2A3VA

Structural basis for broad dna-specificity in integron recombination
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
319
structure length
313
Chain Sequence
b'GSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHSGVLSPLSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (31-MER)
publication title Structural basis for broad DNA-specificity in integron recombination.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Recombination
total genus 91
structure length 313
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00589 Phage_integrase Phage integrase family
A PF13495 Phage_int_SAM_4 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2a3vA01
1.10.443.10 Mainly Alpha Orthogonal Bundle hpI Integrase; Chain A Intergrase catalytic core 2a3vA02
3MGVA 1A0PA 3UXUA 2KJ8A 1PVPA 3CRXA 1XNSA 3NRWA 1NZBA 1FLOA 2KHVA 5DCFA 5C6KA 3NKHA 4A8EA 2KOBA 4CRXA 2KKVA 1F44A 3C29A 1DRGA 5CRXA 1PVRA 2KIWA 1Q3VA 2KJ5A 1Z19A 1P7DA 2HOFA 2HOIA 1CRXA 1Q3UA 3LYSA 3VCFA 3C28A 1AE9A 2OXOA 1OUQA 1Z1BA 2KKPA 4ACOA 2KHQA 1AIHA 5DORA 2CRXA 4DKSA 1M6XA 2KEYA 1M6XC 1PVQA 1KBUA 2KJ9A 2A3VA 1XO0A 1MA7A 1P4EA 2KD1A 1P4EC
chains in the Genus database with same CATH superfamily
4IQUA 4IQTA 2YTUA 5KG6A 4RQ5A 2VIXA 5KAIU 1X66A 5AI8A 1Z4OA 2RRDA 4DSFA 3L3FX 2LM4A 8ICYA 1D8LA 9ICCA 2F77X 4MFFA 8ICXA 2BCVA 2EQYA 1L3SA 2F2AB 5KTQA 5J8YA 4RT3A 4DQIA 1FIQA 4ECRA 5DB6A 4IQWA 4K4IA 1PVPA 1RXWA 2LPEA 5FP0A 4F43A 2PXIA 1X40A 4MFAA 2IOHA 3UMGA 4Q8FA 5DGBA 3U26A 4YD1A 4JUZA 1COKA 2YB1A 4DCCA 2KZMA 4TUQA 3T5HA 1ZJNA 8ICSA 4RQ3A 1UT8A 1MA7A 5DG9A 3EYZA 4F2SA 4M9LA 1TVAA 4E10A 2EDUA 1NK4A 2W43A 2C22A 2VA2A 3RR7A 4MHVA 2ASJA 4QZAA 3GIIA 2ZIWB 5ALOA 1N62A 5KT6A 2WFAA 3PX4A 4J9KA 3BQ1A 4DQRA 5ALQA 4C8LA 2HBLA 3OHBA 2KE7A 5AKEA 3WK8A 3RJFA 3Q8QB 2BHNA 2FI1A 1UPHA 1A76A 4G9BA 1S0NA 1V97A 5KFMA 3KTQA 4JV1A 3SV3A 5DORA 4LVSA 1S8OA 3FYHA 4CF3A 4C0ZA 4R63A 4UBCA 4DQPA 2RP5A 2H3QA 4UB6U 3C29A 3DEEA 3NRZA 4Y2PA 3RBDA 4ECUA 4O3RA 2KV2A 4O5KA 4Y2QA 1N60A 1ZQPA 8ICBA 1SL0A 3UXNA 2BQUA 3CP8A 3D2NA 4M9NA 2MSNA 2WB1F 5L9XA 4QZGA 4RNNA 5ALJA 4F92B 2ES6A 2LBOA 4UB3A 2CN1A 2FMQA 5EWGA 2LM1A 3H40A 7ICIA 1QQ5A 1Q8KA 2BPGA 1TE2A 2WF9A 2J6TA 4RQ6A 9ICIA 2DPJA 1VLBA 5KG1A 2NO5A 4DWIA 4ELVA 5C5JA 1SXEA 3NVZA 3EZ5A 3LWMA 5DQHA 3MABA 1V85A 2I5HA 3EWAA 3QU2A 3TFSA 1B43A 2R8JA 4USAA 3HT3A 2XICA 1S0MA 5KFPA 1KSPA 3C1YA 2BZFA 3PR5B 4F8RA 4ED2A 3AL0B 1SIJA 1S5LU 1BPDA 2ASDA 2E3TA 5JTIA 5KT5A 3QEBZ 7ICQA 4YD2A 1ZQIA 2FE9A 4I2IA 4P0PB 4OJPA 3H8MA 1KQQA 2ALZA 4X5VA 3IRUA 4PHAA 3LK9A 4ECZA 5KFZA 3RB6A 8ICPA 4MEYA 4PJ0U 5KG3A 4JV0A 4PHPA 5CA7A 3MR3A 1C20A 3NVVA 8ICEA 4OJ5A 3V7LA 4B9VA 1HIWA 1J2NA 5KFNA 3IG5A 3HILA 3UXOA 8ICNA 2R8GA 4I2DA 5AM0A 8ICZA 1TAMA 5D46A 2ZIXA 3QUCA 4O5EA 2H3IA 2P6UA 1JX4A 1ZXIA 3WK5A 5KL1B 4AYBF 4DOBA 5KFJA 3T5LA 2JH1A 4RQ4A 2BPFA 3F5EA 3C21A 4J9NA 5J2CA 2KIVA 1TK0A 5KG5A 8ICUA 1ZJMA 3HRDD 2W7PA 3HKZF 2HSZA 3ETRA 2PKEA 8ICAA 2PFPA 1ZD4A 2G07A 4M47A 3H8SA 5HR7A 1L3TA 4F2RA 2A3VA 4MFCA 4OO1J 2XIDA 4KMUA 1NJWA 4ED6A 4UBBA 4Y2SA 2QB0A 5ALMA 1PZNA 1SWVA 2W04A 4KLDA 1SWWA 1NKEA 1V38A 3N28A 5G5HA 3IM1A 1Z1VA 4I2JA 1SZPA 3NVWA 3Q8LA 4QZIA 3GV7B 2C2EA 3F2DA 3NUQA 8ICGA 5HMLA 4ECWA 5AKLA 4C8MA 1NJYA 2JMGA 2NRTA 5KFXA 3M6KA 4BUGA 2W7OA 4M0AA 2F1HA 9ICSA 5AK3A 3ZD8A 4E0YA 3S6JA 3AN1A 4O3PA 2AGOA 1L6NA 2RQ5A 4PHDA 2PI5A 2JH7A 2I9GA 3HPOA 2HBJA 2IA6A 2OHFA 3BQ2A 1XWLA 4EYIB 1L7PA 1KL9A 4XUSA 4IRCA 3RR8A 1SGGA 8ICQA 5KFYA 1N61A 2V4RA 5ALYA 2D8CA 1V9PA 1Z3EB 3BQ7A 2EZXA 4KTQA 2JR5A 3M1YA 4Q43A 3RJKA 4P4PA 1SL2A 5AIBA 4CRXA 2LHTA 1BNOA 3MR2A 9ICEA 2BCUA 4Q44A 1AQ6A 9ICPA 2KSOB 1QSSA 4Y2YA 2YMQA 1M6YA 4KLFA 5L1KA 5DGAA 3RJIA 5ALTA 5AM5A 1BPZA 1ZOLA 2PFNA 5IIKA 1QH9A 1ZQEA 9ICXA 4YR3A 1U47A 4FZNA 2HHWA 1KKXA 4J9OA 1T3QA 3C5FA 3SI8A 2FLPA 1Z1BA 3TI0A 5DB9A 5AHXA 1TK5A 9ICKA 2LMRA 2KFZA 4NLCA 4DLGA 1ED1A 2V4QA 1NZBA 7ICGA 2JRZA 5KFSA 3V6KA 4P0QA 4RNMA 2QB0B 3TANA 1Q3UA 7ICOA 4ECQA 4DKSA 4YXJA 7ICFA 1M6XC 2C28A 5IIOA 3FAHA 5AI4A 1T7PA 2AU0A 3QNMA 4B6JA 3PW0A 3I1YA 5C6KA 2GWSA 5K4LA 2R8KA 1ZQDA 4DL2A 4XA5A 2WHEA 5J2IA 4UARA 3M6ZA 3IDWA 3RRHA 4TUSA 3PW2A 1AE9A 4EZ6A 2KP7A 2B0CA 2KZ3A 3PO4A 4QZDA 3K1ZA 5J8YC 4RQ2A 2H5XA 1JALA 2A1JB 3PSPA 3GV5B 1ZYQA 1NK8A 2PMZF 1YZ7A 3QXGA 4PZOA 4C7YA 5ALUA 1U45A 1RXVA 3WU2U 5KFTA 5KT3A 2WF7A 1U48A 2FDRA 3JPNA 4ED7A 2K4EA 4RQ0A 5B5EU 2NYVA 3A0BU 3SZ2A 1NK9A 