2A3VA

Structural basis for broad dna-specificity in integron recombination
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
319
structure length
313
Chain Sequence
GSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHSGVLSPLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad DNA-specificity in integron recombination.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Recombination
molecule keywords DNA (31-MER)
total genus 91
structure length 313
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00589 Phage_integrase Phage integrase family
A PF13495 Phage_int_SAM_4 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2a3vA01
1.10.443.10 Mainly Alpha Orthogonal Bundle hpI Integrase; Chain A Intergrase catalytic core 2a3vA02
2OXOA 2HOFA 2KHVA 1FLOA 3LYSA 2KKPA 1P4EA 3C29A 1CRXA 3UXUA 4A8EA 2KIWA 1NZBA 3NKHA 5DORA 1P4EC 2HOIA 3CRXA 4DKSA 2KJ5A 2CRXA 1AE9A 2KJ9A 2KKVA 2KHQA 1XO0A 1M6XC 1OUQA 1P7DA 1Q3VA 1Z19A 1Q3UA 2KD1A 4ACOA 3VCFA 2KEYA 3MGVA 5DCFA 5C6KA 1Z1BA 1M6XA 1MA7A 2KJ8A 3NRWA 4CRXA 1KBUA 1A0PA 1F44A 1PVRA 3C28A 1AIHA 5CRXA 1PVPA 1PVQA 1XNSA 2A3VA 1DRGA 2KOBA
chains in the Genus database with same CATH superfamily
2HOFA 1RPLA 4EENA 3AQFA 4EYHB 2GH1A 4KMUA 4I2EA 5ALDA 5EE3A 4Z6EA 4JK1A 3O0FA 3GIMA 2XGQA 3B0YA 4F5NA 3ZD9A 7ICNA 3HPOA 4OJPA 2R8GA 1CUKA 3V6KA 2OXOA 4NLCA 4KLHA 1IM4A 4RQMA 1KRPA 3PV8A 2MSNA 4US9A 2E1EA 3OSNA 4RT2A 1SZHA 2KKVA 3CP8A 2PI5A 1X6JA 2W8KA 3L3FX 4DWPA 5ALJA 2VJ5A 3G6YA 2LYHA 5KFCA 2JEGA 3UQ2A 1ZQTA 1OXJA 3OGUA 1SWVA 1RQLA 8ICJA 4BX9C 1N5WA 1F0MA 4PJ0U 1V38A 1ZETA 1JRPA 8ICYA 5J2GA 4M0AA 1QLNA 2B0CA 3MBYA 4ECVA 1WWUA 2PFPA 2RQ5A 4M9HA 3F53A 4Q44A 7ICFA 1AIHA 1BNOA 5KFIA 4C8OA 3M9NB 4Z6CA 3K4GA 2BQ3A 2Q0ZX 3MR5A 4KLDA 3HKZC 4RQ1A 2AGQA 4J03A 4KITB 2BCRA 5KFXA 4RNOA 3K75D 3ZDBA 3PX6A 3ZI4A 3BS5B 4NLZA 1L3TA 2FJ6A 2DKXA 2A1JA 4U6PA 2Y1IA 5EE0A 3NTUA 1YZ6A 2ISPA 1NI3A 4DSLA 1YT3A 2IBKA 3LWMA 3Q8PB 1NK7A 1Y88A 1L6NA 5ALVA 4NLBA 4PHAA 3H40A 4Y2TA 2I9GA 3IRUA 1Z1BA 7ICUA 1X9XA 3SAHA 4IQWA 4FO6A 2A1AA 4EZ6A 5IIIA 1TE2A 3GIJA 4QZHA 3ZDEA 2CRXA 8ICCA 1TK8A 2F76X 4UW9A 3C2KA 4OJLA 5CHGA 4RNNA 2YTUA 5J2KA 1HJPA 1X2IA 3RAQA 2LI6A 1T94A 1OW5A 4TUSA 3RB0A 2W8LA 4CF5A 4KLTA 5KNIA 5KFEA 2HHSA 4UAYA 9ICOA 3LYSA 9ICAA 3BS7A 1S77D 5J0RA 5J0OA 1WWVA 5CR0A 3NVYA 1ZQDA 3LVWA 3H8MA 3CW2C 5KG6A 4CF4A 2D6FC 8ICZA 1M6YA 1X9MA 4WJ3B 3RJJA 2IOFK 3WU2U 3JPOA 1RQNA 3JPRA 2BDPA 1K5OA 3UMBA 1JI7A 2KJ9A 3RJKA 8ICVA 1N60A 4R8UA 2YX8A 5AKZA 4ECZA 3I76A 2ES6A 5T14A 1T7PA 1XU4A 1N5XA 1PVRA 5DKWA 4KLJA 2O6KA 4PPXA 8ICHA 3M1YA 4K4GA 3HKZF 9ICVA 1N56A 4DS5A 5KFQA 4YFKA 2F8LA 4XUSA 7ICLA 2J6TA 4UAUA 4PZOA 4J9SA 2CXYA 3RB3A 1J2NA 2HMXA 3TADA 1D9FA 4G9BA 1WCNA 2ALZA 2YMMA 5L1KA 3BQ7A 2P6RA 5DG9A 9ICPA 1O08A 3H8WA 1SV0A 2FI1A 2Y0SC 4ELTA 2KOBA 3MR2A 1UT5A 1KLNA 4DEZA 5DORA 5AI0A 2LM1A 7ICEA 2QARB 5KT7A 1X40A 1X9SA 2PMZC 5DG7A 5HP4A 5ALWA 5KL8B 2BCSA 4M47A 1TAMA 2G5IB 3QE9Y 4IQTA 5ALZA 