3V39A

Bd3459, a predatory peptidoglycan endopeptidase from bdellovibrio bacteriovorus
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
402
structure length
402
Chain Sequence
MKVYLNSMCHMAANSKTQQIQGDDNKDDKFPLASISKVVTTLWAVDRLGPDYRFKTKLHVTPTANGSYDIHIEGSRDPLFGRNMSYFLISELNRMKITKIEKLTFDENFLLAWLAEEKPMIGGTTPKYDTVEQQASIVRATLTSSFATAISPGYYTILKTKAARIGVQMSNRPKIDVRTISFVKKAEFQKNEKSTTMVLMSAPLKTILKRMNNQSNNYIADNLYWNLGGTEAFNAYIAGKMQADTSDIEFHNGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMAVAAKDKASTVGSYGGVMAGSTTAKTGSVNKAKTLMGSVSTKNGEIYFAVLMHTDYDKSRSDWGVASQQIKNKVSQLINQNGGPKAIKYTEQLPLPFDKYSYLTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanyl-D-alanine carboxypeptidase
publication title Specialized peptidoglycan hydrolases sculpt the intra-bacterial niche of predatory Bdellovibrio and increase population fitness.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 139
structure length 402
sequence length 402
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2011-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v39A01
3.50.80.20 Alpha Beta 3-Layer(bba) Sandwich D-tyrosyl-trna(Tyr) Deacylase; Chain: A; D-tyrosyl-trna(Tyr) Deacylase; Chain: A; 3v39A02
3OCNA 3DWKA 1Z6FA 2P9VA 2Y2MA 3HUOA 1KDSA 2HPBA 3A3DA 1KVMA 2Y2JA 3HL9A 1DJBA 3DW0A 3ZG9B 4DE3A 3PBOA 1FR6A 4GOGA 3G2ZA 3G30A 4QD4A 4JLFA 4JXGA 4DDYA 5L2FA 3G35A 4JBFA 2IWCA 4N92A 1PW1A 4S2NA 4S2LA 3BFCA 2WGWB 5EOEA 1K54C 1ONHA 1E25A 5M1AA 4E3MA 5KSCA 1QMFA 3BLSA 5AQ7A 3WS2A 1ES4A 1XPBA 2EFXA 2JCHA 4PPRA 4E3JA 3UE3A 4UAAA 1XGJA 2JBFA 3B3XA 3NCKA 4PM6A 4WBGA 3ZGAB 2ZC3B 3OPRA 1L2SA 3UDXA 5BOHA 3N8LA 4KZ9A 4EBPA 4DF6A 5A91A 3D4FA 5IHVA 1FOFA 4DRTA 4R3BA 1O07A 2VGKA 3UPPA 3C5AA 5JYPA 1GCEA 2Y91A 3BECA 2RL3A 1HVBA 5E2GA 5DTSA 4E3NA 4LV3A 2ZM0A 1OMEA 4OONA 4P87A 4E3IA 1C3BA 4R4SA 2A3UA 1H8YA 3HUNA 4OQ0A 3FZCA 3VP0A 3RXWA 1TDLA 4GB7A 3VFFA 3VP1A 3O3VA 2ZC6B 3OZHA 4E3KA 5AQBA 4KZAA 3LCEA 2QMIA 5FQMA 4OQIA 2Q9MA 3IF5A 2OLUA 2EXBA 1AXBA 3W4QA 3BFEA 4BL3A 2ZC7A 4EV4A 4CPKA 4X55A 4R4RA 1NXYA 1BTLA 3ZG0A 2Z2MB 3LEZA 2IWBA 4UA9A 4E3OA 2XH9A 3UE0A 4UA6A 1W8YA 4XXRA 1GHPA 4GN2A 4M3KA 4MNRA 4LCMA 1FR1A 1IYQA 1SCWA 2WKIA 3G31A 2Y2GA 4JXVA 4OQHA 4RX2A 4KZBA 4FH2A 3WS5A 3WS1A 3WWXA 1CEGA 1IYPA 5HFOA 1LI9A 4FH4A 1K4EA 1K57C 1FSWA 3G2YA 4S2JA 1O7EA 3ZVWA 4OKPA 1W5DA 1PIOA 1HD8A 3EQVA 1N9BA 1K56D 2ZMAA 1NY0A 2V2FF 3NDGA 5EPHA 1H5XA 1XP4A 2Y55A 2ZQ8A 3IF6B 5HW3A 3EQUA 1BUEA 1LL5A 3HLCA 5CERA 3FWLA 3Q7ZA 3SS4A 3MKFA 4R1GA 4K0XA 3E2LA 4EBLA 5DF9A 3UE1A 1GA0A 2XDMA 5DTTA 2HDUA 2XR0A 3HLBA 5JYOA 4ZAMA 5AQAA 1NYMA 2C5WB 3GV9A 2XQZA 3IQAA 3MZDA 3ZDJA 2V1ZA 2WGWA 1CI9A 5CTMA 4RVAA 3JYIA 5CHJA 2ZLYA 3BFGA 1MBLA 1W8QA 2G2UA 3BFDA 4KQQA 4N9LA 5CTNA 3GQZA 3V3RA 5J8XA 2DRWA 1PW8A 1BZAA 2OSUA 3IT9A 4FD8A 4OOYA 2Z2LB 1KGGA 2GDNA 3CMZA 2EX2A 3I7JA 5EVIA 1G6AA 5TR7A 2H5SA 1MWUA 2I72A 3HVFA 3LY4A 4S2PA 4PMAA 3WS4A 4LENA 2EX6A 3ZFZA 5HAIA 3GRJA 4OOMA 1GA9A 3Q1FA 3HREA 4OVDA 4C6YA 1DY6A 5FQIA 5FATA 4OP8A 1L0GA 4KG6A 3IWIA 2ZM8A 4S2MA 4MBFA 4DDSA 3Q7VA 4CJNA 3MXSA 5G18A 3CJMA 3G32A 4Y0TA 1MY8A 1VM1A 3ITBA 1LLBA 2ZM2A 3GR2A 2IWDA 3IHAA 1WYCA 4B4XA 4DKIA 4H8RA 5EUAA 1YT4A 4EBNA 4JF4A 1GHIA 2ZQ7A 4S2NC 3V5MA 5E43A 2ZC4B 2Y2LA 3HLWA 1YLTA 3ZNTA 1KE0A 3LO7A 1ERMA 2Q9NA 2B5RA 5TFQA 2Y2HA 1YLYA 3CZDA 1KDWA 3P98A 4EWFA 4YFMA 2RCXA 4E6XA 3V3SA 3RJUA 4RYEA 4X69A 3OPLA 3A3FA 4GD6A 3C7UA 1BT5A 1HZOA 4P85A 3WRTA 5CEBA 3VFHA 1DJAA 3M2KA 4QHCA 4BD1A 5A92A 3IF6C 1NYYA 4MBHA 1K54A 1HTZA 5DVAA 5FI2A 1IKIA 4IVKA 3A3EA 3V39A 4WMCA 3Q81A 3PBRA 4KQOA 2A49A 1BLHA 3A3IA 4OPQA 1RP5A 3TSGA 4ZDXA 3FYZA 1SHVA 4HESA 5CGSA 5E2EA 3VOZA 1J9MA 4HBUA 3N7WA 1CI8A 3MZFA 1I5QA 3W4OA 1YQSA 1FSYA 4QY5A 4WYYA 5EOOA 2WZXA 1YLWA 1K6RA 2XK1A 4OLDA 1WE4A 5D3OA 1XX2A 5F1GA 3GVBA 3HLFA 1K6SA 3IHBA 3P09A 3ZHHA 4XUXA 3IXDA 5M19A 2R9XA 1E3UA 2PU4A 1I2WA 3Q07A 3N6IA 5EVLA 1K38A 2WK0A 2P9VB 1M6KA 3UPOA 2WZZA 5GLCA 2HDRA 3SH7A 4KZ5A 3UPNA 1JTGA 4BLMA 1VQQA 1NZUA 2ZQ9A 4WZ5A 2Y2IA 1EWZA 1XKZA 3IXHA 5GHZA 3ZCZA 4BENA 2PU2A 3ZG7B 1LHYA 5FQQA 5GL9A 1S0WA 4JKTA 5M18A 4OPYA 5HX9A 4KZ4A 1BLPA 4ZJ1A 4ID4A 4KZ3A 1H8ZA 4C3QA 1SDEA 1ES3A 3HLDA 3PAGA 4X6TA 4BQMA 5TGFA 1IYOA 3DTMA 1TEMA 2Y59A 4LV0A 4E6WA 1ERQA 3G4PA 3VOYA 5EVID 3SS3A 2HP5A 3NIAA 2CC1A 2FFFB 2ZJ9A 2Y4AA 4R3JA 4DE2A 3V50A 1M40A 1LL9A 3LY3A 5FQ9A 3PBQA 5FI7A 5A90A 3OC2A 4LV1A 1MWRA 2J9OA 4RX3A 5DTKA 1JVJA 2J7VA 3BLMA 3UNWA 4FCFA 1ES5A 1K57A 5FAPA 1TDGA 4JPMA 1CEFA 1W7FA 2WKEA 2WYXA 1FCMA 4KG5A 2VGJA 4B88A 3VP3A 3CG5A 1K55C 4IVIA 3UDIA 1RGYA 1XXMA 3SH9A 3VP2A 2J8YA 3M2JA 1ONGA 4S2IA 4IBXA 4KZ6A 1DJCA 3N8SA 4S2OA 3QHYA 3UN7A 5F1FA 4BJPA 1BULA 4Y0OA 2HDSA 3BM6A 1YLPA 4XUZA 4Y7PA 4C75A 2ZC5B 1L0EA 2ZQDA 4EQIA 2XEPA 1QMEA 1MWSA 1BLCA 3DWZA 1IEMA 4KENB 5GLAA 2Y2NA 1K25A 1Y54A 4DE1A 2EX9A 1U60A 1YMXA 5CGWA 3BFFA 5FQJA 2ZQAA 4WMCD 5F82A 5CRFA 5GLBA 1MPLA 4MLLA 5F83A 4DXCA 1K4FA 2JE5A 4P0MA 2QZ6A 4OPRA 4QB8A 4S2KA 3ITAA 3FKWA 4X56A 5GHYA 2XLNA 5KSHA 1BLSA 3HBRA 2WUQA 3RXXA 3O86A 5HAPA 2HP9A 1ZG4A 2Y2PA 5FAOA 1XA1A 5GHXA 1RCJA 3TG9A 1FCOA 5EE8A 5A93A 2DCFA 2WAFA 3UY6A 2H0YA 3Q82A 1XGIA 3PBSA 5GLDA 1ZC2A 1E3UD 3VSLA 5FA7A 1PWCA 1ESUA 4BD0A 3MXRA 4FSFA 5HL1A 1PZPA 1IELA 4KQRA 5EECA 2EX8A 4HEFA 2XD5A 3SOIA 2XF3A 1EROA 1LI0A 2C6WB 3TOIA 4P6BA 3O87A 4U3TA 1NJ4A 5U47A 4QJGA 1PI4A 3S4XA 2QPNA 4QU3A 1XA7A 2JC7A 2G2WA 5FQKA 3HLGA 4ZJ2A 1YMSA 4DXBA 1L0FA 3ISGA 1GHMA 1YM1A 1YLZA 4GKUA 2X01A 4N9KA 4D2OA 3NBLA 1MWTA 2R9WA 4KG2A 3NY4A 4X68A 2HDQA 1KVLA 3QNCA 4WEJA 5CHMA 2OLVA 1Q2PA 4OP5A 3BEBA 4YINA 2FFYA 2XGNA 4GDNA 5EVIB 3W8KA 3OPPA 5DF7A 3IF6A 1TVFA 1FCNA 1ES2A 2WGIA 4GD8A 1JWPA 3PAEA 2ZD8A 3NC8A 2OV5A 3MZEA 2V20A 4MBKA 3G34A 3UDFA 2E8IA 1KGEA 3GTCA 4NK3A 1L0DA 4ZBEA 5FI6A 3QNBA 5E2HA 4Q8IA 1FQGA 3VSKA 2EXAA 3IWQA 1KE3A 4HBTA 3IH9A 4OOLA 3Q7VB 5FAQA 5HARA 2WKHA 5AQ9A 4K0WA 3ZVTA 1NRFA 4WZ5C 5I94A 4OH0A 1MXOA 3PTEA 2WADA 1SDNA 4IEDA 1KE4A 2HP6A 3S1YA 4RA7A 1KGFA 2PBYA 3MFDA 2UWXA 4OPZA 3OCLA 5KZHA 4Y0UA 4LV2A 1ZG6A 4DE0A 4WM9A 3PBNA 2X02A 4JF6A 2DNSA 5DF8A 4F94A 3WRZA 1EI5A 2Y2OA 3IH8A 1ESIA 4GZBA 4JF5A 4OLGA 4R0QA 5CGXA 4JXWA 1I2SA 4O7DA 4UHUA 1SKFA 3E2KA 3FV7A 3IXBA 3BRMA 3W4PA 4Z9QA 3HUMA 1CK3A 4BL2A 3VP4A 1ZKJA 2P74A 4ZJ3A 2EFUA 1PZOA 2Y2KA 1PWDA 4LCLA 4U0TA 1RGZA 3AGDA 4U0XA 4PM8A 3IXGA 3M6BA 3MKEA 4PM9A 3S22A 4EUZA 3SH8A 1IKGA 4GNUA 3IWOA 4L0LA 2BG1A 2XFTA 3NDEA 4N1HA 1JWVA 4JXSA 3BYDA 5CHUA 4R23A 5FASA 2WGVA 3C4OA 5KMWA 3C4PA 1W79A 1G68A 1N4OA 3C7VA 4WZ4A 5E2FA 3AGEA 5FSRA 1ALQA 3N4IA 5CXWA 4KZ8A 4E3LA 1MKIA 3FKVA 3NI9A 3O88A 4ZTKA 4PM5A 4UA7A 3A3JA 1JWZA 4X53A 3SS5A 1BSGA 4K91A 3HLEA 3GMWA 4MEZA 1NZOA 1K55A 2BLSA 3MBZA 5EVIC 2X71A 2XFSA 3PBTA 4IBRA 4QY6A 3ZG8B 4PM7A 2H10A 3N8RA 4WELA 4N1XA 1S6RA 1JTDA 4GDBA 3OPHA 2H0TA 1PYYA 4NETA 3VMAA 4KZ7A 3UO9A 4A5RA 2ZQCA 1YLJA 4B4ZA 2WAEA 1WYBA 5FDHA 1PWGA 1Q2QA 4WEKA 3GSGA 4OQGA 3ZG5A 2J9PA 1K56A 1PI5A 5CEDA 2XD1A 3ZNYA 3M6HA 5CECA 5HAQA 2Y2QA 3WS0A 3AGFA 1E4DA 1IYSA
chains in the Genus database with same CATH superfamily
