1AE9A

Structure of the lambda integrase catalytic core
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
179
structure length
171
Chain Sequence
RSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKTGVKIAIPTALHIDALGISMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASGLSFEGDPPTFHELRSLSARLYEKQISDKFAQHLLGHFRDDRGREWDKIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LAMBDA INTEGRASE
publication title Flexibility in DNA recombination: structure of the lambda integrase catalytic core.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Dna recombination
total genus 56
structure length 171
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00589 Phage_integrase Phage integrase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.443.10 Mainly Alpha Orthogonal Bundle hpI Integrase; Chain A Intergrase catalytic core 1ae9A00
1PVPA 5C6KA 1P4EA 1DRGA 1P7DA 4A8EA 1Z1BA 1CRXA 1OUQA 1XO0A 1M6XC 1AIHA 1PVRA 1MA7A 1A0PA 3C29A 2HOIA 5DCFA 3VCFA 1XNSA 4DKSA 3NKHA 3C28A 2CRXA 3MGVA 1P4EC 2HOFA 5CRXA 5DORA 1Q3VA 1FLOA 3CRXA 1M6XA 1PVQA 1NZBA 3UXUA 1KBUA 1AE9A 2A3VA 4CRXA 1F44A 1Z19A 1Q3UA
chains in the Genus database with same CATH superfamily
4E0GA 1PVPA 4E10A 5C6KA 2V6EA 1P4EA 1DRGA 4E0YA 1P7DA 4A8EA 3SQIA 4DWPA 1Z1BA 4E0ZA 1CRXA 4ACOA 1OUQA 1XO0A 1M6XC 1AIHA 1PVRA 1MA7A 1A0PA 3C29A 2HOIA 5DCFA 4E0PA 3VCFA 4DKSA 1XNSA 3NKHA 3C28A 2CRXA 3MGVA 3T79A 1P4EC 2HOFA 5CRXA 5DORA 1Q3VA 4F41A 1FLOA 3CRXA 1M6XA 1PVQA 1Q3UA 1NZBA 3UXUA 1KBUA 1AE9A 2A3VA 4CRXA 1F44A 4F43A 1Z19A 4E0JA
chains in the Genus database with same CATH topology
1PVPA 5C6KA 1P4EA 1DRGA 1P7DA 4A8EA 1Z1BA 1CRXA 1OUQA 1XO0A 1M6XC 1AIHA 1PVRA 1MA7A 1A0PA 3C29A 2HOIA 5DCFA 3VCFA 1XNSA 4DKSA 3NKHA 3C28A 2CRXA 3MGVA 1P4EC 2HOFA 5CRXA 5DORA 1Q3VA 1FLOA 3CRXA 1M6XA 1PVQA 1NZBA 3UXUA 1KBUA 1AE9A 2A3VA 4CRXA 1F44A 1Z19A 1Q3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVP A;  5C6K A;  1P4E A;  1DRG A;  1P7D A;  4A8E A;  1Z1B A;  1CRX A;  1OUQ A;  1XO0 A;  1M6X C;  1AIH A;  1PVR A;  1MA7 A;  1A0P A;  3C29 A;  2HOI A;  5DCF A;  3VCF A;  1XNS A;  4DKS A;  3NKH A;  3C28 A;  2CRX A;  3MGV A;  1P4E C;  2HOF A;  5CRX A;  5DOR A;  1Q3V A;  1FLO A;  3CRX A;  1M6X A;  1PVQ A;  1NZB A;  3UXU A;  1KBU A;  1AE9 A;  2A3V A;  4CRX A;  1F44 A;  1Z19 A;  1Q3U A; 
#chains in the Genus database with same CATH topology
 4E0G A;  1PVP A;  4E10 A;  5C6K A;  2V6E A;  1P4E A;  1DRG A;  4E0Y A;  1P7D A;  4A8E A;  3SQI A;  4DWP A;  1Z1B A;  4E0Z A;  1CRX A;  4ACO A;  1OUQ A;  1XO0 A;  1M6X C;  1AIH A;  1PVR A;  1MA7 A;  1A0P A;  3C29 A;  2HOI A;  5DCF A;  4E0P A;  3VCF A;  4DKS A;  1XNS A;  3NKH A;  3C28 A;  2CRX A;  3MGV A;  3T79 A;  1P4E C;  2HOF A;  5CRX A;  5DOR A;  1Q3V A;  4F41 A;  1FLO A;  3CRX A;  1M6X A;  1PVQ A;  1Q3U A;  1NZB A;  3UXU A;  1KBU A;  1AE9 A;  2A3V A;  4CRX A;  1F44 A;  4F43 A;  1Z19 A;  4E0J A; 
#chains in the Genus database with same CATH homology
 1PVP A;  5C6K A;  1P4E A;  1DRG A;  1P7D A;  4A8E A;  1Z1B A;  1CRX A;  1OUQ A;  1XO0 A;  1M6X C;  1AIH A;  1PVR A;  1MA7 A;  1A0P A;  3C29 A;  2HOI A;  5DCF A;  3VCF A;  1XNS A;  4DKS A;  3NKH A;  3C28 A;  2CRX A;  3MGV A;  1P4E C;  2HOF A;  5CRX A;  5DOR A;  1Q3V A;  1FLO A;  3CRX A;  1M6X A;  1PVQ A;  1NZB A;  3UXU A;  1KBU A;  1AE9 A;  2A3V A;  4CRX A;  1F44 A;  1Z19 A;  1Q3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...