4DFJA 5A0LA 4EBDA 1Z3EB 3KKAC 1Z00A 1RDFA 3PSIA 2KN7A 5DDYA 2JH1A 5AM0A 3QUTA 5KFJA 1N61A 5J2JA 4DKSA 4Z6DA 2AXTU 2NRXA 3UXOA 4NL9C 3MC1A 3U26A 5J2FA 3TKAA 4QZEA 4JWMA 2MA1A 5ALOA 7ICRA 1B22A 5AM5A 3RJGA 4PHPA 2JEFA 1BPBA 4DL6A 3GIIA 4K4IA 4YXJA 3D2NA 2ZIVA 3SI8A 4J9RA 4M9NA 4JUZA 4YR3A 3WK9A 3SZ2A 3MR6A 1KFTA 2W03A 2OH2A 5IIMA 1COKA 1CEZA 4QWCA 3SYZA 2OCEA 4QZDA 1JXLA 2KFNA 1XWLA 4IRCA 2G09A 2UVVA 2DFLA 1SZPA 3AL0B 4DL3A 4Q45A 1J2MA 3SV4A 4MF8A 4I2FA 3GV7B 2DBYA 5DQIA 3H8JA 3WKAA 4R64A 3TARA 2HHUA 4DQIA 1NKEA 5J2IA 2FPLA 2VJ4A 4UATA 3C28A 9ICXA 3ALRA 2D8CA 1ZQOA 8ICKA 5J0YA 1NJZA 4P0PB 1S9FA 3F2CA 1QH9A 4O3RA 1HIWA 1QQ5A 1RYRA 4F4KA 2VA3A 4F5OA 1XC9A 2C2EA 1S0VA 3QEAZ 7ICQA 4M04A 4DL2A 2HW3A 1QSYA 2BPGA 5AKIA 2P35A 3KZXA 3RAXA 4RU9A 3GV8B 3NVWA 2WAQF 5ALQA 4J9NA 3WK7A 4QZCA 4KLLA 4UB5A 2BCQA 4XQ8A 4C8MA 2LMRA 4IRDA 5IIOA 5CA7A 4RQ7A 5KFBA 3RBEA 5KT4A 2AU0A 4B9TA 9ICIA 1VJ5A 5G5HA 4ZH4A 3ZDAA 2H3QA 3B9JA 5ALYA 9ICKA 5J2AA 2QB1A 3EYZA 3HX0A 2I1QA 2KEYA 1ZQWA 3PX4A 4DFDA 4J9KA 1LB2B 4EX7A 1KBUA 2EDUA 2YMQA 2HHVA 5DB6A 2WF5A 2EAMA 1SXDA 4QZ8A 2E8NA 1V9PA 1MN8A 5KFNA 2W04A 8ICNA 4DF8A 4ECTA 5IINA 2PMZF 2ZJ8A 2B21A 3QXGA 1S8OA 5J0WA 2MU2A 5HR6A 1P4EC 3JPPA 2BDUA 1L5UA 5KFPA 1U4BA 4Q43A 1AROP 5HMLA 2DPJA 1M6XC 2PFNA 4RZRA 4KLUA 2W9AA 9ICSA 1N63A 3ORYA 4BWJA 5G5GA 3Q8KA 2FPKA 5CJ7A 2WHEA 1ZQVA 3QYPA 9ICCA 5L1JA 3UPQA 4EBCA 4G3IA 2K8CB 3V6HA 5DDMA 3KHLA 4X5VA 2JHDA 1QSSA 3NVVA 3M6KA 3H4DA 7ICVA 1Q46A 1NKBA 3TFRA 4GXIA 1RZTA 9ICRA 4DQSA 3HJEA 4DOAA 3GDXA 2ZIWB 5KG3A 1NJYA 1PK3A 2XGPA 1AQ6A 3C1YA 3EWAA 4KLMA 4YG2A 4UAZA 2WFAA 5AK3A 5AK6A 1ZQMA 1FIQA 5BOLA 1DRGA 1S0NA 4DSIA 1JN3A 1SIJA 4DS4A 1NKCA 2ZUDA 3L4PA 5J2EA 4C8LA 1QTMA 2KMDA 3SEIA 7ICKA 2ZIXB 3M9MB 3BQTA 4M6WB 3TQ1A 5ALGA 4JMUA 4DL4A 5L1LA 2JZBB 3J81j 9ICMA 4JB3A 1ZD5A 5AM1A 2HBKA 3N28A 8ICFA 2ESEA 1DGSA 2PI4A 2UVWA 2AQ4A 2W55A 4O5CA 2HSZA 3JPSA 5EWEA 4O5EA 4F72A 3SAGA 9ICHA 4FE3A 1ED1A 2KZMA 3H0LB 5AI6A 2FMQA 3ETLA 1T3NA 3OPXA 4PZNA 4QZAA 2EQYA 2NRTA 4I2BA 2BQUA 4I2HA 2FDRA 4B6JA 1XSNA 1SKWA 1P7DA 2E3TA 4DSKA 1T4GA 4CF3A 3QU5A 2R8HA 4MFAA 3PO4A 2YN4A 3OSPA 4IC9A 2ZIUA 5IILA 2AQ0A 4CE6A 1A76A 4F43A 2E1FA 1UQVA 1ZQGA 4F4WA 1A77A 2XICA 2PFQA 4KLOA 5J0TA 4RQ2A 3T5HA 3PY8A 5ALRA 2ZIUB 4KTQA 2AGPA 3WK4A 4UB3A 2JEIA 2G5HB 2F8KA 4HYKA 2YB4A 5J0XA 1PVQA 2HBLA 5L1IA 1LKYA 4E0JA 2R8IA 5AK4A 3KOOA 4DLEA 1FFUA 2ZTEA 2ASJA 1B4FA 3VC8A 3OJUA 5KFZA 3MGVA 3FYHA 2GWSA 2NO4A 2ZIWA 2BCVA 2W7OA 4RQ0A 3KHHA 2KP7A 1T3QA 5E79U 5DQHA 1PZNA 1KQQA 5HHIA 2VA8A 4RQNA 5AI8A 2L5YA 3NASA 4C80A 5CEHA 4BJQA 5KFVA 2KHQA 2QB0A 1SKSA 5HMMA 5C5JA 2GOLA 4E0ZA 1SV4A 4O5KA 1QQ6A 1L7OA 1FFVA 2UVUA 5AKYA 3T5LA 5KFUA 4FZNA 4P4MA 3BJYA 4O3SA 5C0YA 3K1RB 3IM1A 2P6UA 1TAQA 4EEYA 5ALMA 5J2BA 5KFHA 1CRXA 2XCPA 3KBBA 3JPTA 2K89A 3QZ8A 4UB8U 1BPDA 1JUDA 4YR2A 2HCFA 5KAFU 1ZQAA 5ALLA 2BR0A 1JXEA 4I2JA 4Y2UA 4QZGA 5AKHA 8ICEA 4FBUA 1XSLA 2KVCA 3SR6A 2OWOA 4I2IA 3BZCA 2ZIXA 4Y2PA 3HW8A 3F5AA 