0M A;  5DJU A;  3B47 A;  4C3Q A;  3CLO A;  1JWP A;  2PHY A;  3A3D A;  3PBS A;  2HDQ A;  1L0F A;  1PW1 A;  2Y59 A;  1W63 M;  4JBF A;  3NCK A;  3TRC A;  3OOV A;  3BJN A;  4RRQ A;  2K2N A;  4WEK A;  4Q8I A;  3AGF A;  2ZM0 A;  1W8Q A;  3HLC A;  3KO9 A;  2GDN A;  3PXP A;  4R4S A;  4UQI M;  1TF1 A;  4GN2 A;  3HCY A;  1PWD A;  1HTZ A;  2EXB A;  4X68 A;  4KEN B;  1WYC A;  4EV4 A;  4OPR A;  1VB6 A;  4MCW A;  4S2P A;  1ESU A;  4S2L A;  4CPK A;  5TFQ A;  3H9W A;  2XLN A;  4JF5 A;  4FD8 A;  3KSF A;  4KZ3 A;  3H82 B;  4NXB A;  2HL2 A;  2DMW A;  5J8X A;  3LIB A;  4MEZ A;  5K5B A;  1YLP A;  1K55 A;  2HF6 A;  4WMC D;  2WGV A;  3NDG A;  3G6O A;  5I5L A;  4JF4 A;  2V1A A;  4I38 A;  5CHJ A;  1J3W A;  3JVV A;  4H6J A;  3UE3 A;  2Y2N A;  2XR0 A;  4YIN A;  3N8S A;  4KG5 A;  1NY0 A;  4EER A;  2VGK A;  1SKO B;  2GZA A;  4I3I A;  4EQ1 A;  3K3D A;  3TE8 A;  3OPL A;  2W1R A;  2WUQ A;  3N4I A;  2H0T A;  5HAQ A;  4D2O A;  2VLG A;  1XXM A;  5EVE A;  4U3T A;  4O0P A;  5M1A A;  3GMW A;  3VMA A;  4RR7 A;  1FOF A;  2B02 A;  5L10 A;  3RFB A;  5E2F A;  4S0L A;  4OH0 A;  4KUO A;  4H8R A;  5EVI A;  2HPB A;  1AXB A;  1K56 D;  3A3I A;  3BFG A;  2J80 A;  4XUX A;  2WKI A;  5TBM A;  4P6Z M;  1XJ6 A;  1DJA A;  4IJG A;  4MBF A;  3VP3 A;  5L09 A;  2O9B A;  5F82 A;  4L9F A;  5F6A A;  5FAP A;  3BLM A;  3VFF A;  1PWC A;  3C7U A;  4UQI S;  3P01 A;  5F83 A;  1XP4 A;  3IX3 A;  1PFL A;  1SDE A;  1DP6 A;  3JVU A;  1W7F A;  4X1M A;  1CQA A;  3BFF A;  3HRE A;  1ACF A;  5J4E A;  2IWB A;  1S67 L;  3NOU C;  1YPR A;  3T4T A;  5HDS A;  5HWW A;  3IHB A;  3IWO A;  5F1F A;  2VV6 A;  1RCJ A;  1F2K A;  4GOG A;  4S2M A;  3JYI A;  4DDS A;  3OPH A;  4Y17 A;  3WRT A;  2ZQ9 A;  2PBY A;  4IUK A;  2JN7 A;  2XGN A;  3BWL A;  2XD1 A;  1TS7 A;  1NWZ A;  4HHD A;  1D06 A;  1FR6 A;  3SS4 A;  1UWP X;  1TS0 A;  1LT0 A;  4B9O A;  1L0D A;  1EWZ A;  1H5X A;  2O9A A;  4HBU A;  1T1C A;  5F69 A;  1E4D A;  1OJG A;  2ZMV A;  5FQJ A;  1XFN A;  4LRX C;  2JKR M;  2UV0 E;  3G32 A;  1BTL A;  2DNS A;  4R38 A;  5CEB A;  2QKP A;  