7ICKA 5L1JA 3PX6A 4MF8A 2D3DA 2HDOA 4IS7A 3OJUA 1UA1A 1FLOA 1TAUA 3OPXA 5ALKA 5ALDA 2H3ZA 8ICHA 1P7DA 3PSFA 4F5QA 2O6KA 2AXTU 1KFDA 3SMVA 1U4BA 4NM1A 1DK3A 1SV0C 1NK6A 4UB5A 4KLUA 4ELUA 3SAGA 3AMZA 2P35A 4RQ8A 1UT5A 3RB0A 2OM6A 1QQ7A 4DLEA 3CW2C 4B9TA 4RQMA 1GO3F 3JPOA 2DF4B 5HMMA 4NLZA 5HP4A 4PL2A 4UASA 1WCLA 4F3OA 3D2SA 2ZJAA 2ISPA 4BXOA 3G6VA 1TKDA 1VJ5A 3RJHA 3RH6A 3QZ8A 3KKAA 1XSLA 3M9OB 4EYHB 4Y2TA 2MAXA 1BVSA 2DPIA 4I27A 1D9DA 1NOMA 2IHMA 2XC9A 2DKXA 3M8SA 3GQCA 1ZQJA 3MFIA 3ZDBA 3AQEA 1OW5A 3GV8B 2F8LA 2GLEA 3V6JA 2HI0A 2WF8A 5KT4A 8ICTA 2W03A 4GXIA 3MR6A 2E8OA 4BGDA 2QB1A 3RB3A 1T4GA 4R66A 4KLQA 1L3UA 4O5CA 5KNIA 2KIWA 3WKCA 2XGPA 2HVHA 5ALEA 1UQVA 1RQNA 4FFDA 3PMLA 2L5YA 1HJPA 3RJJA 1JRPA 2IOFA 2J6UA 2UVVA 2WB1C 9ICGA 5EE1A 3ZDAA 2AJQA 2BDPA 3T3FA 3LVVA 3BS5B 2ZIVA 4DSJA 4FO6A 4M6WB 4C80A 2E1FA 5KG2A 2M0NA 2RDJA 3SAHA 1N56A 1MN8A 1OUQA 2G08A 2KEYA 5KFEA 1J2MA 3ZDDA 3OSPA 1RZTA 4DS5A 3TADC 1D9FA 5HHHA 5BPCA 1WUDA 3IN5A 5J2HA 4DF8A 5L1LA 2I6XA 1Z00A 1XS9D 1S9FA 2HOQA 4RQ1A 3CYMA 4DL5A 2VKQA 4C4SA 4QZHA 4RNOA 4RU9A 3TAQA 2IOFK 3TKAA 2Y0SC 5DDYA 4FS2A 2P6RA 5GTIU 4OJLA 2YMLA 4IC9A 2R8HA 2BKEA 4PZNA 1QQ6A 1ZETA 4QZ9A 2ZIUA 1L5UA 2KKPA 2G5HB 2JZBA 3PSIA 1NKBA 2IMWP 4JK1A 4WJ3B 3GFKB 5H2FU 2M9NA 5DLFA 2PFQA 4F93B 4NY8A 2MUTA 1ZQMA 4CE6A 5KFKA 3GDXA 3QUQA 5ALGA 5E79U 5AM3A 5KAFU 4I2BA 4HYKA 1SB3C 1S77D 3SENA 4F71A 7ICEA 2W9CB 2VANA 1O08A 2K4IA 3LDAA 4RT2A 2OYYA 4IQVA 4YMMA 2PFOA 2KK0A 1ZQGA 1PVQA 3Q8KA 4BDPA 4AYBC 3SR6A 4YP3A 2KHVA 2OEHA 3H8JA 4GLXA 5DG8A 4F4WA 1N5WA 3F5AA 1F44A 5AK5A 2E5SA 2ZG6A 3HKZC 4I2GA 2KHQA 1C7YA 5DBAA 4NL9A 3QEAZ 5F3XB 2K8BB 5KFVA 1ZQOA 3H4BA 4ED8A 3CRXA 2A19A 2KFNA 3NKHA 4A8EA 4KLHA 4KLLA 4PGXA 4B9SA 2ZIVB 1ZD5A 2EAMA 3HX0A 5ALSA 1AROP 4DL6A 2FMPA 3N97B 7ICHA 5HHIA 1T8EA 1K5OA 4YN4A 5IILA 3RJGA 3ORYA 4TQRA 1KBUA 2NRZA 5J2AA 4F50A 1LKYA 1LVHA 8ICRA 2ZTEA 4DFJA 5DLGA 2AH5A 5KG7A 1HUOA 3AM9A 2XO7A 1QSYA 4QIWC 5J0QA 1DRGA 3UMBA 2EANA 5AKHA 3TACB 3V7KA 1U49A 4UAZA 2AQ0A 3V72A 1BNPA 4F72A 1Z00B 4DQQA 4K4HA 5AI6A 2XY5A 1KRPA 3E2EA 1L7NA 1U9LA 4PL1A 1SL1A 4UAVA 5J2BA 4FBTA 1J97A 1XNSA 3ETLA 3ICXA 2Y1JA 3QU7A 4MF2A 2UVUA 5CJ7A 1A6SA 5EE9A 1K1QA 3PNCA 4M9GA 1ZQWA 5ALWA 1DXSA 3Q8RB 3ISDA 4I2FA 4F4YA 3M8RA 4UB8U 2LYBA 5KFHA 2YX8A 2Y9UA 5AM4A 2E1EA 5ALFA 1KEJA 4QWAA 2JZBB 3SYZA 5DB7A 2HBKA 2UVRA 3F53A 2C2DA 4ICAA 5AI9A 5T14A 3HJEA 1N63A 3G6XA 1ZQFA 5J2FA 4J9MA 4M04A 4ELTA 4BJQA 4R64A 4DFPA 1H38A 5TISU 4QZBA 2CXYA 2RDIA 5AIAA 3THVA 3WK6A 2E8NA 4E0JA 2HVIA 4KX5A 1XU4A 3GU3A 2W11A 2ASLA 3H0LB 3MDAA 2JEJA 4P2HA 7ICUA 4YFKA 1Q3VA 4DS4A 3LYSA 1TV9A 3PO5A 4YXMA 4UAYA 3B0YA 1S0VA 5J2KA 2NO4A 3AU2A 5KFDA 3LWLA 3EPIA 4DSEA 3ZDCA 2EZZA 2KZZA 3NRWA 2DQNB 4NJ8A 9ICJA 3FC4A 2BQ3A 5J0YA 2JEIA 4GC7A 5KT7A 2H3VA 1BPEA 3T5KA 5KFOA 1S0OA 5AKGA 2AQ4A 4F4XA 2VA8A 5D49A 3DV9A 3MR5A 1ZQHA 2ODGA 5CEHA 4E0GA 5ALXA 2LYAA 5ALNA 4OCZA 4M2YA 2R18A 9ICUA 4Q45A 3PMNA 3FM9A 2F3NA 1S97A 3TAPA 5J0RA 1WCNA 5G5GA 7ICPA 5IIMA 1Y88A 5J2DA 1XSPA 4OD0A 4CNQA 3BJYA 5KFFA 1JROA 9ICLA 4J9PA 2PMZC 2JEFA 2XI9A 5AK6A 2DFLA 4TQSA 1BGXT 3AQFA 1KLNA 1D8BA 4YMNA 3B0XA 1ZQYA 1IV8A 7ICMA 1FEZA 4DFDA 1UA0A 4QZCA 1L3VA 2GH1A 5ALLA 2MU2A 1X6IA 1A77A 1ZQZA 2V6EA 3RH5A 2AGQA 4B9NA 8ICVA 3OJSA 1L8OA 1PK1A 5KFAA 2KJ9A 2BR0A 4DSKA 4IRDA 4GXJA 1YT3A 2XVTA 2ZIXB 2ZTCA 4J9LA 4NM2A 4O3MA 2VJ4A 2G09A 1X6JA 4M9JA 1SV4A 4Y2VA 5AKXA 2UVWA 3ZD9A 8ICWA 1ZQCA 3V6HA 2WF6A 2DUYA 2KVSA 5EOZA 5KFWA 1QLNA 3KKAC 3GIJA 1CUKA 1JN3A 2W9AA 3TARA 2KMDA 4PPXA 4KX3A 3C23A 1JI7A 4DO9A 2HHVA 1KTQA 5CWRA 2KTQA 4EBDA 4KLIA 1AIHA 3J81j 2FPKA 1ZRNA 5AI0A 5EWFA 4BWMA 4O9MA 4B9LA 4FE3A 1MC8A 4J9QA 3RAXA 3RTVA 2FLLA 4UQGA 4KLEA 4F5OA 9ICMA 1PK3A 3KHRA 1FFVA 3ONNA 3JPRA 1QCKA 1ZD3A 2Z7JA 3HWTA 2W8LA 1DK2A 5J0PA 5DBBA 4FZLA 4IRKA 5EE0A 4JMUA 4P4MA 4BWJA 3UXUA 5DQIA 2YMMA 3D2QA 1WWVA 1IG6A 3QE9Y 2ZTDA 3RJEA 2CPRA 3OHAA 4O3NA 4ZH4A 3PVXA 4Y2JA 2ZUBA 1L7MA 2QLTA 1X9WA 3NVYA 1WYGA 1P4EA 2Q4TA 5KFRA 2XCPA 3PZPA 4FS1A 3KBBA 5A0LA 2FLNA 3NS1A 3KHGA 4PGYA 2J6SA 8ICJA 1LV5A 5AKZA 1SKSA 4DL4A 1RM6C 3MFHA 2XY7A 4DQSA 2YY6A 2DBYA 1B0XA 1NK5A 4QWEA 3PW4A 1DGSA 1PK1B 5DCFA 2C2RA 4EEKA 2ZIWA 3TFRA 9ICAA 5EWEA 2BCRA 4FBUA 5D4BA 1IM4A 2W3SA 4ACOA 4I2HA 4G3IA 3RH4A 4O3QA 1NK7A 3QYPA 5IIJA 1Q46A 2KD1A 4QW8A 3I76A 2BCSA 2K89A 3KD3A 9ICTA 2ZXHA 2DKZA 3KOOA 5KFCA 9ICFA 2KICA 2JGAA 3IG8A 1ZQAA 4ED1A 1TAQA 3QX7A 3WK4A 