4B9LA 1N62A 2KK0A 3WK5A 1RYUA 2ODGA 3H4BA 3WKCA 1ZQEA 5TZVA 4ED7A 1U49A 3H8SA 2Y9TA 4F41A 8ICLA 4R8UB 3TFSA 3EPGA 2ZXIA 2XY6A 1NZPA 2VA2A 4RPZA 3SQIA 4QW9A 1ZD3A 5CWRA 4QZIA 4PHDA 2FE9A 3PO5A 5AKJA 3ZD8A 5KTQA 1UA1A 3NRWA 3QNMA 4I28A 5J2DA 4B9SA 4ELVA 2EAOA 4OO1J 3E58A 3RF9A 2WTFA 4UB6U 8ICBA 1L3UA 1X66A 4EELA 4P0PA 4M9LA 4R66A 1ZQYA 1Z4NA 1ZQCA 4DOBA 5J0SA 1XO1A 1QCKA 9ICNA 3PSPA 1Z4OA 2N1RA 1K1SA 2F44A 4ECSA 2W54A 3ONNA 4QWDA 2XO7A 1TAUA 4MHVA 2F1HA 4A8EA 3TI0A 3NUQA 4IS7A 4NLGA 5ALNA 9ICFA 4QZ9A 3PR5B 1Q3VA 3DDHA 2PFOA 3H0MB 4AYBF 1J97A 4YMNA 2LKYA 2KZZA 5FP0A 3PNCA 2Y1JA 2IMWP 5ALFA 8ICAA 3PMLA 3JPQA 5DCFA 3QX7A 4Y2RA 2ISOA 3RTVA 5KL1B 1NK9A 2ZTCA 2FLLA 5KG0A 9ICUA 2DKZA 3M7DA 4ECYA 1SL0A 8ICQA 9ICBA 2ASDA 5EWFA 4DFKA 3F2BA 1UHUA 1RXWA 2VKQA 2F1JA 2KE7A 3AU6A 1U48A 4DSEA 2F77X 2IOFA 1SL1A 4XRHA 4F5RA 3MFIA 3GFKB 3PW5A 8ICGA 4CNQA 1PVPA 3PSTA 3PW2A 2ZUBA 4AYBC 1VDVA 2JGAA 1L7NA 2C22A 1SWWA 2JXJA 4I2CA 2LYBA 4ED6A 2KVSA 3BQ0A 3TAQA 4FBTA 1ZYQA 3C21A 1TV9A 1ZD2P 3VCBA 2HHQA 4MF2A 2K4PA 3MFHA 4B9VA 4O3NA 5ALKA 5EE1A 3T3FA 3NVZA 2Z7JA 4DWIA 2BKEA 2ZJAA 3N97B 3Q8QB 5HNKA 2M9NA 3M6ZA 3M8SA 2FMSA 1NJXA 2KTQA 4C4SA 4IQUA 2KD1A 4EX6A 5DBBA 2AJQA 2ZXHA 1NK5A 3TACB 5J0QA 3T5KA 2FLPA 3G6XA 3AU2A 5KG2A 5B66U 2C2RA 4M9GA 5KFFA 1ZJMA 5DQGA 4KX3A 3WK8A 5DLGA 2KFZA 7ICOA 2KNJA 2WF8A 3AN1A 5EOZA 4UB4A 2W43A 2HHTA 4OJOA 2F3NA 4RQ5A 4DSJA 4UQGA 1IXRA 3C2MA 4FZLA 9ICLA 4NJ8A 3A0BU 3IG5A 3GZFA 1NK8A 3RH4A 3QZ7A 3WK6A 4TQRA 3RH6A 4Y2YA 4DOCA 3IP4B 3UMGA 2E8MA 4RUCA 4RUAA 2RRDA 3B0XA 4J9MA 3SMVA 2XY5A 2LHTA 3UM9A 1RM6C 1Z19A 1Z00B 2DGZA 4C7YA 1V97A 4IL6U 2A1JB 7ICSA 2HDOA 2A19A 4F71A 4QNLA 2BCUA 4KLEA 3IHQB 2K4IA 3PVXA 4UBCA 1IIPA 1NNLA 4YN4A 3ZDDA 5AI4A 4RQ4A 4BXOB 2I6XA 4EBEA 1ECWA 1DXSA 3PW0A 1KEJA 2WB1C 4JV1A 5GTIU 3GU3A 3LK9A 2V9WA 5DB9A 1BNPA 4ED0A 2QB0B 4DSFA 3ETRA 4IQVA 5AIBA 5B5EU 2OYYA 5AI5A 4NY8A 1AE9A 1ZQRA 4F2SA 3MGHA 2XCAA 1SL2A 4OJ5A 1XS9D 2AHOB 5ALEA 2FLNA 2JRZA 1B43A 4C4TA 4TUPA 2HHXA 1L8LA 3N7RC 4QWEA 4QZFA 2YMPA 4PHEA 3UXNA 2I5HA 5KT6A 3C5GA 4ED3A 4QWAA 1ZQLA 2H3VA 5AM2A 4RQ3A 2NYVA 1RG6A 4E0GA 2ZTDA 4J9PA 5CRXA 4YQWA 2BPFA 2HVHA 2HBMA 1Q8KA 1DK2A 1FLOA 3V7KA 1NZBA 2MUTB 5KFWA 4DQPA 4YMMA 4J9OA 5F9LA 2W9BB 5KG7A 4GLXA 5EWGA 1ZOLA 4F5QA 3EW9A 5AKEA 2Y9UA 4BDPA 4CRXA 1ZQQA 2W9CA 4ED2A 3KFUF 2MUTA 1LVHA 1COOA 2EZYA 4F2RA 5DBCA 3Q8RB 2KIWA 4P4OA 3AQEA 2CN1A 3CRXA 4YD1A 2P66A 1IG6A 3L5KA 4FS1A 4YVZA 5KG4A 2JR5A 5D4BA 2HBJA 1BPEA 2VANA 4R63A 5L9XA 2A3VA 4Z6FA 4ICAA 2W9BA 4QIWF 5KFYA 4UAVA 5KFRA 2PKEA 4E0YA 4IR9A 4E0PA 4MFFA 1MSWD 2KZ3A 2YB1A 3A0HU 1Q3UA 2J6SA 3G6VA 3EZ5A 4IR1A 3H7IA 1N2XA 4KMOB 2MAXA 3AUOA 4Y2SA 1NK4A 5F3XB 2RDJA 1JIHA 2KIVA 1JX4A 2JEJA 3ED5A 1U9LA 3F5EA 2C2DA 3WKBA 5DB8A 4FFDA 2WF9A 1QSLA 4YR0A 1A0PA 1BPXA 3HILA 3PZPA 4YD2A 2LPEA 3C23A 3GIKA 5KT5A 3SENA 7ICMA 3IN5A 4O0IA 2OEHA 1SGGA 1M6XA 3MR3A 3RR7A 4KLSA 1N48A 4F93B 1P4EA 1JMSA 1D9DA 3NKHA 5DB7A 2KSOA 3UXPA 4Y2JA 1S97A 