2W3D A;  5FQK A;  5AVE A;  2V20 A;  1NYM A;  3LI9 A;  2XA7 M;  1IEM A;  3BYD A;  2WZZ A;  2EWW A;  1DRM A;  3E4Q A;  4E3K A;  2PD7 A;  3KO7 A;  3LIC A;  4B4X A;  3MS6 A;  2W1T A;  3V3R A;  2IA2 A;  3GQZ A;  3LR3 A;  5CRF A;  1G68 A;  4PPR A;  3ZG8 B;  2WAF A;  1ZG4 A;  5EV0 A;  3NJA A;  3SS5 A;  4HH2 A;  1ERM A;  3UDX A;  3IXD A;  1ES5 A;  1SCW A;  2FZ0 A;  1FQG A;  4MLL A;  1K25 A;  2C6W B;  2WGW A;  4ZBE A;  1OTD A;  1PNE A;  3WS5 A;  4P6Z S;  4DMZ A;  1XJ3 A;  4RR8 A;  4KZA A;  3QP8 A;  1WE4 A;  1RGZ A;  2VGL M;  3Q7V A;  3IBJ A;  3Q7Z A;  5GLB A;  4WM9 A;  2I72 A;  5HWV A;  2Y79 A;  4HNB A;  2V9A A;  3GR2 A;  1PI5 A;  3CIT A;  3UNW A;  2FFY A;  4ESP A;  2L1M A;  2ZD8 A;  4LV1 A;  1BT5 A;  4X1L A;  4LRZ E;  4BL2 A;  3A0S A;  4QJG A;  3OBF A;  3MMH A;  4WZ5 C;  3QP1 A;  4X69 A;  4NXE A;  4OLG A;  4LEN A;  1L2S A;  4EUV A;  5FDS A;  1OT6 A;  4R0Q A;  5CXW A;  4E6W A;  2JKF A;  1VET A;  3L9K A;  2OKV A;  4YOF A;  3MF0 A;  1OJ5 A;  3O86 A;  4UA6 A;  5FI6 A;  3UE0 A;  3HLB A;  3CUE C;  2WKR A;  1C3B A;  5F5Y A;  2K7S A;  3Q81 A;  4I39 A;  3LR5 A;  1LL5 A;  4NG2 A;  4FOF A;  4LLO B;  3E4O A;  3UDF A;  5CEC A;  3BM6 A;  3UPO A;  5BOH A;  3DTK A;  1KVM A;  3TJZ C;  4KZ9 A;  2VV8 A;  1YAX A;  2VKS A;  2XA7 S;  4GD6 A;  3R7W B;  4CLC A;  5FL3 A;  1FCN A;  2Y55 A;  2GNX A;  3MQO A;  5IS1 A;  1D7E A;  1FR1 A;  5HDD A;  3FV7 A;  1MZU A;  4HJ6 A;  3A3J A;  3P7N A;  2A3U A;  3L7H A;  2H5S A;  2XD5 A;  2PT7 A;  4Y3I A;  5DTS A;  3N8L A;  4OOL A;  5AQ7 A;  4KZB A;  3LID A;  4LFU A;  3HUO A;  4JGR A;  2W27 A;  3KNF A;  3CJM A;  3S22 A;  4S2K A;  1I2W A;  2Y2P A;  4K0W A;  5FQ9 A;  1KGG A;  4LRY C;  3O87 A;  1DP9 A;  1XJ2 A;  3HVF A;  3PD2 A;  2VGL S;  2NUP C;  3B42 A;  2JC7 A;  4PM6 A;  2XQZ A;  1ZTU A;  2MJ6 A;  1IFQ A;  1EW0 A;  3FG8 A;  2FFF B;  2WKP A;  5G4Y A;  4KZ7 A;  2V8F A;  1NLZ A;  3W8K A;  2G2W A;  2DCF A;  1DJC A;  3KYQ A;  3ZNT A;  3B3X A;  4N9K A;  3F1N B;  1PIO A;  2XK1 A;  4K08 A;  5KSC A;  4GS9 B;  3V50 A;  1T18 A;  1YLT A;  1Y2Q A;  