3DWKA 4BBTA 3V67A 4R6LA 1KDSA 4DE3A 3DW0A 1STZA 3LI8A 3PBOA 1FR6A 4JGRA 4Y15A 4S2NA 4S2LA 2WGWB 2PT7A 5EOEA 1K54C 1ONHA 4UQIS 4E3MA 3JVUA 3LIBA 4NBJA 3D72A 3R4KA 4UAAA 1XGJA 2JBFA 4IJGA 2QWSA 1L2SA 3N8LA 4KZ9A 4EBPA 3RFBA 4DF6A 4Y17A 4DRTA 2QJ5A 1O07A 2VGKA 3UPPA 3C5AA 2W3FA 4E3NA 4OONA 1VEUB 3FZCA 3RXWA 3VP1A 2ZC6B 4KZAA 3LCEA 2Q9MA 3IF5A 4EU0A 3BFEA 4I3JA 2ZC7A 3LIEA 4X55A 1FIKA 3KX0X 4R4RA 3E4PA 1OTAA 2IWBA 3UE0A 4S02A 4GN2A 4M3KA 4MNRA 1IYQA 1SCWA 2WKIA 1UWPX 4IHQA 4JXVA 4KZBA 2HL1A 3WS5A 3WS1A 5HFOA 1LL8A 4FH4A 3G2YA 1O7EA 2KOIA 4I3AA 3EQVA 1N9BA 2ZMAA 1IOUA 2V2FF 2XRNA 2V8CA 3OBFA 1OTDA 5HZHA 3DTEA 1BUEA 1LL5A 5CERA 4RR7A 3Q7ZA 3NECA 4K0XA 3E2LA 5EVEA 3BQ8A 2XDMA 5DTTA 3HLBA 1Y2QA 3B42A 4GHIB 3GV9A 5HWWA 4RRRA 1TS7A 4RVAA 1F5MA 5CTNA 2OSUA 1KGGA 3I7JA 1MWUA 4WLAA 4PMAA 2PD7A 2ZL1A 5EV0A 1EW0A 1DY6A 1X0OA 5FATA 4UQIM 3C30A 4D60A 4S2MA 4DDSA 5G18A 3CJMA 5DFYA 1WYCA 5FL3A 3S7QA 4S2NC 1Y28A 3V5MA 2H28A 3T12B 3SZTA 3HLWA 4RRKA 3LO7A 4YFMA 2RCXA 3L7HA 3C7UA 2WKRA 3WRTA 4QHCA 4BD1A 3IF6C 3T1RA 4KUKA 4IVKA 4LFUA 2PR5A 3Q81A 3NOPC 4OPQA 1RP5A 4Y5FA 3UB6A 3FG8A 1J9MA 4HBUA 1CI8A 1I5QA 4NEED 1FSYA 3F1PB 1K6RA 2K2NA 5D3OA 2M7UA 1XX2A 5F1GA 3IX4A 4NXGA 3E98A 1I2WA 1M6KA 3T4JA 3UPNA 4BLMA 1ACFA 1YKDA 3IXHA 5FQQA 1S0WA 4OPYA 1YPRA 4ZJ1A 4RRAA 4ID4A 4HQAA 1SKOA 5TGFA 2WKPA 1ERQA 2HP5A 5DKKA 2Y4AA 3ZYTA 3LY3A 5FQ9A 4R3AA 5DJTA 5I5LA 3OC2A 5TBMB 3UNWA 4FCFA 1ES5A 1K57A 4FUWA 5FAPA 1FCMA 3KYZA 1XXMA 4YWZA 4LPZA 4ARZA 3N8SA 3IX3A 2HDSA 3BM6A 1YLPA 5L10A 3E0YA 4Y7PA 2W1TA 1GSXA 4EQIA 4EESA 4S0KA 5FQJA 5GLBA 1K4FA 4G3VA 4QB8A 4S2KA 3ITAA 3FKWA 4X56A 5GHYA 5KSHA 2O9CA 3RXXA 4LRZE 1TD5A 1ZG4A 5GHXA 2DCFA 2H0YA 1XGIA 3CITA 3UB7A 1BYWA 1ZC2A 1ESUA 2K7SA 4FSFA 4RRGA 1IELA 1SZVA 5EECA 5EFWA 3E4QA 2C6WB 4QJGA 1PI4A 3S4XA 2V0WA 1XA7A 1YMSA 4DXBA 1YLZA 4D2OA 3NBLA 2L4RA 5L09A 2FFYA 2XGNA 4HJ3A 1TVFA 2WGIA 3IS2A 1JWPA 2B18A 2ZD8A 3G34A 3CLOA 2LB9A 4ZBEA 3KSFA 4Q8IA 2EXAA 3OOVA 1KE3A 4HBTA 2Y79A 2WKHA 3DAVA 3QP6A 3T4KA 3ZVTA 4DJ2A 2V1AA 3PTEA 3PD4A 2K31A 1KGFA 2BASA 2UWXA 5KZHA 2AVXA 1ZG6A 4DE0A 2Z6CA 3T4OA 3PBNA 5DF8A 4G3WA 1OPXA 1DP9A 4OLGA 4X25A 4UHUA 1SKFA 3W4PA 3HUMA 2OOLA 1T19A 4HJ4A 2EFUA 3MKEA 3IWOA 2XFTA 4N1HA 3KOCA 5CHUA 3MF0A 2WGVA 4MN6A 1W79A 3LR4A 1N4OA 4P6ZS 3S7NA 1ALQA 3H82A 1MKIA 4RRBA 3O88A 3EGXC 1V9ZA 2JHEA 1P9WA 2PAVP 1K55A 2BLSA 4PM7A 3CUEA 4S0IA 4GDBA 4RR9A 3FPWA 4A5RA 4ME4A 3S7OA 1YLJA 1XJ6A 2WAEA 5HDSA 1SKOB 3ULFA 3ZG5A 1K56A 1PI5A 2A2LA 5HAQA 3WS0A 1E4DA 3OCNA 2V9AA 2L1MA 3MJQA 1S66L 3HJIA 3UMEA 3ZG9B 1DJBA 3W2ZA 4IUHA 4GOGA 4QD4A 4JLFA 2P08A 2FH5A 4N92A 4JBFA 2ACGA 2IWCA 2D02A 3PD5A 2O99A 3BFCA 4DJ3A 3T1XA 3BLSA 5AQ7A 1ES4A 2EFXA 4E3JA 3UE3A 4WBGA 3ZGAB 2ZC3B 3BQAA 5CX7A 2W1TB 1NLYA 4LRXC 5IHVA 3KNPA 4R3BA 3K3CA 4LRYC 2Y91A 3A0VA 5DTSA 1OMEA 4K08A 4P87A 4CLCB 4E3IA 4B9OA 1TC5A 4R4SA 2HZ5A 2A3UA 4OQ0A 3CI6A 3VP0A 5AQBA 2QMIA 5FQMA 4OQIA 4CQHA 3W4QA 4RRCA 2ZOHA 3OLOA 2Z2MB 3L9KA 4LCMA 1OTEA 4HY8A 2YKFA 3NJAA 5HWTA 3G31A 4O8GA 1CEGA 4CLCE 4P6ZM 3ZVWA 4OKPA 1HD8A 2PDRA 1K56D 3K3DA 4Q0IA 5EPHA 5HW3A 1XP4A 2Y55A 3CPTB 3IS2B 4RRMA 3HLCA 2B02A 5J7EA 4EBLA 3DTIA 5JYOA 4ZAMA 1NYMA 4Z1WA 2VV8A 3ZDJA 5CTMA 3KO4A 3BFGA 3BFDA 2G2UA 5J8XA 1PW8A 1J7GA 4FD8A 2Z2LB 2A24A 2W3DA 2GDNA 2QYBA 2EX2A 5TR7A 1G6AA 2H5SA 1D06A 4S2PA 3PR6A 3WS4A 4LENA 3ZFZA 4OOMA 1GA9A 1Y4OA 5L8MA 4NXBA 2ZM8A 1IFQA 3U2AA 3MXSA 4KQDA 3G32A 1MY8A 1VM1A 2ZM2A 2JKGA 4B4XA 3TE8A 4H8RA 4EBNA 1GHIA 2D01A 4QPRA 2ZC4B 1KE0A 4RRIA 4ZRRA 2Q9NA 2B5RA 5J61A 3QP4A 1YLYA 4E6XA 1ZTUA 3RJUA 3LR3A 1BT5A 1XJ3A 3PD2A 1DJAA 1HTZA 4RRLA 3V39A 3A3EA 3H7WB 4WMCA 5HD5A 4BWIA 4KQOA 2A49A 5CGSA 3N7WA 4PAUA 1YQSA 4QY5A 1YLWA 1WE4A 3R7WA 1P97A 3GVBA 3HLFA 3P09A 5M19A 2R9XA 2PU4A 3Q07A 3N6IA 3UPOA 3SH7A 2HF6A 4KZ5A 1JTGA 3KO5A 1NZUA 2ZQ9A 4BBUA 3ZCZA 3NHQA 2EA9A 5GL9A 5M18A 1G5UA 4AFIA 4KZ4A 4H6JB 4KZ3A 3MQQA 1SDEA 1ES3A 3HLDA 3PAGA 4BQMA 1T1AA 1TEMA 1T1BA 3SS3A 2I9VA 3NIAA 5IU1A 4DE2A 3V50A 3F1OA 3PBQA 1V9YA 1FILA 1MWRA 2XA7S 5DTKA 1JVJA 2J7VA 4EW7A 1VETB 4KG5A 4B88A 3CG5A 4IVIA 5J3WA 1RGYA 3SH9A 3M2JA 1ONGA 1YSQA 4S2IA 2HGVA 1DJCA 2VEAA 5F1FA 1BULA 3T4SA 4PKYG 1L0EA 4GCZA 2WKQA 3NOUC 2XEPA 2PD8A 1QMEA 1MWSA 1IEMA 3TW8A 1T18A 1K25A 3MXQA 4DE1A 5F6AA 3BFFA 4EETB 4MN5A 4WMCD 5CRFA 1MPLA 4MLLA 1S67L 3F1NA 2VV7A 2Y2PA 4NG2A 5FAOA 1GSVA 3TG9A 1OT9A 5EE8A 3UY6A 2EWWA 3Q82A 3PBSA 5GLDA 1OJ5A 2HJEA 3VSLA 4HP9A 4XT2A 4BD0A 3MXRA 1AWIA 5HL1A 2EX8A 1LI0A 4P6BA 4Q0JA 2R78A 4QU3A 3IBRA 3MQOA 4ZJ2A 1L0FA 1OTIA 3ISGA 1F9IA 4GKUA 4KG2A 4X68A 2HDQA 3S7PA 3KODA 2ZMVA 2A24B 4EQ1A 5DF7A 3LGOA 5F69A 1FCNA 2JN7A 3NC8A 2OV5A 3MZEA 4EERA 2YKHA 1OT6A 1KGEA 3KOBA 1L0DA 5J4EA 5FI6A 3FC7A 3VSKA 3IH9A 1ODVA 5FAQA 3LYXA 5HDCA 5AQ9A 3MMHA 1NRFA 3DBAA 3NOTC 1XFNA 1MXOA 1SDNA 4IEDA 3S1YA 4RA7A 3B33A 3K2NA 2XROA 4GLQA 1LT0A 2XA7M 4GZBA 4FOFA 3FV7A 5G4ZA 4EEPA 4ZJ3A 2Y2KA 1PZOA 1PWDA 4U0TA 4U0XA 4PM8A 4PM9A 3SH8A 1IKGA 4R38A 1L3LA 3NDEA 4HNBA 2GX5A 4S03A 1G68A 2VZWA 3C7VA 1K0KA 4WZ4A 4X1LA 3AGEA 4E3LA 1TF1A 3EWKA 2GZAA 4X53A 1BSGA 3GMWA 4UEYA 2XFSA 3PBTA 2H10A 1S6RA 2H0TA 2DBOA 4NETA 5EM1A 3VMAA 3KYEA 5HDDA 3MR0A 4B4ZA 3A0RA 4WEKA 3T4LA 2J3TD 5CEDA 3M6HA 4O01A 2Y2QA 5AJGA 2QJ7A 3LY4A 4NXEA 3IBJA 4RRQA 3B47A 1Z6FA 2Y2MA 2HPBA 1UGUA 3A3DA 1KVMA 5KIZA 4LLOB 4JXGA 3PXPA 4EUVA 5KSCA 1QMFA 3WS2A 1XPBA 4F3LA 3B3XA 3NCKA 2P04A 4PM6A 4I39A 1DP6A 3OPRA 3UDXA 5AVFA 5BOHA 1XJ4A 2NUTC 1PFLA 2W3EA 3D4FA 1FOFA 2KX6A 3SW1A 2XSSA 2ZL1B 4FTXA 5JYPA 1HVBA 4NXFA 3HUNA 4HJ6A 1TDLA 4GB7A 4II7A 3O3VA 3EOIA 1LSVA 5DFXA 4MN7A 2OLUA 2EXBA 3KSIA 5EM0A 1JNUA 4MDZA 3LEZA 3UMDA 2XH9A 2CMNA 1W8YA 4XXRA 1W63Q 1GHPA 1FR1A 1MZUA 3VOLA 4OQHA 4RX2A 4FH2A 3WWXA 2JKRI 1K57C 4S2JA 1PIOA 1NY0A 1DP8A 1D1JA 5IS1A 3FWLA 4NKPA 3SS4A 3MKFA 4R1GA 1GA0A 3MQ0A 2ZMFA 5AQAA 3T50A 2BTFP 2XQZA 3IQAA 2JKRM 2V1ZA 2WGWA 1CI9A 3A0SA 3BY9A 3LR0A 2VX8A 2ZLYA 1MBLA 1W8QA 4N9LA 4M4XA 4OOYA 2HJ9C 3CMZA 5F68A 5EVIA 2I72A 3HVFA 4Q0HA 2PYPA 1NRJA 3GRJA 3RH8B 3HREA 4OVDA 1VEUA 3IWIA 4MBFA 3Q7VA 3C2WA 2W3HA 3PHYA 4Y0TA 1NWZA 2IWDA 3IHAA 1VHMA 4ARZB 4DKIA 5EUAA 1YLTA 2V0UA 1ZHHB 1ERMA 2W3GA 3PD3A 3CZDA 1KDWA 3P98A 4Y3IA 3V3SA 4HHDA 3OPLA 3A3FA 2VGLM 3LIAA 3VFHA 4Y2FA 1F98A 4MBHA 1OTBA 1K54A 5DVAA 5FI2A 1IKIA 5A8BA 4Y13A 4L9EA 4ZDXA 1SHVA 3VOZA 1J3WA 5EOOA 2WZXA 2L0WA 2XK1A 4OLDA 3U4LP 3IHBA 4RR6A 3VE4A 1E3UA 3EEAA 2WK0A 3D9YA 2OKVA 5GLCA 2HDRA 4GHIA 3BJNA 1D7EA 4HOIA 1YSPA 2O0YA 1XKZA 5GHZA 1LHYA 4JKTA 1CQAA 1PRQA 4F3LB 4C3QA 1H8ZA 4X6TA 3JVVA 1IYOA 2Y59A 4DN0A 3G4PA 4E6WA 3VOYA 5EVID 2FFFB 1M40A 1S1YA 2JKTI 1XFQA 5A90A 3BLMA 4JPMA 1W7FA 2WYXA 1K55C 3VP2A 1W63M 1P9RA 2J8YA 3CUEC 3VE3A 5HWVA 4EEUA 4KZ6A 1DRMA 4BJPA 4L9FA 4Y0OA 1PNEA 3QP1A 1Z09A 4XUZA 2JKTM 3MSHA 4C75A 2ZC5B 4KENB 1BLCA 3DWZA 4I5SA 5GLAA 2PBDP 5HPFA 1U60A 1YMXA 5CGWA 2ZQAA 4RRFA 4P0MA 2QZ6A 4OPRA 2LB5A 4KUOA 3O86A 5HAPA 1XA1A 1RCJA 2W27A 4MMNA 3KO7A 1FCOA 5A93A 2J3WA 4JGOA 2HL0A 1LSXA 1E3UD 1VB6A 3H82B 2QHKA 5MC7A 1PZPA 4HEFA 2O9BA 1EROA 3BW6A 4GS9A 4U3TA 1NJ4A 3HJKA 5FQKA 2G2WA 3LIDA 1GHMA 4I38A 4R70A 2X01A 4N9KA 1MWTA 1KVLA 4WEJA 1S4RA 4OP5A 3BEBA 2KLIA 4GDNA 5EVIB 3W8KA 3OPPA 3IF6A 4GD8A 3PAEA 4MBKA 2V20A 2E8IA 5F5YA 5TBMA 3IWQA 4RQ9A 