2ZIVB 3FC4A 9ICTA 2KJ5A 3NGDA 5AHXA 1TK0A 3PMNA 4KN4A 4UB1A 3N7PD 4I2GA 5KFTA 3HT3A 1SKRA 2K4EA 4EYIB 4PH5A 4F50A 5J0UA 2LM4A 4ECXA 4NV0A 1ZQFA 1V85A 3PW7A 3KD3A 5AICA 4AP9A 4CGZA 2RP5A 5KG5A 2ZG6A 2WF7A 2HHWA 3JPNA 4HAIA 2BGWA 4DCCA 2V6EA 2EH9A 3IG8A 3BQ2A 4RT3A 5AKGA 5AM3A 4U7CA 5BPCA 4DQQA 3N7SC 4EEKA 2BHNA 2QARA 4NL9A 4USAA 1ZJNA 1K1QA 2DQNB 3LWLA 1ZQJA 3ISBA 3C5FA 2IHNA 2LBOA 2DPIA 1LKYB 3AMZA 3RRHA 3THVA 4DFPA 4FS2A 4DFMA 3KKAA 4NM1A 3FDSA 4C8NA 4F4ZA 4ECUA 4GFJA 3IV6A 5D46A 1F44A 4DO9A 5CB1A 8ICPA 1ZQZA 4Y2XA 4CDGA 4ED1A 4ZOHC 1HUZA 2ASLA 4XA5A 3BS5A 3RJIA 2FPMA 5J8YC 1NK0A 8ICTA 2GLEA 2D3DA 5GTHU 1CI4A 4JV2A 2R8JA 1SV0C 7ICIA 3EUB2 5C6KA 3WKDA 1WG8A 2EANA 4YXMA 1RXVA 3M9OB 2IOHA 3SD7A 1ZQHA 3QU2A 3DV9A 3TADC 1RYSA 3RJEA 5ALHA 4E10A 4BGDA 5KAIU 3MDCA 1QQ7A 3RBDA 4C7ZA 1BGXT 4LJXA 3PSFA 2BQRA 3T79A 2E8OA 1VLBA 1S0MA 4P0QB 4NWIA 2NV3A 1ZQBA 8ICIA 5ALPA 4OD0A 4PL1A 3KZIU 4P4PA 3RFAA 3D6JA 5AIAA 4ELUA 2XIDA 3TAPA 4JV0A 3IDWA 4GC7A 1L3SA 4PL2A 1ZQIA 3E2EA 2OHFA 8ICXA 3PR4A 3PW4A 2AH5A 3UMCA 1F5SA 2V4QA 3C29A 4F4XA 4GC6A 1LV5A 2HOIA 1L7MA 3N4MB 5AKXA 4RPYA 5ALSA 4F8RA 5K4LA 4O3OA 3OHAA 2FMPA 5L1MA 4K4HA 1B0XA 2DF4B 4M6WA 5JU5A 3RJHA 1XNSA 2ATLA 5BOMA 3T5JA 3RB6A 3UXUA 3DEEA 1TFRA 4EZ9A 1ZQSA 1WCLA 1KDHA 2E8PA 3LVVA 4DF4A 5AKLA 3CYMA 1SXEA 2W3SA 3KTQA 2WB1F 9ICEA 4ED8A 4YMOA 4RPXA 2YY6A 5KT2A 3QUCA 2WAQC 5AK5A 4YP3A 3K1ZA 1KFSA 5KFLA 5F9NA 4J9LA 3MGIA 3M8RA 4UBBA 4FZMA 4ECQA 3EPIA 1PK1A 5J0PA 1YZ7A 4QWBA 5ALXA 1TK5A 2B6GA 4ECRA 5H2FU 4F4YA 2R18A 2DWQA 1ZQ1C 3QU7A 1MQ3A 4DQRA 4GXKA 1KW4A 5TISU 5J2CA 5KG1A 4TURA 8ICOA 3H0RB 4MEXA 2RDIA 3RJFA 2YMLA 5DBAA 3QEBZ 1U47A 4C4RA 1UT8A 4P2HA 3OHBA 1JALA 1S5LU 3QUBA 4E0DA 2H3FA 4O3QA 4UB2A 3BQ1A 2NRWA 8ICSA 1NJWA 2YQEA 4KN7A 4OJ6A 4ECWA 1ZQUA 3V6JA 4BUGA 3C1ZA 2XC9A 2XY7A 2KV2A 1ZQXA 4RNMA 4LZGA 4C8KA 1PUZA 2XVTA 5DLFA 1BPZA 1ZD4A 5KT3A 1S10A 1UCVA 4I2AA 1FEZA 4I27A 1KTQA 1DOQA 2RLTA 1NK6A 2K8BB 1BPYA 2KKPA 1MC8A 2RHFA 3GILA 5KFSA 2DL0A 4C0ZA 4UAWA 1WUDA 1KN5A 1X6IA 1GO3F 3Q8LA 1MA7A 4NM2A 4RQ6A 1SB3C 2H3ZA 4KLIA 3E0FA 3Q8MA 2JH7A 1EXNA 1D8YA 2G08A 1X42A 2VIXA 2JMGA 2W3RA 3HRDD 5IIKA 4QIWC 2ZJ5A 5CP2A 3R9KA 3ISDA 5J29A 1U45A 1JROA 8ICWA 4P0QA 1XO0A 5ALIA 3MABA 5KFOA 3RRGA 2W7PA 4B9NA 5J8YA 4Q8FA 3C2LA 2MRLA 1C20A 2JV3A 4NLNA 4QW8A 1URJA 5EE9A 1TKDA 1UPHA 1IV8A 3BDPA 4J9QA 5ALUA 5JUMA 4QZBA 1KSPA 2E5SA 4R65A 1S76D 4UARA 3BZKA 5ALTA 5KFDA 5D49A 3WKEA 4TUQA 4Y2QA 2ZUCA 5HHHA 7ICJA 3KHGA 5DGBA 4DLGA 3Q8SB 3OJSA 3F2DA 2KHVA 4O9MA 1ZQKA 3RB4A 5JRTA 2Q4TA 1ZQPA 3KHRA 2IA6A 9ICJA 3SAFA 3QUQA 2R8KA 3I28A 5J2HA 4F91B 5AKKA 2K8AA 1HEKA 4KX5A 4MEYA 2QLTA 5JTIA 2AGOA 1TVAA 4TQSA 4F3OA 1L8OA 2G06A 3ZDCA 4B9MA 7ICGA 4DL7A 5AI9A 3D2QA 3QU9A 2JZBA 3V72A 2HVIA 5KFMA 2W9CB 2M0NA 1S0OA 1ZRMA 2HOQA 3UQ0A 4O3MA 4KLQA 1D8BA 1ZXIA 4CCHA 9ICWA 8ICRA 9ICQA 2Y0SF 3HP6A 1WYGA 1O03A 2H5XA 4BWMA 1ZQNA 2GO7A 3SV3A 2G07A 8ICUA 4NXZA 2W11A 4JWNA 2KICA 2KG5A 2HI0A 1HUOA 1KL9A 4F92B 