2WF5A 4P0QB 5J29A 4U6PA 3MDCA 2F1JA 3IHQB 1XO0A 5HR6A 4JV2A 1A0PA 1KFTA 1ZQSA 2N1RA 1SZHA 4B9UA 2EZYA 3Q8MA 5AK4A 2BCQA 2W3RA 5J0WA 1NK0A 2OCEA 4C8KA 3L5KA 3MGHA 2QKQA 5B66U 3GILA 2KJ5A 4C8NA 5AKJA 3Q8PB 2F76X 1KFSA 2IBKA 1M6XA 2FPMA 4Z6CA 3ALRA 1HUZA 1RYSA 2NV3A 5GTHU 3PR4A 5ALVA 2F8KA 2B6GA 7ICRA 4M9HA 5KT2A 4YQWA 4KLSA 2XY6A 5C0YA 1NI3A 8ICLA 2IHNA 2G5IB 3KFUF 2RHFA 5KFQA 4AP9A 3RB4A 4BX9C 3SAFA 1IIPA 2PI4A 1PUZA 5AKYA 3WKEA 3OTQA 4US8A 2R8IA 4I2AA 3C5GA 4RQNA 3C2MA 4GFJA 4ECTA 3JPTA 2FMSA 2LI6A 3EW9A 5JRTA 5DQGA 3ZI4A 4YCXA 1TK8A 1T3NA 4C4TA 5J0OA 4NV0A 3NGDA 4EX7A 4F5RA 3QU9A 3H8WA 4P0PA 1X2IA 4O0IA 2KN7A 5L1IA 5BOLA 2I1QA 1FO4A 2NRVA 2KOBA 4FZMA 4E0ZA 2F44A 5KFBA 5AICA 5AM2A 3N7RC 2KNJA 2HMXA 4ECYA 1SV0A 5AKIA 3UPQA 2JHDA 4RQ7A 2XGQA 8ICKA 4BXOB 3G6YA 3M9MB 4R8UA 2KKVA 4EENA 5CHGA 3PW7A 2KVCA 2WAQF 4F5NA 2K60A 2RLTA 1N5XA 2G06A 4UB1A 1ZQRA 4TURA 4TUPA 4QZEA 5IINA 4F4ZA 5KFLA 3NTUA 1UHUA 3C2KA 4EELA 7ICTA 1X9MA 4F4KA 4E0DA 3D6JA 2HHTA 1JXLA 5KFGA 1S10A 4JWNA 4XQ8A 1KDHA 2HOIA 2XCAA 4C4RA 4UAUA 1ZQKA 3PW5A 2WTFA 1MSWD 3QUTA 2E8PA 1ZQBA 2GOLA 3UM9A 4KN4A 1B4FA 3VC8A 1ZQTA 4B9MA 2D6FC 2JEGA 2NRWA 4OJOA 4KLJA 4Y2XA 1WG8A 4DWPA 4XRHA 4J03A 3JPPA 2A1AA 2W9BA 5KG4A 3HP6A 3VCFA 2Y1IA 4QWBA 4ECVA 2BGWA 5ALPA 1ZQLA 4CDGA 5J0XA 3MGVA 4DL7A 5TZVA 5J0SA 3SEIA 3MGIA 1MQ3A 1T94A 9ICHA 1ZQQA 2JXJA 2YQEA 3A0HU 4NXZA 4JWMA 5ALZA 1CRXA 4DSIA 4GIBA 5CP2A 1DGJA 2YB4A 2VJ5A 9ICVA 4IL6U 3TADA 1X42A 4F91B 2KG5A 2Y0SF 4QWCA 1N48A 4QNLA 4Z6EA 4RZRA 3CNHA 3UQ2A 3Q8SB 4QWDA 3N4MB 3B9JA 3BDPA 5KFUA 2Q0ZX 2H3FA 4PHEA 5CB1A 2ZIUB 3MC1A 2VA3A 1COOA 2ZUCA 3QU4A 3WK7A 3UQ0A 1RYUA 3SD7A 4IR9A 2KSOA 2AGPA 2MUTB 1NJXA 3RRGA 5ALIA 2W8KA 7ICLA 2YMPA 4KITB 1KW4A 4R8UB 3PSTA 3T5JA 4KN7A 7ICNA 4LZGA 2Y9TA 3OGUA 4QW9A 2G0AA 5HNKA 1BPBA 1SKRA 5DBCA 3ED5A 4OJ6A 8ICFA 2JV3A 4NLKA 4DF4A 2HCFA 1QTMA 2V9WA 4R65A 3N7PD 5DB8A 4ZOHC 3BZKA 4QJFB 4YMOA 4US9A 1JIHA 1UCVA 4F5PA 3F2CA 2MA1A 4RPZA 5EE3A 2HHXA 4I29A 1O03A 3O0FA 1RQLA 4UAWA 4DEZA 3I28A 4ECSA 1KN5A 1BPXA 4DFKA 9ICNA 2ZJ5A 2W9BB 1RPLA 9ICRA 2F1IA 2OWOA 3QU5A 3K4GA 4KMOB 2LYHA 4U7CA 5J0TA 1LB2B 3H4DA 2EAOA 2DGZA 4Z6DA 4QIWF 1LKYB 4KLGA 4J9SA 5J2JA 3AU6A 8ICIA 2A1JA 3C28A 1JMSA 4RPYA 5J0UA 3AEVA 3FDSA 1ZQNA 3NASA 3ISBA 3TQ1A 8ICMA 1P4EC 3PV8A 1NJZA 4PH5A 1X9SA 4YR0A 5DG7A 2W54A 3UMCA 2K8CB 1NKCA 1SKWA 2P66A 2BQRA 4UW9A 4YR2A 3KHHA 5L1MA 3F2BA 3WKDA 5AM1A 5J2EA 4QZ8A 3JPSA 4DOAA 3M7DA 3VCBA 3PX0A 4K4GA 3GIMA 1D8YA 3ISCA 2QARA 1CEZA 2ATLA 2K8AA 5F9NA 1ZD2P 4I2EA 2HOFA 1NNLA 4EX6A 3UXPA 4CGZA 4DFMA 3OSNA 5KG0A 3R9KA 4C8OA 5F9LA 1XC9A 4NLNA 1XO1A 7ICSA 1RG6A 4J9RA 3HW8A 1DOQA 2OH2A 1XSNA 2E8MA 4LZDA 1CI4A 3QUBA 4GXKA 1NZPA 1ZQVA 1F0MA 3H0RB 5AKKA 1WWUA 2FJ6A 5JUMA 1ZQXA 4EEYA 1MQ2A 4EBEA 3EPGA 2DL0A 3IV6A 2BDUA 2HHUA 3BQTA 4DOCA 3E0FA 4GC6A 4RUCA 3JPQA 4CF5A 4RUAA 1S76D 5J2GA 3L4PA 2HHSA 2MRLA 3SV4A 1Z19A 2K4PA 9ICOA 4E0PA 3QZ7A 2NRXA 5BOMA 3BZCA 2FPLA 3RF9A 3H0MB 3RBEA 4JB3A 3ZDEA 1Z4NA 4DSLA 3C1ZA 2W9MA 1FFUA 4UB4A 4QZFA 1F5SA 8ICOA 3N7SC 4Y2RA 1QSLA 4KLMA 1EXNA 4PGQA 1SXDA 5DKWA 3PY8A 3M9NB 4C7ZA 1URJA 4MEXA 2B21A 3GIKA 2OXOA 2ISOA 4LJXA 2CRXA 3RAQA 4UB2A 4F41A 3BS5A 9ICBA 4O3OA 4M6WA 3BS7A 2GO7A 4Q8EA 1ECWA 4UATA 4I28A 3K1RB 3V7JA 4NWIA 1RDFA 3EUB2 2EAPA 1JXEA 5CRXA 1PVRA 3LVWA 5ALRA 3WK9A 3AUOA 4DL3A 1X9XA 1BPYA 3E58A 5ALHA 1TFRA 5IIIA 2AHOB 3DDHA 5DDMA 2HBMA 5KL8B 2DWQA 5JU5A 1IXRA 2EH9A 3WKAA 4KLTA 1VDVA 1OXJA 2QARB 5KFIA 4P4OA 2ESEA 1L8LA 3MBYA 3GZFA 1L7OA 4CF4A 4NLGA 3H7IA 1B22A 1K1SA 1JUDA 7ICJA 2KJ8A 3KZXA 4CCHA 7ICVA 3C2LA 4ED0A 1ZQ1C 2ZJ8A 4EZ9A 4ECXA 4IR1A 4EBCA 1ZQUA 4YG2A 1HEKA 2W55A 1ZRMA 9ICWA 4RPXA 1RYRA 4NLBA 2K4HA 2ZXIA 8ICCA 5AI5A 3RFAA 3WKBA 2LKYA 4KLOA 5CR0A 4ED3A 1N2XA 2W9CA 3SQIA 3KZIU 2BPCA 1YZ6A 2YN4A 2WAQC 2HW3A 2ZUDA 9ICQA 4I2CA 4O3SA 3T79A 2HHQA 3K75D 4HAIA 4YVZA 3KHLA 4Y2UA 4Z6FA 4NL9C 3IP4B 3BQ0A
chains in the Genus database with same CATH topology