4MCWA 4OOLA 3Q7VB 5HARA 3FPVA 4WN5A 2V8FA 5I94A 2INWA 2Z6DA 2HP6A 3MFDA 3LIFA 4OPZA 3OCLA 4B93A 3LR5A 2X02A 3WRZA 2Y2OA 3IH8A 4S0JA 5CGXA 4O7DA 3IXBA 4Z9QA 1ZKJA 2P74A 2UV0E 1RGZA 3AGDA 3IXGA 4HIAA 4GNUA 2BG1A 3DTKA 4R23A 3C4OA 3KO3A 5E2FA 3N4IA 5CXWA 4KZ8A 3NI9A 3KYQA 4PM5A 4UA7A 5LBRA 2HV1A 2X71A 3N8RA 4WELA 2QKPA 5AVEA 3OPHA 3VV4A 3QP2A 2ZQCA 3LMVA 2MJ6A 4ETZA 5TJJA 1PWGA 3LFVA 1TS0A 2J9PA 3QP8A 2XD1A 3ZNYA 5G4YA 1IYSA 3TOIA 1S1ZA 2HL2A 2M1CA 2P9VA 3HUOA 3HL9A 2Y2JA 4WF0A 2EWVA 3G2ZA 4HH3A 3G30A 3LEQA 4WL9A 4DDYA 5L2FA 3G35A 4HH2A 1PW1A 3TJZC 1N9OA 1E25A 5M1AA 3O5YA 2JCHA 4PPRA 5DJUA 3BY8A 5A91A 5C5KA 1GCEA 2OWJA 3BECA 2RL3A 5E2GA 4LV3A 2ZM0A 4L9GA 3CWFA 1A0KA 1G28A 1C3BA 1H8YA 1YAXA 3VFFA 4E3KA 3OZHA 2W1RA 1AXBA 1S4SA 4BL3A 5K5BA 4O0PA 4EV4A 4CPKA 3GECA 3TRCA 1NXYA 1BTLA 3ZG0A 4UA9A 4E3OA 2Y8HA 4UA6A 3IX8A 3LMUA 4GS9B 4YNRA 3MS6A 2Y2GA 2Q0OA 3T1QB 1IYPA 2PRFA 1LI9A 2KDKA 1K4EA 1FSWA 4X1MA 3G6OA 1W5DA 3LICA 3NDGA 3R7WB 1H5XA 2ZQ8A 3IF6B 3EQUA 2HKZA 2W0NA 3JPUA 3C38A 2M7VA 3MFXA 1GSWA 1H0MA 5DF9A 3UE1A 2HDUA 1CJFA 2XR0A 4IUKA 4E04A 2IA2A 2C5WB 3EEHA 3MZDA 5L07A 2J80A 3JYIA 5CHJA 3V3RA 4KQQA 3GQZA 2DMWA 2DRWA 1BZAA 3IT9A 1N9LA 2B95A 4JGPA 1XJ2A 4YOFA 2EX6A 3QP5A 3F1OB 5HAIA 3Q1FA 4HI4A 3P7NA 4C6YA 2NUPC 5FQIA 4OP8A 1TS6A 4KG6A 1L0GA 4CJNA 3PYPA 3ITBA 1LLBA 3GR2A 3KNFA 1YT4A 4JF4A 2ZQ7A 2OWHA 5E43A 2Y2LA 3ZNTA 5TFQA 2Y2HA 3H9WA 4EWFA 4RYEA 2VLGA 4X69A 2J3TC 4GD6A 1HZOA 4P85A 5CEBA 3M2KA 5A92A 1NYYA 4ESPA 3PBRA 3A3IA 1BLHA 2VGLS 3ZQ5A 3TSGA 4GW9A 3LMTA 3FYZA 4HESA 5E2EA 2OAQ1 3MZFA 1WA9A 3W4OA 4WYYA 3F1NB 3LI9A 2E8JA 3CPTA 4QWOA 3ZHHA 1K6SA 4XUXA 3KSGA 3IXDA 5EVLA 1K38A 2P9VB 4XT2B 3UB8A 2WZZA 5FDSA 5HPIA 2GJ3A 1VQQA 4WZ5A 2Y2IA 1EWZA 3C8CA 4BENA 2PU2A 3ZG7B 1H3QA 3ICYA 5HX9A 1BLPA 5HD3A 1MC0A 4WUJA 4JGQA 1T1CA 3DTMA 3KO9A 4LV0A 2CC1A 2ZJ9A 4R3JA 4CLCA 3P01A 1LL9A 2ZOIA 5FI7A 1OJGA 4LV1A 2J9OA 4RX3A 1G6OA 3T1SA 1TDGA 1CEFA 2WKEA 2VGJA 3VP3A 3UDIA 3T4TA 3E4OA 4IBXA 4S0LA 2JKFA 3LUQA 3QHYA 4S2OA 3UN7A 2VKSA 4BMWA 4GJ4A 4RR8A 4G3KA 2ZQDA 2ZBBA 4LGWA 2Y2NA 1Y54A 2EX9A 2V1BA 4NBIA 3H7WA 1TS8A 5F82A 3NULA 5F83A 4DXCA 2JE5A 1F2KA 2XLNA 1BLSA 2P7JA 3HBRA 2WUQA 2HP9A 2WAFA 1NLZA 5FA7A 1PWCA 2G7UA 3UE6A 5IT5A 4BBVA 4KQRA 3SOIA 2XD5A 2XF3A 4HP4A 3EGDC 3O87A 5U47A 2QPNA 2JC7A 3HLGA 1YM1A 3CHWP 4H6JA 2R9WA 3NY4A 3T4QA 5HSQA 4ETXA 3QNCA 5CHMA 2VK3A 2OLVA 1P0ZA 3D3OA 1Q2PA 4YINA 5FEGA 1LSWA 3KO6A 1ES2A 1HLUP 1UWNX 2GNXA 4CLCD 3UDFA 3UB9A 3GTCA 4NK3A 3QNBA 5E2HA 1FQGA 4I3IA 2VJWA 3HCYA 3KSHA 1VETA 2FZ0A 4K0WA 4WZ5C 4RRJA 4OH0A 2WADA 1KE4A 5HL6A 2PBYA 1H8MA 4Y0UA 4LV2A 4WM9A 2VV6A 5DKLA 3CAXA 2DNSA 4JF6A 4F94A 1EI5A 2OAP1 1ESIA 4JF5A 4R0QA 4JXWA 1I2SA 4PHTA 3E2KA 2O9AA 2PR6A 3BRMA 4CLCC 2PHYA 1CK3A 4BL2A 3VP4A 4LCLA 1MKMA 3GDIA 3M6BA 3S22A 4EUZA 4L0LA 3RTYA 4PKYA 1JWVA 4JXSA 3BYDA 5FASA 5KMWA 1KOUA 3C4PA 4EXOA 2PYRA 5FSRA 1CF0A 3FKVA 4ZTKA 3A3JA 4RRHA 1JWZA 3SS5A 3UB5P 2VA0A 3HLEA 4K91A 4MEZA 1NZOA 5EVIC 3ZG8B 3MBZA 4RRDA 5FEFA 4QY6A 4IBRA 4N1XA 1JTDA 1PYYA 4KZ7A 3BWLA 3UO9A 1WYBA 5FDHA 4DMZA 1Q2QA 3GSGA 4OQGA 3F1PA 5CECA 1JKEA 1N9NA 3AGFA
chains in the Genus database with same CATH topology
3OCNA 3DWKA 4RRQA 2HL2A 1Z6FA 2P9VA 2Y2MA 3HUOA 1KDSA 2HPBA 3A3DA 1KVMA 2Y2JA 3HL9A 1DJBA 3DW0A 3ZG9B 4DE3A 3PBOA 1FR6A 4GOGA 3G2ZA 3G30A 4QD4A 4JLFA 4JXGA 4DDYA 5L2FA 3G35A 4JBFA 2IWCA 4N92A 1PW1A 3PD5A 4S2NA 4S2LA 3BFCA 2WGWB 5EOEA 1K54C 1ONHA 1E25A 5M1AA 4E3MA 5KSCA 1QMFA 3BLSA 5AQ7A 3WS2A 1ES4A 1XPBA 4NBJA 2EFXA 2JCHA 4PPRA 4E3JA 3UE3A 4UAAA 1XGJA 2JBFA 3B3XA 3NCKA 4PM6A 4WBGA 3ZGAB 2ZC3B 3OPRA 1L2SA 3UDXA 5BOHA 3N8LA 4KZ9A 4EBPA 4DF6A 5A91A 3D4FA 5IHVA 1FOFA 3KNPA 4DRTA 4R3BA 1O07A 2VGKA 3UPPA 3C5AA 5JYPA 1GCEA 2Y91A 3BECA 2RL3A 1HVBA 5E2GA 5DTSA 4E3NA 4LV3A 2ZM0A 1OMEA 4OONA 4P87A 4E3IA 1C3BA 1TC5A 4R4SA 2A3UA 1H8YA 3HUNA 4OQ0A 3FZCA 3VP0A 3RXWA 1TDLA 4GB7A 3VFFA 3VP1A 3O3VA 2ZC6B 3OZHA 4E3KA 5AQBA 4KZAA 3LCEA 2QMIA 5FQMA 4OQIA 2Q9MA 3IF5A 2OLUA 2EXBA 1AXBA 3W4QA 4RRCA 3BFEA 4BL3A 2ZC7A 4EV4A 4CPKA 4X55A 4R4RA 1NXYA 1BTLA 3ZG0A 2Z2MB 3LEZA 2IWBA 4UA9A 4E3OA 2XH9A 3UE0A 4UA6A 1W8YA 4S02A 4XXRA 3LMUA 1GHPA 4GN2A 4M3KA 4MNRA 4LCMA 1FR1A 1IYQA 1SCWA 2WKIA 3G31A 2Y2GA 4JXVA 4OQHA 4RX2A 4KZBA 4FH2A 3WS5A 2HL1A 3WS1A 3WWXA 1CEGA 1IYPA 5HFOA 1LI9A 4FH4A 1K4EA 1K57C 1FSWA 3G2YA 4S2JA 1O7EA 3ZVWA 4OKPA 1W5DA 1PIOA 1HD8A 3EQVA 1N9BA 1K56D 2ZMAA 1NY0A 2V2FF 3NDGA 5EPHA 1H5XA 1XP4A 2Y55A 2ZQ8A 3IF6B 5HW3A 3EQUA 1BUEA 4RRMA 2HKZA 1LL5A 3HLCA 5CERA 3FWLA 4RR7A 3Q7ZA 3SS4A 3MKFA 4R1GA 4K0XA 3E2LA 4EBLA 5DF9A 3UE1A 1GA0A 2XDMA 5DTTA 2HDUA 2XR0A 3HLBA 5JYOA 4ZAMA 1Y2QA 5AQAA 1NYMA 2C5WB 3GV9A 2XQZA 3IQAA 3MZDA 3ZDJA 2V1ZA 2WGWA 1CI9A 4RRRA 5CTMA 4RVAA 3JYIA 5CHJA 2ZLYA 3BFGA 3KO4A 1MBLA 1W8QA 2G2UA 3BFDA 4KQQA 4N9LA 5CTNA 3GQZA 3V3RA 5J8XA 2DRWA 1PW8A 1BZAA 2OSUA 3IT9A 4FD8A 4OOYA 2Z2LB 1J7GA 1KGGA 2GDNA 3CMZA 2EX2A 3I7JA 5EVIA 1G6AA 5TR7A 2H5SA 1MWUA 2I72A 3HVFA 3LY4A 4S2PA 4PMAA 3WS4A 4LENA 2EX6A 3ZFZA 5HAIA 3GRJA 4OOMA 1GA9A 3Q1FA 3HREA 4OVDA 4C6YA 1DY6A 5FQIA 5FATA 4OP8A 1L0GA 4KG6A 3IWIA 2ZM8A 4S2MA 4MBFA 4DDSA 3Q7VA 4CJNA 3MXSA 5G18A 3CJMA 3G32A 4Y0TA 1MY8A 1VM1A 3ITBA 1LLBA 2ZM2A 3GR2A 2IWDA 3IHAA 3KNFA 1WYCA 4B4XA 4DKIA 4H8RA 5EUAA 1YT4A 4EBNA 4JF4A 1GHIA 2ZQ7A 4S2NC 3V5MA 5E43A 2ZC4B 2Y2LA 3HLWA 1YLTA 3ZNTA 4RRKA 1KE0A 3LO7A 4RRIA 1ERMA 2Q9NA 2B5RA 5J61A 5TFQA 2Y2HA 1YLYA 3CZDA 1KDWA 3P98A 4EWFA 4YFMA 2RCXA 4E6XA 3PD3A 3V3SA 3RJUA 4RYEA 4X69A 3OPLA 3A3FA 4GD6A 3C7UA 1BT5A 1HZOA 4P85A 3WRTA 5CEBA 3VFHA 3PD2A 1DJAA 3M2KA 4QHCA 4BD1A 5A92A 3IF6C 1NYYA 4MBHA 1K54A 1HTZA 5DVAA 5FI2A 1IKIA 4RRLA 4IVKA 3A3EA 3V39A 4WMCA 3Q81A 3PBRA 4KQOA 2A49A 1BLHA 3A3IA 4OPQA 1RP5A 3TSGA 4ZDXA 3LMTA 3FYZA 1SHVA 4HESA 5CGSA 5E2EA 3VOZA 1J9MA 4HBUA 3N7WA 1CI8A 3MZFA 1I5QA 3W4OA 1YQSA 1FSYA 4QY5A 4WYYA 5EOOA 2WZXA 1YLWA 1K6RA 2XK1A 4OLDA 1WE4A 5D3OA 1XX2A 5F1GA 3GVBA 3HLFA 1K6SA 3IHBA 3P09A 3ZHHA 4RR6A 4XUXA 3IXDA 5M19A 2R9XA 1E3UA 2PU4A 1I2WA 3Q07A 3N6IA 5EVLA 1K38A 2WK0A 2P9VB 1M6KA 3UPOA 2OKVA 2WZZA 5GLCA 2HDRA 3SH7A 4KZ5A 3UPNA 1JTGA 4BLMA 1VQQA 3KO5A 1NZUA 2ZQ9A 4WZ5A 2Y2IA 1EWZA 1XKZA 3IXHA 5GHZA 3ZCZA 4BENA 2PU2A 3ZG7B 1LHYA 5FQQA 5GL9A 1S0WA 4JKTA 5M18A 4OPYA 5HX9A 4KZ4A 1BLPA 4ZJ1A 4RRAA 4ID4A 4KZ3A 1H8ZA 4C3QA 1SDEA 1ES3A 3HLDA 3PAGA 4X6TA 4BQMA 5TGFA 1IYOA 3DTMA 1TEMA 3KO9A 2Y59A 4LV0A 4E6WA 1ERQA 3G4PA 3VOYA 5EVID 3SS3A 2HP5A 3NIAA 2CC1A 2FFFB 2ZJ9A 2Y4AA 4R3JA 4DE2A 3V50A 1M40A 1LL9A 3LY3A 5FQ9A 3PBQA 5FI7A 5A90A 3OC2A 4LV1A 4RRDA 1MWRA 2J9OA 4RX3A 5DTKA 1JVJA 2J7VA 3BLMA 3UNWA 4FCFA 1ES5A 1K57A 5FAPA 1TDGA 4JPMA 1CEFA 1W7FA 2WKEA 2WYXA 1FCMA 4KG5A 2VGJA 4B88A 3VP3A 3CG5A 1K55C 4IVIA 3UDIA 1RGYA 1XXMA 3SH9A 3VP2A 2J8YA 3M2JA 1ONGA 4S2IA 4IBXA 4S0LA 4KZ6A 1DJCA 3N8SA 4S2OA 3QHYA 3UN7A 5F1FA 4BJPA 1BULA 4Y0OA 2HDSA 3BM6A 1YLPA 4XUZA 4Y7PA 4C75A 4RR8A 2ZC5B 1L0EA 2ZQDA 4EQIA 2XEPA 1QMEA 1MWSA 1BLCA 3DWZA 1IEMA 4KENB 5GLAA 2Y2NA 1K25A 1Y54A 4DE1A 4S0KA 2EX9A 4NBIA 1U60A 1YMXA 5CGWA 3BFFA 5FQJA 2ZQAA 4WMCD 5F82A 5CRFA 5GLBA 1MPLA 4MLLA 5F83A 4DXCA 1K4FA 2JE5A 4RRFA 4P0MA 2QZ6A 4OPRA 4QB8A 