4Q0I A;  3T1X A;  4JF6 A;  5EOO A;  5G18 A;  3A0R A;  3IT9 A;  3OLO A;  4O7D A;  2QWS A;  3C38 A;  2QZ6 A;  4MBH A;  3RXW A;  3A0V A;  1V9Z A;  2W0N A;  4S2N C;  5E2E A;  3QP5 A;  1M6K A;  4WF0 A;  4E04 A;  2XEP A;  1YMX A;  2M7U A;  2VEA A;  1ZC2 A;  3LYX A;  2DBO A;  2WAE A;  1S6R A;  2ZC5 B;  1MWT A;  3D3O A;  3NDE A;  1XKZ A;  1DJB A;  2E8J A;  1J9M A;  4GKU A;  3TW8 A;  3BLS A;  4XT2 B;  5HAR A;  5HZH A;  3D4F A;  4OOM A;  5GLA A;  4BWI A;  4Y15 A;  4MN7 A;  3FYZ A;  5CX7 A;  3W4Q A;  5AQA A;  1TS6 A;  5A90 A;  5F1G A;  4KZ8 A;  3SW1 A;  4RR6 A;  2Y91 A;  4I3J A;  2ZM2 A;  4S0J A;  4QU3 A;  1S1Z A;  1D1J A;  3CZD A;  3IF6 A;  5HD5 A;  3G2Z A;  1ERO A;  4XT2 A;  1L0E A;  4DDY A;  1JKE A;  2M1C A;  3ZG7 B;  5FI7 A;  2PU2 A;  3Q1F A;  3O88 A;  2GJ3 A;  3UB8 A;  4Y2F A;  5IT5 A;  3DTE A;  2XSS A;  1AWI A;  1K54 A;  3W4P A;  2ZQA A;  1VM1 A;  3SZT A;  1LSV A;  3LO7 A;  4WEL A;  4PKY G;  1MKM A;  3W2Z A;  4MNR A;  2Y2H A;  4RRL A;  2QMI A;  1LL9 A;  3MZE A;  3FWL A;  3S4X A;  3IWQ A;  3GV9 A;  3RXX A;  3VP0 A;  2J9P A;  4X53 A;  3W4O A;  5CTN A;  1XPB A;  1K38 A;  2P04 A;  4YWZ A;  3HJI A;  2PRF A;  5HFO A;  5EEC A;  4BJP A;  4D60 A;  1VEU B;  1NRJ A;  1N9O A;  4R1G A;  3VOY A;  1BLS A;  4XUZ A;  4NXG A;  4KZ5 A;  3CWF A;  3LCE A;  3IS2 B;  3Q82 A;  3RJU A;  4Q0J A;  2HGV A;  3LEQ A;  3VSL A;  2P7J A;  1K55 C;  1NZO A;  5FSR A;  1IYO A;  3NUL A;  2PYP A;  4RRR A;  2J7V A;  4NET A;  3NHQ A;  1SDN A;  4EEU A;  2EXA A;  2H0Y A;  2VGJ A;  3UB5 P;  3ITA A;  4HP9 A;  1HLU P;  1NLY A;  1I5Q A;  4RRA A;  3VV4 A;  3DTM A;  4E3M A;  1NYY A;  4MMN A;  3K3C A;  5A92 A;  4HEF A;  1WA9 A;  3WS2 A;  5KMW A;  4B88 A;  3PD5 A;  3LY3 A;  1CK3 A;  4G3V A;  4KG2 A;  5EM1 A;  2P9V B;  1GSW A;  2O0Y A;  3M6H A;  4JLF A;  4OVD A;  5EVI C;  4JXG A;  2XF3 A;  1BLP A;  2WKE A;  2WKQ A;  4JGQ A;  2BG1 A;  4S2J A;  1SZV A;  5EPH A;  1H8Z A;  5FAO A;  1BSG A;  4LPZ A;  4HES A;  1S0W A;  5C5K A;  5DJT A;  4KG6 A;  4WLA A;  3H82 A;  4R3B A;  4S0I A;  1EI5 A;  4RRD A;  