2HBJA 3VC8A 4C0ZA 1ECWA 3M7DA 4OJ5A 4OJ6A 2VIXA 3VCBA 3NRWA 2D6FC 2Y0SC 2DQNB 4OJOA 2RP5A 2H3QA 4NWIA 4OJLA 5DCFA 1HIWA 5C6KA 4IC9A 2RRDA 3L3FX 2ZIWA 3IG5A 4QIWC 3C29A 1DRGA 5CRXA 4KX3A 3LVWA 3DEEA 1PVRA 2K8AA 3N7PD 2H3VA 2KV2A 3AQEA 3M6ZA 2HOFA 4GFJA 2F8LA 3VCFA 2F77X 1AE9A 2ZIUA 4CGZA 2KKPA 4ACOA 2G5HB 1AIHA 2F2AB 4QJFB 3PSIA 3K1ZA 1TAMA 2W03A 4WJ3B 3CP8A 4CDGA 2ZIXA 3D2NA 3PSPA 2LYAA 4NV0A 2H3IA 2WB1F 4PL1A 2KD1A 2PMZF 3MGVA 3F2CA 2MA1A 2HBMA 2R18A 5KL1B 4FE3A 4AYBF 1PVPA 4P0PA 1XNSA 1T94A 2JH1A 5KL8B 3ICXA 3O0FA 2K89A 2KOBA 3F5EA 4FZMA 2LHTA 4CRXA 2LBOA 2OH2A 2KIWA 1A6SA 2ZXHA 2CN1A 3N7RC 2KICA 1CRXA 2JGAA 2K4EA 2KNJA 3IG8A 2HMXA 2K4IA 2OYYA 3H0RB 3HKZF 2Z7JA 3ONNA 2LYBA 2YB1A 2W7PA 4P0QB 2YX8A 2YB4A 4FZLA 4U6PA 2G07A 2E1EA 1PVQA 2VJ5A 5HR7A 3GZFA 4OO1J 2WB1C 2JHDA 1XO0A 1MA7A 2PMZC 4JMUA 2XI9A 2XIDA 2BDUA 2A3VA 4U7CA 1A0PA 4KMOB 4AYBC 3UXUA 3E0FA 2KJ8A 3KZXA 2Y0SF 2N1RA 1FLOA 2KHVA 3AQFA 1SZHA 3LVVA 2ZIVA 2HBKA 3D2QA 4FZNA 2W04A 1D8BA 2DGZA 3F53A 1ZQ1C 3OPXA 2E1FA 3F5AA 2M0NA 2KKVA 4ICAA 4QIWF 2CPRA 2E5SA 4QNLA 5T14A 1F44A 2XICA 2H3ZA 2KVCA 2MRLA 2KJ5A 3SAHA 1Z19A 1HEKA 2WAQF 1P7DA 3PSFA 2F76X 2GH1A 2G06A 3C28A 2ZG6A 3HKZC 2ZIWB 4BJQA 1OUQA 3SMVA 1Z1BA 2KHQA 4NLBA 3RF9A 3AL0B 1M6XA 2G08A 2K4HA 2KEYA 2H3FA 3ALRA 2ZXIA 3H0MB 2K8BB 2KJ9A 2ZIUB 1P4EA 2NV3A 2Q4TA 4NLCA 1P4EC 2HBLA 3SAGA 5HR6A 3F2DA 3NUQA 3RFAA 3PZPA 1ED1A 3CRXA 1NZBA 2LKYA 1WUDA 3IN5A 1YT3A 2XVTA 2K8CB 2OM6A 2ZIXB 3GU3A 3N7SC 3H0LB 4KX5A 3NKHA 2JMGA 4A8EA 5A0LA 3SQIA 5C0YA 4P0PB 4P0QA 2ZIVB 4OJPA 3M6KA 1UPHA 2G5IB 1Q3VA 2WAQC 4BUGA 1GO3F 2HOQA 2W7OA 2HOIA 4O3MA 1URJA 2VJ4A 2DF4B 2RHFA 1Q3UA 3KFUF 2G09A 3CYMA 3LYSA 3PSTA 3T79A 2OXOA 2VKQA 5DORA 4PL2A 2CRXA 3D2SA 4BX9C 3SAFA 3F2BA 4DKSA 2G0AA 1L6NA 1M6XC 2GOLA 1KBUA 1IIPA 2JH7A 3IP4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGV A;  1A0P A;  3UXU A;  2KJ8 A;  1PVP A;  3CRX A;  1XNS A;  3NRW A;  1NZB A;  1FLO A;  2KHV A;  5DCF A;  5C6K A;  3NKH A;  4A8E A;  2KOB A;  4CRX A;  2KKV A;  1F44 A;  3C29 A;  1DRG A;  5CRX A;  1PVR A;  2KIW A;  1Q3V A;  2KJ5 A;  1Z19 A;  1P7D A;  2HOF A;  2HOI A;  1CRX A;  1Q3U A;  3LYS A;  3VCF A;  3C28 A;  1AE9 A;  2OXO A;  1OUQ A;  1Z1B A;  2KKP A;  4ACO A;  2KHQ A;  1AIH A;  5DOR A;  2CRX A;  4DKS A;  1M6X A;  2KEY A;  1M6X C;  1PVQ A;  1KBU A;  2KJ9 A;  2A3V A;  1XO0 A;  1MA7 A;  1P4E A;  2KD1 A;  1P4E C; 
#chains in the Genus database with same CATH topology
 4IQU A;  4IQT A;  2YTU A;  5KG6 A;  4RQ5 A;  2VIX A;  5KAI U;  1X66 A;  5AI8 A;  1Z4O A;  2RRD A;  4DSF A;  3L3F X;  2LM4 A;  8ICY A;  1D8L A;  9ICC A;  2F77 X;  4MFF A;  8ICX A;  2BCV A;  2EQY A;  1L3S A;  2F2A B;  5KTQ A;  5J8Y A;  4RT3 A;  4DQI A;  1FIQ A;  4ECR A;  5DB6 A;  4IQW A;  4K4I A;  1PVP A;  1RXW A;  2LPE A;  5FP0 A;  4F43 A;  2PXI A;  1X40 A;  4MFA A;  2IOH A;  3UMG A;  4Q8F A;  5DGB A;  3U26 A;  4YD1 A;  4JUZ A;  1COK A;  2YB1 A;  4DCC A;  2KZM A;  4TUQ A;  3T5H A;  1ZJN A;  8ICS A;  4RQ3 A;  1UT8 A;  1MA7 A;  5DG9 A;  3EYZ A;  4F2S A;  4M9L A;  1TVA A;  4E10 A;  2EDU A;  1NK4 A;  2W43 A;  2C22 A;  2VA2 A;  3RR7 A;  4MHV A;  2ASJ A;  4QZA A;  3GII A;  2ZIW B;  5ALO A;  1N62 A;  5KT6 A;  2WFA A;  3PX4 A;  4J9K A;  3BQ1 A;  4DQR A;  5ALQ A;  4C8L A;  2HBL A;  3OHB A;  2KE7 A;  5AKE A;  3WK8 A;  3RJF A;  3Q8Q B;  2BHN A;  2FI1 A;  1UPH A;  1A76 A;  4G9B A;  1S0N A;  1V97 A;  5KFM A;  3KTQ A;  4JV1 A;  3SV3 A;  5DOR A;  4LVS A;  1S8O A;  3FYH A;  4CF3 A;  4C0Z A;  4R63 A;  4UBC A;  4DQP A;  2RP5 A;  2H3Q A;  4UB6 U;  3C29 A;  3DEE A;  3NRZ A;  4Y2P A;  3RBD A;  4ECU A;  4O3R A;  2KV2 A;  4O5K A;  4Y2Q A;  1N60 A;  1ZQP A;  8ICB A;  1SL0 A;  3UXN A;  2BQU A;  3CP8 A;  3D2N A;  4M9N A;  2MSN A;  2WB1 F;  5L9X A;  4QZG A;  4RNN A;  5ALJ A;  4F92 B;  2ES6 A;  2LBO A;  4UB3 A;  2CN1 A;  2FMQ A;  5EWG A;  2LM1 A;  3H40 A;  7ICI A;  1QQ5 A;  1Q8K A;  2BPG A;  1TE2 A;  2WF9 A;  2J6T A;  4RQ6 A;  9ICI A;  2DPJ A;  1VLB A;  5KG1 A;  2NO5 A;  4DWI A;  4ELV A;  5C5J A;  1SXE A;  3NVZ A;  3EZ5 A;  3LWM A;  5DQH A;  3MAB A;  1V85 A;  2I5H A;  3EWA A;  3QU2 A;  3TFS A;  1B43 A;  2R8J A;  4USA A;  3HT3 A;  2XIC A;  1S0M A;  5KFP A;  1KSP A;  3C1Y A;  2BZF A;  3PR5 B;  4F8R A;  4ED2 A;  3AL0 B;  1SIJ A;  1S5L U;  1BPD A;  2ASD A;  2E3T A;  5JTI A;  5KT5 A;  3QEB Z;  7ICQ A;  4YD2 A;  1ZQI A;  2FE9 A;  4I2I A;  4P0P B;  4OJP A;  3H8M A;  1KQQ A;  2ALZ A;  4X5V A;  3IRU A;  4PHA A;  3LK9 A;  4ECZ A;  5KFZ A;  3RB6 A;  8ICP A;  4MEY A;  4PJ0 U;  5KG3 A;  4JV0 A;  4PHP A;  5CA7 A;  3MR3 A;  1C20 A;  3NVV A;  8ICE A;  4OJ5 A;  3V7L A;  4B9V A;  1HIW A;  1J2N A;  5KFN A;  3IG5 A;  3HIL A;  3UXO A;  8ICN A;  2R8G A;  4I2D A;  5AM0 A;  8ICZ A;  1TAM A;  5D46 A;  2ZIX A;  3QUC A;  4O5E A;  2H3I A;  2P6U A;  1JX4 A;  1ZXI A;  3WK5 A;  5KL1 B;  4AYB F;  4DOB A;  