4S2KA 3ITAA 3FKWA 4X56A 5GHYA 2XLNA 5KSHA 1BLSA 3HBRA 2WUQA 3RXXA 3O86A 5HAPA 2HP9A 1ZG4A 2Y2PA 5FAOA 1XA1A 5GHXA 1RCJA 3TG9A 3KO7A 1FCOA 5EE8A 5A93A 2DCFA 2WAFA 3UY6A 2H0YA 3Q82A 1XGIA 3PBSA 2HL0A 5GLDA 1ZC2A 1E3UD 3VSLA 5FA7A 1PWCA 1ESUA 4BD0A 3MXRA 4FSFA 5HL1A 1PZPA 4RRGA 1IELA 4KQRA 5EECA 2EX8A 4HEFA 2XD5A 3SOIA 2XF3A 1EROA 1LI0A 2C6WB 3TOIA 4P6BA 3O87A 4U3TA 1NJ4A 5U47A 4QJGA 1PI4A 3S4XA 2QPNA 4QU3A 1XA7A 2JC7A 2G2WA 5FQKA 3HLGA 4ZJ2A 1YMSA 4DXBA 1L0FA 3ISGA 1GHMA 1YM1A 1YLZA 4GKUA 2X01A 4N9KA 4D2OA 3NBLA 1MWTA 2R9WA 4KG2A 3NY4A 4X68A 2HDQA 1KVLA 3QNCA 3KODA 4WEJA 5CHMA 2OLVA 1Q2PA 4OP5A 3BEBA 4YINA 2FFYA 2XGNA 4GDNA 5EVIB 3W8KA 3OPPA 5DF7A 3IF6A 1TVFA 1FCNA 1ES2A 2WGIA 4GD8A 1JWPA 3PAEA 2ZD8A 3NC8A 2OV5A 3MZEA 2V20A 4MBKA 3G34A 3UDFA 2E8IA 1KGEA 3GTCA 4NK3A 3KOBA 1L0DA 4ZBEA 5FI6A 3QNBA 5E2HA 4Q8IA 1FQGA 3VSKA 2EXAA 3IWQA 1KE3A 4HBTA 3IH9A 4OOLA 3Q7VB 5FAQA 5HARA 2WKHA 5AQ9A 4K0WA 3ZVTA 1NRFA 4WZ5C 5I94A 4RRJA 4OH0A 1MXOA 3PTEA 2WADA 3PD4A 1SDNA 4IEDA 1KE4A 2HP6A 3S1YA 4RA7A 1KGFA 2PBYA 3MFDA 2UWXA 4OPZA 3OCLA 5KZHA 4Y0UA 4LV2A 1ZG6A 4DE0A 4WM9A 3PBNA 2X02A 4JF6A 2DNSA 5DF8A 4F94A 3WRZA 1EI5A 2Y2OA 3IH8A 1ESIA 4GZBA 4JF5A 4OLGA 4R0QA 5CGXA 4JXWA 4S0JA 1I2SA 4O7DA 4UHUA 1SKFA 3E2KA 3FV7A 3IXBA 3BRMA 3W4PA 4Z9QA 3HUMA 1CK3A 4BL2A 3VP4A 1ZKJA 2P74A 4ZJ3A 2EFUA 1PZOA 2Y2KA 1PWDA 4LCLA 4U0TA 1RGZA 3AGDA 4U0XA 4PM8A 3IXGA 3M6BA 3MKEA 4PM9A 3S22A 4EUZA 3SH8A 1IKGA 4GNUA 3IWOA 4L0LA 2BG1A 2XFTA 3NDEA 4N1HA 3KOCA 1JWVA 4JXSA 3BYDA 5CHUA 4R23A 5FASA 2WGVA 3C4OA 5KMWA 3KO3A 3C4PA 1W79A 4S03A 1G68A 1N4OA 3C7VA 4WZ4A 5E2FA 3AGEA 5FSRA 1ALQA 3N4IA 5CXWA 4KZ8A 4E3LA 1MKIA 4RRBA 3FKVA 3NI9A 3O88A 4ZTKA 4PM5A 4UA7A 3A3JA 4RRHA 1JWZA 4X53A 3SS5A 1BSGA 4K91A 3HLEA 3GMWA 4MEZA 1NZOA 1K55A 2BLSA 3MBZA 5EVIC 2X71A 2XFSA 3PBTA 4IBRA 4QY6A 3ZG8B 4PM7A 2H10A 3N8RA 4WELA 4N1XA 1S6RA 1JTDA 4S0IA 4GDBA 3OPHA 2H0TA 1PYYA 2DBOA 4NETA 4RR9A 3VMAA 4KZ7A 3UO9A 4A5RA 2ZQCA 3LMVA 1YLJA 4B4ZA 2WAEA 1WYBA 5FDHA 1PWGA 1Q2QA 4WEKA 3GSGA 4OQGA 3ZG5A 2J9PA 1K56A 1PI5A 5CEDA 2XD1A 3ZNYA 3M6HA 5CECA 5HAQA 2Y2QA 3WS0A 1JKEA 3AGFA 1E4DA 1IYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OCN A;  3DWK A;  1Z6F A;  2P9V A;  2Y2M A;  3HUO A;  1KDS A;  2HPB A;  3A3D A;  1KVM A;  2Y2J A;  3HL9 A;  1DJB A;  3DW0 A;  3ZG9 B;  4DE3 A;  3PBO A;  1FR6 A;  4GOG A;  3G2Z A;  3G30 A;  4QD4 A;  4JLF A;  4JXG A;  4DDY A;  5L2F A;  3G35 A;  4JBF A;  2IWC A;  4N92 A;  1PW1 A;  4S2N A;  4S2L A;  3BFC A;  2WGW B;  5EOE A;  1K54 C;  1ONH A;  1E25 A;  5M1A A;  4E3M A;  5KSC A;  1QMF A;  3BLS A;  5AQ7 A;  3WS2 A;  1ES4 A;  1XPB A;  2EFX A;  2JCH A;  4PPR A;  4E3J A;  3UE3 A;  4UAA A;  1XGJ A;  2JBF A;  3B3X A;  3NCK A;  4PM6 A;  4WBG A;  3ZGA B;  2ZC3 B;  3OPR A;  1L2S A;  3UDX A;  5BOH A;  3N8L A;  4KZ9 A;  4EBP A;  4DF6 A;  5A91 A;  3D4F A;  5IHV A;  1FOF A;  4DRT A;  4R3B A;  1O07 A;  2VGK A;  3UPP A;  3C5A A;  5JYP A;  1GCE A;  2Y91 A;  3BEC A;  2RL3 A;  1HVB A;  5E2G A;  5DTS A;  4E3N A;  4LV3 A;  2ZM0 A;  1OME A;  4OON A;  4P87 A;  4E3I A;  1C3B A;  4R4S A;  2A3U A;  1H8Y A;  3HUN A;  4OQ0 A;  3FZC A;  3VP0 A;  3RXW A;  1TDL A;  4GB7 A;  3VFF A;  3VP1 A;  3O3V A;  2ZC6 B;  3OZH A;  4E3K A;  5AQB A;  4KZA A;  3LCE A;  2QMI A;  5FQM A;  4OQI A;  2Q9M A;  3IF5 A;  2OLU A;  2EXB A;  1AXB A;  3W4Q A;  3BFE A;  4BL3 A;  2ZC7 A;  4EV4 A;  4CPK A;  4X55 A;  4R4R A;  1NXY A;  1BTL A;  3ZG0 A;  2Z2M B;  3LEZ A;  2IWB A;  4UA9 A;  4E3O A;  2XH9 A;  3UE0 A;  4UA6 A;  1W8Y A;  4XXR A;  1GHP A;  4GN2 A;  4M3K A;  4MNR A;  4LCM A;  1FR1 A;  1IYQ A;  1SCW A;  2WKI A;  3G31 A;  2Y2G A;  4JXV A;  4OQH A;  4RX2 A;  4KZB A;  4FH2 A;  3WS5 A;  3WS1 A;  3WWX A;  1CEG A;  1IYP A;  5HFO A;  1LI9 A;  4FH4 A;  1K4E A;  1K57 C;  1FSW A;  3G2Y A;  4S2J A;  1O7E A;  3ZVW A;  4OKP A;  1W5D A;  1PIO A;  1HD8 A;  3EQV A;  1N9B A;  1K56 D;  2ZMA A;  1NY0 A;  2V2F F;  3NDG A;  5EPH A;  1H5X A;  1XP4 A;  2Y55 A;  2ZQ8 A;  3IF6 B;  5HW3 A;  3EQU A;  1BUE A;  1LL5 A;  3HLC A;  5CER A;  3FWL A;  3Q7Z A;  3SS4 A;  3MKF A;  4R1G A;  4K0X A;  3E2L A;  4EBL A;  5DF9 A;  3UE1 A;  1GA0 A;  2XDM A;  5DTT A;  2HDU A;  2XR0 A;  3HLB A;  5JYO A;  4ZAM A;  5AQA A;  1NYM A;  2C5W B;  3GV9 A;  2XQZ A;  3IQA A;  3MZD A;  3ZDJ A;  2V1Z A;  2WGW A;  1CI9 A;  5CTM A;  4RVA A;  3JYI A;  5CHJ A;  2ZLY A;  3BFG A;  1MBL A;  1W8Q A;  2G2U A;  3BFD A;  4KQQ A;  4N9L A;  5CTN A;  3GQZ A;  3V3R A;  5J8X A;  2DRW A;  1PW8 A;  1BZA A;  2OSU A;  3IT9 A;  4FD8 A;  4OOY A;  2Z2L B;  1KGG A;  2GDN A;  3CMZ A;  2EX2 A;  3I7J A;  5EVI A;  1G6A A;  5TR7 A;  2H5S A;  1MWU A;  2I72 A;  3HVF A;  3LY4 A;  4S2P A;  4PMA A;  3WS4 A;  4LEN A;  2EX6 A;  3ZFZ A;  5HAI A;  3GRJ A;  4OOM A;  1GA9 A;  3Q1F A;  3HRE A;  4OVD A;  4C6Y A;  1DY6 A;  5FQI A;  5FAT A;  4OP8 A;  1L0G A;  4KG6 A;  3IWI A;  2ZM8 A;  4S2M A;  4MBF A;  4DDS A;  3Q7V A;  4CJN A;  3MXS A;  5G18 A;  3CJM A;  3G32 A;  4Y0T A;  1MY8 A;  1VM1 A;  3ITB A;  1LLB A;  2ZM2 A;  3GR2 A;  2IWD A;  3IHA A;  1WYC A;  4B4X A;  4DKI A;  4H8R A;  5EUA A;  1YT4 A;  4EBN A;  4JF4 A;  1GHI A;  2ZQ7 A;  4S2N C;  3V5M A;  5E43 A;  2ZC4 B;  2Y2L A;  3HLW A;  1YLT A;  3ZNT A;  1KE0 A;  3LO7 A;  1ERM A;  2Q9N A;  2B5R A;  5TFQ A;  2Y2H A;  1YLY A;  3CZD A;  1KDW A;  3P98 A;  4EWF A;  4YFM A;  2RCX A;  4E6X A;  3V3S A;  3RJU A;  4RYE A;  4X69 A;  3OPL A;  3A3F A;  4GD6 A;  3C7U A;  1BT5 A;  1HZO A;  4P85 A;  3WRT A;  5CEB A;  3VFH A;  1DJA A;  3M2K A;  4QHC A;  4BD1 A;  5A92 A;  3IF6 C;  1NYY A;  4MBH A;  1K54 A;  1HTZ A;  5DVA A;  5FI2 A;  1IKI A;  4IVK A;  3A3E A;  3V39 A;  4WMC A;  3Q81 A;  3PBR A;  4KQO A;  2A49 A;  1BLH A;  3A3I A;  4OPQ A;  1RP5 A;  3TSG A;  4ZDX A;  3FYZ A;  1SHV A;  4HES A;  5CGS A;  5E2E A;  3VOZ A;  1J9M A;  4HBU A;  3N7W A;  1CI8 A;  3MZF A;  1I5Q A;  3W4O A;  1YQS A;  1FSY A;  4QY5 A;  4WYY A;  5EOO A;  2WZX A;  1YLW A;  1K6R A;  2XK1 A;  4OLD A;  1WE4 A;  5D3O A;  1XX2 A;  5F1G A;  3GVB A;  3HLF A;  1K6S A;  3IHB A;  3P09 A;  3ZHH A;  4XUX A;  3IXD A;  5M19 A;  2R9X A;  1E3U A;  2PU4 A;  1I2W A;  3Q07 A;  3N6I A;  5EVL A;  1K38 A;  2WK0 A;  2P9V B;  1M6K A;  3UPO A;  2WZZ A;  5GLC A;  2HDR A;  3SH7 A;  4KZ5 A;  3UPN A;  1JTG A;  4BLM A;  1VQQ A;  1NZU A;  2ZQ9 A;  4WZ5 A;  2Y2I A;  1EWZ A;  1XKZ A;  3IXH A;  5GHZ A;  3ZCZ A;  4BEN A;  2PU2 A;  3ZG7 B;  1LHY A;  5FQQ A;  5GL9 A;  1S0W A;  4JKT A;  5M18 A;  4OPY A;  5HX9 A;  4KZ4 A;  1BLP A;  4ZJ1 A;  4ID4 A;  4KZ3 A;  1H8Z A;  4C3Q A;  1SDE A;  1ES3 A;  3HLD A;  3PAG A;  4X6T A;  4BQM A;  5TGF A;  1IYO A;  3DTM A;  1TEM A;  2Y59 A;  4LV0 A;  4E6W A;  1ERQ A;  3G4P A;  3VOY A;  5EVI D;  3SS3 A;  2HP5 A;  3NIA A;  2CC1 A;  2FFF B;  2ZJ9 A;  2Y4A A;  4R3J A;  4DE2 A;  3V50 A;  1M40 A;  1LL9 A;  3LY3 A;  5FQ9 A;  3PBQ A;  5FI7 A;  5A90 A;  3OC2 A;  4LV1 A;  1MWR A;  2J9O A;  4RX3 A;  5DTK A;  1JVJ A;  2J7V A;  3BLM A;  3UNW A;  4FCF A;  1ES5 A;  1K57 A;  5FAP A;  1TDG A;  4JPM A;  1CEF A;  1W7F A;  2WKE A;  2WYX A;  1FCM A;  4KG5 A;  2VGJ A;  4B88 A;  