2EZXA 4KLGA 3OTQA 1T8EA 3RH5A 4I29A 3GQCA 8ICMA 4M9JA 4KLFA 2CPRA 3MDAA 7ICPA 1BVSA 2G0AA 4ACOA 3VCFA 2XI9A 1D8LA 4QJFB 2EZZA 3QU4A 4M2YA 4YCXA 1L3VA 4PGXA 3LDAA 3GV5B 4RQ8A 4GIBA 2K60A 5KFKA 5DGAA 4OCZA 5KFGA 2K4HA 4LVSA 3ISCA 4NLKA 2W9MA 3S6JA 1MQ2A 2IHMA 4F5PA 1DGJA 5DG8A 4DL5A 1NOMA 3AM9A 1X9WA 3NRZA 4I2DA 2BPCA 7ICTA 1XSPA 3ICXA 9ICGA 4BXOA 2UVRA 1UA0A 2OM6A 1A6SA 2F2AB 5KFAA 2PXIA 2WF6A 3D2SA 1DK3A 5IIJA 3AEVA 4O3PA 4IRKA 2NO5A 1OUQA 3V7LA 3TANA 2V4RA 1H38A 5HR7A 1C7YA 4B9UA 2H3IA 1KFDA 2KJ8A 3RR8A 2C28A 3I1YA 2NRVA 4GXJA 1FO4A 4LZDA 2NRZA 2F1IA 2KSOB 4UASA 4PGYA 3FAHA 3FM9A 4Q8EA 5AM4A 4MFCA 7ICHA 2DUYA 4PGQA 3HWTA 1ZRNA 1Z1VA 2QKQA 1L7PA 3NS1A 3PX0A 2J6UA 1PK1B 2LYAA 3V7JA 2EAPA 4US8A 4Y2VA 3CNHA 2BZFA 1KKXA
chains in the Genus database with same CATH topology
2HOFA 2Z7JA 2HBKA 3RF9A 3AL0B 1P4EA 3AQFA 2K4IA 4U6PA 2KIWA 2W04A 2F8LA 3NKHA 4P0PA 2GH1A 3AQEA 2CN1A 1IIPA 2E5SA 2ZIVB 3H0RB 3M6ZA 2KJ5A 3CRXA 4BJQA 2CPRA 2HMXA 2KHQA 1YT3A 3PSFA 3T79A 2PMZF 1L6NA 2G0AA 2KD1A 3SAGA 4ACOA 3VCFA 4P0QB 3O0FA 2GOLA 4NLBA 4FE3A 4NWIA 1ED1A 2NV3A 2HBJA 2XI9A 1Z1BA 3H0LB 1ECWA 2ZXHA 3N7PD 4QJFB 3SAHA 2K4EA 2WB1C 3PSPA 4OJPA 4PL1A 2VJ4A 3RFAA 4FZNA 5HR6A 3C28A 2N1RA 3GU3A 3OPXA 3ALRA 2XIDA 5C0YA 2H3FA 2Y0SC 3ONNA 4PL2A 2A3VA 1P4EC 2BDUA 2KOBA 4ICAA 2OXOA 3F2DA 2KHVA 4P0PB 3F2CA 4QIWF 4NLCA 3C29A 1CRXA 4NV0A 4OJ6A 4A8EA 5DORA 2K4HA 3NUQA 2K89A 1HIWA 2HOIA 2E1EA 4BUGA 2CRXA 2OYYA 1AE9A 1SZHA 2KV2A 2YB1A 2KKVA 4CGZA 2F76X 1M6XC 2Q4TA 2RP5A 2PMZC 3CP8A 4OJ5A 4OJLA 1Q3VA 1P7DA 4KX3A 1Q3UA 2ZG6A 3SAFA 3H0MB 3L3FX 5KL8B 4AYBF 2VJ5A 1TAMA 2XVTA 2G5IB 4IC9A 2LKYA 1T94A 2ZIUA 3ICXA 2K8AA 2KVCA 1HEKA 2DF4B 2KNJA 3IG8A 2K8CB 3N7RC 4KX5A 5A0LA 4KMOB 4U7CA 5DCFA 1XNSA 2JHDA 3N7SC 2E1FA 2K8BB 2OM6A 3KZXA 3LYSA 2KKPA 2ZIXA 2DQNB 3M6KA 2JH1A 3PSIA 4OJOA 2RHFA 3F5AA 5KL1B 1A6SA 2F2AB 2LBOA 4BX9C 3M7DA 3DEEA 3UXUA 2XICA 4DKSA 4FZLA 4C0ZA 2G06A 3D2SA 1WUDA 3D2QA 3F5EA 3IG5A 3LVWA 3LVVA 1OUQA 2WAQF 3GZFA 2D6FC 3F2BA 3CYMA 5HR7A 2ZIUB 2H3VA 2VKQA 2ZIWB 2MA1A 1AIHA 2H3IA 3F53A 1GO3F 2M0NA 1MA7A 4WJ3B 4GFJA 2KJ8A 2F77X 2WB1F 2H3ZA 2HOQA 1A0PA 2G5HB 1F44A 4O3MA 3E0FA 1D8BA 2YB4A 2JH7A 3PZPA 5CRXA 3IP4B 4CDGA 2G08A 1PVQA 2ZXIA 2VIXA 2JMGA 1DRGA 2HBMA 2Y0SF 2HBLA 2WAQC 3D2NA 2ZIVA 3PSTA 4QIWC 1PVPA 1FLOA 3SQIA 3K1ZA 4AYBC 2RRDA 2JGAA 3IN5A 1NZBA 2H3QA 2LYBA 4FZMA 2G07A 2KJ9A 3SMVA 3HKZC 2ZIXB 4P0QA 2LHTA 1XO0A 3VC8A 1Z19A 2KICA 2KEYA 2W7PA 2W03A 3MGVA 2DGZA 2OH2A 2YX8A 3VCBA 4JMUA 5C6KA 1M6XA 2LYAA 2ZIWA 3NRWA 2MRLA 2W7OA 4CRXA 5T14A 1KBUA 2R18A 1PVRA 1ZQ1C 4QNLA 1URJA 3HKZF 3KFUF 2G09A 1UPHA 4OO1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OXO A;  2HOF A;  2KHV A;  1FLO A;  3LYS A;  2KKP A;  1P4E A;  3C29 A;  1CRX A;  3UXU A;  4A8E A;  2KIW A;  1NZB A;  3NKH A;  5DOR A;  1P4E C;  2HOI A;  3CRX A;  4DKS A;  2KJ5 A;  2CRX A;  1AE9 A;  2KJ9 A;  2KKV A;  2KHQ A;  1XO0 A;  1M6X C;  1OUQ A;  1P7D A;  1Q3V A;  1Z19 A;  1Q3U A;  2KD1 A;  4ACO A;  3VCF A;  2KEY A;  3MGV A;  5DCF A;  5C6K A;  1Z1B A;  1M6X A;  1MA7 A;  2KJ8 A;  3NRW A;  4CRX A;  1KBU A;  1A0P A;  1F44 A;  1PVR A;  3C28 A;  1AIH A;  5CRX A;  1PVP A;  1PVQ A;  1XNS A;  2A3V A;  1DRG A;  2KOB A; 