4S2I A;  3KOB A;  4U0X A;  2Q0O A;  2WYX A;  2WKH A;  4NBJ A;  1N9B A;  4QB8 A;  2Z6C A;  4WN5 A;  2M7V A;  4GHI B;  2J3T D;  2H28 A;  3IX4 A;  3BQ8 A;  3IH9 A;  1K4F A;  3S7N A;  1ONG A;  3WRZ A;  4FH4 A;  4N1H A;  1G28 A;  2CC1 A;  4GLQ A;  2Y2I A;  1SKO A;  1BUL A;  1RP5 A;  1N9L A;  3T4J A;  1MKI A;  1OME A;  1OTE A;  1PZO A;  5L2F A;  1P97 A;  4MBK A;  3E98 A;  5HD3 A;  3S7Q A;  2JKR I;  2PAV P;  3EEA A;  3LI8 A;  3MBZ A;  2A24 B;  3F1P B;  3HUM A;  4WZ4 A;  4Y5F A;  2XDM A;  2EX2 A;  3I7J A;  3VE4 A;  3A3E A;  3OCN A;  3T4K A;  3CMZ A;  3ULF A;  5DFX A;  3KO4 A;  1STZ A;  5FI2 A;  1K0K A;  2X71 A;  2R9W A;  4NKP A;  3BY8 A;  2R9X A;  1HVB A;  2ZOH A;  5HPI A;  1KDS A;  3MZF A;  1H0M A;  4EES A;  1X0O A;  4ID4 A;  2J3W A;  1XFQ A;  4M3K A;  5DVA A;  3T4O A;  3G35 A;  1P0Z A;  1YSP A;  2HL0 A;  2QJ7 A;  1W8Y A;  1IYS A;  3PD3 A;  1DY6 A;  2V8C A;  3NOP C;  3BY9 A;  4XXR A;  5AQB A;  3MSH A;  1GSV A;  2PYR A;  3PBT A;  3IBR A;  3M2K A;  3FZC A;  2V1Z A;  4DJ2 A;  5CED A;  2JCH A;  2Y2K A;  4HI4 A;  4CJN A;  1N9N A;  1CJF A;  3V3S A;  2BAS A;  2W3E A;  2KOI A; 
#chains in the Genus database with same CATH homology
 5CHU A;  4HBT A;  4GD6 A;  4B4Z A;  1PI4 A;  5DF8 A;  1NXY A;  3IF5 A;  3MZD A;  3OZH A;  5EOE A;  1FCN A;  2Z2M B;  4WBG A;  3ZDJ A;  3KO3 A;  1FCO A;  5HL1 A;  1W5D A;  2Y55 A;  5FDH A;  1RGY A;  1FR1 A;  3FV7 A;  1ES2 A;  4LV2 A;  2X01 A;  3A3J A;  4N92 A;  2A3U A;  2H5S A;  2XD5 A;  3BEB A;  5DTS A;  4S0K A;  3N8L A;  1YLJ A;  4UA9 A;  4OOL A;  5GHY A;  1WYB A;  5AQ7 A;  4C6Y A;  4KZB A;  2Y2L A;  1G6A A;  1KGE A;  4GDB A;  1JTD A;  4ZTK A;  4GZB A;  5GL9 A;  3HUO A;  5HW3 A;  3KOC A;  4WYY A;  4GNU A;  3KNF A;  3LY4 A;  3CJM A;  3S22 A;  1PZP A;  5M18 A;  3G4P A;  4S2K A;  3KOD A;  1E3U D;  1ES3 A;  1I2W A;  2Y2P A;  3OPR A;  4K0W A;  4PM7 A;  4NBI A;  5FQ9 A;  5EVL A;  2OLU A;  2ZC4 B;  1KGG A;  4RR9 A;  3O87 A;  1TDG A;  1Z6F A;  1FCM A;  3HVF A;  3PD2 A;  4QY6 A;  2ZM8 A;  4S2N A;  3UY6 A;  3HBR A;  2XFS A;  4OPZ A;  