3VP3 A;  3CG5 A;  1K55 C;  4IVI A;  3UDI A;  1RGY A;  1XXM A;  3SH9 A;  3VP2 A;  2J8Y A;  3M2J A;  1ONG A;  4S2I A;  4IBX A;  4KZ6 A;  1DJC A;  3N8S A;  4S2O A;  3QHY A;  3UN7 A;  5F1F A;  4BJP A;  1BUL A;  4Y0O A;  2HDS A;  3BM6 A;  1YLP A;  4XUZ A;  4Y7P A;  4C75 A;  2ZC5 B;  1L0E A;  2ZQD A;  4EQI A;  2XEP A;  1QME A;  1MWS A;  1BLC A;  3DWZ A;  1IEM A;  4KEN B;  5GLA A;  2Y2N A;  1K25 A;  1Y54 A;  4DE1 A;  2EX9 A;  1U60 A;  1YMX A;  5CGW A;  3BFF A;  5FQJ A;  2ZQA A;  4WMC D;  5F82 A;  5CRF A;  5GLB A;  1MPL A;  4MLL A;  5F83 A;  4DXC A;  1K4F A;  2JE5 A;  4P0M A;  2QZ6 A;  4OPR A;  4QB8 A;  4S2K A;  3ITA A;  3FKW A;  4X56 A;  5GHY A;  2XLN A;  5KSH A;  1BLS A;  3HBR A;  2WUQ A;  3RXX A;  3O86 A;  5HAP A;  2HP9 A;  1ZG4 A;  2Y2P A;  5FAO A;  1XA1 A;  5GHX A;  1RCJ A;  3TG9 A;  1FCO A;  5EE8 A;  5A93 A;  2DCF A;  2WAF A;  3UY6 A;  2H0Y A;  3Q82 A;  1XGI A;  3PBS A;  5GLD A;  1ZC2 A;  1E3U D;  3VSL A;  5FA7 A;  1PWC A;  1ESU A;  4BD0 A;  3MXR A;  4FSF A;  5HL1 A;  1PZP A;  1IEL A;  4KQR A;  5EEC A;  2EX8 A;  4HEF A;  2XD5 A;  3SOI A;  2XF3 A;  1ERO A;  1LI0 A;  2C6W B;  3TOI A;  4P6B A;  3O87 A;  4U3T A;  1NJ4 A;  5U47 A;  4QJG A;  1PI4 A;  3S4X A;  2QPN A;  4QU3 A;  1XA7 A;  2JC7 A;  2G2W A;  5FQK A;  3HLG A;  4ZJ2 A;  1YMS A;  4DXB A;  1L0F A;  3ISG A;  1GHM A;  1YM1 A;  1YLZ A;  4GKU A;  2X01 A;  4N9K A;  4D2O A;  3NBL A;  1MWT A;  2R9W A;  4KG2 A;  3NY4 A;  4X68 A;  2HDQ A;  1KVL A;  3QNC A;  4WEJ A;  5CHM A;  2OLV A;  1Q2P A;  4OP5 A;  3BEB A;  4YIN A;  2FFY A;  2XGN A;  4GDN A;  5EVI B;  3W8K A;  3OPP A;  5DF7 A;  3IF6 A;  1TVF A;  1FCN A;  1ES2 A;  2WGI A;  4GD8 A;  1JWP A;  3PAE A;  2ZD8 A;  3NC8 A;  2OV5 A;  3MZE A;  2V20 A;  4MBK A;  3G34 A;  3UDF A;  2E8I A;  1KGE A;  3GTC A;  4NK3 A;  1L0D A;  4ZBE A;  5FI6 A;  3QNB A;  5E2H A;  4Q8I A;  1FQG A;  3VSK A;  2EXA A;  3IWQ A;  1KE3 A;  4HBT A;  3IH9 A;  4OOL A;  3Q7V B;  5FAQ A;  5HAR A;  2WKH A;  5AQ9 A;  4K0W A;  3ZVT A;  1NRF A;  4WZ5 C;  5I94 A;  4OH0 A;  1MXO A;  3PTE A;  2WAD A;  1SDN A;  4IED A;  1KE4 A;  2HP6 A;  3S1Y A;  4RA7 A;  1KGF A;  2PBY A;  3MFD A;  2UWX A;  4OPZ A;  3OCL A;  5KZH A;  4Y0U A;  4LV2 A;  1ZG6 A;  4DE0 A;  4WM9 A;  3PBN A;  2X02 A;  4JF6 A;  2DNS A;  5DF8 A;  4F94 A;  3WRZ A;  1EI5 A;  2Y2O A;  3IH8 A;  1ESI A;  4GZB A;  4JF5 A;  4OLG A;  4R0Q A;  5CGX A;  4JXW A;  1I2S A;  4O7D A;  4UHU A;  1SKF A;  3E2K A;  3FV7 A;  3IXB A;  3BRM A;  3W4P A;  4Z9Q A;  3HUM A;  1CK3 A;  4BL2 A;  3VP4 A;  1ZKJ A;  2P74 A;  4ZJ3 A;  2EFU A;  1PZO A;  2Y2K A;  1PWD A;  4LCL A;  4U0T A;  1RGZ A;  3AGD A;  4U0X A;  4PM8 A;  3IXG A;  3M6B A;  3MKE A;  4PM9 A;  3S22 A;  4EUZ A;  3SH8 A;  1IKG A;  4GNU A;  3IWO A;  4L0L A;  2BG1 A;  2XFT A;  3NDE A;  4N1H A;  1JWV A;  4JXS A;  3BYD A;  5CHU A;  4R23 A;  5FAS A;  2WGV A;  3C4O A;  5KMW A;  3C4P A;  1W79 A;  1G68 A;  1N4O A;  3C7V A;  4WZ4 A;  5E2F A;  3AGE A;  5FSR A;  1ALQ A;  3N4I A;  5CXW A;  4KZ8 A;  4E3L A;  1MKI A;  3FKV A;  3NI9 A;  3O88 A;  4ZTK A;  4PM5 A;  4UA7 A;  3A3J A;  1JWZ A;  4X53 A;  3SS5 A;  1BSG A;  4K91 A;  3HLE A;  3GMW A;  4MEZ A;  1NZO A;  1K55 A;  2BLS A;  3MBZ A;  5EVI C;  2X71 A;  2XFS A;  3PBT A;  4IBR A;  4QY6 A;  3ZG8 B;  4PM7 A;  2H10 A;  3N8R A;  4WEL A;  4N1X A;  1S6R A;  1JTD A;  4GDB A;  3OPH A;  2H0T A;  1PYY A;  4NET A;  3VMA A;  4KZ7 A;  3UO9 A;  4A5R A;  2ZQC A;  1YLJ A;  4B4Z A;  2WAE A;  1WYB A;  5FDH A;  1PWG A;  1Q2Q A;  4WEK A;  3GSG A;  4OQG A;  3ZG5 A;  2J9P A;  1K56 A;  1PI5 A;  5CED A;  2XD1 A;  3ZNY A;  3M6H A;  5CEC A;  5HAQ A;  2Y2Q A;  3WS0 A;  3AGF A;  1E4D A;  1IYS A; 
#chains in the Genus database with same CATH topology
 3DWK A;  4BBT A;  3V67 A;  4R6L A;  1KDS A;  4DE3 A;  3DW0 A;  1STZ A;  3LI8 A;  3PBO A;  1FR6 A;  4JGR A;  4Y15 A;  4S2N A;  4S2L A;  2WGW B;  2PT7 A;  5EOE A;  1K54 C;  1ONH A;  4UQI S;  4E3M A;  3JVU A;  3LIB A;  4NBJ A;  3D72 A;  3R4K A;  4UAA A;  1XGJ A;  2JBF A;  4IJG A;  2QWS A;  1L2S A;  3N8L A;  4KZ9 A;  4EBP A;  3RFB A;  4DF6 A;  4Y17 A;  4DRT A;  2QJ5 A;  1O07 A;  2VGK A;  3UPP A;  3C5A A;  2W3F A;  4E3N A;  4OON A;  1VEU B;  3FZC A;  3RXW A;  3VP1 A;  2ZC6 B;  4KZA A;  3LCE A;  2Q9M A;  3IF5 A;  4EU0 A;  3BFE A;  4I3J A;  2ZC7 A;  3LIE A;  4X55 A;  1FIK A;  3KX0 X;  4R4R A;  3E4P A;  1OTA A;  2IWB A;  3UE0 A;  4S02 A;  4GN2 A;  4M3K A;  4MNR A;  1IYQ A;  1SCW A;  2WKI A;  1UWP X;  4IHQ A;  4JXV A;  4KZB A;  2HL1 A;  3WS5 A;  3WS1 A;  5HFO A;  1LL8 A;  4FH4 A;  3G2Y A;  1O7E A;  2KOI A;  4I3A A;  3EQV A;  1N9B A;  2ZMA A;  1IOU A;  2V2F F;  2XRN A;  2V8C A;  3OBF A;  1OTD A;  5HZH A;  3DTE A;  1BUE A;  1LL5 A;  5CER A;  4RR7 A;  3Q7Z A;  3NEC A;  4K0X A;  3E2L A;  5EVE A;  3BQ8 A;  2XDM A;  5DTT A;  3HLB A;  1Y2Q A;  3B42 A;  4GHI B;  3GV9 A;  5HWW A;  4RRR A;  1TS7 A;  4RVA A;  1F5M A;  5CTN A;  2OSU A;  1KGG A;  3I7J A;  1MWU A;  4WLA A;  4PMA A;  2PD7 A;  2ZL1 A;  5EV0 A;  1EW0 A;  1DY6 A;  1X0O A;  5FAT A;  4UQI M;  3C30 A;  4D60 A;  4S2M A;  4DDS A;  5G18 A;  3CJM A;  5DFY A;  1WYC A;  5FL3 A;  3S7Q A;  4S2N C;  1Y28 A;  3V5M A;  2H28 A;  3T12 B;  3SZT A;  3HLW A;  4RRK A;  3LO7 A;  4YFM A;  2RCX A;  3L7H A;  3C7U A;  2WKR A;  3WRT A;  4QHC A;  4BD1 A;  3IF6 C;  3T1R A;  4KUK A;  4IVK A;  4LFU A;  2PR5 A;  3Q81 A;  3NOP C;  4OPQ A;  1RP5 A;  4Y5F A;  3UB6 A;  3FG8 A;  1J9M A;  4HBU A;  1CI8 A;  1I5Q A;  4NEE D;  1FSY A;  3F1P B;  1K6R A;  2K2N A;  5D3O A;  2M7U A;  1XX2 A;  5F1G A;  3IX4 A;  4NXG A;  3E98 A;  1I2W A;  1M6K A;  3T4J A;  3UPN A;  4BLM A;  1ACF A;  1YKD A;  3IXH A;  5FQQ A;  1S0W A;  4OPY A;  1YPR A;  4ZJ1 A;  4RRA A;  4ID4 A;  4HQA A;  1SKO A;  5TGF A;  2WKP A;  1ERQ A;  2HP5 A;  5DKK A;  2Y4A A;  3ZYT A;  3LY3 A;  5FQ9 A;  4R3A A;  5DJT A;  5I5L A;  3OC2 A;  5TBM B;  3UNW A;  4FCF A;  1ES5 A;  1K57 A;  4FUW A;  5FAP A;  1FCM A;  3KYZ A;  1XXM A;  4YWZ A;  4LPZ A;  4ARZ A;  3N8S A;  3IX3 A;  2HDS A;  3BM6 A;  1YLP A;  5L10 A;  3E0Y A;  4Y7P A;  2W1T A;  1GSX A;  4EQI A;  4EES A;  4S0K A;  5FQJ A;  5GLB A;  1K4F A;  4G3V A;  4QB8 A;  4S2K A;  3ITA A;  3FKW A;  4X56 A;  5GHY A;  5KSH A;  2O9C A;  3RXX A;  4LRZ E;  1TD5 A;  1ZG4 A;  5GHX A;  2DCF A;  2H0Y A;  1XGI A;  3CIT A;  3UB7 A;  1BYW A;  1ZC2 A;  1ESU A;  2K7S A;  4FSF A;  4RRG A;  1IEL A;  1SZV A;  5EEC A;  5EFW A;  3E4Q A;  2C6W B;  4QJG A;  1PI4 A;  3S4X A;  2V0W A;  1XA7 A;  1YMS A;  4DXB A;  1YLZ A;  4D2O A;  3NBL A;  2L4R A;  5L09 A;  2FFY A;  2XGN A;  4HJ3 A;  1TVF A;  2WGI A;  3IS2 A;  1JWP A;  2B18 A;  2ZD8 A;  3G34 A;  3CLO A;  2LB9 A;  4ZBE A;  3KSF A;  4Q8I A;  2EXA A;  3OOV A;  1KE3 A;  4HBT A;  2Y79 A;  2WKH A;  3DAV A;  3QP6 A;  3T4K A;  3ZVT A;  4DJ2 A;  2V1A A;  3PTE A;  3PD4 A;  2K31 A;  1KGF A;  2BAS A;  2UWX A;  5KZH A;  2AVX A;  1ZG6 A;  4DE0 A;  2Z6C A;  3T4O A;  3PBN A;  5DF8 A;  4G3W A;  1OPX A;  1DP9 A;  4OLG A;  4X25 A;  4UHU A;  1SKF A;  3W4P A;  3HUM A;  2OOL A;  1T19 A;  4HJ4 A;  2EFU A;  3MKE A;  3IWO A;  2XFT A;  4N1H A;  3KOC A;  5CHU A;  