#chains in the Genus database with same CATH topology
 2HOF A;  1RPL A;  4EEN A;  3AQF A;  4EYH B;  2GH1 A;  4KMU A;  4I2E A;  5ALD A;  5EE3 A;  4Z6E A;  4JK1 A;  3O0F A;  3GIM A;  2XGQ A;  3B0Y A;  4F5N A;  3ZD9 A;  7ICN A;  3HPO A;  4OJP A;  2R8G A;  1CUK A;  3V6K A;  2OXO A;  4NLC A;  4KLH A;  1IM4 A;  4RQM A;  1KRP A;  3PV8 A;  2MSN A;  4US9 A;  2E1E A;  3OSN A;  4RT2 A;  1SZH A;  2KKV A;  3CP8 A;  2PI5 A;  1X6J A;  2W8K A;  3L3F X;  4DWP A;  5ALJ A;  2VJ5 A;  3G6Y A;  2LYH A;  5KFC A;  2JEG A;  3UQ2 A;  1ZQT A;  1OXJ A;  3OGU A;  1SWV A;  1RQL A;  8ICJ A;  4BX9 C;  1N5W A;  1F0M A;  4PJ0 U;  1V38 A;  1ZET A;  1JRP A;  8ICY A;  5J2G A;  4M0A A;  1QLN A;  2B0C A;  3MBY A;  4ECV A;  1WWU A;  2PFP A;  2RQ5 A;  4M9H A;  3F53 A;  4Q44 A;  7ICF A;  1AIH A;  1BNO A;  5KFI A;  4C8O A;  3M9N B;  4Z6C A;  3K4G A;  2BQ3 A;  2Q0Z X;  3MR5 A;  4KLD A;  3HKZ C;  4RQ1 A;  2AGQ A;  4J03 A;  4KIT B;  2BCR A;  5KFX A;  4RNO A;  3K75 D;  3ZDB A;  3PX6 A;  3ZI4 A;  3BS5 B;  4NLZ A;  1L3T A;  2FJ6 A;  2DKX A;  2A1J A;  4U6P A;  2Y1I A;  5EE0 A;  3NTU A;  1YZ6 A;  2ISP A;  1NI3 A;  4DSL A;  1YT3 A;  2IBK A;  3LWM A;  3Q8P B;  1NK7 A;  1Y88 A;  1L6N A;  5ALV A;  4NLB A;  4PHA A;  3H40 A;  4Y2T A;  2I9G A;  3IRU A;  1Z1B A;  7ICU A;  1X9X A;  3SAH A;  4IQW A;  4FO6 A;  2A1A A;  4EZ6 A;  5III A;  1TE2 A;  3GIJ A;  4QZH A;  3ZDE A;  2CRX A;  8ICC A;  1TK8 A;  2F76 X;  4UW9 A;  3C2K A;  4OJL A;  5CHG A;  4RNN A;  2YTU A;  5J2K A;  1HJP A;  1X2I A;  3RAQ A;  2LI6 A;  1T94 A;  1OW5 A;  4TUS A;  3RB0 A;  2W8L A;  4CF5 A;  4KLT A;  5KNI A;  5KFE A;  2HHS A;  4UAY A;  9ICO A;  3LYS A;  9ICA A;  3BS7 A;  1S77 D;  5J0R A;  5J0O A;  1WWV A;  5CR0 A;  3NVY A;  1ZQD A;  3LVW A;  3H8M A;  3CW2 C;  5KG6 A;  4CF4 A;  2D6F C;  8ICZ A;  1M6Y A;  1X9M A;  4WJ3 B;  3RJJ A;  2IOF K;  3WU2 U;  3JPO A;  1RQN A;  3JPR A;  2BDP A;  1K5O A;  3UMB A;  1JI7 A;  2KJ9 A;  3RJK A;  8ICV A;  1N60 A;  4R8U A;  2YX8 A;  5AKZ A;  4ECZ A;  3I76 A;  2ES6 A;  5T14 A;  1T7P A;  1XU4 A;  1N5X A;  1PVR A;  5DKW A;  4KLJ A;  2O6K A;  4PPX A;  8ICH A;  3M1Y A;  4K4G A;  3HKZ F;  9ICV A;  1N56 A;  4DS5 A;  5KFQ A;  4YFK A;  2F8L A;  4XUS A;  7ICL A;  2J6T A;  4UAU A;  4PZO A;  4J9S A;  2CXY A;  3RB3 A;  1J2N A;  2HMX A;  3TAD A;  1D9F A;  4G9B A;  1WCN A;  2ALZ A;  2YMM A;  5L1K A;  3BQ7 A;  2P6R A;  5DG9 A;  9ICP A;  1O08 A;  3H8W A;  1SV0 A;  2FI1 A;  2Y0S C;  4ELT A;  2KOB A;  3MR2 A;  1UT5 A;  1KLN A;  4DEZ A;  5DOR A;  5AI0 A;  2LM1 A;  7ICE A;  2QAR B;  5KT7 A;  1X40 A;  1X9S A;  2PMZ C;  5DG7 A;  5HP4 A;  5ALW A;  5KL8 B;  2BCS A;  4M47 A;  1TAM A;  2G5I B;  3QE9 Y;  4IQT A;  5ALZ A;  4DFJ A;  5A0L A;  