4R23 A;  4S03 A;  3G30 A;  5DF7 A;  2JC7 A;  4PM6 A;  2XQZ A;  2OLV A;  5EVI B;  4RRM A;  3HLG A;  4PM9 A;  3NC8 A;  4LV3 A;  4PM5 A;  3E2K A;  4BD1 A;  1KVL A;  2WAD A;  5FA7 A;  2FFF B;  4P87 A;  2A49 A;  4N9L A;  1Y54 A;  4KZ7 A;  4K0X A;  4KZ4 A;  1LI0 A;  5EE8 A;  1SKF A;  5JYP A;  1KE4 A;  4QD4 A;  5TGF A;  4ZDX A;  3UO9 A;  1ALQ A;  3W8K A;  2G2W A;  2DCF A;  1DJC A;  2IWC A;  4S2O A;  3ZNT A;  3B3X A;  3PBN A;  4N9K A;  1JWV A;  5FQI A;  1LHY A;  2Y2O A;  1N4O A;  1YM1 A;  3HLD A;  1K57 A;  1KE3 A;  1PIO A;  4KZ6 A;  1CI8 A;  3S1Y A;  4QY5 A;  3PBO A;  3LMT A;  1XGJ A;  2XK1 A;  1YLY A;  4DF6 A;  5KSC A;  4ZJ1 A;  3TG9 A;  3TOI A;  1GCE A;  1MPL A;  4P0M A;  3V50 A;  2HDR A;  4C3Q A;  5M19 A;  4LCL A;  4R3J A;  1JWP A;  1YLT A;  1Y2Q A;  5HX9 A;  4RRB A;  4JF6 A;  4OP8 A;  3A3D A;  3PBS A;  5EOO A;  2HDQ A;  1L0F A;  5G18 A;  1PW1 A;  2Y59 A;  3IT9 A;  3MKE A;  2B5R A;  3IQA A;  4OOY A;  4JBF A;  3ZG0 A;  4O7D A;  3NCK A;  4RRH A;  1K4E A;  4RRQ A;  3NBL A;  3E2L A;  2QZ6 A;  4MBH A;  3RXW A;  3FKV A;  4WEK A;  4Q8I A;  3AGF A;  2ZM0 A;  1W8Q A;  3HLC A;  4S2N C;  5E2E A;  4DXB A;  3KO9 A;  2WK0 A;  1M6K A;  2EX8 A;  4X56 A;  2GDN A;  2C5W B;  3DW0 A;  4R4S A;  2HL1 A;  2Z2L B;  2XEP A;  3SH8 A;  4GN2 A;  1YMX A;  1TEM A;  3BFC A;  4X55 A;  1PWD A;  3BRM A;  5FQQ A;  1ZC2 A;  4RRI A;  1HTZ A;  2EXB A;  4X68 A;  4NK3 A;  4KEN B;  1WYC A;  2OSU A;  3O3V A;  2DBO A;  2WAE A;  4EV4 A;  1S6R A;  2ZC5 B;  4RRK A;  2X02 A;  2ZQ7 A;  4OPR A;  1MWT A;  4K91 A;  3NDE A;  1XKZ A;  2ZQC A;  1DJB A;  1ESU A;  4S2P A;  1JTG A;  4S2L A;  1J9M A;  4UA7 A;  4GKU A;  4CPK A;  1IYQ A;  2Q9N A;  5TFQ A;  3BLS A;  2XLN A;  3IXH A;  4JF5 A;  4OLD A;  3VSK A;  5CER A;  4FSF A;  5HAR A;  4FD8 A;  1ES4 A;  1NZU A;  3D4F A;  4OOM A;  1LI9 A;  3MFD A;  5GLA A;  4OQI A;  4OKP A;  4RRJ A;  4KZ3 A;  3FYZ A;  3N8R A;  3W4Q A;  1XA1 A;  4DE3 A;  4EBN A;  1IEL A;  1K57 C;  4E3L A;  3QNC A;  5AQA A;  4IBR A;  3SH7 A;  2HL2 A;  2ZC3 B;  5A90 A;  1ZG6 A;  3PBR