2A3VA

Structural basis for broad dna-specificity in integron recombination
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
319
structure length
313
Chain Sequence
GSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHSGVLSPLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords DNA (31-MER)
publication title Structural basis for broad DNA-specificity in integron recombination.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
total genus 91
structure length 313
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00589 Phage_integrase Phage integrase family
A PF13495 Phage_int_SAM_4 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2a3vA01
1.10.443.10 Mainly Alpha Orthogonal Bundle hpI Integrase; Chain A Intergrase catalytic core 2a3vA02
4A8EA 1A0PA 1M6XC 1PVQA 2OXOA 1AE9A 1PVRA 1P4EA 2KD1A 4CRXA 1KBUA 2A3VA 2KEYA 1MA7A 1PVPA 3NKHA 1CRXA 5C6KA 2KHQA 1P4EC 1FLOA 1Z19A 1XO0A 2HOIA 5DCFA 1NZBA 1DRGA 3C29A 5CRXA 3LYSA 2KKVA 2HOFA 4ACOA 2KJ8A 1AIHA 5DORA 2KJ9A 1P7DA 2KIWA 2CRXA 3CRXA 3NRWA 2KKPA 4DKSA 3MGVA 1Q3VA 1XNSA 2KOBA 2KJ5A 1F44A 3C28A 1Z1BA 2KHVA 1OUQA 3VCFA 1M6XA 3UXUA 1Q3UA
chains in the Genus database with same CATH superfamily
2H5XA 2KNJA 4YD1A 3TAQA 8ICPA 4E10A 1N5XA 4NV0A 3BZCA 3SEIA 3BQTA 3V7JA 3QEBZ 2AJQA 3ZI4A 7ICUA 2I1QA 1FEZA 2F1HA 1QLNA 4IRCA 1KW4A 4RQ5A 1ZQFA 1NK6A 5DB7A 3L3FX 4F2RA 1WG8A 4IS7A 4OD0A 5T14A 4DS4A 3N7SC 5J0YA 1UT5A 5AK3A 5AM4A 1TE2A 3RAQA 3B0YA 1QTMA 3ZD9A 2KZZA 1S10A 4IL6U 3KZXA 5KTQA 3C2KA 2Y1IA 5DGAA 9ICGA 1Y88A 4DCCA 1SXDA 1NK5A 4F4KA 4KITB 3UQ0A 4DFJA 4QWCA 1L6NA 3H8WA 3VCBA 4LZDA 1BPDA 4NM1A 5AK6A 2KHVA 5ALTA 2XY5A 3N97B 4JWNA 3V6JA 4UAUA 1IV8A 2Z7JA 4GFJA 2BR0A 2KSOB 3MBYA 4USAA 2EAPA 9ICTA 1X6IA 2QKQA 1KQQA 4O3NA 3K75D 1X9SA 3VCFA 5AICA 4QZ8A 2QARA 4U7CA 5DBCA 2HHUA 2DL0A 2Q4TA 4A8EA 3LVVA 1N48A 4C8KA 5BOMA 4BUGA 3ZDCA 4UAVA 3NKHA 3GV8B 5DLGA 2XGQA 3KOOA 2GO7A 2J6TA 1XO1A 4Y2VA 8ICOA 1SB3C 2XVTA 4OJPA 1S76D 1JXEA 9ICWA 4M0AA 2BPGA 2K4EA 3GU3A 4R66A 4DEZA 4CCHA 1YZ6A 5KFAA 2KP7A 4BXOB 3SZ2A 2ALZA 2C28A 1QSYA 1SKWA 2WHEA 4QZGA 3SD7A 2ZTCA 4BDPA 3CRXA 4EBCA 3RBDA 3RRHA 2OHFA 2EAOA 2ASJA 2YY6A 2ESEA 1JI7A 2YX8A 5J2FA 1B4FA 4DQPA 3Q8KA 4J9RA 2JV3A 5HMLA 3JPOA 3OSNA 3WKEA 1RXWA 4JV2A 4MF2A 2NO4A 1P7DA 5AI8A 3G6VA 3RJGA 2ZIVB 1BPYA 3UXUA 2YB1A 3D6JA 2PXIA 3D2QA 3H4DA 8ICGA 4IRKA 4EEYA 4J9NA 2YMPA 3QU7A 2K8AA 5KL8B 5KG5A 8ICRA 2PI5A 4AYBC 1IG6A 1ZQCA 2RQ5A 1S97A 4DSKA 1SWWA 4P2HA 3C28A 2XIDA 5DDMA 1JX4A 4AP9A 1V9PA 2R18A 2ZUDA 3SR6A 4JB3A 4KLUA 5IILA 3M6KA 1MC8A 9ICAA 3IG8A 4KLHA 3EZ5A 4PPXA 3ED5A 4ECYA 8ICTA 9ICCA 5KT5A 5BOLA 3PSPA 3ETLA 2RDJA 3OHBA 4BWMA 4I2GA 4DL6A 5AKIA 2BCRA 2HMXA 3PW4A 2WF7A 2I6XA 4F4WA 4CE6A 1ZQBA 4RQ2A 4DF8A 4ECTA 3Q8RB 2Y1JA 3IV6A 5ALZA 1NKBA 1WWUA 2E3TA 5ALMA 2WB1C 2JEGA 1JRPA 4PZNA 1DOQA 2AH5A 1TV9A 1EXNA 4DFDA 4ED3A 4QW9A 2QB0B 5DQIA 4KLJA 5KG0A 1UA0A 4UBBA 2VANA 3IM1A 1RZTA 2DFLA 1S0NA 7ICJA 2PFNA 4EZ6A 2KE7A 1S0MA 3T5JA 3A0HU 3M8SA 2WAQC 3C2MA 3C5GA 3QEAZ 1SWVA 1L7OA 2FMQA 4FBTA 3TKAA 4JK1A 7ICIA 1QSSA 1NK9A 1NJXA 3L4PA 2F8LA 4KX5A 2Y0SF 2IOFA 4KLLA 4ZOHC 5AM2A 5KFZA 4C0ZA 4QZFA 1ZQLA 1L7NA 4I2JA 4ECVA 4NLCA 5KFHA 4GXKA 2AQ0A 9ICVA 3EWAA 1SZHA 5AI6A 4TQRA 2RLTA 4OJ6A 3QZ8A 3RH6A 2BCVA 1L8LA 4MFFA 4YFKA 3KHGA 9ICXA 4QW8A 4YQWA 4ECWA 2FPMA 4I2BA 4YP3A 5EWEA 7ICQA 1JXLA 5AKJA 1ZQIA 4ELUA 1RQLA 3T3FA 2W7OA 2ISPA 5ALHA 3MR2A 3GIIA 5L1LA 3NUQA 2F1JA 2XCAA 3SMVA 2F76X 2NRWA 1XO0A 2K8BB 4ED0A 2CN1A 1KTQA 4KTQA 2J6SA 2NRZA 2WB1F 8ICMA 3HKZF 1SKSA 3H8MA 5AI0A 4TUQA 4FZMA 4UAWA 4DFPA 9ICRA 1CUKA 5KFGA 3QYPA 5IIMA 4GC6A 2O6KA 3ISDA 4OCZA 4NLKA 4KN7A 4DSEA 3PW7A 2YB4A 3MR5A 5KFQA 4P0PB 3F2DA 3IHQB 1D9FA 2WAQF 1A76A 1TVAA 4RQ7A 4FFDA 4F4YA 2OH2A 2H3VA 3WK9A 1S0OA 1X9XA 2MAXA 1QSLA 1K5OA 3BDPA 3KTQA 3WU2U 5H2FU 9ICEA 5C6KA 2HI0A 4C7ZA 2HOIA 2BCQA 5AKKA 4UQGA 4QZ9A 3TADC 5DBBA 4CF5A 2JEJA 1KSPA 4KLIA 3OJUA 4M6WB 3ORYA 2MUTB 3QNMA 2KN7A 4F91B 4YMNA 4RQ8A 3TACB 2PMZC 1ZQZA 2E1FA 1X40A 3WK7A 1FFUA 2K4HA 5DB9A 2E8PA 3KHHA 2WTFA 5AI9A 2KIWA 1RPLA 3PZPA 2KICA 1ZQJA 3T5KA 3HP6A 1TAMA 4WJ3B 3PW0A 5KG7A 2I9GA 2M9NA 1FFVA 1KBUA 4LVSA 5KFWA 5KFBA 3G6XA 4DL5A 5KG1A 1XC9A 1Z00A 1ZQEA 1PK1A 4OJ5A 3CP8A 1D8YA 2LM4A 3NRZA 1WWVA 4Y2QA 4J9KA 2FJ6A 4KLFA 5J0PA 5J2EA 4Z6DA 5AM5A 2JHDA 4TUSA 2LBOA 1Q3UA 5HR7A 5EE3A 1WCNA 2N1RA 4O3OA 3AQEA 2ZIWA 3F53A 4P4OA 1AIHA 3UXOA 1RM6C 