5KFJ A;  3T5L A;  2JH1 A;  4RQ4 A;  2BPF A;  3F5E A;  3C21 A;  4J9N A;  5J2C A;  2KIV A;  1TK0 A;  5KG5 A;  8ICU A;  1ZJM A;  3HRD D;  2W7P A;  3HKZ F;  2HSZ A;  3ETR A;  2PKE A;  8ICA A;  2PFP A;  1ZD4 A;  2G07 A;  4M47 A;  3H8S A;  5HR7 A;  1L3T A;  4F2R A;  2A3V A;  4MFC A;  4OO1 J;  2XID A;  4KMU A;  1NJW A;  4ED6 A;  4UBB A;  4Y2S A;  2QB0 A;  5ALM A;  1PZN A;  1SWV A;  2W04 A;  4KLD A;  1SWW A;  1NKE A;  1V38 A;  3N28 A;  5G5H A;  3IM1 A;  1Z1V A;  4I2J A;  1SZP A;  3NVW A;  3Q8L A;  4QZI A;  3GV7 B;  2C2E A;  3F2D A;  3NUQ A;  8ICG A;  5HML A;  4ECW A;  5AKL A;  4C8M A;  1NJY A;  2JMG A;  2NRT A;  5KFX A;  3M6K A;  4BUG A;  2W7O A;  4M0A A;  2F1H A;  9ICS A;  5AK3 A;  3ZD8 A;  4E0Y A;  3S6J A;  3AN1 A;  4O3P A;  2AGO A;  1L6N A;  2RQ5 A;  4PHD A;  2PI5 A;  2JH7 A;  2I9G A;  3HPO A;  2HBJ A;  2IA6 A;  2OHF A;  3BQ2 A;  1XWL A;  4EYI B;  1L7P A;  1KL9 A;  4XUS A;  4IRC A;  3RR8 A;  1SGG A;  8ICQ A;  5KFY A;  1N61 A;  2V4R A;  5ALY A;  2D8C A;  1V9P A;  1Z3E B;  3BQ7 A;  2EZX A;  4KTQ A;  2JR5 A;  3M1Y A;  4Q43 A;  3RJK A;  4P4P A;  1SL2 A;  5AIB A;  4CRX A;  2LHT A;  1BNO A;  3MR2 A;  9ICE A;  2BCU A;  4Q44 A;  1AQ6 A;  9ICP A;  2KSO B;  1QSS A;  4Y2Y A;  2YMQ A;  1M6Y A;  4KLF A;  5L1K A;  5DGA A;  3RJI A;  5ALT A;  5AM5 A;  1BPZ A;  1ZOL A;  2PFN A;  5IIK A;  1QH9 A;  1ZQE A;  9ICX A;  4YR3 A;  1U47 A;  4FZN A;  2HHW A;  1KKX A;  4J9O A;  1T3Q A;  3C5F A;  3SI8 A;  2FLP A;  1Z1B A;  3TI0 A;  5DB9 A;  5AHX A;  1TK5 A;  9ICK A;  2LMR A;  2KFZ A;  4NLC A;  4DLG A;  1ED1 A;  2V4Q A;  1NZB A;  7ICG A;  2JRZ A;  5KFS A;  3V6K A;  4P0Q A;  4RNM A;  2QB0 B;  3TAN A;  1Q3U A;  7ICO A;  4ECQ A;  4DKS A;  4YXJ A;  7ICF A;  1M6X C;  2C28 A;  5IIO A;  3FAH A;  5AI4 A;  1T7P A;  2AU0 A;  3QNM A;  4B6J A;  3PW0 A;  3I1Y A;  5C6K A;  2GWS A;  5K4L A;  2R8K A;  1ZQD A;  4DL2 A;  4XA5 A;  2WHE A;  5J2I A;  4UAR A;  3M6Z A;  3IDW A;  3RRH A;  4TUS A;  3PW2 A;  1AE9 A;  4EZ6 A;  2KP7 A;  2B0C A;  2KZ3 A;  3PO4 A;  4QZD A;  3K1Z A;  5J8Y C;  4RQ2 A;  2H5X A;  1JAL A;  2A1J B;  3PSP A;  3GV5 B;  1ZYQ A;  1NK8 A;  2PMZ F;  1YZ7 A;  3QXG A;  4PZO A;  4C7Y A;  5ALU A;  1U45 A;  1RXV A;  3WU2 U;  5KFT A;  5KT3 A;  2WF7 A;  1U48 A;  2FDR A;  3JPN A;  4ED7 A;  2K4E A;  4RQ0 A;  5B5E U;  2NYV A;  3A0B U;  3SZ2 A;  1NK9 A;  7ICK A;  5L1J A;  3PX6 A;  4MF8 A;  2D3D A;  2HDO A;  4IS7 A;  3OJU A;  1UA1 A;  1FLO A;  1TAU A;  3OPX A;  5ALK A;  5ALD A;  2H3Z A;  8ICH A;  1P7D A;  3PSF A;  4F5Q A;  2O6K A;  2AXT U;  1KFD A;  3SMV A;  1U4B A;  4NM1 A;  1DK3 A;  1SV0 C;  1NK6 A;  4UB5 A;  4KLU A;  4ELU A;  3SAG A;  3AMZ A;  2P35 A;  4RQ8 A;  1UT5 A;  3RB0 A;  2OM6 A;  1QQ7 A;  4DLE A;  3CW2 C;  4B9T A;  4RQM A;  1GO3 F;  3JPO A;  2DF4 B;  5HMM A;  4NLZ A;  5HP4 A;  4PL2 A;  4UAS A;  1WCL A;  4F3O A;  3D2S A;  2ZJA A;  2ISP A;  4BXO A;  3G6V A;  1TKD A;  1VJ5 A;  3RJH A;  3RH6 A;  3QZ8 A;  3KKA A;  1XSL A;  3M9O B;  4EYH B;  4Y2T A;  2MAX A;  1BVS A;  2DPI A;  4I27 A;  1D9D A;  1NOM A;  2IHM A;  2XC9 A;  2DKX A;  3M8S A;  3GQC A;  1ZQJ A;  3MFI A;  3ZDB A;  3AQE A;  1OW5 A;  3GV8 B;  2F8L A;  2GLE A;  3V6J A;  2HI0 A;  2WF8 A;  5KT4 A;  8ICT A;  2W03 A;  4GXI A;  3MR6 A;  2E8O A;  4BGD A;  2QB1 A;  3RB3 A;  1T4G A;  4R66 A;  4KLQ A;  1L3U A;  4O5C A;  5KNI A;  2KIW A;  3WKC A;  2XGP A;  2HVH A;  5ALE A;  1UQV A;  1RQN A;  4FFD A;  3PML A;  2L5Y A;  1HJP A;  3RJJ A;  1JRP A;  2IOF A;  2J6U A;  2UVV A;  2WB1 C;  9ICG A;  5EE1 A;  3ZDA A;  2AJQ A;  2BDP A;  3T3F A;  3LVV A;  3BS5 B;  2ZIV A;  4DSJ A;  4FO6 A;  4M6W B;  4C80 A;  2E1F A;  5KG2 A;  2M0N A;  2RDJ A;  3SAH A;  1N56 A;  1MN8 A;  1OUQ A;  2G08 A;  2KEY A;  5KFE A;  1J2M A;  3ZDD A;  3OSP A;  1RZT A;  4DS5 A;  3TAD C;  1D9F A;  5HHH A;  5BPC A;  1WUD A;  3IN5 A;  5J2H A;  4DF8 A;  5L1L A;  2I6X A;  1Z00 A;  1XS9 D;  1S9F A;  2HOQ A;  4RQ1 A;  3CYM A;  4DL5 A;  2VKQ A;  4C4S A;  4QZH A;  4RNO A;  4RU9 A;  3TAQ A;  2IOF K;  3TKA A;  2Y0S C;  5DDY A;  4FS2 A;  2P6R A;  5GTI U;  4OJL A;  2YML A;  4IC9 A;  2R8H A;  2BKE A;  4PZN A;  1QQ6 A;  1ZET A;  4QZ9 A;  2ZIU A;  1L5U A;  2KKP A;  2G5H B;  2JZB A;  3PSI A;  1NKB A;  2IMW P;  4JK1 A;  4WJ3 B;  3GFK B;  5H2F U;  2M9N A;  5DLF A;  2PFQ A;  4F93 B;  4NY8 A;  2MUT A;  1ZQM A;  4CE6 A;  5KFK A;  3GDX A;  3QUQ A;  5ALG A;  5E79 U;  5AM3 A;  5KAF U;  