A;  3UN7 A;  1FSW A;  3QNB A;  2QPN A;  4KZ8 A;  4MEZ A;  5F1G A;  2Y91 A;  5J8X A;  5DTK A;  4RR6 A;  1YT4 A;  2ZM2 A;  3NIA A;  4S0J A;  5EUA A;  4QU3 A;  1YLP A;  3BFE A;  3IF6 A;  1K55 A;  3CZD A;  3IXB A;  3SOI A;  3IXG A;  3G2Z A;  2WGV A;  1ERO A;  3NDG A;  4WMC D;  1L0E A;  4DDY A;  1JKE A;  4RRG A;  4E3J A;  1TVF A;  2EFU A;  4JF4 A;  5FI7 A;  3ZG7 B;  5CHJ A;  2PU2 A;  3Q1F A;  3O88 A;  5TR7 A;  1K54 A;  3UE3 A;  3W4P A;  2ZQA A;  1VM1 A;  2XR0 A;  2Y2N A;  3Q07 A;  5EVI D;  4YIN A;  1I2S A;  2XFT A;  3N8S A;  4KG5 A;  1CEG A;  4RVA A;  1NY0 A;  3LO7 A;  2VGK A;  4WEL A;  2HDU A;  3G31 A;  1K6R A;  2ZLY A;  3OPL A;  3ZG5 A;  3DWK A;  4S02 A;  1MY8 A;  2WUQ A;  3N4I A;  4DE1 A;  4MNR A;  1ONH A;  3OCL A;  2WGW B;  2H0T A;  2Y2H A;  2QMI A;  5HAQ A;  4RRL A;  1LL9 A;  4D2O A;  3MZE A;  3FWL A;  3S4X A;  3ITB A;  4R4R A;  4RYE A;  1NRF A;  1XXM A;  4ZJ2 A;  4BL3 A;  1JVJ A;  2HDS A;  4JXS A;  4U3T A;  5FQM A;  2HP5 A;  3ZHH A;  3IWQ A;  4IED A;  3IH8 A;  1H8Y A;  5M1A A;  3GV9 A;  3RXX A;  3VP0 A;  3GMW A;  2ZC6 B;  5GLD A;  3VMA A;  2J9P A;  3G2Y A;  3Q7V B;  4X53 A;  3W4O A;  5CTN A;  1XPB A;  4RR7 A;  1K38 A;  3ZCZ A;  4WMC A;  1FOF A;  5HFO A;  5DTT A;  5EEC A;  1QME A;  4BJP A;  1Q2Q A;  4UAA A;  1YLW A;  4R1G A;  5E2F A;  3VOY A;  1BLS A;  1K6S A;  4S0L A;  4OH0 A;  4RRC A;  4XUZ A;  4H8R A;  4KZ5 A;  5EVI A;  2HPB A;  1AXB A;  1K56 D;  3LCE A;  3TSG A;  5D3O A;  3A3I A;  3BFG A;  4FCF A;  3KO5 A;  3PAG A;  5DF9 A;  3Q82 A;  3RJU A;  3WS0 A;  3WWX A;  4XUX A;  2WKI A;  3VSL A;  1DJA A;  3EQV A;  3IF6 C;  4A5R A;  1K55 C;  2ZMA A;  4MBF A;  3VP3 A;  1NZO A;  2J8Y A;  5FSR A;  1IYO A;  1MWR A;  1YLZ A;  3V39 A;  3ZFZ A;  1XX2 A;  1TDL A;  5F82 A;  5CTM A;  4RRR A;  5FAP A;  1BZA A;  2J7V A;  4NET A;  4OPY A;  1K54 C;  3M6B A;  3BLM A;  3VFF A;  4OQG A;  1PWC A;  3C7U A;  4JXW A;  2OV5 A;  1SDN A;  3M2J A;  2V2F F;  3HUN A;  5CHM A;  3LMU A;  1NJ4 A;  2EXA A;  2H0Y A;  4ZJ3 A;  2VGJ A;  1ERQ A;  4JKT A;  2HKZ A;  5F83 A;  1MBL