3K1RB 1HJPA 2HHXA 1T3NA 1N61A 5F9LA 4F50A 2ZG6A 9ICLA 2VA3A 2NYVA 3Q8SB 4YCXA 3RR8A 8ICEA 5AKLA 4FS1A 1PZNA 1OW5A 5J2GA 2AHOB 3RJKA 3RJIA 2W3SA 1VLBA 2ZIXB 2PFOA 3BJYA 2W9MA 3F2BA 4DOCA 2HVIA 3DEEA 3F5AA 5GTIU 4EEKA 5IINA 2G06A 4UB8U 3NVWA 4R8UB 2LI6A 1SIJA 1Z1VA 5ALKA 1SGGA 1BPEA 4EBDA 4O9MA 1IIPA 3MFHA 5AKGA 1LVHA 1NK8A 4US9A 2RP5A 1A77A 5L1MA 4O3PA 5ALLA 1KL9A 2Q0ZX 4FZNA 4RQ3A 5J2BA 4O3MA 2UVUA 4U6PA 1XSPA 5DLFA 2DKZA 2F8KA 8ICJA 2KTQA 3M6ZA 3RB3A 2KVSA 1SL1A 4RT2A 4P0QB 4E0GA 4KLSA 4JMUA 3MGHA 3SAHA 1ZOLA 4JV1A 5K4LA 2MU2A 2IOFK 8ICYA 4IQUA 5KT4A 3IP4B 4EZ9A 2BZFA 1SV4A 5DDYA 4QZBA 4I2DA 5ALOA 2EANA 1GO3F 2HBJA 2ZJ8A 1UHUA 2KZ3A 4NY8A 3RTVA 5CRXA 1HUOA 3RJHA 4QZEA 4QIWF 3JPNA 3TAPA 5EWGA 2P6RA 5F9NA 2LKYA 2VIXA 4ED8A 2ASDA 4Q43A 2KMDA 3PVXA 2LMRA 2ZIUB 5CEHA 2F44A 4NLZA 9ICFA 4C4TA 2XI9A 3PO4A 4MF8A 1U48A 5J2HA 4ECQA 4YXJA 3NRWA 3QXGA 5J8YC 1TFRA 4R63A 3PW5A 1VDVA 4Q8EA 5KFIA 5ALWA 4IQWA 4E0PA 3ICXA 7ICGA 3ETRA 9ICMA 3GV5B 2M0NA 4E0ZA 1FLOA 8ICCA 1ZXIA 1X2IA 4BX9C 3N7PD 4ICAA 1ZD4A 2F3NA 3KZIU 3LVWA 4B9TA 4M9LA 3IN5A 3WKCA 4O5EA 4PHAA 2NO5A 3QU9A 1NNLA 1NK4A 1F44A 1VJ5A 2PFPA 2NRTA 4QZAA 3RB4A 9ICQA 3EYZA 4UBCA 5KFNA 2KSOA 3UXNA 9ICOA 3JPPA 4ECRA 3AN1A 3SENA 5DQGA 4ED6A 5AKYA 3M8RA 1L3VA 2WF6A 1ZJNA 4Q45A 1F0MA 5J2AA 4PH5A 4ED7A 1DK2A 5ALJA 2K60A 4PHDA 2GOLA 4RNNA 1AROP 4DLEA 4DL2A 1X6JA 3MR6A 1ZQTA 4J9MA 3LDAA 1UCVA 2Y9TA 4DS5A 5KFKA 3SV4A 2HDOA 4M9HA 3AUOA 4YR0A 1SV0C 2BQ3A 2H3QA 4O3RA 2I5HA 2V4QA 3HPOA 3ZDDA 4BXOA 1LKYB 5CP2A 4RU9A 4KMUA 2W9BB 4B6JA 4TUPA 5J0XA 5DCFA 2ZTDA 4I2IA 1L8OA 3JPSA 4O3SA 4C80A 1X9WA 3KHLA 1L3UA 2BPCA 3HX0A 2W9BA 9ICPA 5AIBA 4YG2A 3NGDA 3ONNA 8ICFA 4DFKA 1N56A 2KEYA 2HHTA 5DBAA 4DF4A 2DPJA 3B9JA 2ZIVA 2D6FC 2Y0SC 3BS5B 4Y2YA 1Q46A 1S9FA 2F77X 2KJ5A 2KV2A 3EUB2 4NLBA 1T4GA 5EE1A 1N2XA 2FE9A 4F5NA 3ZDBA 2MA1A 4DSIA 2G5HB 3MABA 3QUQA 2BDPA 5KFEA 3RFAA 1N63A 3THVA 1BPBA 3TADA 3N7RC 3I28A 4RT3A 5KFFA 2DPIA 2G07A 4F41A 3ISBA 1Q3VA 1N60A 1QQ6A 2R8JA 4NWIA 5KFRA 5AK4A 5KG4A 3RH5A 3MC1A 2UVRA 4Y2PA 1QQ5A 3EPGA 5IIKA 3S6JA 7ICLA 5D46A 3K4GA 3C29A 4CDGA 4OJLA 4GC7A 4ACOA 3GILA 5DG8A 1COOA 1C20A 2HOQA 3H8JA 3H8SA 5J0UA 4UB6U 5AI4A 3HKZC 4DSJA 4DLGA 4UB5A 1V97A 1ZRMA 4G3IA 4KLEA 3V6HA 1PK3A 1UPHA 1X42A 4RPZA 4Y2RA 4F5RA 4PZOA 5DG9A 8ICXA 4NL9C 5KFXA 3QUTA 2HSZA 4BGDA 4MHVA 4Y2TA 2JEFA 4C4SA 5KG6A 2QB0A 3RH4A 4DSLA 3KFUF 2WF5A 4HYKA 1PVQA 2FPLA 2VA2A 3SV3A 1PUZA 4FO6A 1QQ7A 2FLLA 5D49A 1HIWA 4JV0A 4R64A 3TFSA 1UQVA 3N28A 2C2EA 1RYUA 5CHGA 5B5EU 5ALXA 3WK8A 2JXJA 3HJEA 5KG3A 2LHTA 4OJOA 2IA6A 2HW3A 3J81j 2W9AA 2VKQA 7ICRA 4ECZA 5GTHU 3MGIA 2MSNA 4RNMA 2K4PA 5J29A 1ZQNA 2EDUA 2LYHA 1B43A 5KFPA 1XNSA 4PGQA 4PHPA 5KFDA 4ZH4A 3HW8A 1WUDA 4DL3A 1KN5A 4ED1A 5HP4A 4F4ZA 2YQEA 5J0OA 2YTUA 3LK9A 4O0IA 3OSPA 7ICSA 1K1QA 4IC9A 3PSIA 3HRDD 5EOZA 4UB2A 5IIJA 2W43A 3MGVA 2HHWA 1XU4A 2IBKA 2DQNB 1ZD2P 4YMMA 5HHIA 2BDUA 5ALVA 5KFVA 4UAZA 5KFJA 2K89A 1KFSA 5G5GA 2XY7A 5ALUA 2W03A 3N4MB 2UVVA 2KHQA 1S77D 1RYRA 7ICFA 2P6UA 3LYSA 2MRLA 3GIMA 4NM2A 3U26A 4XUSA 4NJ8A 2XGPA 3PY8A 4TQSA 2YMMA 1S5LU 2GH1A 2KFNA 4F2SA 3AEVA 5J2DA 1LB2B 1NOMA 2JMGA 4UARA 1V38A 3CNHA 2VA8A 4QZHA 5L1JA 2EZZA 4P0PA 3V6KA 3T79A 1P4EC 3F5EA 4DSFA 2JH7A 1L3SA 1FIQA 4QNLA 3UXPA 2WFAA 5ALEA 3TQ1A 3M1YA 2ATLA 4DQIA 3H7IA 3RJFA 3B0XA 1D8BA 5KFLA 4C8MA 8ICAA 3HILA 3WK5A 1JALA 3RJJA 8ICQA 3QUBA 4NLGA 4PJ0U 3SAGA 3NS1A 4M6WA 9ICJA 2MUTA 2K8CB 1ZQYA 5J8YA 3SYZA 4QZCA 4MFCA 1X66A 2JGAA 3PX0A 4RQ6A 3Q8MA 4M47A 4IR9A 4RQ1A 4QWAA 3QU5A 1RYSA 4KMOB 7ICEA 1JN3A 2KIVA 4PL1A 7ICPA 5C0YA 4E0JA 2BGWA 4GIBA 2NRXA 2EZYA 4OO1J 3MDAA 3IRUA 1T7PA 1B0XA 3PMLA 3AU6A 2W3RA 5ALDA 2A1AA 2D3DA 3Q8QB 1H38A 2GLEA 4K4HA 4J03A 4ECSA 4J9PA 2HOFA 3HWTA 4C8LA 3JPQA 4C7YA 2OM6A 4QIWC 3LWLA 1SL2A 4I2CA 2L5YA 1XSNA 3FDSA 3TI0A 1V85A 4O5KA 4B9LA 2A1JB 2LYAA 1TAUA 1PVPA 1KFTA 8ICHA 2DBYA 2KVCA 3FC4A 1SV0A 3NASA 5KFSA 1BGXT 1JUDA 3E2EA 3RR7A 3T5HA 1ZQVA 3IG5A 4KN4A 1NKCA 4EX6A 4UB3A 2ZIXA 3GDXA 3C5FA 1RXVA 3GQCA 1NI3A 2OYYA 3GIJA 1ZQHA 2E8NA 4R8UA 2FMSA 5FP0A 4DWIA 1BPZA 4CF4A 5KAIU 1JROA 5KT7A 3M9MB 4Z6FA 5J0TA 4BWJA 2YMQA 2UVWA 2EQYA 3D2NA 1PVRA 2KD1A 2KZMA 1C7YA 2AGOA 1MSWD 7ICNA 2ZJ5A 4MEYA 5CB1A 1ZQDA 4EYHB 4ELVA 4UATA 4I2AA 3QU2A 8ICZA 5DB6A 3WKAA 4YXMA 3UQ2A 2H3FA 3I76A 3OTQA 3RRGA 3NVVA 1KKXA 5J0WA 1ZQAA 1ZQGA 5KAFU 1TK8A 1HUZA 1DGJA 1M6XC 2ZJAA 1B22A 1T94A 4P0QA 3C2LA 1UT8A 1X9MA 