4I2B A;  4HYK A;  1SB3 C;  1S77 D;  3SEN A;  4F71 A;  7ICE A;  2W9C B;  2VAN A;  1O08 A;  2K4I A;  3LDA A;  4RT2 A;  2OYY A;  4IQV A;  4YMM A;  2PFO A;  2KK0 A;  1ZQG A;  1PVQ A;  3Q8K A;  4BDP A;  4AYB C;  3SR6 A;  4YP3 A;  2KHV A;  2OEH A;  3H8J A;  4GLX A;  5DG8 A;  4F4W A;  1N5W A;  3F5A A;  1F44 A;  5AK5 A;  2E5S A;  2ZG6 A;  3HKZ C;  4I2G A;  2KHQ A;  1C7Y A;  5DBA A;  4NL9 A;  3QEA Z;  5F3X B;  2K8B B;  5KFV A;  1ZQO A;  3H4B A;  4ED8 A;  3CRX A;  2A19 A;  2KFN A;  3NKH A;  4A8E A;  4KLH A;  4KLL A;  4PGX A;  4B9S A;  2ZIV B;  1ZD5 A;  2EAM A;  3HX0 A;  5ALS A;  1ARO P;  4DL6 A;  2FMP A;  3N97 B;  7ICH A;  5HHI A;  1T8E A;  1K5O A;  4YN4 A;  5IIL A;  3RJG A;  3ORY A;  4TQR A;  1KBU A;  2NRZ A;  5J2A A;  4F50 A;  1LKY A;  1LVH A;  8ICR A;  2ZTE A;  4DFJ A;  5DLG A;  2AH5 A;  5KG7 A;  1HUO A;  3AM9 A;  2XO7 A;  1QSY A;  4QIW C;  5J0Q A;  1DRG A;  3UMB A;  2EAN A;  5AKH A;  3TAC B;  3V7K A;  1U49 A;  4UAZ A;  2AQ0 A;  3V72 A;  1BNP A;  4F72 A;  1Z00 B;  4DQQ A;  4K4H A;  5AI6 A;  2XY5 A;  1KRP A;  3E2E A;  1L7N A;  1U9L A;  4PL1 A;  1SL1 A;  4UAV A;  5J2B A;  4FBT A;  1J97 A;  1XNS A;  3ETL A;  3ICX A;  2Y1J A;  3QU7 A;  4MF2 A;  2UVU A;  5CJ7 A;  1A6S A;  5EE9 A;  1K1Q A;  3PNC A;  4M9G A;  1ZQW A;  5ALW A;  1DXS A;  3Q8R B;  3ISD A;  4I2F A;  4F4Y A;  3M8R A;  4UB8 U;  2LYB A;  5KFH A;  2YX8 A;  2Y9U A;  5AM4 A;  2E1E A;  5ALF A;  1KEJ A;  4QWA A;  2JZB B;  3SYZ A;  5DB7 A;  2HBK A;  2UVR A;  3F53 A;  2C2D A;  4ICA A;  5AI9 A;  5T14 A;  3HJE A;  1N63 A;  3G6X A;  1ZQF A;  5J2F A;  4J9M A;  4M04 A;  4ELT A;  4BJQ A;  4R64 A;  4DFP A;  1H38 A;  5TIS U;  4QZB A;  2CXY A;  2RDI A;  5AIA A;  3THV A;  3WK6 A;  2E8N A;  4E0J A;  2HVI A;  4KX5 A;  1XU4 A;  3GU3 A;  2W11 A;  2ASL A;  3H0L B;  3MDA A;  2JEJ A;  4P2H A;  7ICU A;  4YFK A;  1Q3V A;  4DS4 A;  3LYS A;  1TV9 A;  3PO5 A;  4YXM A;  4UAY A;  3B0Y A;  1S0V A;  5J2K A;  2NO4 A;  3AU2 A;  5KFD A;  3LWL A;  3EPI A;  4DSE A;  3ZDC A;  2EZZ A;  2KZZ A;  3NRW A;  2DQN B;  4NJ8 A;  9ICJ A;  3FC4 A;  2BQ3 A;  5J0Y A;  2JEI A;  4GC7 A;  5KT7 A;  2H3V A;  1BPE A;  3T5K A;  5KFO A;  1S0O A;  5AKG A;  2AQ4 A;  4F4X A;  2VA8 A;  5D49 A;  3DV9 A;  3MR5 A;  1ZQH A;  2ODG A;  5CEH A;  4E0G A;  5ALX A;  2LYA A;  5ALN A;  4OCZ A;  4M2Y A;  2R18 A;  9ICU A;  4Q45 A;  3PMN A;  3FM9 A;  2F3N A;  1S97 A;  3TAP A;  5J0R A;  1WCN A;  5G5G A;  7ICP A;  5IIM A;  1Y88 A;  5J2D A;  1XSP A;  4OD0 A;  4CNQ A;  3BJY A;  5KFF A;  1JRO A;  9ICL A;  4J9P A;  2PMZ C;  2JEF A;  2XI9 A;  5AK6 A;  2DFL A;  4TQS A;  1BGX T;  3AQF A;  1KLN A;  1D8B A;  4YMN A;  3B0X A;  1ZQY A;  1IV8 A;  7ICM A;  1FEZ A;  4DFD A;  1UA0 A;  4QZC A;  1L3V A;  2GH1 A;  5ALL A;  2MU2 A;  1X6I A;  1A77 A;  1ZQZ A;  2V6E A;  3RH5 A;  2AGQ A;  4B9N A;  8ICV A;  3OJS A;  1L8O A;  1PK1 A;  5KFA A;  2KJ9 A;  2BR0 A;  4DSK A;  4IRD A;  4GXJ A;  1YT3 A;  2XVT A;  2ZIX B;  2ZTC A;  4J9L A;  4NM2 A;  4O3M A;  2VJ4 A;  2G09 A;  1X6J A;  4M9J A;  1SV4 A;  4Y2V A;  5AKX A;  2UVW A;  3ZD9 A;  8ICW A;  1ZQC A;  3V6H A;  2WF6 A;  2DUY A;  2KVS A;  5EOZ A;  5KFW A;  1QLN A;  3KKA C;  3GIJ A;  1CUK A;  1JN3 A;  2W9A A;  3TAR A;  2KMD A;  4PPX A;  4KX3 A;  3C23 A;  1JI7 A;  4DO9 A;  2HHV A;  1KTQ A;  5CWR A;  2KTQ A;  4EBD A;  4KLI A;  1AIH A;  3J81 j;  2FPK A;  1ZRN A;  5AI0 A;  5EWF A;  4BWM A;  4O9M A;  4B9L A;  4FE3 A;  1MC8 A;  4J9Q A;  3RAX A;  3RTV A;  2FLL A;  4UQG A;  4KLE A;  4F5O A;  9ICM A;  1PK3 A;  3KHR A;  1FFV A;  3ONN A;  3JPR A;  1QCK A;  1ZD3 A;  2Z7J A;  3HWT A;  2W8L A;  1DK2 A;  5J0P A;  5DBB A;  4FZL A;  4IRK A;  5EE0 A;  4JMU A;  4P4M A;  4BWJ A;  3UXU A;  5DQI A;  2YMM A;  3D2Q A;  1WWV A;  1IG6 A;  3QE9 Y;  2ZTD A;  3RJE A;  2CPR A;  3OHA A;  4O3N A;  4ZH4 A;  3PVX A;  4Y2J A;  2ZUB A;  1L7M A;  2QLT A;  1X9W A;  3NVY A;  1WYG A;  1P4E A;  2Q4T A;  5KFR A;  2XCP A;  3PZP A;  4FS1 A;  3KBB A;  5A0L A;  2FLN A;  3NS1 A;  3KHG A;  4PGY A;  2J6S A;  8ICJ A;  1LV5 A;  5AKZ A;  1SKS A;  4DL4 A;  1RM6 C;  3MFH A;  2XY7 A;  4DQS A;  2YY6 A;  2DBY A;  1B0X A;  1NK5 A;  4QWE A;  3PW4 A;  1DGS A;  1PK1 B;  5DCF A;  2C2R A;  4EEK A;  2ZIW A;  3TFR A;  9ICA A;  5EWE A;  2BCR A;  4FBU A;  5D4B A;  1IM4 A;  2W3S A;  4ACO A;  4I2H A;  4G3I A;  3RH4 A;  4O3Q A;  1NK7 A;  3QYP A;  5IIJ A;  1Q46 A;  2KD1 A;  4QW8 A;  3I76 A;  2BCS A;  2K89 