4EBD A;  1Z3E B;  3KKA C;  1Z00 A;  1RDF A;  3PSI A;  2KN7 A;  5DDY A;  2JH1 A;  5AM0 A;  3QUT A;  5KFJ A;  1N61 A;  5J2J A;  4DKS A;  4Z6D A;  2AXT U;  2NRX A;  3UXO A;  4NL9 C;  3MC1 A;  3U26 A;  5J2F A;  3TKA A;  4QZE A;  4JWM A;  2MA1 A;  5ALO A;  7ICR A;  1B22 A;  5AM5 A;  3RJG A;  4PHP A;  2JEF A;  1BPB A;  4DL6 A;  3GII A;  4K4I A;  4YXJ A;  3D2N A;  2ZIV A;  3SI8 A;  4J9R A;  4M9N A;  4JUZ A;  4YR3 A;  3WK9 A;  3SZ2 A;  3MR6 A;  1KFT A;  2W03 A;  2OH2 A;  5IIM A;  1COK A;  1CEZ A;  4QWC A;  3SYZ A;  2OCE A;  4QZD A;  1JXL A;  2KFN A;  1XWL A;  4IRC A;  2G09 A;  2UVV A;  2DFL A;  1SZP A;  3AL0 B;  4DL3 A;  4Q45 A;  1J2M A;  3SV4 A;  4MF8 A;  4I2F A;  3GV7 B;  2DBY A;  5DQI A;  3H8J A;  3WKA A;  4R64 A;  3TAR A;  2HHU A;  4DQI A;  1NKE A;  5J2I A;  2FPL A;  2VJ4 A;  4UAT A;  3C28 A;  9ICX A;  3ALR A;  2D8C A;  1ZQO A;  8ICK A;  5J0Y A;  1NJZ A;  4P0P B;  1S9F A;  3F2C A;  1QH9 A;  4O3R A;  1HIW A;  1QQ5 A;  1RYR A;  4F4K A;  2VA3 A;  4F5O A;  1XC9 A;  2C2E A;  1S0V A;  3QEA Z;  7ICQ A;  4M04 A;  4DL2 A;  2HW3 A;  1QSY A;  2BPG A;  5AKI A;  2P35 A;  3KZX A;  3RAX A;  4RU9 A;  3GV8 B;  3NVW A;  2WAQ F;  5ALQ A;  4J9N A;  3WK7 A;  4QZC A;  4KLL A;  4UB5 A;  2BCQ A;  4XQ8 A;  4C8M A;  2LMR A;  4IRD A;  5IIO A;  5CA7 A;  4RQ7 A;  5KFB A;  3RBE A;  5KT4 A;  2AU0 A;  4B9T A;  9ICI A;  1VJ5 A;  5G5H A;  4ZH4 A;  3ZDA A;  2H3Q A;  3B9J A;  5ALY A;  9ICK A;  5J2A A;  2QB1 A;  3EYZ A;  3HX0 A;  2I1Q A;  2KEY A;  1ZQW A;  3PX4 A;  4DFD A;  4J9K A;  1LB2 B;  4EX7 A;  1KBU A;  2EDU A;  2YMQ A;  2HHV A;  5DB6 A;  2WF5 A;  2EAM A;  1SXD A;  4QZ8 A;  2E8N A;  1V9P A;  1MN8 A;  5KFN A;  2W04 A;  8ICN A;  4DF8 A;  4ECT A;  5IIN A;  2PMZ F;  2ZJ8 A;  2B21 A;  3QXG A;  1S8O A;  5J0W A;  2MU2 A;  5HR6 A;  1P4E C;  3JPP A;  2BDU A;  1L5U A;  5KFP A;  1U4B A;  4Q43 A;  1ARO P;  5HML A;  2DPJ A;  1M6X C;  2PFN A;  4RZR A;  4KLU A;  2W9A A;  9ICS A;  1N63 A;  3ORY A;  4BWJ A;  5G5G A;  3Q8K A;  2FPK A;  5CJ7 A;  2WHE A;  1ZQV A;  3QYP A;  9ICC A;  5L1J A;  3UPQ A;  4EBC A;  4G3I A;  2K8C B;  3V6H A;  5DDM A;  3KHL A;  4X5V A;  2JHD A;  1QSS A;  3NVV A;  3M6K A;  3H4D A;  7ICV A;  1Q46 A;  1NKB A;  3TFR A;  4GXI A;  1RZT A;  9ICR A;  4DQS A;  3HJE A;  4DOA A;  3GDX A;  2ZIW B;  5KG3 A;  1NJY A;  1PK3 A;  2XGP A;  1AQ6 A;  3C1Y A;  3EWA A;  4KLM A;  4YG2 A;  4UAZ A;  2WFA A;  5AK3 A;  5AK6 A;  1ZQM A;  1FIQ A;  5BOL A;  1DRG A;  1S0N A;  4DSI A;  1JN3 A;  1SIJ A;  4DS4 A;  1NKC A;  2ZUD A;  3L4P A;  5J2E A;  4C8L A;  1QTM A;  2KMD A;  3SEI A;  7ICK A;  2ZIX B;  3M9M B;  3BQT A;  4M6W B;  3TQ1 A;  5ALG A;  4JMU A;  4DL4 A;  5L1L A;  2JZB B;  3J81 j;  9ICM A;  4JB3 A;  1ZD5 A;  5AM1 A;  2HBK A;  3N28 A;  8ICF A;  2ESE A;  1DGS A;  2PI4 A;  2UVW A;  2AQ4 A;  2W55 A;  4O5C A;  2HSZ A;  3JPS A;  5EWE A;  4O5E A;  4F72 A;  3SAG A;  9ICH A;  4FE3 A;  1ED1 A;  2KZM A;  3H0L B;  5AI6 A;  2FMQ A;  3ETL A;  1T3N A;  