2XCPA 3UM9A 3EW9A 5JRTA 4JWMA 2CXYA 4FS2A 3CW2C 2KK0A 4RQ4A 4NXZA 3OGUA 1U4BA 9ICNA 4ECXA 5HMMA 1MQ3A 4B9SA 4DQQA 2PKEA 2VJ4A 4DL4A 4Y2JA 3GZFA 3UMBA 1URJA 5KFYA 4QWBA 2W11A 2V4RA 3E58A 1ED1A 4NLNA 4P4MA 3GIKA 4LJXA 1Z4OA 4Z6CA 2R8IA 4DFMA 4K4GA 4C8OA 4F4XA 4RUCA 1ZQRA 4DOAA 2ZIUA 4KLTA 3BS7A 2B0CA 4G9BA 1A0PA 2W8KA 4J9QA 4FZLA 5CJ7A 9ICBA 2BQRA 2HHSA 1Q8KA 4NL9A 2E1EA 5ALNA 1TK5A 4C8NA 5HHHA 4DOBA 1ZQWA 2E8MA 3LWMA 2FLNA 5AM3A 4YVZA 8ICKA 3VC8A 3QU4A 4M9GA 2JEIA 2KFZA 2XO7A 4I2FA 2RHFA 3K1ZA 1U45A 1TAQA 2QARB 2IOHA 1UA1A 1WCLA 2R8GA 2W8LA 4KLGA 2IMWP 4XA5A 4B9MA 4YD2A 3WKBA 1DK3A 7ICHA 4EENA 2IHMA 2CPRA 2G08A 2BHNA 3L5KA 3G6YA 4LZGA 4EYIB 4PGXA 3OJSA 2WF9A 3KHRA 2LM1A 3C1YA 5EE9A 2XY6A 1CRXA 2G5IB 1NZPA 5J2JA 4F43A 3BZKA 2ODGA 2HVHA 2KJ9A 5DG7A 1IM4A 7ICKA 1J2MA 3ISCA 3FM9A 2JRZA 4KLOA 2BCSA 3MDCA 3O0FA 2DKXA 2W55A 2AQ4A 4F71A 2D8CA 3FAHA 8ICNA 2OCEA 5KT2A 4QZIA 3KKAC 2ZUCA 4F3OA 4US8A 2EAMA 1TK0A 2LYBA 2ASLA 3UPQA 1LKYA 5A0LA 1LV5A 4QWEA 4RQ0A 3FYHA 2H3ZA 5AI5A 4M2YA 1S8OA 3ZDAA 4CGZA 2ISOA 1QCKA 3ZD8A 2C2DA 4R65A 2A3VA 3PO5A 2FPKA 5DQHA 5CWRA 2PI4A 5JU5A 1ECWA 3AL0B 2CRXA 2KKPA 2GWSA 5IIIA 4B9UA 9ICUA 1A6SA 1Z4NA 5JUMA 1ZQSA 1JIHA 3SQIA 3H0RB 4JUZA 1BNOA 4GLXA 1P4EA 9ICIA 4MFAA 4I28A 2ZTEA 3PSFA 3BS5A 2JR5A 3PX4A 5CR0A 3GV7B 4CF3A 5AKXA 4ECUA 4DQRA 4X5VA 1RQNA 4Z6EA 3GFKB 4Y2XA 2OWOA 5L9XA 1BNPA 8ICBA 3V7LA 3IDWA 2ES6A 3ALRA 8ICVA 2W7PA 2W54A 1MA7A 5KT6A 2R8HA 1N62A 3UMGA 3M7DA 3H0LB 1T3QA 5HR6A 3H4BA 5J2IA 3I1YA 2LPEA 4IQTA 1NK7A 4IRDA 4DQSA 1ZQOA 4EBEA 3CYMA 4C4RA 2HHVA 4XQ8A 5AKZA 4TURA 8ICLA 3QE9Y 4I2EA 2AGPA 4Q8FA 2V9WA 2NRVA 3BQ0A 3PR4A 2KG5A 3R9KA 2B21A 3SAFA 1Z1BA 2Y9UA 4E0DA 4F5OA 1D8LA 1M6YA 1BVSA 2BKEA 7ICTA 4ED2A 3BQ7A 3RF9A 4Y2SA 3TARA 3M9NB 2NV3A 4IR1A 2P35A 1SKRA 4KLMA 1YZ7A 2EH9A 4Q44A 4YR2A 4QJFB 2FI1A 5AIAA 4UAYA 3OPXA 2C2RA 5ALSA 2XC9A 2RRDA 2VJ5A 1KRPA 3H40A 4BJQA 1XWLA 2V6EA 2ZXHA 4B9VA 4FE3A 2AGQA 3ZDEA 5D4BA 3RAXA 4AYBF 4F93B 4B9NA 5KFOA 5ALFA 1T8EA 2EZXA 2W9CB 2DF4B 3PR5B 3BQ1A 5ALRA 4K4IA 1NJZA 4EX7A 2ZXIA 2OEHA 3RBEA 3JPTA 5B66U 4RPXA 2BPFA 9ICSA 5DGBA 3F2CA 3EPIA 2W9CA 3BQ2A 2FDRA 5KG2A 1YT3A 3DV9A 4RQMA 3QUCA 3WK6A 3PNCA 3WK4A 5KFTA 4O3QA 2DUYA 4EELA 2YMLA 5L1IA 4DKSA 8ICIA 3KBBA 3T5LA 4GXIA 2H3IA 4MEXA 2WF8A 1SL0A 3RJEA 2HCFA 8ICWA 3C23A 2F1IA 2AU0A 1CEZA 1NJYA 3PV8A 1ZQQA 3AQFA 4J9LA 5KL1B 2KOBA 5HNKA 4QZDA 1M6XA 7ICVA 2K4IA 8ICSA 2C22A 1ZYQA 1AE9A 4F5QA 4KLDA 3QX7A 1NZBA 2F2AB 3JPRA 4J9OA 1KLNA 4RNOA 1ZQKA 3Q8PB 4RUAA 3NVYA 2JH1A 2FMPA 5G5HA 5J0SA 1MQ2A 2HBLA 1SXEA 3NTUA 5F3XB 4ELTA 4PL2A 3M9OB 2HHQA 4YR3A 3SI8A 4DWPA 2DWQA 5KFUA 1FO4A 3AMZA 5DORA 1MN8A 3V72A 4I29A 7ICOA 1QH9A 5KFCA 1RG6A 3RB6A 3UMCA 1ZETA 3WKDA 4CNQA 1ZD3A 2OXOA 3AU2A 5TISU 1U47A 2YN4A 2BCUA 4E0YA 4F5PA 1HEKA 3KD3A 5ALPA 2DGZA 1NJWA 5J0RA 4GXJA 5ALQA 2FLPA 3QZ7A 5ALYA 3PSTA 3Q8LA 5AHXA 4I2HA 2PFQA 1Z00B 2QLTA 3MR3A 3C21A 3V7KA 3PX6A 1PK1B 5L1KA 3E0FA 1D9DA 4RQNA 4HAIA 1DGSA 2XICA 9ICKA 3RB0A 2R8KA 1SZPA 3C1ZA 4F72A 5J0QA 4RZRA 2E8OA 1N5WA 5E79U 2P66A 1U9LA 2HBKA 1OUQA 1ZQPA 4YMOA 2E5SA 4QWDA 2J6UA 4UB1A 2ZIWB 5ALGA 1S0VA 4F8RA 4XRHA 2JZBB 5ALIA 3OHAA 4M9NA 3HT3A 1KEJA 1XSLA 5AKEA 1L3TA 5J2KA 2G09A 4DL7A 5TZVA 5DKWA 1CI4A 4P4PA 1L7PA 4M04A 3MFIA 2JZBA 4PHEA 7ICMA 4KLQA 3D2SA 4RPYA 4M9JA 2IHNA 1IXRA 1ZJMA 2A1JA 1WYGA 1O08A 1ZQUA 1L5UA 1ZRNA 3KKAA 4Y2UA 3PW2A 1OXJA 1KDHA 4O5CA 3DDHA 4UASA 5EE0A 5JTIA 4J9SA 3A0BU 3TANA 2KJ8A 2W04A 1NK0A 3H0MB 1COKA 2PMZF 2RDIA 3NVZA 9ICHA 1O03A 5KNIA 2ZUBA 1J97A 2A19A 2HBMA 4FBUA 1F5SA 1AQ6A 1RDFA 5AM1A 5KFMA 4UW9A 5J2CA 1JMSA 1XS9D 1TKDA 5DB8A 1Z19A 2BQUA 1ZD5A 1DRGA 5C5JA 1NKEA 1ZQXA 2AXTU 4KX3A 2QB1A 5AK5A 5BPCA 3PMNA 1ZQMA 4UB4A 1ZQ1C 5EWFA 5KT3A 1K1SA 1J2NA 4IQVA 4YN4A 1DXSA 1Z3EB 3AM9A 4CRXA 5CA7A 4F92B 8ICUA 2G0AA 2KKVA 5AM0A 4PGYA 4I27A 1KFDA 5IIOA 3TFRA 1L7MA 2B6GA 4DO9A 5AKHA 1BPXA 1U49A
chains in the Genus database with same CATH topology