A;  3LMV A;  3ITA A;  1XP4 A;  1SDE A;  2ZC7 A;  3KNP A;  3UDI A;  3PAE A;  4LV0 A;  1I5Q A;  4RRA A;  1W7F A;  3ZVT A;  4E3I A;  2Y2Q A;  4KQQ A;  3BFF A;  3HRE A;  2WZX A;  1MWU A;  3DTM A;  1NYY A;  2IWB A;  4E3M A;  1BLC A;  5E43 A;  1K56 A;  3WS4 A;  2H10 A;  3PBQ A;  4HEF A;  5A92 A;  1GHM A;  3C7V A;  3WS2 A;  5KMW A;  3IHB A;  3IWO A;  1MWS A;  5F1F A;  4B88 A;  3PD5 A;  2XH9 A;  4U0T A;  3LY3 A;  1CK3 A;  1PWG A;  4KG2 A;  1MXO A;  3UPP A;  3C5A A;  3N6I A;  1RCJ A;  4GOG A;  2P9V B;  1O7E A;  4S2M A;  3JYI A;  4DDS A;  3OPH A;  3WRT A;  2ZQ9 A;  3M6H A;  2PBY A;  2WGI A;  4X6T A;  3C4P A;  4JLF A;  4OVD A;  5EVI C;  4JXG A;  3VFH A;  4RX2 A;  2XF3 A;  2XGN A;  1BLP A;  4F94 A;  2WKE A;  2XD1 A;  1YMS A;  2BG1 A;  3HLW A;  4S2J A;  5J61 A;  3N7W A;  5EPH A;  1H8Z A;  1VQQ A;  2E8I A;  3CG5 A;  5FAO A;  1BSG A;  3OC2 A;  1FR6 A;  3SS4 A;  4GB7 A;  1PYY A;  3ZVW A;  1LLB A;  1GHP A;  3G34 A;  2HP6 A;  1YQS A;  1L0D A;  3FKW A;  5AQ9 A;  1EWZ A;  1FSY A;  1H5X A;  4HBU A;  3BFD A;  5GHX A;  4HES A;  1BUE A;  2DRW A;  3AGE A;  1E4D A;  4Y7P A;  1S0W A;  1CI9 A;  5FQJ A;  3NY4 A;  4PM8 A;  2RCX A;  4KG6 A;  3G32 A;  2JBF A;  1BTL A;  2DNS A;  4QHC A;  3OPP A;  4R3B A;  3PD4 A;  4S0I A;  3VP2 A;  4GDN A;  1KDW A;  1KGF A;  5CEB A;  5FAS A;  1EI5 A;  4RRD A;  4OON A;  4S2I A;  3KOB A;  3DWZ A;  1GA9 A;  4U0X A;  4P85 A;  3ZG9 B;  5FQK A;  4E6X A;  4EUZ A;  2V20 A;  1NYM A;  3A3F A;  3MKF A;  4IBX A;  2WYX A;  1IEM A;  3BYD A;  4IVK A;  2WKH A;  2ZQD A;  4NBJ A;  2WZZ A;  4E3O A;  1N9B A;  4FH2 A;  4E3K A;  4QB8 A;  3KO7 A;  3ISG A;  3QHY A;  4PMA A;  1SHV A;  4B4X A;  1HZO A;  3V3R A;  3IH9 A;  3GQZ A;  1GA0 A;  1K4F A;  5CRF A;  4BEN A;  1G68 A;  1ONG A;  4PPR A;  3WRZ A;  2WAF A;  4FH4 A;  3ZG8 B;  3ZNY A;  4N1H A;  4EWF A;  1ZG4 A;  5KSH A;  2G2U A;  2EX9 A;  4WZ5 A;  3SS5 A;  2CC1 A;  5GLC A;  1ERM A;  3BEC A;  2Y2I A;  3UDX A;  3IXD A;  3SS3 A;  1BUL A;  1RP5 A;  5E2G A;  2UWX A;  1ES5 A;  2Y2G A;  3LEZ A;  4EQI A;  1SCW A;  5I94 