3MF0 A;  2WGV A;  4MN6 A;  1W79 A;  3LR4 A;  1N4O A;  4P6Z S;  3S7N A;  1ALQ A;  3H82 A;  1MKI A;  4RRB A;  3O88 A;  3EGX C;  1V9Z A;  2JHE A;  1P9W A;  2PAV P;  1K55 A;  2BLS A;  4PM7 A;  3CUE A;  4S0I A;  4GDB A;  4RR9 A;  3FPW A;  4A5R A;  4ME4 A;  3S7O A;  1YLJ A;  1XJ6 A;  2WAE A;  5HDS A;  1SKO B;  3ULF A;  3ZG5 A;  1K56 A;  1PI5 A;  2A2L A;  5HAQ A;  3WS0 A;  1E4D A;  3OCN A;  2V9A A;  2L1M A;  3MJQ A;  1S66 L;  3HJI A;  3UME A;  3ZG9 B;  1DJB A;  3W2Z A;  4IUH A;  4GOG A;  4QD4 A;  4JLF A;  2P08 A;  2FH5 A;  4N92 A;  4JBF A;  2ACG A;  2IWC A;  2D02 A;  3PD5 A;  2O99 A;  3BFC A;  4DJ3 A;  3T1X A;  3BLS A;  5AQ7 A;  1ES4 A;  2EFX A;  4E3J A;  3UE3 A;  4WBG A;  3ZGA B;  2ZC3 B;  3BQA A;  5CX7 A;  2W1T B;  1NLY A;  4LRX C;  5IHV A;  3KNP A;  4R3B A;  3K3C A;  4LRY C;  2Y91 A;  3A0V A;  5DTS A;  1OME A;  4K08 A;  4P87 A;  4CLC B;  4E3I A;  4B9O A;  1TC5 A;  4R4S A;  2HZ5 A;  2A3U A;  4OQ0 A;  3CI6 A;  3VP0 A;  5AQB A;  2QMI A;  5FQM A;  4OQI A;  4CQH A;  3W4Q A;  4RRC A;  2ZOH A;  3OLO A;  2Z2M B;  3L9K A;  4LCM A;  1OTE A;  4HY8 A;  2YKF A;  3NJA A;  5HWT A;  3G31 A;  4O8G A;  1CEG A;  4CLC E;  4P6Z M;  3ZVW A;  4OKP A;  1HD8 A;  2PDR A;  1K56 D;  3K3D A;  4Q0I A;  5EPH A;  5HW3 A;  1XP4 A;  2Y55 A;  3CPT B;  3IS2 B;  4RRM A;  3HLC A;  2B02 A;  5J7E A;  4EBL A;  3DTI A;  5JYO A;  4ZAM A;  1NYM A;  4Z1W A;  2VV8 A;  3ZDJ A;  5CTM A;  3KO4 A;  3BFG A;  3BFD A;  2G2U A;  5J8X A;  1PW8 A;  1J7G A;  4FD8 A;  2Z2L B;  2A24 A;  2W3D A;  2GDN A;  2QYB A;  2EX2 A;  5TR7 A;  1G6A A;  2H5S A;  1D06 A;  4S2P A;  3PR6 A;  3WS4 A;  4LEN A;  3ZFZ A;  4OOM A;  1GA9 A;  1Y4O A;  5L8M A;  4NXB A;  2ZM8 A;  1IFQ A;  3U2A A;  3MXS A;  4KQD A;  3G32 A;  1MY8 A;  1VM1 A;  2ZM2 A;  2JKG A;  4B4X A;  3TE8 A;  4H8R A;  4EBN A;  1GHI A;  2D01 A;  4QPR A;  2ZC4 B;  1KE0 A;  4RRI A;  4ZRR A;  2Q9N A;  2B5R A;  5J61 A;  3QP4 A;  1YLY A;  4E6X A;  1ZTU A;  3RJU A;  3LR3 A;  1BT5 A;  1XJ3 A;  3PD2 A;  1DJA A;  1HTZ A;  4RRL A;  3V39 A;  3A3E A;  3H7W B;  4WMC A;  5HD5 A;  4BWI A;  4KQO A;  2A49 A;  5CGS A;  3N7W A;  4PAU A;  1YQS A;  4QY5 A;  1YLW A;  1WE4 A;  3R7W A;  1P97 A;  3GVB A;  3HLF A;  3P09 A;  5M19 A;  2R9X A;  2PU4 A;  3Q07 A;  3N6I A;  3UPO A;  3SH7 A;  2HF6 A;  4KZ5 A;  1JTG A;  3KO5 A;  1NZU A;  2ZQ9 A;  4BBU A;  3ZCZ A;  3NHQ A;  2EA9 A;  5GL9 A;  5M18 A;  1G5U A;  4AFI A;  4KZ4 A;  4H6J B;  4KZ3 A;  3MQQ A;  1SDE A;  1ES3 A;  3HLD A;  3PAG A;  4BQM A;  1T1A A;  1TEM A;  1T1B A;  3SS3 A;  2I9V A;  3NIA A;  5IU1 A;  4DE2 A;  3V50 A;  3F1O A;  3PBQ A;  1V9Y A;  1FIL A;  1MWR A;  2XA7 S;  5DTK A;  1JVJ A;  2J7V A;  4EW7 A;  1VET B;  4KG5 A;  4B88 A;  3CG5 A;  4IVI A;  5J3W A;  1RGY A;  3SH9 A;  3M2J A;  1ONG A;  1YSQ A;  4S2I A;  2HGV A;  1DJC A;  2VEA A;  5F1F A;  1BUL A;  3T4S A;  4PKY G;  1L0E A;  4GCZ A;  2WKQ A;  3NOU C;  2XEP A;  2PD8 A;  1QME A;  1MWS A;  1IEM A;  3TW8 A;  1T18 A;  1K25 A;  3MXQ A;  4DE1 A;  5F6A A;  3BFF A;  4EET B;  4MN5 A;  4WMC D;  5CRF A;  1MPL A;  4MLL A;  1S67 L;  3F1N A;  2VV7 A;  2Y2P A;  4NG2 A;  5FAO A;  1GSV A;  3TG9 A;  1OT9 A;  5EE8 A;  3UY6 A;  2EWW A;  3Q82 A;  3PBS A;  5GLD A;  1OJ5 A;  2HJE A;  3VSL A;  4HP9 A;  4XT2 A;  4BD0 A;  3MXR A;  1AWI A;  5HL1 A;  2EX8 A;  1LI0 A;  4P6B A;  4Q0J A;  2R78 A;  4QU3 A;  3IBR A;  3MQO A;  4ZJ2 A;  1L0F A;  1OTI A;  3ISG A;  1F9I A;  4GKU A;  4KG2 A;  4X68 A;  2HDQ A;  3S7P A;  3KOD A;  2ZMV A;  2A24 B;  4EQ1 A;  5DF7 A;  3LGO A;  5F69 A;  1FCN A;  2JN7 A;  3NC8 A;  2OV5 A;  3MZE A;  4EER A;  2YKH A;  1OT6 A;  1KGE A;  3KOB A;  1L0D A;  5J4E A;  5FI6 A;  3FC7 A;  3VSK A;  3IH9 A;  1ODV A;  5FAQ A;  3LYX A;  5HDC A;  5AQ9 A;  3MMH A;  1NRF A;  3DBA A;  3NOT C;  1XFN A;  1MXO A;  1SDN A;  4IED A;  3S1Y A;  4RA7 A;  3B33 A;  3K2N A;  2XRO A;  4GLQ A;  1LT0 A;  2XA7 M;  4GZB A;  4FOF A;  3FV7 A;  5G4Z A;  4EEP A;  4ZJ3 A;  2Y2K A;  1PZO A;  1PWD A;  4U0T A;  4U0X A;  4PM8 A;  4PM9 A;  3SH8 A;  1IKG A;  4R38 A;  1L3L A;  3NDE A;  4HNB A;  2GX5 A;  4S03 A;  1G68 A;  2VZW A;  3C7V A;  1K0K A;  4WZ4 A;  4X1L A;  3AGE A;  4E3L A;  1TF1 A;  3EWK A;  2GZA A;  4X53 A;  1BSG A;  3GMW A;  4UEY A;  2XFS A;  3PBT A;  2H10 A;  1S6R A;  2H0T A;  2DBO A;  4NET A;  5EM1 A;  3VMA A;  3KYE A;  5HDD A;  3MR0 A;  4B4Z A;  3A0R A;  4WEK A;  3T4L A;  2J3T D;  5CED A;  3M6H A;  4O01 A;  2Y2Q A;  5AJG A;  2QJ7 A;  3LY4 A;  4NXE A;  3IBJ A;  4RRQ A;  3B47 A;  1Z6F A;  2Y2M A;  2HPB A;  1UGU A;  3A3D A;  1KVM A;  5KIZ A;  4LLO B;  4JXG A;  3PXP A;  4EUV A;  5KSC A;  1QMF A;  3WS2 A;  1XPB A;  4F3L A;  3B3X A;  3NCK A;  2P04 A;  4PM6 A;  4I39 A;  1DP6 A;  3OPR A;  3UDX A;  5AVF A;  5BOH A;  1XJ4 A;  2NUT C;  1PFL A;  2W3E A;  3D4F A;  1FOF A;  2KX6 A;  3SW1 A;  2XSS A;  2ZL1 B;  4FTX A;  5JYP A;  1HVB A;  4NXF A;  3HUN A;  4HJ6 A;  1TDL A;  4GB7 A;  4II7 A;  3O3V A;  3EOI A;  1LSV A;  5DFX A;  4MN7 A;  2OLU A;  2EXB A;  3KSI A;  5EM0 A;  1JNU A;  4MDZ A;  3LEZ A;  3UMD A;  2XH9 A;  2CMN A;  1W8Y A;  4XXR A;  1W63 Q;  1GHP A;  1FR1 A;  1MZU A;  3VOL A;  4OQH A;  4RX2 A;  4FH2 A;  3WWX A;  2JKR I;  1K57 C;  4S2J A;  1PIO A;  1NY0 A;  1DP8 A;  1D1J A;  5IS1 A;  3FWL A;  4NKP A;  3SS4 A;  3MKF A;  4R1G A;  1GA0 A;  3MQ0 A;  2ZMF A;  5AQA A;  3T50 A;  2BTF P;  2XQZ A;  3IQA A;  2JKR M;  2V1Z A;  2WGW A;  1CI9 A;  3A0S A;  3BY9 A;  3LR0 A;  2VX8 A;  2ZLY A;  1MBL A;  1W8Q A;  4N9L A;  4M4X A;  4OOY A;  2HJ9 C;  3CMZ A;  5F68 A;  5EVI A;  2I72 A;  3HVF A;  4Q0H A;  2PYP A;  1NRJ A;  3GRJ A;  3RH8 B;  3HRE A;  4OVD A;  1VEU A;  3IWI A;  4MBF A;  3Q7V A;  3C2W A;  2W3H A;  3PHY A;  4Y0T A;  1NWZ A;  2IWD A;  3IHA A;  1VHM A;  4ARZ B;  4DKI A;  5EUA A;  1YLT A;  2V0U A;  1ZHH B;  1ERM A;  2W3G A;  3PD3 A;  3CZD A;  1KDW A;  3P98 A;  4Y3I A;  3V3S A;  4HHD A;  3OPL A;  3A3F A;  2VGL M;  3LIA A;  3VFH A;  4Y2F A;  1F98 A;  4MBH A;  1OTB A;  1K54 A;  5DVA A;  5FI2 A;  1IKI A;  5A8B A;  4Y13 A;  4L9E A;  4ZDX A;  1SHV A;  3VOZ A;  1J3W A;  5EOO A;  2WZX A;  2L0W A;  2XK1 A;  4OLD A;  3U4L P;  3IHB A;  4RR6 A;  3VE4 A;  1E3U A;  3EEA A;  2WK0 A;  3D9Y A;  2OKV A;  5GLC A;  2HDR A;  4GHI A;  3BJN A;  1D7E A;  4HOI A;  1YSP A;  2O0Y A;  1XKZ A;  5GHZ A;  1LHY A;  4JKT A;  1CQA A;  1PRQ A;  4F3L B;  4C3Q A;  1H8Z A;  4X6T A;  3JVV A;  1IYO A;  2Y59 A;  4DN0 A;  3G4P A;  4E6W A;  3VOY A;  5EVI D;  2FFF B;  1M40 A;  1S1Y A;  2JKT I;  1XFQ A;  5A90 A;  3BLM A;  4JPM A;  1W7F A;  2WYX A;  1K55 C;  3VP2 A;  1W63 M;  1P9R A;  2J8Y A;  3CUE C;  3VE3 A;  5HWV A;  4EEU A;  4KZ6 A;  1DRM A;  4BJP A;  4L9F A;  4Y0O A;  1PNE A;  3QP1 A;  1Z09 A;  4XUZ A;  2JKT M;  3MSH A;  4C75 A;  2ZC5 B;  4KEN B;  1BLC A;  3DWZ A;  4I5S A;  5GLA A;  2PBD P;  5HPF A;  1U60 A;  1YMX A;  5CGW A;  2ZQA A;  4RRF A;  4P0M A;  2QZ6 A;  4OPR A;  2LB5 A;  4KUO A;  3O86 A;  5HAP A;  1XA1 A;  1RCJ A;  2W27 A;  4MMN A;  3KO7 A;  1FCO A;  5A93 A;  2J3W A;  4JGO A;  2HL0 A;  1LSX A;  1E3U D;  1VB6 A;  3H82 B;  2QHK A;  5MC7 A;  1PZP A;  4HEF A;  2O9B A;  1ERO A;  3BW6 