3IG5A 2H3ZA 4U6PA 3RF9A 1A0PA 2K4EA 2W7OA 2KNJA 3GU3A 4CGZA 1AE9A 4FZLA 3M6ZA 2MA1A 4NV0A 2HMXA 2ZIXA 2NV3A 3NUQA 1KBUA 2A3VA 3SMVA 2G5HB 2G09A 2F76X 4WJ3B 1XO0A 3SAGA 3RFAA 4QJFB 2K8BB 1NZBA 2OYYA 1ECWA 3N7RC 4P0QB 2E1EA 2CN1A 2K8CB 2F2AB 3AL0B 3OPXA 2WB1F 4JMUA 3L3FX 3CP8A 4OJ5A 2CRXA 2G07A 2KKPA 3SAHA 3HKZF 3CRXA 1Q3VA 1XNSA 5T14A 3D2SA 2RRDA 2WB1C 1WUDA 3N7SC 2VJ5A 4FZMA 4NWIA 3VC8A 2JGAA 4BJQA 1A6SA 2JHDA 2LBOA 1Q3UA 5HR7A 3IP4B 3SQIA 2JH1A 2YX8A 2GOLA 3H0RB 2RHFA 3K1ZA 2ZXHA 3D2NA 4FE3A 3KZXA 1PVRA 2KD1A 1P4EA 2HBLA 4AYBF 2N1RA 2YB4A 1GO3F 2HBJA 3PSFA 4IC9A 4PL2A 2DF4B 4KMOB 4PL1A 4P0PB 3C29A 4CDGA 3PSIA 3F2DA 5CRXA 3AQEA 4OJLA 5C0YA 4ACOA 1L6NA 2ZIWA 2KJ8A 3F53A 1AIHA 5DORA 4QIWF 2W04A 3VCBA 1P7DA 3MGVA 2ZXIA 2H3FA 2HOQA 2WAQF 4OO1J 2H3QA 2DQNB 2KHVA 2LKYA 2ZIVB 2H3VA 3H0MB 2OH2A 2CPRA 2VIXA 2ZG6A 2PMZF 3UXUA 2BDUA 2YB1A 3HKZC 2WAQC 3F2CA 2G08A 3D2QA 2HBMA 1M6XC 2K89A 2OXOA 3ALRA 2W7PA 2Z7JA 1YT3A 2ZIUB 1T94A 4P0QA 4GFJA 2W03A 1MA7A 2K8AA 5KL8B 2KHQA 2F8LA 1UPHA 4KX5A 1CRXA 1Z19A 2G5IB 2Y0SF 5C6KA 1HEKA 2HOIA 3M7DA 5DCFA 1DRGA 3H0LB 2DGZA 2ZIXB 3LYSA 2MRLA 4AYBC 2XI9A 2HOFA 5HR6A 4KX3A 2KJ9A 3F2BA 4DKSA 3NRWA 3PSTA 3DEEA 3C28A 2XIDA 3F5AA 4C0ZA 2VKQA 3VCFA 2GH1A 2H3IA 2OM6A 4U7CA 4QIWC 2G06A 1ZQ1C 3E0FA 3O0FA 4NLCA 2JMGA 2Q4TA 2R18A 4A8EA 3KFUF 3ONNA 1PVQA 3LVVA 1SZHA 2XICA 2PMZC 4P0PA 2VJ4A 3CYMA 4OJ6A 4BUGA 3ICXA 3T79A 4CRXA 2LYAA 2E1FA 2KEYA 2M0NA 1PVPA 3NKHA 1FLOA 1P4EC 3GZFA 1IIPA 2K4HA 3M6KA 3N7PD 4ICAA 1HIWA 4BX9C 3F5EA 2JH7A 3IG8A 1URJA 2KVCA 3LVWA 2ZIVA 2G0AA 2KKVA 2D6FC 3IN5A 2RP5A 4QNLA 1ED1A 2Y0SC 3AQFA 2KIWA 3SAFA 3PZPA 2F77X 2KICA 2KOBA 2KJ5A 2KV2A 2LHTA 2LYBA 4FZNA 5KL1B 1Z1BA 1F44A 3PSPA 2HBKA 4NLBA 4OJOA 5A0LA 1OUQA 2XVTA 2E5SA 1M6XA 2ZIWB 4O3MA 2ZIUA 4OJPA 1D8BA 1TAMA 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8E A;  1A0P A;  1M6X C;  1PVQ A;  2OXO A;  1AE9 A;  1PVR A;  1P4E A;  2KD1 A;  4CRX A;  1KBU A;  2A3V A;  2KEY A;  1MA7 A;  1PVP A;  3NKH A;  1CRX A;  5C6K A;  2KHQ A;  1P4E C;  1FLO A;  1Z19 A;  1XO0 A;  2HOI A;  5DCF A;  1NZB A;  1DRG A;  3C29 A;  5CRX A;  3LYS A;  2KKV A;  2HOF A;  4ACO A;  2KJ8 A;  1AIH A;  5DOR A;  2KJ9 A;  1P7D A;  2KIW A;  2CRX A;  3CRX A;  3NRW A;  2KKP A;  4DKS A;  3MGV A;  1Q3V A;  1XNS A;  2KOB A;  2KJ5 A;  1F44 A;  3C28 A;  1Z1B A;  2KHV A;  1OUQ A;  3VCF A;  1M6X A;  3UXU A;  1Q3U A; 
#chains in the Genus database with same CATH topology
 2H5X A;  2KNJ A;  4YD1 A;  3TAQ A;  8ICP A;  4E10 A;  1N5X A;  4NV0 A;  3BZC A;  3SEI A;  3BQT A;  3V7J A;  3QEB Z;  2AJQ A;  3ZI4 A;  7ICU A;  2I1Q A;  1FEZ A;  2F1H A;  1QLN A;  4IRC A;  1KW4 A;  4RQ5 A;  1ZQF A;  1NK6 A;  5DB7 A;  3L3F X;  4F2R A;  1WG8 A;  4IS7 A;  4OD0 A;  5T14 A;  4DS4 A;  3N7S C;  5J0Y A;  1UT5 A;  5AK3 A;  5AM4 A;  1TE2 A;  3RAQ A;  3B0Y A;  1QTM A;  3ZD9 A;  2KZZ A;  1S10 A;  4IL6 U;  3KZX A;  5KTQ A;  3C2K A;  2Y1I A;  5DGA A;  9ICG A;  1Y88 A;  4DCC A;  1SXD A;  1NK5 A;  4F4K A;  4KIT B;  3UQ0 A;  4DFJ A;  4QWC A;  1L6N A;  3H8W A;  3VCB A;  4LZD A;  1BPD A;  4NM1 A;  5AK6 A;  2KHV A;  5ALT A;  2XY5 A;  3N97 B;  4JWN A;  3V6J A;  4UAU A;  1IV8 A;  2Z7J A;  4GFJ A;  2BR0 A;  2KSO B;  3MBY A;  4USA A;  2EAP A;  9ICT A;  1X6I A;  2QKQ A;  1KQQ A;  4O3N A;  3K75 D;  1X9S A;  3VCF A;  5AIC A;  4QZ8 A;  2QAR A;  4U7C A;  5DBC A;  2HHU A;  2DL0 A;  2Q4T A;  4A8E A;  3LVV A;  1N48 A;  4C8K A;  5BOM A;  4BUG A;  3ZDC A;  4UAV A;  3NKH A;  3GV8 B;  5DLG A;  2XGQ A;  3KOO A;  2GO7 A;  2J6T A;  1XO1 A;  4Y2V A;  8ICO A;  1SB3 C;  2XVT A;  4OJP A;  1S76 D;  1JXE A;  9ICW A;  4M0A A;  2BPG A;  2K4E A;  3GU3 A;  4R66 A;  4DEZ A;  4CCH A;  1YZ6 A;  5KFA A;  2KP7 A;  4BXO B;  3SZ2 A;  2ALZ A;  2C28 A;  1QSY A;  1SKW A;  2WHE A;  4QZG A;  3SD7 A;  2ZTC A;  4BDP A;  3CRX A;  4EBC A;  3RBD A;  3RRH A;  2OHF A;  2EAO A;  2ASJ A;  2YY6 A;  2ESE A;  1JI7 A;  2YX8 A;  5J2F A;  1B4F A;  4DQP A;  3Q8K A;  4J9R A;  2JV3 A;  5HML A;  3JPO A;  3OSN A;  3WKE A;  1RXW A;  4JV2 A;  4MF2 A;  2NO4 A;  1P7D A;  5AI8 A;  3G6V A;  3RJG A;  2ZIV B;  1BPY A;  3UXU A;  2YB1 A;  3D6J A;  2PXI A;  3D2Q A;  3H4D A;  8ICG A;  4IRK A;  4EEY A;  4J9N A;  2YMP A;  3QU7 A;  2K8A A;  5KL8 B;  5KG5 A;  8ICR A;  2PI5 A;  4AYB C;  1IG6 A;  1ZQC A;  2RQ5 A;  1S97 A;  4DSK A;  1SWW A;  4P2H A;  3C28 A;  2XID A;  5DDM A;  1JX4 A;  4AP9 A;  1V9P A;  2R18 A;  2ZUD A;  3SR6 A;  4JB3 A;  4KLU A;  5IIL A;  3M6K A;  1MC8 A;  9ICA A;  3IG8 A;  4KLH A;  3EZ5 A;  4PPX A;  3ED5 A;  4ECY A;  8ICT A;  9ICC A;  5KT5 A;  5BOL A;  3PSP A;  3ETL A;  2RDJ A;  3OHB A;  4BWM A;  4I2G A;  4DL6 A;  5AKI A;  2BCR A;  2HMX A;  3PW4 A;  2WF7 A;  2I6X A;  4F4W A;  4CE6 A;  1ZQB A;  4RQ2 A;  4DF8 A;  4ECT A;  3Q8R B;  2Y1J A;  3IV6 A;  5ALZ A;  1NKB A;  1WWU A;  2E3T A;  5ALM A;  2WB1 C;  2JEG A;  