A;  1FQG A;  4OPQ A;  1HD8 A;  1XA7 A;  1MKI A;  3NI9 A;  4MLL A;  3WS1 A;  1K25 A;  1OME A;  2C6W B;  2WGW A;  4ZBE A;  3WS5 A;  3MXS A;  4BLM A;  1PZO A;  5L2F A;  4EBP A;  2IWD A;  4RR8 A;  4KZA A;  4MBK A;  5U47 A;  1WE4 A;  3UPN A;  4DE0 A;  4OQH A;  3MBZ A;  1IYP A;  2J9O A;  3VP1 A;  1BLH A;  1RGZ A;  4JPM A;  1M40 A;  5IHV A;  2JE5 A;  1KE0 A;  3Q7V A;  3HUM A;  4WZ4 A;  2ZJ9 A;  2XDM A;  2Q9M A;  3Q7Z A;  4P6B A;  4N1X A;  4DKI A;  5GLB A;  4WM9 A;  3ZGA B;  1TC5 A;  2EX2 A;  3I7J A;  4L0L A;  2I72 A;  4DXC A;  4KQO A;  1L0G A;  3AGD A;  1GHI A;  1W79 A;  3A3E A;  1PI5 A;  3GR2 A;  3OCN A;  3GSG A;  4GD8 A;  3CMZ A;  3PTE A;  4Y0T A;  3SH9 A;  2P74 A;  4BQM A;  3KO4 A;  1E3U A;  3VP4 A;  4E3N A;  1U60 A;  2FFY A;  2PU4 A;  3HLF A;  3IWI A;  1ZKJ A;  4IVI A;  5FAQ A;  3UNW A;  4EBL A;  5JYO A;  5FI2 A;  5A91 A;  4Y0U A;  2X71 A;  5CGS A;  2Y2M A;  4LCM A;  4RA7 A;  3VOZ A;  4C75 A;  4DE2 A;  4YFM A;  2RL3 A;  2ZD8 A;  1BT5 A;  4LV1 A;  2ZQ8 A;  2R9W A;  5CGW A;  4BL2 A;  3GVB A;  1Q2P A;  1J7G A;  1PW8 A;  5HAI A;  2R9X A;  1HVB A;  4ZAM A;  1ESI A;  4QJG A;  1KDS A;  3MZF A;  4WZ5 C;  1O07 A;  1IKG A;  4X69 A;  4ID4 A;  5E2H A;  4M3K A;  4OLG A;  5DVA A;  4LEN A;  1L2S A;  3G35 A;  5FAT A;  4R0Q A;  5CXW A;  2BLS A;  5GHZ A;  4E6W A;  4JXV A;  2EFX A;  4UHU A;  2OKV A;  1IKI A;  3O86 A;  4DRT A;  5KZH A;  4WEJ A;  2HL0 A;  4OP5 A;  4RRF A;  3HLE A;  2Y4A A;  3HL9 A;  1W8Y A;  1E25 A;  2HP9 A;  4UA6 A;  5FI6 A;  1IYS A;  3HLB A;  3UE0 A;  3V5M A;  4Z9Q A;  3PD3 A;  1QMF A;  1DY6 A;  1C3B A;  5A93 A;  3P98 A;  4OQ0 A;  3Q81 A;  5HAP A;  3EQU A;  1XGI A;  4XXR A;  5CGX A;  5AQB A;  1LL5 A;  1JWZ A;  3GRJ A;  3MXR A;  4KQR A;  3PBT A;  4Y0O A;  3M2K A;  3C4O A;  3UE1 A;  3FZC A;  3IHA A;  2V1Z A;  3IF6 B;  4RX3 A;  3UDF A;  5CEC A;  2JCH A;  5CED A;  2Y2K A;  3BM6 A;  4CJN A;  2P9V A;  5BOH A;  3UPO A;  4BD0 A;  2Y2J A;  1KVM A;  3V3S A;  3P09 A;  2EX6 A;  4KZ9 A;  3GTC A;  1CEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...