A;  4GS9 A;  4U3T A;  1NJ4 A;  3HJK A;  5FQK A;  2G2W A;  3LID A;  1GHM A;  4I38 A;  4R70 A;  2X01 A;  4N9K A;  1MWT A;  1KVL A;  4WEJ A;  1S4R A;  4OP5 A;  3BEB A;  2KLI A;  4GDN A;  5EVI B;  3W8K A;  3OPP A;  3IF6 A;  4GD8 A;  3PAE A;  4MBK A;  2V20 A;  2E8I A;  5F5Y A;  5TBM A;  3IWQ A;  4RQ9 A;  4MCW A;  4OOL A;  3Q7V B;  5HAR A;  3FPV A;  4WN5 A;  2V8F A;  5I94 A;  2INW A;  2Z6D A;  2HP6 A;  3MFD A;  3LIF A;  4OPZ A;  3OCL A;  4B93 A;  3LR5 A;  2X02 A;  3WRZ A;  2Y2O A;  3IH8 A;  4S0J A;  5CGX A;  4O7D A;  3IXB A;  4Z9Q A;  1ZKJ A;  2P74 A;  2UV0 E;  1RGZ A;  3AGD A;  3IXG A;  4HIA A;  4GNU A;  2BG1 A;  3DTK A;  4R23 A;  3C4O A;  3KO3 A;  5E2F A;  3N4I A;  5CXW A;  4KZ8 A;  3NI9 A;  3KYQ A;  4PM5 A;  4UA7 A;  5LBR A;  2HV1 A;  2X71 A;  3N8R A;  4WEL A;  2QKP A;  5AVE A;  3OPH A;  3VV4 A;  3QP2 A;  2ZQC A;  3LMV A;  2MJ6 A;  4ETZ A;  5TJJ A;  1PWG A;  3LFV A;  1TS0 A;  2J9P A;  3QP8 A;  2XD1 A;  3ZNY A;  5G4Y A;  1IYS A;  3TOI A;  1S1Z A;  2HL2 A;  2M1C A;  2P9V A;  3HUO A;  3HL9 A;  2Y2J A;  4WF0 A;  2EWV A;  3G2Z A;  4HH3 A;  3G30 A;  3LEQ A;  4WL9 A;  4DDY A;  5L2F A;  3G35 A;  4HH2 A;  1PW1 A;  3TJZ C;  1N9O A;  1E25 A;  5M1A A;  3O5Y A;  2JCH A;  4PPR A;  5DJU A;  3BY8 A;  5A91 A;  5C5K A;  1GCE A;  2OWJ A;  3BEC A;  2RL3 A;  5E2G A;  4LV3 A;  2ZM0 A;  4L9G A;  3CWF A;  1A0K A;  1G28 A;  1C3B A;  1H8Y A;  1YAX A;  3VFF A;  4E3K A;  3OZH A;  2W1R A;  1AXB A;  1S4S A;  4BL3 A;  5K5B A;  4O0P A;  4EV4 A;  4CPK A;  3GEC A;  3TRC A;  1NXY A;  1BTL A;  3ZG0 A;  4UA9 A;  4E3O A;  2Y8H A;  4UA6 A;  3IX8 A;  3LMU A;  4GS9 B;  4YNR A;  3MS6 A;  2Y2G A;  2Q0O A;  3T1Q B;  1IYP A;  2PRF A;  1LI9 A;  2KDK A;  1K4E A;  1FSW A;  4X1M A;  3G6O A;  1W5D A;  3LIC A;  3NDG A;  3R7W B;  1H5X A;  2ZQ8 A;  3IF6 B;  3EQU A;  2HKZ A;  2W0N A;  3JPU A;  3C38 A;  2M7V A;  3MFX A;  1GSW A;  1H0M A;  5DF9 A;  3UE1 A;  2HDU A;  1CJF A;  2XR0 A;  4IUK A;  4E04 A;  2IA2 A;  2C5W B;  3EEH A;  3MZD A;  5L07 A;  2J80 A;  3JYI A;  5CHJ A;  3V3R A;  4KQQ A;  3GQZ A;  2DMW A;  2DRW A;  1BZA A;  3IT9 A;  1N9L A;  2B95 A;  4JGP A;  1XJ2 A;  4YOF A;  2EX6 A;  3QP5 A;  3F1O B;  5HAI A;  3Q1F A;  4HI4 A;  3P7N A;  4C6Y A;  2NUP C;  5FQI A;  4OP8 A;  1TS6 A;  4KG6 A;  1L0G A;  4CJN A;  3PYP A;  3ITB A;  1LLB A;  3GR2 A;  3KNF A;  1YT4 A;  4JF4 A;  2ZQ7 A;  2OWH A;  5E43 A;  2Y2L A;  3ZNT A;  5TFQ A;  2Y2H A;  3H9W A;  4EWF A;  4RYE A;  2VLG A;  4X69 A;  2J3T C;  4GD6 A;  1HZO A;  4P85 A;  5CEB A;  3M2K A;  5A92 A;  1NYY A;  4ESP A;  3PBR A;  3A3I A;  1BLH A;  2VGL S;  3ZQ5 A;  3TSG A;  4GW9 A;  3LMT A;  3FYZ A;  4HES A;  5E2E A;  2OAQ 1;  3MZF A;  1WA9 A;  3W4O A;  4WYY A;  3F1N B;  3LI9 A;  2E8J A;  3CPT A;  4QWO A;  3ZHH A;  1K6S A;  4XUX A;  3KSG A;  3IXD A;  5EVL A;  1K38 A;  2P9V B;  4XT2 B;  3UB8 A;  2WZZ A;  5FDS A;  5HPI A;  2GJ3 A;  1VQQ A;  4WZ5 A;  2Y2I A;  1EWZ A;  3C8C A;  4BEN A;  2PU2 A;  3ZG7 B;  1H3Q A;  3ICY A;  5HX9 A;  1BLP A;  5HD3 A;  1MC0 A;  4WUJ A;  4JGQ A;  1T1C A;  3DTM A;  3KO9 A;  4LV0 A;  2CC1 A;  2ZJ9 A;  4R3J A;  4CLC A;  3P01 A;  1LL9 A;  2ZOI A;  5FI7 A;  1OJG A;  4LV1 A;  2J9O A;  4RX3 A;  1G6O A;  3T1S A;  1TDG A;  1CEF A;  2WKE A;  2VGJ A;  3VP3 A;  3UDI A;  3T4T A;  3E4O A;  4IBX A;  4S0L A;  2JKF A;  3LUQ A;  3QHY A;  4S2O A;  3UN7 A;  2VKS A;  4BMW A;  4GJ4 A;  4RR8 A;  4G3K A;  2ZQD A;  2ZBB A;  4LGW A;  2Y2N A;  1Y54 A;  2EX9 A;  2V1B A;  4NBI A;  3H7W A;  1TS8 A;  5F82 A;  3NUL A;  5F83 A;  4DXC A;  2JE5 A;  1F2K A;  2XLN A;  1BLS A;  2P7J A;  3HBR A;  2WUQ A;  2HP9 A;  2WAF A;  1NLZ A;  5FA7 A;  1PWC A;  2G7U A;  3UE6 A;  5IT5 A;  4BBV A;  4KQR A;  3SOI A;  2XD5 A;  2XF3 A;  4HP4 A;  3EGD C;  3O87 A;  5U47 A;  2QPN A;  2JC7 A;  3HLG A;  1YM1 A;  3CHW P;  4H6J A;  2R9W A;  3NY4 A;  3T4Q A;  5HSQ A;  4ETX A;  3QNC A;  5CHM A;  2VK3 A;  2OLV A;  1P0Z A;  3D3O A;  1Q2P A;  4YIN A;  5FEG A;  1LSW A;  3KO6 A;  1ES2 A;  1HLU P;  1UWN X;  2GNX A;  4CLC D;  3UDF A;  3UB9 A;  3GTC A;  4NK3 A;  3QNB A;  5E2H A;  1FQG A;  4I3I A;  2VJW A;  3HCY A;  3KSH A;  1VET A;  2FZ0 A;  4K0W A;  4WZ5 C;  4RRJ A;  4OH0 A;  2WAD A;  1KE4 A;  5HL6 A;  2PBY A;  1H8M A;  4Y0U A;  4LV2 A;  4WM9 A;  2VV6 A;  5DKL A;  3CAX A;  2DNS A;  4JF6 A;  4F94 A;  1EI5 A;  2OAP 1;  1ESI A;  4JF5 A;  4R0Q A;  4JXW A;  1I2S A;  4PHT A;  3E2K A;  2O9A A;  2PR6 A;  3BRM A;  4CLC C;  2PHY A;  1CK3 A;  4BL2 A;  3VP4 A;  4LCL A;  1MKM A;  3GDI A;  3M6B A;  3S22 A;  4EUZ A;  4L0L A;  3RTY A;  4PKY A;  1JWV A;  4JXS A;  3BYD A;  5FAS A;  5KMW A;  1KOU A;  3C4P A;  4EXO A;  2PYR A;  5FSR A;  1CF0 A;  3FKV A;  4ZTK A;  3A3J A;  4RRH A;  1JWZ A;  3SS5 A;  3UB5 P;  2VA0 A;  3HLE A;  4K91 A;  4MEZ A;  1NZO A;  5EVI C;  3ZG8 B;  3MBZ A;  4RRD A;  5FEF A;  4QY6 A;  4IBR A;  4N1X A;  1JTD A;  1PYY A;  4KZ7 A;  3BWL A;  3UO9 A;  1WYB A;  5FDH A;  4DMZ A;  1Q2Q A;  3GSG A;  4OQG A;  3F1P A;  5CEC A;  1JKE A;  1N9N A;  3AGF A; 
#chains in the Genus database with same CATH homology
 3OCN A;  3DWK A;  4RRQ A;  2HL2 A;  1Z6F A;  2P9V A;  2Y2M A;  3HUO A;  1KDS A;  2HPB A;  3A3D A;  1KVM A;  2Y2J A;  3HL9 A;  1DJB A;  3DW0 A;  3ZG9 B;  4DE3 A;  3PBO A;  1FR6 A;  4GOG A;  3G2Z A;  3G30 A;  4QD4 A;  4JLF A;  4JXG A;  4DDY A;  5L2F A;  3G35 A;  4JBF A;  2IWC A;  4N92 A;  1PW1 A;  3PD5 A;  4S2N A;  4S2L A;  3BFC A;  2WGW B;  5EOE A;  1K54 C;  1ONH A;  1E25 A;  5M1A A;  4E3M A;  5KSC A;  1QMF A;  3BLS A;  5AQ7 A;  3WS2 A;  1ES4 A;  1XPB A;  4NBJ A;  2EFX A;  2JCH A;  4PPR A;  4E3J A;  3UE3 A;  4UAA A;  1XGJ A;  2JBF A;  3B3X A;  3NCK A;  4PM6 A;  4WBG A;  3ZGA B;  2ZC3 B;  3OPR A;  1L2S A;  3UDX A;  5BOH A;  3N8L A;  4KZ9 A;  4EBP A;  4DF6 A;  5A91 A;  3D4F A;  5IHV A;  1FOF A;  3KNP A;  4DRT A;  4R3B A;  1O07 A;  2VGK A;  3UPP A;  3C5A A;  5JYP A;  1GCE A;  2Y91 A;  3BEC A;  2RL3 A;  1HVB A;  5E2G A;  5DTS A;  4E3N A;  4LV3 A;  2ZM0 A;  1OME A;  4OON A;  4P87 A;  4E3I A;  1C3B A;  1TC5 A;  4R4S A;  2A3U A;  1H8Y A;  3HUN A;  4OQ0 A;  3FZC A;  3VP0 A;  3RXW A;  1TDL A;  4GB7 A;  3VFF A;  3VP1 A;  3O3V A;  2ZC6 B;  3OZH A;  4E3K A;  5AQB A;  4KZA A;  3LCE A;  2QMI A;  5FQM A;  4OQI A;  2Q9M A;  3IF5 A;  2OLU A;  2EXB A;  1AXB A;  3W4Q A;  4RRC A;  3BFE A;  4BL3 A;  2ZC7 A;  4EV4 A;  4CPK A;  4X55 A;  4R4R A;  1NXY A;  1BTL A;  3ZG0 A;  2Z2M B;  3LEZ A;  2IWB A;  4UA9 A;  4E3O A;  2XH9 A;  3UE0 A;  4UA6 A;  1W8Y A;  4S02 A;  4XXR A;  3LMU A;  1GHP A;  4GN2 A;  4M3K A;  4MNR A;  4LCM A;  1FR1 A;  1IYQ A;  1SCW A;  2WKI A;  3G31 A;  2Y2G A;  4JXV A;  4OQH A;  4RX2 A;  4KZB A;  4FH2 A;  3WS5 A;  2HL1 A;  3WS1 A;  3WWX A;  1CEG A;  1IYP A;  5HFO A;  1LI9 A;  4FH4 A;  1K4E A;  1K57 C;  1FSW A;  3G2Y A;  4S2J A;  1O7E A;  3ZVW A;  4OKP A;  1W5D A;  1PIO A;  1HD8 A;  3EQV A;  1N9B A;  1K56 D;  2ZMA A;  1NY0 A;  2V2F F;  3NDG A;  5EPH A;  1H5X A;  1XP4 A;  2Y55 A;  2ZQ8 A;  3IF6 B;  5HW3 A;  3EQU A;  1BUE A;  4RRM A;  2HKZ A;  1LL5 A;  3HLC A;  5CER A;  3FWL A;  4RR7 A;  3Q7Z A;  3SS4 A;  3MKF A;  4R1G A;  4K0X