1JRP A;  4PZN A;  1DOQ A;  2AH5 A;  1TV9 A;  1EXN A;  4DFD A;  4ED3 A;  4QW9 A;  2QB0 B;  5DQI A;  4KLJ A;  5KG0 A;  1UA0 A;  4UBB A;  2VAN A;  3IM1 A;  1RZT A;  2DFL A;  1S0N A;  7ICJ A;  2PFN A;  4EZ6 A;  2KE7 A;  1S0M A;  3T5J A;  3A0H U;  3M8S A;  2WAQ C;  3C2M A;  3C5G A;  3QEA Z;  1SWV A;  1L7O A;  2FMQ A;  4FBT A;  3TKA A;  4JK1 A;  7ICI A;  1QSS A;  1NK9 A;  1NJX A;  3L4P A;  2F8L A;  4KX5 A;  2Y0S F;  2IOF A;  4KLL A;  4ZOH C;  5AM2 A;  5KFZ A;  4C0Z A;  4QZF A;  1ZQL A;  1L7N A;  4I2J A;  4ECV A;  4NLC A;  5KFH A;  4GXK A;  2AQ0 A;  9ICV A;  3EWA A;  1SZH A;  5AI6 A;  4TQR A;  2RLT A;  4OJ6 A;  3QZ8 A;  3RH6 A;  2BCV A;  1L8L A;  4MFF A;  4YFK A;  3KHG A;  9ICX A;  4QW8 A;  4YQW A;  4ECW A;  2FPM A;  4I2B A;  4YP3 A;  5EWE A;  7ICQ A;  1JXL A;  5AKJ A;  1ZQI A;  4ELU A;  1RQL A;  3T3F A;  2W7O A;  2ISP A;  5ALH A;  3MR2 A;  3GII A;  5L1L A;  3NUQ A;  2F1J A;  2XCA A;  3SMV A;  2F76 X;  2NRW A;  1XO0 A;  2K8B B;  4ED0 A;  2CN1 A;  1KTQ A;  4KTQ A;  2J6S A;  2NRZ A;  2WB1 F;  8ICM A;  3HKZ F;  1SKS A;  3H8M A;  5AI0 A;  4TUQ A;  4FZM A;  4UAW A;  4DFP A;  9ICR A;  1CUK A;  5KFG A;  3QYP A;  5IIM A;  4GC6 A;  2O6K A;  3ISD A;  4OCZ A;  4NLK A;  4KN7 A;  4DSE A;  3PW7 A;  2YB4 A;  3MR5 A;  5KFQ A;  4P0P B;  3F2D A;  3IHQ B;  1D9F A;  2WAQ F;  1A76 A;  1TVA A;  4RQ7 A;  4FFD A;  4F4Y A;  2OH2 A;  2H3V A;  3WK9 A;  1S0O A;  1X9X A;  2MAX A;  1QSL A;  1K5O A;  3BDP A;  3KTQ A;  3WU2 U;  5H2F U;  9ICE A;  5C6K A;  2HI0 A;  4C7Z A;  2HOI A;  2BCQ A;  5AKK A;  4UQG A;  4QZ9 A;  3TAD C;  5DBB A;  4CF5 A;  2JEJ A;  1KSP A;  4KLI A;  3OJU A;  4M6W B;  3ORY A;  2MUT B;  3QNM A;  2KN7 A;  4F91 B;  4YMN A;  4RQ8 A;  3TAC B;  2PMZ C;  1ZQZ A;  2E1F A;  1X40 A;  3WK7 A;  1FFU A;  2K4H A;  5DB9 A;  2E8P A;  3KHH A;  2WTF A;  5AI9 A;  2KIW A;  1RPL A;  3PZP A;  2KIC A;  1ZQJ A;  3T5K A;  3HP6 A;  1TAM A;  4WJ3 B;  3PW0 A;  5KG7 A;  2I9G A;  2M9N A;  1FFV A;  1KBU A;  4LVS A;  5KFW A;  5KFB A;  3G6X A;  4DL5 A;  5KG1 A;  1XC9 A;  1Z00 A;  1ZQE A;  1PK1 A;  4OJ5 A;  3CP8 A;  1D8Y A;  2LM4 A;  3NRZ A;  1WWV A;  4Y2Q A;  4J9K A;  2FJ6 A;  4KLF A;  5J0P A;  5J2E A;  4Z6D A;  5AM5 A;  2JHD A;  4TUS A;  2LBO A;  1Q3U A;  5HR7 A;  5EE3 A;  1WCN A;  2N1R A;  4O3O A;  3AQE A;  2ZIW A;  3F53 A;  4P4O A;  1AIH A;  3UXO A;  1RM6 C;  3K1R B;  1HJP A;  2HHX A;  1T3N A;  1N61 A;  5F9L A;  4F50 A;  2ZG6 A;  9ICL A;  2VA3 A;  2NYV A;  3Q8S B;  4YCX A;  3RR8 A;  8ICE A;  5AKL A;  4FS1 A;  1PZN A;  1OW5 A;  5J2G A;  2AHO B;  3RJK A;  3RJI A;  2W3S A;  1VLB A;  2ZIX B;  2PFO A;  3BJY A;  2W9M A;  3F2B A;  4DOC A;  2HVI A;  3DEE A;  3F5A A;  5GTI U;  4EEK A;  5IIN A;  2G06 A;  4UB8 U;  3NVW A;  4R8U B;  2LI6 A;  1SIJ A;  1Z1V A;  5ALK A;  1SGG A;  1BPE A;  4EBD A;  4O9M A;  1IIP A;  3MFH A;  5AKG A;  1LVH A;  1NK8 A;  4US9 A;  2RP5 A;  1A77 A;  5L1M A;  4O3P A;  5ALL A;  1KL9 A;  2Q0Z X;  4FZN A;  4RQ3 A;  5J2B A;  4O3M A;  2UVU A;  4U6P A;  1XSP A;  5DLF A;  2DKZ A;  2F8K A;  8ICJ A;  2KTQ A;  3M6Z A;  3RB3 A;  2KVS A;  1SL1 A;  4RT2 A;  4P0Q B;  4E0G A;  4KLS A;  4JMU A;  3MGH A;  3SAH A;  1ZOL A;  4JV1 A;  5K4L A;  2MU2 A;  2IOF K;  8ICY A;  4IQU A;  5KT4 A;  3IP4 B;  4EZ9 A;  2BZF A;  1SV4 A;  5DDY A;  4QZB A;  4I2D A;  5ALO A;  2EAN A;  1GO3 F;  2HBJ A;  2ZJ8 A;  1UHU A;  2KZ3 A;  4NY8 A;  3RTV A;  5CRX A;  1HUO A;  3RJH A;  4QZE A;  4QIW F;  3JPN A;  3TAP A;  5EWG A;  2P6R A;  5F9N A;  2LKY A;  2VIX A;  4ED8 A;  2ASD A;  4Q43 A;  2KMD A;  3PVX A;  2LMR A;  2ZIU B;  5CEH A;  2F44 A;  4NLZ A;  9ICF A;  4C4T A;  2XI9 A;  3PO4 A;  4MF8 A;  1U48 A;  5J2H A;  4ECQ A;  4YXJ A;  3NRW A;  3QXG A;  5J8Y C;  1TFR A;  4R63 A;  3PW5 A;  1VDV A;  4Q8E A;  5KFI A;  5ALW A;  4IQW A;  4E0P A;  3ICX A;  7ICG A;  3ETR A;  9ICM A;  3GV5 B;  2M0N A;  4E0Z A;  1FLO A;  8ICC A;  1ZXI A;  1X2I A;  4BX9 C;  3N7P D;  4ICA A;  1ZD4 A;  2F3N A;  3KZI U;  3LVW A;  4B9T A;  4M9L A;  3IN5 A;  3WKC A;  4O5E A;  4PHA A;  2NO5 A;  3QU9 A;  1NNL A;  1NK4 A;  1F44 A;  1VJ5 A;  2PFP A;  2NRT A;  4QZA A;  3RB4 A;  9ICQ A;  3EYZ A;  4UBC A;  5KFN A;  2KSO A;  3UXN A;  9ICO A;  3JPP A;  4ECR A;  3AN1 A;  3SEN A;  5DQG A;  4ED6 A;  5AKY A;  3M8R A;  1L3V A;  2WF6 A;  1ZJN A;  4Q45 A;  1F0M A;  5J2A A;  4PH5 A;  4ED7 A;  1DK2 A;  5ALJ A;  2K60 A;  4PHD A;  2GOL A;  4RNN A;  1ARO P;  