A;  3KD3 A;  9ICT A;  2ZXH A;  2DKZ A;  3KOO A;  5KFC A;  9ICF A;  2KIC A;  2JGA A;  3IG8 A;  1ZQA A;  4ED1 A;  1TAQ A;  3QX7 A;  3WK4 A;  2WF5 A;  4P0Q B;  5J29 A;  4U6P A;  3MDC A;  2F1J A;  3IHQ B;  1XO0 A;  5HR6 A;  4JV2 A;  1A0P A;  1KFT A;  1ZQS A;  2N1R A;  1SZH A;  4B9U A;  2EZY A;  3Q8M A;  5AK4 A;  2BCQ A;  2W3R A;  5J0W A;  1NK0 A;  2OCE A;  4C8K A;  3L5K A;  3MGH A;  2QKQ A;  5B66 U;  3GIL A;  2KJ5 A;  4C8N A;  5AKJ A;  3Q8P B;  2F76 X;  1KFS A;  2IBK A;  1M6X A;  2FPM A;  4Z6C A;  3ALR A;  1HUZ A;  1RYS A;  2NV3 A;  5GTH U;  3PR4 A;  5ALV A;  2F8K A;  2B6G A;  7ICR A;  4M9H A;  5KT2 A;  4YQW A;  4KLS A;  2XY6 A;  5C0Y A;  1NI3 A;  8ICL A;  2IHN A;  2G5I B;  3KFU F;  2RHF A;  5KFQ A;  4AP9 A;  3RB4 A;  4BX9 C;  3SAF A;  1IIP A;  2PI4 A;  1PUZ A;  5AKY A;  3WKE A;  3OTQ A;  4US8 A;  2R8I A;  4I2A A;  3C5G A;  4RQN A;  3C2M A;  4GFJ A;  4ECT A;  3JPT A;  2FMS A;  2LI6 A;  3EW9 A;  5JRT A;  5DQG A;  3ZI4 A;  4YCX A;  1TK8 A;  1T3N A;  4C4T A;  5J0O A;  4NV0 A;  3NGD A;  4EX7 A;  4F5R A;  3QU9 A;  3H8W A;  4P0P A;  1X2I A;  4O0I A;  2KN7 A;  5L1I A;  5BOL A;  2I1Q A;  1FO4 A;  2NRV A;  2KOB A;  4FZM A;  4E0Z A;  2F44 A;  5KFB A;  5AIC A;  5AM2 A;  3N7R C;  2KNJ A;  2HMX A;  4ECY A;  1SV0 A;  5AKI A;  3UPQ A;  2JHD A;  4RQ7 A;  2XGQ A;  8ICK A;  4BXO B;  3G6Y A;  3M9M B;  4R8U A;  2KKV A;  4EEN A;  5CHG A;  3PW7 A;  2KVC A;  2WAQ F;  4F5N A;  2K60 A;  2RLT A;  1N5X A;  2G06 A;  4UB1 A;  1ZQR A;  4TUR A;  4TUP A;  4QZE A;  5IIN A;  4F4Z A;  5KFL A;  3NTU A;  1UHU A;  3C2K A;  4EEL A;  7ICT A;  1X9M A;  4F4K A;  4E0D A;  3D6J A;  2HHT A;  1JXL A;  5KFG A;  1S10 A;  4JWN A;  4XQ8 A;  1KDH A;  2HOI A;  2XCA A;  4C4R A;  4UAU A;  1ZQK A;  3PW5 A;  2WTF A;  1MSW D;  3QUT A;  2E8P A;  1ZQB A;  2GOL A;  3UM9 A;  4KN4 A;  1B4F A;  3VC8 A;  1ZQT A;  4B9M A;  2D6F C;  2JEG A;  2NRW A;  4OJO A;  4KLJ A;  4Y2X A;  1WG8 A;  4DWP A;  4XRH A;  4J03 A;  3JPP A;  2A1A A;  2W9B A;  5KG4 A;  3HP6 A;  3VCF A;  2Y1I A;  4QWB A;  4ECV A;  2BGW A;  5ALP A;  1ZQL A;  4CDG A;  5J0X A;  3MGV A;  4DL7 A;  5TZV A;  5J0S A;  3SEI A;  3MGI A;  1MQ3 A;  1T94 A;  9ICH A;  1ZQQ A;  2JXJ A;  2YQE A;  3A0H U;  4NXZ A;  4JWM A;  5ALZ A;  1CRX A;  4DSI A;  4GIB A;  5CP2 A;  1DGJ A;  2YB4 A;  2VJ5 A;  9ICV A;  4IL6 U;  3TAD A;  1X42 A;  4F91 B;  2KG5 A;  2Y0S F;  4QWC A;  1N48 A;  4QNL A;  4Z6E A;  4RZR A;  3CNH A;  3UQ2 A;  3Q8S B;  4QWD A;  3N4M B;  3B9J A;  3BDP A;  5KFU A;  2Q0Z X;  2H3F A;  4PHE A;  5CB1 A;  2ZIU B;  3MC1 A;  2VA3 A;  1COO A;  2ZUC A;  3QU4 A;  3WK7 A;  3UQ0 A;  1RYU A;  3SD7 A;  4IR9 A;  2KSO A;  2AGP A;  2MUT B;  1NJX A;  3RRG A;  5ALI A;  2W8K A;  7ICL A;  2YMP A;  4KIT B;  1KW4 A;  4R8U B;  3PST A;  3T5J A;  4KN7 A;  7ICN A;  4LZG A;  2Y9T A;  3OGU A;  4QW9 A;  2G0A A;  5HNK A;  1BPB A;  1SKR A;  5DBC A;  3ED5 A;  4OJ6 A;  8ICF A;  2JV3 A;  4NLK A;  4DF4 A;  2HCF A;  1QTM A;  2V9W A;  4R65 A;  3N7P D;  5DB8 A;  4ZOH C;  3BZK A;  4QJF B;  4YMO A;  4US9 A;  1JIH A;  1UCV A;  4F5P A;  3F2C A;  2MA1 A;  4RPZ A;  5EE3 A;  2HHX A;  4I29 A;  1O03 A;  3O0F A;  1RQL A;  4UAW A;  4DEZ A;  3I28 A;  4ECS A;  1KN5 A;  1BPX A;  4DFK A;  9ICN A;  2ZJ5 A;  2W9B B;  1RPL A;  9ICR A;  2F1I A;  2OWO A;  3QU5 A;  3K4G A;  4KMO B;  2LYH A;  4U7C A;  5J0T A;  1LB2 B;  3H4D A;  2EAO A;  2DGZ A;  4Z6D A;  4QIW F;  1LKY B;  4KLG A;  4J9S A;  5J2J A;  3AU6 A;  8ICI A;  2A1J A;  3C28 A;  1JMS A;  4RPY A;  5J0U A;  3AEV A;  3FDS A;  1ZQN A;  3NAS A;  3ISB A;  3TQ1 A;  8ICM A;  1P4E C;  3PV8 A;  1NJZ A;  4PH5 A;  1X9S A;  4YR0 A;  5DG7 A;  2W54 A;  3UMC A;  2K8C B;  1NKC A;  1SKW A;  2P66 A;  2BQR A;  4UW9 A;  4YR2 A;  3KHH A;  5L1M A;  3F2B A;  3WKD A;  5AM1 A;  5J2E A;  4QZ8 A;  3JPS A;  4DOA A;  3M7D A;  3VCB A;  3PX0 A;  4K4G A;  3GIM A;  1D8Y A;  3ISC A;  2QAR A;  1CEZ A;  2ATL A;  2K8A A;  5F9N A;  1ZD2 P;  4I2E A;  2HOF A;  1NNL A;  4EX6 A;  3UXP A;  4CGZ A;  4DFM A;  3OSN A;  5KG0 A;  3R9K A;  4C8O A;  5F9L A;  1XC9 A;  4NLN A;  1XO1 A;  7ICS A;  1RG6 A;  4J9R A;  3HW8 A;  1DOQ A;  2OH2 A;  1XSN A;  2E8M A;  4LZD A;  1CI4 A;  3QUB A;  4GXK A;  1NZP A;  1ZQV A;  1F0M A;  3H0R B;  5AKK A;  1WWU A;  2FJ6 A;  5JUM A;  1ZQX A;  4EEY A;  1MQ2 A;  4EBE A;  3EPG A;  2DL0 A;  3IV6 A;  2BDU A;  2HHU A;  3BQT A;  4DOC A;  3E0F A;  4GC6 A;  4RUC A;  3JPQ A;  4CF5 A;  4RUA A;  1S76 D;  5J2G A;  3L4P A;  2HHS A;  2MRL A;  3SV4 A;  1Z19 A;  2K4P A;  9ICO A;  4E0P A;  3QZ7 A;  2NRX A;  5BOM A;  3BZC A;  2FPL A;  3RF9 A;  3H0M B;  3RBE A;  4JB3 A;  3ZDE A;  1Z4N A;  4DSL A;  3C1Z A;  2W9M A;  1FFU A;  4UB4 A;  4QZF A;  1F5S A;  8ICO A;  3N7S C;  4Y2R A;  1QSL A;  4KLM A;  1EXN A;  4PGQ A;  1SXD A;  5DKW A;  3PY8 A;  3M9N B;  4C7Z A;  1URJ A;  4MEX A;  2B21 A;  3GIK A;  2OXO A;  2ISO A;  4LJX A;  2CRX A;  3RAQ A;  4UB2 A;  4F41 A;  3BS5 A;  9ICB A;  4O3O A;  4M6W A;  3BS7 A;  2GO7 A;  4Q8E A;  1ECW A;  4UAT A;  4I28 A;  3K1R B;  3V7J A;  4NWI A;  1RDF A;  3EUB 2;  2EAP A;  1JXE A;  5CRX A;  1PVR A;  3LVW A;  5ALR A;  3WK9 A;  3AUO A;  4DL3 A;  1X9X A;  1BPY A;  3E58 A;  5ALH A;  1TFR A;  5III A;  2AHO B;  3DDH A;  5DDM A;  2HBM A;  5KL8 B;  2DWQ A;  5JU5 A;  1IXR A;  2EH9 A;  3WKA A;  4KLT A;  1VDV A;  1OXJ A;  2QAR B;  5KFI A;  4P4O A;  2ESE A;  1L8L A;  3MBY A;  3GZF A;  1L7O A;  4CF4 A;  4NLG A;  3H7I A;  1B22 A;  1K1S A;  1JUD A;  7ICJ A;  2KJ8 A;  3KZX A;  4CCH A;  7ICV A;  3C2L A;  4ED0 A;  1ZQ1 C;  2ZJ8 A;  4EZ9 A;  4ECX A;  4IR1 A;  4EBC A;  1ZQU A;  4YG2 A;  1HEK A;  2W55 A;  1ZRM A;  9ICW A;  4RPX A;  1RYR A;  4NLB A;  2K4H A;  2ZXI A;  8ICC A;  5AI5 A;  3RFA A;  3WKB A;  2LKY A;  4KLO A;  5CR0 A;  4ED3 A;  1N2X A;  2W9C A;  3SQI A;  3KZI U;  2BPC A;  1YZ6 A;  2YN4 A;  2WAQ C;  2HW3 A;  2ZUD A;  9ICQ A;  4I2C A;  4O3S A;  3T79 A;  2HHQ A;  3K75 D;  4HAI A;  4YVZ A;  3KHL A;  4Y2U A;  4Z6F A;  4NL9 C;  3IP4 B;  3BQ0 A; 
#chains in the Genus database with same CATH homology
 2HBJ A;  3VC8 A;  4C0Z A;  1ECW A;  3M7D A;  4OJ5 A;  4OJ6 A;  2VIX A;  3VCB A;  3NRW A;  2D6F C;  2Y0S C;  2DQN B;  4OJO A;  2RP5 A;  2H3Q A;  4NWI A;  4OJL A;  5DCF A;  1HIW A;  5C6K A;  4IC9 A;  2RRD A;  3L3F X;  2ZIW A;  3IG5 A;  4QIW C;  3C29 A;  1DRG A;  5CRX A;  4KX3 A;  3LVW A;  3DEE A;  1PVR A;  2K8A A;  3N7P D;  2H3V A;  2KV2 A;  3AQE A;  3M6Z A;  2HOF A;  4GFJ A;  2F8L A;  3VCF A;  2F77 X;  1AE9 A;  2ZIU A;  4CGZ A;  2KKP A;  4ACO A;  2G5H B;  1AIH A;  2F2A B;  4QJF B;  3PSI A;  3K1Z A;  1TAM A;  2W03 A;  4WJ3 B;  3CP8 A;  4CDG A;  2ZIX A;  3D2N A;  3PSP A;  2LYA A;  4NV0 A;  2H3I A;  2WB1 F;  4PL1 A;  2KD1 A;  2PMZ F;  3MGV A;  3F2C A;  2MA1 A;  2HBM A;  2R18 A;  5KL1 B;  4FE3 A;  4AYB F;  1PVP A;  4P0P A;  1XNS A;  1T94 A;  2JH1 A;  5KL8 B;  3ICX A;  3O0F A;  2K89 A;  2KOB A;  3F5E A;  4FZM A;  2LHT A;  4CRX A;  2LBO A;  2OH2 A;  2KIW A;  1A6S A;  2ZXH A;  2CN1 A;  3N7R C;  2KIC A;  1CRX A;  2JGA A;  2K4E A;  2KNJ A;  3IG8 A;  2HMX A;  2K4I A;  2OYY A;  3H0R B;  3HKZ F;  2Z7J A;  3ONN A;  2LYB A;  2YB1 A;  2W7P A;  4P0Q B;  2YX8 A;  2YB4 A;  4FZL A;  4U6P A;  2G07 A;  2E1E A;  1PVQ A;  2VJ5 A;  5HR7 A;  3GZF A;  4OO1 J;  2WB1 C;  2JHD A;  1XO0 A;  1MA7 A;  2PMZ C;  4JMU A;  2XI9 A;  2XID A;  2BDU A;  2A3V A;  4U7C A;  1A0P A;  4KMO B;  4AYB C;  3UXU A;  3E0F A;  2KJ8 A;  3KZX A;  2Y0S F;  2N1R A;  1FLO A;  2KHV A;  3AQF A;  1SZH A;  3LVV A;  2ZIV A;  2HBK A;  3D2Q A;  4FZN A;  2W04 A;  1D8B A;  2DGZ A;  3F53 A;  1ZQ1 C;  3OPX A;  2E1F A;  3F5A A;  2M0N A;  2KKV A;  4ICA A;  4QIW F;  2CPR A;  2E5S A;  4QNL A;  5T14 A;  1F44 A;  2XIC A;  2H3Z A;  2KVC A;  2MRL A;  2KJ5 A;  3SAH A;  1Z19 A;  1HEK A;  2WAQ F;  1P7D A;  3PSF A;  2F76 X;  2GH1 A;  2G06 A;  3C28 A;  2ZG6 A;  3HKZ C;  2ZIW B;  4BJQ A;  1OUQ A;  3SMV A;  1Z1B A;  2KHQ A;  4NLB A;  3RF9 A;  3AL0 B;  1M6X A;  2G08 A;  2K4H A;  2KEY A;  2H3F A;  3ALR A;  2ZXI A;  3H0M B;  2K8B B;  2KJ9 A;  2ZIU B;  1P4E A;  2NV3 A;  2Q4T A;  4NLC A;  1P4E C;  2HBL A;  3SAG A;  5HR6 A;  3F2D A;  3NUQ A;  3RFA A;  3PZP A;  1ED1 A;  3CRX A;  1NZB A;  2LKY A;  1WUD A;  3IN5 A;  1YT3 A;  2XVT A;  2K8C B;  2OM6 A;  2ZIX B;  3GU3 A;  3N7S C;  3H0L B;  4KX5 A;  3NKH A;  2JMG A;  4A8E A;  5A0L A;  3SQI A;  5C0Y A;  4P0P B;  4P0Q A;  2ZIV B;  4OJP A;  3M6K A;  1UPH A;  2G5I B;  1Q3V A;  2WAQ C;  4BUG A;  1GO3 F;  2HOQ A;  2W7O A;  2HOI A;  4O3M A;  1URJ A;  2VJ4 A;  2DF4 B;  2RHF A;  1Q3U A;  3KFU F;  2G09 A;  3CYM A;  3LYS A;  3PST A;  3T79 A;  2OXO A;  2VKQ A;  5DOR A;  4PL2 A;  2CRX A;  3D2S A;  4BX9 C;  3SAF A;  3F2B A;  4DKS A;  2G0A A;  1L6N A;  1M6X C;  2GOL A;  1KBU A;  1IIP A;  2JH7 A;  3IP4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...