A;  3E2L A;  4EBL A;  5DF9 A;  3UE1 A;  1GA0 A;  2XDM A;  5DTT A;  2HDU A;  2XR0 A;  3HLB A;  5JYO A;  4ZAM A;  1Y2Q A;  5AQA A;  1NYM A;  2C5W B;  3GV9 A;  2XQZ A;  3IQA A;  3MZD A;  3ZDJ A;  2V1Z A;  2WGW A;  1CI9 A;  4RRR A;  5CTM A;  4RVA A;  3JYI A;  5CHJ A;  2ZLY A;  3BFG A;  3KO4 A;  1MBL A;  1W8Q A;  2G2U A;  3BFD A;  4KQQ A;  4N9L A;  5CTN A;  3GQZ A;  3V3R A;  5J8X A;  2DRW A;  1PW8 A;  1BZA A;  2OSU A;  3IT9 A;  4FD8 A;  4OOY A;  2Z2L B;  1J7G A;  1KGG A;  2GDN A;  3CMZ A;  2EX2 A;  3I7J A;  5EVI A;  1G6A A;  5TR7 A;  2H5S A;  1MWU A;  2I72 A;  3HVF A;  3LY4 A;  4S2P A;  4PMA A;  3WS4 A;  4LEN A;  2EX6 A;  3ZFZ A;  5HAI A;  3GRJ A;  4OOM A;  1GA9 A;  3Q1F A;  3HRE A;  4OVD A;  4C6Y A;  1DY6 A;  5FQI A;  5FAT A;  4OP8 A;  1L0G A;  4KG6 A;  3IWI A;  2ZM8 A;  4S2M A;  4MBF A;  4DDS A;  3Q7V A;  4CJN A;  3MXS A;  5G18 A;  3CJM A;  3G32 A;  4Y0T A;  1MY8 A;  1VM1 A;  3ITB A;  1LLB A;  2ZM2 A;  3GR2 A;  2IWD A;  3IHA A;  3KNF A;  1WYC A;  4B4X A;  4DKI A;  4H8R A;  5EUA A;  1YT4 A;  4EBN A;  4JF4 A;  1GHI A;  2ZQ7 A;  4S2N C;  3V5M A;  5E43 A;  2ZC4 B;  2Y2L A;  3HLW A;  1YLT A;  3ZNT A;  4RRK A;  1KE0 A;  3LO7 A;  4RRI A;  1ERM A;  2Q9N A;  2B5R A;  5J61 A;  5TFQ A;  2Y2H A;  1YLY A;  3CZD A;  1KDW A;  3P98 A;  4EWF A;  4YFM A;  2RCX A;  4E6X A;  3PD3 A;  3V3S A;  3RJU A;  4RYE A;  4X69 A;  3OPL A;  3A3F A;  4GD6 A;  3C7U A;  1BT5 A;  1HZO A;  4P85 A;  3WRT A;  5CEB A;  3VFH A;  3PD2 A;  1DJA A;  3M2K A;  4QHC A;  4BD1 A;  5A92 A;  3IF6 C;  1NYY A;  4MBH A;  1K54 A;  1HTZ A;  5DVA A;  5FI2 A;  1IKI A;  4RRL A;  4IVK A;  3A3E A;  3V39 A;  4WMC A;  3Q81 A;  3PBR A;  4KQO A;  2A49 A;  1BLH A;  3A3I A;  4OPQ A;  1RP5 A;  3TSG A;  4ZDX A;  3LMT A;  3FYZ A;  1SHV A;  4HES A;  5CGS A;  5E2E A;  3VOZ A;  1J9M A;  4HBU A;  3N7W A;  1CI8 A;  3MZF A;  1I5Q A;  3W4O A;  1YQS A;  1FSY A;  4QY5 A;  4WYY A;  5EOO A;  2WZX A;  1YLW A;  1K6R A;  2XK1 A;  4OLD A;  1WE4 A;  5D3O A;  1XX2 A;  5F1G A;  3GVB A;  3HLF A;  1K6S A;  3IHB A;  3P09 A;  3ZHH A;  4RR6 A;  4XUX A;  3IXD A;  5M19 A;  2R9X A;  1E3U A;  2PU4 A;  1I2W A;  3Q07 A;  3N6I A;  5EVL A;  1K38 A;  2WK0 A;  2P9V B;  1M6K A;  3UPO A;  2OKV A;  2WZZ A;  5GLC A;  2HDR A;  3SH7 A;  4KZ5 A;  3UPN A;  1JTG A;  4BLM A;  1VQQ A;  3KO5 A;  1NZU A;  2ZQ9 A;  4WZ5 A;  2Y2I A;  1EWZ A;  1XKZ A;  3IXH A;  5GHZ A;  3ZCZ A;  4BEN A;  2PU2 A;  3ZG7 B;  1LHY A;  5FQQ A;  5GL9 A;  1S0W A;  4JKT A;  5M18 A;  4OPY A;  5HX9 A;  4KZ4 A;  1BLP A;  4ZJ1 A;  4RRA A;  4ID4 A;  4KZ3 A;  1H8Z A;  4C3Q A;  1SDE A;  1ES3 A;  3HLD A;  3PAG A;  4X6T A;  4BQM A;  5TGF A;  1IYO A;  3DTM A;  1TEM A;  3KO9 A;  2Y59 A;  4LV0 A;  4E6W A;  1ERQ A;  3G4P A;  3VOY A;  5EVI D;  3SS3 A;  2HP5 A;  3NIA A;  2CC1 A;  2FFF B;  2ZJ9 A;  2Y4A A;  4R3J A;  4DE2 A;  3V50 A;  1M40 A;  1LL9 A;  3LY3 A;  5FQ9 A;  3PBQ A;  5FI7 A;  5A90 A;  3OC2 A;  4LV1 A;  4RRD A;  1MWR A;  2J9O A;  4RX3 A;  5DTK A;  1JVJ A;  2J7V A;  3BLM A;  3UNW A;  4FCF A;  1ES5 A;  1K57 A;  5FAP A;  1TDG A;  4JPM A;  1CEF A;  1W7F A;  2WKE A;  2WYX A;  1FCM A;  4KG5 A;  2VGJ A;  4B88 A;  3VP3 A;  3CG5 A;  1K55 C;  4IVI A;  3UDI A;  1RGY A;  1XXM A;  3SH9 A;  3VP2 A;  2J8Y A;  3M2J A;  1ONG A;  4S2I A;  4IBX A;  4S0L A;  4KZ6 A;  1DJC A;  3N8S A;  4S2O A;  3QHY A;  3UN7 A;  5F1F A;  4BJP A;  1BUL A;  4Y0O A;  2HDS A;  3BM6 A;  1YLP A;  4XUZ A;  4Y7P A;  4C75 A;  4RR8 A;  2ZC5 B;  1L0E A;  2ZQD A;  4EQI A;  2XEP A;  1QME A;  1MWS A;  1BLC A;  3DWZ A;  1IEM A;  4KEN B;  5GLA A;  2Y2N A;  1K25 A;  1Y54 A;  4DE1 A;  4S0K A;  2EX9 A;  4NBI A;  1U60 A;  1YMX A;  5CGW A;  3BFF A;  5FQJ A;  2ZQA A;  4WMC D;  5F82 A;  5CRF A;  5GLB A;  1MPL A;  4MLL A;  5F83 A;  4DXC A;  1K4F A;  2JE5 A;  4RRF A;  4P0M A;  2QZ6 A;  4OPR A;  4QB8 A;  4S2K A;  3ITA A;  3FKW A;  4X56 A;  5GHY A;  2XLN A;  5KSH A;  1BLS A;  3HBR A;  2WUQ A;  3RXX A;  3O86 A;  5HAP A;  2HP9 A;  1ZG4 A;  2Y2P A;  5FAO A;  1XA1 A;  5GHX A;  1RCJ A;  3TG9 A;  3KO7 A;  1FCO A;  5EE8 A;  5A93 A;  2DCF A;  2WAF A;  3UY6 A;  2H0Y A;  3Q82 A;  1XGI A;  3PBS A;  2HL0 A;  5GLD A;  1ZC2 A;  1E3U D;  3VSL A;  5FA7 A;  1PWC A;  1ESU A;  4BD0 A;  3MXR A;  4FSF A;  5HL1 A;  1PZP A;  4RRG A;  1IEL A;  4KQR A;  5EEC A;  2EX8 A;  4HEF A;  2XD5 A;  3SOI A;  2XF3 A;  1ERO A;  1LI0 A;  2C6W B;  3TOI A;  4P6B A;  3O87 A;  4U3T A;  1NJ4 A;  5U47 A;  4QJG A;  1PI4 A;  3S4X A;  2QPN A;  4QU3 A;  1XA7 A;  2JC7 A;  2G2W A;  5FQK A;  3HLG A;  4ZJ2 A;  1YMS A;  4DXB A;  1L0F A;  3ISG A;  1GHM A;  1YM1 A;  1YLZ A;  4GKU A;  2X01 A;  4N9K A;  4D2O A;  3NBL A;  1MWT A;  2R9W A;  4KG2 A;  3NY4 A;  4X68 A;  2HDQ A;  1KVL A;  3QNC A;  3KOD A;  4WEJ A;  5CHM A;  2OLV A;  1Q2P A;  4OP5 A;  3BEB A;  4YIN A;  2FFY A;  2XGN A;  4GDN A;  5EVI B;  3W8K A;  3OPP A;  5DF7 A;  3IF6 A;  1TVF A;  1FCN A;  1ES2 A;  2WGI A;  4GD8 A;  1JWP A;  3PAE A;  2ZD8 A;  3NC8 A;  2OV5 A;  3MZE A;  2V20 A;  4MBK A;  3G34 A;  3UDF A;  2E8I A;  1KGE A;  3GTC A;  4NK3 A;  3KOB A;  1L0D A;  4ZBE A;  5FI6 A;  3QNB A;  5E2H A;  4Q8I A;  1FQG A;  3VSK A;  2EXA A;  3IWQ A;  1KE3 A;  4HBT A;  3IH9 A;  4OOL A;  3Q7V B;  5FAQ A;  5HAR A;  2WKH A;  5AQ9 A;  4K0W A;  3ZVT A;  1NRF A;  4WZ5 C;  5I94 A;  4RRJ A;  4OH0 A;  1MXO A;  3PTE A;  2WAD A;  3PD4 A;  1SDN A;  4IED A;  1KE4 A;  2HP6 A;  3S1Y A;  4RA7 A;  1KGF A;  2PBY A;  3MFD A;  2UWX A;  4OPZ A;  3OCL A;  5KZH A;  4Y0U A;  4LV2 A;  1ZG6 A;  4DE0 A;  4WM9 A;  3PBN A;  2X02 A;  4JF6 A;  2DNS A;  5DF8 A;  4F94 A;  3WRZ A;  1EI5 A;  2Y2O A;  3IH8 A;  1ESI A;  4GZB A;  4JF5 A;  4OLG A;  4R0Q A;  5CGX A;  4JXW A;  4S0J A;  1I2S A;  4O7D A;  4UHU A;  1SKF A;  3E2K A;  3FV7 A;  3IXB A;  3BRM A;  3W4P A;  4Z9Q A;  3HUM A;  1CK3 A;  4BL2 A;  3VP4 A;  1ZKJ A;  2P74 A;  4ZJ3 A;  2EFU A;  1PZO A;  2Y2K A;  1PWD A;  4LCL A;  4U0T A;  1RGZ A;  3AGD A;  4U0X A;  4PM8 A;  3IXG A;  3M6B A;  3MKE A;  4PM9 A;  3S22 A;  4EUZ A;  3SH8 A;  1IKG A;  4GNU A;  3IWO A;  4L0L A;  2BG1 A;  2XFT A;  3NDE A;  4N1H A;  3KOC A;  1JWV A;  4JXS A;  3BYD A;  5CHU A;  4R23 A;  5FAS A;  2WGV A;  3C4O A;  5KMW A;  3KO3 A;  3C4P A;  1W79 A;  4S03 A;  1G68 A;  1N4O A;  3C7V A;  4WZ4 A;  5E2F A;  3AGE A;  5FSR A;  1ALQ A;  3N4I A;  5CXW A;  4KZ8 A;  4E3L A;  1MKI A;  4RRB A;  3FKV A;  3NI9 A;  3O88 A;  4ZTK A;  4PM5 A;  4UA7 A;  3A3J A;  4RRH A;  1JWZ A;  4X53 A;  3SS5 A;  1BSG A;  4K91 A;  3HLE A;  3GMW A;  4MEZ A;  1NZO A;  1K55 A;  2BLS A;  3MBZ A;  5EVI C;  2X71 A;  2XFS A;  3PBT A;  4IBR A;  4QY6 A;  3ZG8 B;  4PM7 A;  2H10 A;  3N8R A;  4WEL A;  4N1X A;  1S6R A;  1JTD A;  4S0I A;  4GDB A;  3OPH A;  2H0T A;  1PYY A;  2DBO A;  4NET A;  4RR9 A;  3VMA A;  4KZ7 A;  3UO9 A;  4A5R A;  2ZQC A;  3LMV A;  1YLJ A;  4B4Z A;  2WAE A;  1WYB A;  5FDH A;  1PWG A;  1Q2Q A;  4WEK A;  3GSG A;  4OQG A;  3ZG5 A;  2J9P A;  1K56 A;  1PI5 A;  5CED A;  2XD1 A;  3ZNY A;  3M6H A;  5CEC A;  5HAQ A;  2Y2Q A;  3WS0 A;  1JKE A;  3AGF A;  1E4D A;  1IYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...