4DLE A;  4DL2 A;  1X6J A;  3MR6 A;  1ZQT A;  4J9M A;  3LDA A;  1UCV A;  2Y9T A;  4DS5 A;  5KFK A;  3SV4 A;  2HDO A;  4M9H A;  3AUO A;  4YR0 A;  1SV0 C;  2BQ3 A;  2H3Q A;  4O3R A;  2I5H A;  2V4Q A;  3HPO A;  3ZDD A;  4BXO A;  1LKY B;  5CP2 A;  4RU9 A;  4KMU A;  2W9B B;  4B6J A;  4TUP A;  5J0X A;  5DCF A;  2ZTD A;  4I2I A;  1L8O A;  3JPS A;  4O3S A;  4C80 A;  1X9W A;  3KHL A;  1L3U A;  2BPC A;  3HX0 A;  2W9B A;  9ICP A;  5AIB A;  4YG2 A;  3NGD A;  3ONN A;  8ICF A;  4DFK A;  1N56 A;  2KEY A;  2HHT A;  5DBA A;  4DF4 A;  2DPJ A;  3B9J A;  2ZIV A;  2D6F C;  2Y0S C;  3BS5 B;  4Y2Y A;  1Q46 A;  1S9F A;  2F77 X;  2KJ5 A;  2KV2 A;  3EUB 2;  4NLB A;  1T4G A;  5EE1 A;  1N2X A;  2FE9 A;  4F5N A;  3ZDB A;  2MA1 A;  4DSI A;  2G5H B;  3MAB A;  3QUQ A;  2BDP A;  5KFE A;  3RFA A;  1N63 A;  3THV A;  1BPB A;  3TAD A;  3N7R C;  3I28 A;  4RT3 A;  5KFF A;  2DPI A;  2G07 A;  4F41 A;  3ISB A;  1Q3V A;  1N60 A;  1QQ6 A;  2R8J A;  4NWI A;  5KFR A;  5AK4 A;  5KG4 A;  3RH5 A;  3MC1 A;  2UVR A;  4Y2P A;  1QQ5 A;  3EPG A;  5IIK A;  3S6J A;  7ICL A;  5D46 A;  3K4G A;  3C29 A;  4CDG A;  4OJL A;  4GC7 A;  4ACO A;  3GIL A;  5DG8 A;  1COO A;  1C20 A;  2HOQ A;  3H8J A;  3H8S A;  5J0U A;  4UB6 U;  5AI4 A;  3HKZ C;  4DSJ A;  4DLG A;  4UB5 A;  1V97 A;  1ZRM A;  4G3I A;  4KLE A;  3V6H A;  1PK3 A;  1UPH A;  1X42 A;  4RPZ A;  4Y2R A;  4F5R A;  4PZO A;  5DG9 A;  8ICX A;  4NL9 C;  5KFX A;  3QUT A;  2HSZ A;  4BGD A;  4MHV A;  4Y2T A;  2JEF A;  4C4S A;  5KG6 A;  2QB0 A;  3RH4 A;  4DSL A;  3KFU F;  2WF5 A;  4HYK A;  1PVQ A;  2FPL A;  2VA2 A;  3SV3 A;  1PUZ A;  4FO6 A;  1QQ7 A;  2FLL A;  5D49 A;  1HIW A;  4JV0 A;  4R64 A;  3TFS A;  1UQV A;  3N28 A;  2C2E A;  1RYU A;  5CHG A;  5B5E U;  5ALX A;  3WK8 A;  2JXJ A;  3HJE A;  5KG3 A;  2LHT A;  4OJO A;  2IA6 A;  2HW3 A;  3J81 j;  2W9A A;  2VKQ A;  7ICR A;  4ECZ A;  5GTH U;  3MGI A;  2MSN A;  4RNM A;  2K4P A;  5J29 A;  1ZQN A;  2EDU A;  2LYH A;  1B43 A;  5KFP A;  1XNS A;  4PGQ A;  4PHP A;  5KFD A;  4ZH4 A;  3HW8 A;  1WUD A;  4DL3 A;  1KN5 A;  4ED1 A;  5HP4 A;  4F4Z A;  2YQE A;  5J0O A;  2YTU A;  3LK9 A;  4O0I A;  3OSP A;  7ICS A;  1K1Q A;  4IC9 A;  3PSI A;  3HRD D;  5EOZ A;  4UB2 A;  5IIJ A;  2W43 A;  3MGV A;  2HHW A;  1XU4 A;  2IBK A;  2DQN B;  1ZD2 P;  4YMM A;  5HHI A;  2BDU A;  5ALV A;  5KFV A;  4UAZ A;  5KFJ A;  2K89 A;  1KFS A;  5G5G A;  2XY7 A;  5ALU A;  2W03 A;  3N4M B;  2UVV A;  2KHQ A;  1S77 D;  1RYR A;  7ICF A;  2P6U A;  3LYS A;  2MRL A;  3GIM A;  4NM2 A;  3U26 A;  4XUS A;  4NJ8 A;  2XGP A;  3PY8 A;  4TQS A;  2YMM A;  1S5L U;  2GH1 A;  2KFN A;  4F2S A;  3AEV A;  5J2D A;  1LB2 B;  1NOM A;  2JMG A;  4UAR A;  1V38 A;  3CNH A;  2VA8 A;  4QZH A;  5L1J A;  2EZZ A;  4P0P A;  3V6K A;  3T79 A;  1P4E C;  3F5E A;  4DSF A;  2JH7 A;  1L3S A;  1FIQ A;  4QNL A;  3UXP A;  2WFA A;  5ALE A;  3TQ1 A;  3M1Y A;  2ATL A;  4DQI A;  3H7I A;  3RJF A;  3B0X A;  1D8B A;  5KFL A;  4C8M A;  8ICA A;  3HIL A;  3WK5 A;  1JAL A;  3RJJ A;  8ICQ A;  3QUB A;  4NLG A;  4PJ0 U;  3SAG A;  3NS1 A;  4M6W A;  9ICJ A;  2MUT A;  2K8C B;  1ZQY A;  5J8Y A;  3SYZ A;  4QZC A;  4MFC A;  1X66 A;  2JGA A;  3PX0 A;  4RQ6 A;  3Q8M A;  4M47 A;  4IR9 A;  4RQ1 A;  4QWA A;  3QU5 A;  1RYS A;  4KMO B;  7ICE A;  1JN3 A;  2KIV A;  4PL1 A;  7ICP A;  5C0Y A;  4E0J A;  2BGW A;  4GIB A;  2NRX A;  2EZY A;  4OO1 J;  3MDA A;  3IRU A;  1T7P A;  1B0X A;  3PML A;  3AU6 A;  2W3R A;  5ALD A;  2A1A A;  2D3D A;  3Q8Q B;  1H38 A;  2GLE A;  4K4H A;  4J03 A;  4ECS A;  4J9P A;  2HOF A;  3HWT A;  4C8L A;  3JPQ A;  4C7Y A;  2OM6 A;  4QIW C;  3LWL A;  1SL2 A;  4I2C A;  2L5Y A;  1XSN A;  3FDS A;  3TI0 A;  1V85 A;  4O5K A;  4B9L A;  2A1J B;  2LYA A;  1TAU A;  1PVP A;  1KFT A;  8ICH A;  2DBY A;  2KVC A;  3FC4 A;  1SV0 A;  3NAS A;  5KFS A;  1BGX T;  1JUD A;  3E2E A;  3RR7 A;  3T5H A;  1ZQV A;  3IG5 A;  4KN4 A;  1NKC A;  4EX6 A;  4UB3 A;  2ZIX A;  3GDX A;  3C5F A;  1RXV A;  3GQC A;  1NI3 A;  2OYY A;  3GIJ A;  1ZQH A;  2E8N A;  4R8U A;  2FMS A;  5FP0 A;  4DWI A;  1BPZ A;  4CF4 A;  5KAI U;  1JRO A;  5KT7 A;  3M9M B;  4Z6F A;  5J0T A;  4BWJ A;  2YMQ A;  2UVW A;  2EQY A;  3D2N A;  1PVR A;  2KD1 A;  2KZM A;  1C7Y A;  2AGO A;  1MSW D;  7ICN A;  2ZJ5 A;  4MEY A;  5CB1 A;  1ZQD A;  4EYH B;  4ELV A;  4UAT A;  4I2A A;  3QU2 A;  8ICZ A;  5DB6 A;  3WKA A;  4YXM A;  3UQ2 A;  2H3F A;  3I76 A;  3OTQ A;  3RRG A;  3NVV A;  1KKX A;  5J0W A;  1ZQA A;  1ZQG A;  5KAF U;  1TK8 A;  1HUZ A;  1DGJ A;  1M6X C;  2ZJA A;  1B22 A;  1T94 A;  4P0Q A;  3C2L A;  1UT8 A;  1X9M A;  2XCP A;  3UM9 A;  3EW9 A;  5JRT A;  4JWM A;  2CXY A;  4FS2 A;  3CW2 C;  2KK0 A;  4RQ4 A;  4NXZ A;  3OGU A;  1U4B A;  9ICN A;  4ECX A;  5HMM A;  1MQ3 A;  4B9S A;  4DQQ A;  2PKE A;  2VJ4 A;  4DL4 A;  4Y2J A;  3GZF A;  3UMB A;  1URJ A;  5KFY A;  4QWB A;  2W11 A;  2V4R A;  3E58 A;  1ED1 A;  4NLN A;  4P4M A;  3GIK A;  4LJX A;  1Z4O A;  4Z6C A;  2R8I A;  4DFM A;  4K4G A;  4C8O A;  4F4X A;  4RUC A;  1ZQR A;  4DOA A;  2ZIU A;  4KLT A;  3BS7 A;  2B0C A;  4G9B A;  1A0P A;  2W8K A;  4J9Q A;  4FZL A;  5CJ7 A;  9ICB A;  2BQR A;  2HHS A;  1Q8K A;  4NL9 A;  2E1E A;  5ALN A;  1TK5 A;  4C8N A;  5HHH A;  4DOB A;  1ZQW A;  2E8M A;  3LWM A;  2FLN A;  5AM3 A;  4YVZ A;  8ICK A;  3VC8 A;  3QU4 A;  4M9G A;  2JEI A;  2KFZ A;  2XO7 A;  4I2F A;  2RHF A;  3K1Z A;  1U45 A;  1TAQ A;  2QAR B;  2IOH A;  1UA1 A;  1WCL A;  2R8G A;  2W8L A;  4KLG A;  2IMW P;  4XA5 A;  4B9M A;  4YD2 A;  3WKB A;  1DK3 A;  7ICH A;  4EEN A;  2IHM A;  2CPR A;  2G08 A;  2BHN A;  3L5K A;  3G6Y A;  4LZG A;  4EYI B;  4PGX A;  3OJS A;  2WF9 A;  3KHR A;  2LM1 A;  3C1Y A;  5EE9 A;  2XY6 A;  1CRX A;  2G5I B;  1NZP A;  5J2J A;  4F43 A;  3BZK A;  2ODG A;  2HVH A;  2KJ9 A;  5DG7 A;  1IM4 A;  7ICK A;  1J2M A;  3ISC A;  3FM9 A;  2JRZ A;  4KLO A;  2BCS A;  3MDC A;  3O0F A;  2DKX A;  2W55 A;  2AQ4 A;  4F71 A;  2D8C A;  3FAH A;  8ICN A;  2OCE A;  5KT2 A;  4QZI A;  3KKA C;  2ZUC A;  4F3O A;  4US8 A;  2EAM A;  1TK0 A;  2LYB A;  2ASL A;  3UPQ A;  1LKY A;  5A0L A;  1LV5 A;  4QWE A;  4RQ0 A;  3FYH A;  2H3Z A;  5AI5 A;  4M2Y A;  1S8O A;  3ZDA A;  4CGZ A;  2ISO A;  1QCK A;  3ZD8 A;  2C2D A;  4R65 A;  2A3V A;  3PO5 A;  2FPK A;  5DQH A;  5CWR A;  2PI4 A;  5JU5 A;  1ECW A;  3AL0 B;  2CRX A;  2KKP A;  2GWS A;  5III A;  4B9U A;  9ICU A;  1A6S A;  1Z4N A;  5JUM A;  1ZQS A;  1JIH A;  3SQI A;  3H0R B;  4JUZ A;  1BNO A;  4GLX A;  1P4E A;  9ICI A;  4MFA A;  4I28 A;  2ZTE A;  3PSF A;  3BS5 A;  2JR5 A;  3PX4 A;  5CR0 A;  3GV7 B;  4CF3 A;  5AKX A;  4ECU A;  4DQR A;  4X5V A;  1RQN A;  4Z6E A;  3GFK B;  4Y2X A;  2OWO A;  5L9X A;  1BNP A;  8ICB A;  3V7L A;  3IDW A;  2ES6 A;  3ALR A;  8ICV A;  2W7P A;  2W54 A;  1MA7 A;  5KT6 A;  2R8H A;  1N62 A;  3UMG A;  3M7D A;  3H0L B;  1T3Q A;  5HR6 A;  3H4B A;  5J2I A;  3I1Y A;  2LPE A;  4IQT A;  1NK7 A;  4IRD A;  4DQS A;  1ZQO A;  4EBE A;  3CYM A;  4C4R A;  2HHV A;  4XQ8 A;  5AKZ A;  4TUR A;  8ICL A;  3QE9 Y;  4I2E A;  2AGP A;  4Q8F A;  2V9W A;  2NRV A;  3BQ0 A;  3PR4 A;  2KG5 A;  3R9K A;  2B21 A;  3SAF A;  1Z1B A;  2Y9U A;  4E0D A;  4F5O A;  1D8L A;  1M6Y A;  1BVS A;  2BKE A;  7ICT A;  4ED2 A;  3BQ7 A;  3RF9 A;  4Y2S A;  3TAR A;  3M9N B;  2NV3 A;  4IR1 A;  2P35 A;  1SKR A;  4KLM A;  1YZ7 A;  2EH9 A;  4Q44 A;  4YR2 A;  4QJF B;  2FI1 A;  5AIA A;  4UAY A;  3OPX A;  2C2R A;  5ALS A;  2XC9 A;  2RRD A;  2VJ5 A;  1KRP A;  3H40 A;  4BJQ A;  1XWL A;  2V6E A;  2ZXH A;  4B9V A;  4FE3 A;  2AGQ A;  3ZDE A;  5D4B A;  3RAX A;  4AYB F;  4F93 B;  4B9N A;  5KFO A;  5ALF A;  1T8E A;  2EZX A;  2W9C B;  2DF4 B;  3PR5 B;  3BQ1 A;  5ALR A;  4K4I A;  1NJZ A;  4EX7 A;  2ZXI A;  2OEH A;  3RBE A;  3JPT A;  5B66 U;  4RPX A;  2BPF A;  9ICS A;  5DGB A;  3F2C A;  3EPI A;  2W9C A;  3BQ2 A;  2FDR A;  5KG2 A;  1YT3 A;  3DV9 A;  4RQM A;  3QUC A;  3WK6 A;  3PNC A;  3WK4 A;  5KFT A;  4O3Q A;  2DUY A;  4EEL A;  2YML A;  5L1I A;  4DKS A;  8ICI A;  3KBB A;  3T5L A;  4GXI A;  2H3I A;  4MEX A;  2WF8 A;  1SL0 A;  3RJE A;  2HCF A;  8ICW A;  3C23 A;  2F1I A;  2AU0 A;  1CEZ A;  1NJY A;  3PV8 A;  1ZQQ A;  3AQF A;  4J9L A;  5KL1 B;  2KOB A;  5HNK A;  4QZD A;  1M6X A;  7ICV A;  2K4I A;  8ICS A;  2C22 A;  1ZYQ A;  1AE9 A;  4F5Q A;  4KLD A;  3QX7 A;  1NZB A;  2F2A B;  3JPR A;  4J9O A;  1KLN A;  4RNO A;  1ZQK A;  3Q8P B;  4RUA A;  3NVY A;  2JH1 A;  2FMP A;  5G5H A;  5J0S A;  1MQ2 A;  2HBL A;  1SXE A;  3NTU A;  5F3X B;  4ELT A;  4PL2 A;  3M9O B;  2HHQ A;  4YR3 A;  3SI8 A;  4DWP A;  2DWQ A;  5KFU A;  1FO4 A;  3AMZ A;  5DOR A;  1MN8 A;  3V72 A;  4I29 A;  7ICO A;  1QH9 A;  5KFC A;  1RG6 A;  3RB6 A;  3UMC A;  1ZET A;  3WKD A;  4CNQ A;  1ZD3 A;  2OXO A;  3AU2 A;  5TIS U;  1U47 A;  2YN4 A;  2BCU A;  4E0Y A;  4F5P A;  1HEK A;  3KD3 A;  5ALP A;  2DGZ A;  1NJW A;  5J0R A;  4GXJ A;  5ALQ A;  2FLP A;  3QZ7 A;  5ALY A;  3PST A;  3Q8L A;  5AHX A;  4I2H A;  2PFQ A;  1Z00 B;  2QLT A;  3MR3 A;  3C21 A;  3V7K A;  3PX6 A;  1PK1 B;  5L1K A;  3E0F A;  1D9D A;  4RQN A;  4HAI A;  1DGS A;  2XIC A;  9ICK A;  3RB0 A;  2R8K A;  1SZP A;  3C1Z A;  4F72 A;  5J0Q A;  4RZR A;  2E8O A;  1N5W A;  5E79 U;  2P66 A;  1U9L A;  2HBK A;  1OUQ A;  1ZQP A;  4YMO A;  2E5S A;  4QWD A;  2J6U A;  4UB1 A;  2ZIW B;  5ALG A;  1S0V A;  4F8R A;  4XRH A;  2JZB B;  5ALI A;  3OHA A;  4M9N A;  3HT3 A;  1KEJ A;  1XSL A;  5AKE A;  1L3T A;  5J2K A;  2G09 A;  4DL7 A;  5TZV A;  5DKW A;  1CI4 A;  4P4P A;  1L7P A;  4M04 A;  3MFI A;  2JZB A;  4PHE A;  7ICM A;  4KLQ A;  3D2S A;  4RPY A;  4M9J A;  2IHN A;  1IXR A;  1ZJM A;  2A1J A;  1WYG A;  1O08 A;  1ZQU A;  1L5U A;  1ZRN A;  3KKA A;  4Y2U A;  3PW2 A;  1OXJ A;  1KDH A;  4O5C A;  3DDH A;  4UAS A;  5EE0 A;  5JTI A;  4J9S A;  3A0B U;  3TAN A;  2KJ8 A;  2W04 A;  1NK0 A;  3H0M B;  1COK A;  2PMZ F;  2RDI A;  3NVZ A;  9ICH A;  1O03 A;  5KNI A;  2ZUB A;  1J97 A;  2A19 A;  2HBM A;  4FBU A;  1F5S A;  1AQ6 A;  1RDF A;  5AM1 A;  5KFM A;  4UW9 A;  5J2C A;  1JMS A;  1XS9 D;  1TKD A;  5DB8 A;  1Z19 A;  2BQU A;  1ZD5 A;  1DRG A;  5C5J A;  1NKE A;  1ZQX A;  2AXT U;  4KX3 A;  2QB1 A;  5AK5 A;  5BPC A;  3PMN A;  1ZQM A;  4UB4 A;  1ZQ1 C;  5EWF A;  5KT3 A;  1K1S A;  1J2N A;  4IQV A;  4YN4 A;  1DXS A;  1Z3E B;  3AM9 A;  4CRX A;  5CA7 A;  4F92 B;  8ICU A;  2G0A A;  2KKV A;  5AM0 A;  4PGY A;  4I27 A;  1KFD A;  5IIO A;  3TFR A;  1L7M A;  2B6G A;  4DO9 A;  5AKH A;  1BPX A;  1U49 A; 
#chains in the Genus database with same CATH homology
 3IG5 A;  2H3Z A;  4U6P A;  3RF9 A;  1A0P A;  2K4E A;  2W7O A;  2KNJ A;  3GU3 A;  4CGZ A;  1AE9 A;  4FZL A;  3M6Z A;  2MA1 A;  4NV0 A;  2HMX A;  2ZIX A;  2NV3 A;  3NUQ A;  1KBU A;  2A3V A;  3SMV A;  2G5H B;  2G09 A;  2F76 X;  4WJ3 B;  1XO0 A;  3SAG A;  3RFA A;  4QJF B;  2K8B B;  1NZB A;  2OYY A;  1ECW A;  3N7R C;  4P0Q B;  2E1E A;  2CN1 A;  2K8C B;  2F2A B;  3AL0 B;  3OPX A;  2WB1 F;  4JMU A;  3L3F X;  3CP8 A;  4OJ5 A;  2CRX A;  2G07 A;  2KKP A;  3SAH A;  3HKZ F;  3CRX A;  1Q3V A;  1XNS A;  5T14 A;  3D2S A;  2RRD A;  2WB1 C;  1WUD A;  3N7S C;  2VJ5 A;  4FZM A;  4NWI A;  3VC8 A;  2JGA A;  4BJQ A;  1A6S A;  2JHD A;  2LBO A;  1Q3U A;  5HR7 A;  3IP4 B;  3SQI A;  2JH1 A;  2YX8 A;  2GOL A;  3H0R B;  2RHF A;  3K1Z A;  2ZXH A;  3D2N A;  4FE3 A;  3KZX A;  1PVR A;  2KD1 A;  1P4E A;  2HBL A;  4AYB F;  2N1R A;  2YB4 A;  1GO3 F;  2HBJ A;  3PSF A;  4IC9 A;  4PL2 A;  2DF4 B;  4KMO B;  4PL1 A;  4P0P B;  3C29 A;  4CDG A;  3PSI A;  3F2D A;  5CRX A;  3AQE A;  4OJL A;  5C0Y A;  4ACO A;  1L6N A;  2ZIW A;  2KJ8 A;  3F53 A;  1AIH A;  5DOR A;  4QIW F;  2W04 A;  3VCB A;  1P7D A;  3MGV A;  2ZXI A;  2H3F A;  2HOQ A;  2WAQ F;  4OO1 J;  2H3Q A;  2DQN B;  2KHV A;  2LKY A;  2ZIV B;  2H3V A;  3H0M B;  2OH2 A;  2CPR A;  2VIX A;  2ZG6 A;  2PMZ F;  3UXU A;  2BDU A;  2YB1 A;  3HKZ C;  2WAQ C;  3F2C A;  2G08 A;  3D2Q A;  2HBM A;  1M6X C;  2K89 A;  2OXO A;  3ALR A;  2W7P A;  2Z7J A;  1YT3 A;  2ZIU B;  1T94 A;  4P0Q A;  4GFJ A;  2W03 A;  1MA7 A;  2K8A A;  5KL8 B;  2KHQ A;  2F8L A;  1UPH A;  4KX5 A;  1CRX A;  1Z19 A;  2G5I B;  2Y0S F;  5C6K A;  1HEK A;  2HOI A;  3M7D A;  5DCF A;  1DRG A;  3H0L B;  2DGZ A;  2ZIX B;  3LYS A;  2MRL A;  4AYB C;  2XI9 A;  2HOF A;  5HR6 A;  4KX3 A;  2KJ9 A;  3F2B A;  4DKS A;  3NRW A;  3PST A;  3DEE A;  3C28 A;  2XID A;  3F5A A;  4C0Z A;  2VKQ A;  3VCF A;  2GH1 A;  2H3I A;  2OM6 A;  4U7C A;  4QIW C;  2G06 A;  1ZQ1 C;  3E0F A;  3O0F A;  4NLC A;  2JMG A;  2Q4T A;  2R18 A;  4A8E A;  3KFU F;  3ONN A;  1PVQ A;  3LVV A;  1SZH A;  2XIC A;  2PMZ C;  4P0P A;  2VJ4 A;  3CYM A;  4OJ6 A;  4BUG A;  3ICX A;  3T79 A;  4CRX A;  2LYA A;  2E1F A;  2KEY A;  2M0N A;  1PVP A;  3NKH A;  1FLO A;  1P4E C;  3GZF A;  1IIP A;  2K4H A;  3M6K A;  3N7P D;  4ICA A;  1HIW A;  4BX9 C;  3F5E A;  2JH7 A;  3IG8 A;  1URJ A;  2KVC A;  3LVW A;  2ZIV A;  2G0A A;  2KKV A;  2D6F C;  3IN5 A;  2RP5 A;  4QNL A;  1ED1 A;  2Y0S C;  3AQF A;  2KIW A;  3SAF A;  3PZP A;  2F77 X;  2KIC A;  2KOB A;  2KJ5 A;  2KV2 A;  2LHT A;  2LYB A;  4FZN A;  5KL1 B;  1Z1B A;  1F44 A;  3PSP A;  2HBK A;  4NLB A;  4OJO A;  5A0L A;  1OUQ A;  2XVT A;  2E5S A;  1M6X A;  2ZIW B;  4O3M A;  2ZIU A;  4OJP A;  1D8B A;  1TAM A;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...