3OPX A;  4PZN A;  4QZA A;  2EQY A;  2NRT A;  4I2B A;  2BQU A;  4I2H A;  2FDR A;  4B6J A;  1XSN A;  1SKW A;  1P7D A;  2E3T A;  4DSK A;  1T4G A;  4CF3 A;  3QU5 A;  2R8H A;  4MFA A;  3PO4 A;  2YN4 A;  3OSP A;  4IC9 A;  2ZIU A;  5IIL A;  2AQ0 A;  4CE6 A;  1A76 A;  4F43 A;  2E1F A;  1UQV A;  1ZQG A;  4F4W A;  1A77 A;  2XIC A;  2PFQ A;  4KLO A;  5J0T A;  4RQ2 A;  3T5H A;  3PY8 A;  5ALR A;  2ZIU B;  4KTQ A;  2AGP A;  3WK4 A;  4UB3 A;  2JEI A;  2G5H B;  2F8K A;  4HYK A;  2YB4 A;  5J0X A;  1PVQ A;  2HBL A;  5L1I A;  1LKY A;  4E0J A;  2R8I A;  5AK4 A;  3KOO A;  4DLE A;  1FFU A;  2ZTE A;  2ASJ A;  1B4F A;  3VC8 A;  3OJU A;  5KFZ A;  3MGV A;  3FYH A;  2GWS A;  2NO4 A;  2ZIW A;  2BCV A;  2W7O A;  4RQ0 A;  3KHH A;  2KP7 A;  1T3Q A;  5E79 U;  5DQH A;  1PZN A;  1KQQ A;  5HHI A;  2VA8 A;  4RQN A;  5AI8 A;  2L5Y A;  3NAS A;  4C80 A;  5CEH A;  4BJQ A;  5KFV A;  2KHQ A;  2QB0 A;  1SKS A;  5HMM A;  5C5J A;  2GOL A;  4E0Z A;  1SV4 A;  4O5K A;  1QQ6 A;  1L7O A;  1FFV A;  2UVU A;  5AKY A;  3T5L A;  5KFU A;  4FZN A;  4P4M A;  3BJY A;  4O3S A;  5C0Y A;  3K1R B;  3IM1 A;  2P6U A;  1TAQ A;  4EEY A;  5ALM A;  5J2B A;  5KFH A;  1CRX A;  2XCP A;  3KBB A;  3JPT A;  2K89 A;  3QZ8 A;  4UB8 U;  1BPD A;  1JUD A;  4YR2 A;  2HCF A;  5KAF U;  1ZQA A;  5ALL A;  2BR0 A;  1JXE A;  4I2J A;  4Y2U A;  4QZG A;  5AKH A;  8ICE A;  4FBU A;  1XSL A;  2KVC A;  3SR6 A;  2OWO A;  4I2I A;  3BZC A;  2ZIX A;  4Y2P A;  3HW8 A;  3F5A A;  4B9L A;  1N62 A;  2KK0 A;  3WK5 A;  1RYU A;  2ODG A;  3H4B A;  3WKC A;  1ZQE A;  5TZV A;  4ED7 A;  1U49 A;  3H8S A;  2Y9T A;  4F41 A;  8ICL A;  4R8U B;  3TFS A;  3EPG A;  2ZXI A;  2XY6 A;  1NZP A;  2VA2 A;  4RPZ A;  3SQI A;  4QW9 A;  1ZD3 A;  5CWR A;  4QZI A;  4PHD A;  2FE9 A;  3PO5 A;  5AKJ A;  3ZD8 A;  5KTQ A;  1UA1 A;  3NRW A;  3QNM A;  4I28 A;  5J2D A;  4B9S A;  4ELV A;  2EAO A;  4OO1 J;  3E58 A;  3RF9 A;  2WTF A;  4UB6 U;  8ICB A;  1L3U A;  1X66 A;  4EEL A;  4P0P A;  4M9L A;  4R66 A;  1ZQY A;  1Z4N A;  1ZQC A;  4DOB A;  5J0S A;  1XO1 A;  1QCK A;  9ICN A;  3PSP A;  1Z4O A;  2N1R A;  1K1S A;  2F44 A;  4ECS A;  2W54 A;  3ONN A;  4QWD A;  2XO7 A;  1TAU A;  4MHV A;  2F1H A;  4A8E A;  3TI0 A;  3NUQ A;  4IS7 A;  4NLG A;  5ALN A;  9ICF A;  4QZ9 A;  3PR5 B;  1Q3V A;  3DDH A;  2PFO A;  3H0M B;  4AYB F;  1J97 A;  4YMN A;  2LKY A;  2KZZ A;  5FP0 A;  3PNC A;  2Y1J A;  2IMW P;  5ALF A;  8ICA A;  3PML A;  3JPQ A;  5DCF A;  3QX7 A;  4Y2R A;  2ISO A;  3RTV A;  5KL1 B;  1NK9 A;  2ZTC A;  2FLL A;  5KG0 A;  9ICU A;  2DKZ A;  3M7D A;  4ECY A;  1SL0 A;  8ICQ A;  9ICB A;  2ASD A;  5EWF A;  4DFK A;  3F2B A;  1UHU A;  1RXW A;  2VKQ A;  2F1J A;  2KE7 A;  3AU6 A;  1U48 A;  4DSE A;  2F77 X;  2IOF A;  1SL1 A;  4XRH A;  4F5R A;  3MFI A;  3GFK B;  3PW5 A;  8ICG A;  4CNQ A;  1PVP A;  3PST A;  3PW2 A;  2ZUB A;  4AYB C;  1VDV A;  2JGA A;  1L7N A;  2C22 A;  1SWW A;  2JXJ A;  4I2C A;  2LYB A;  4ED6 A;  2KVS A;  3BQ0 A;  3TAQ A;  4FBT A;  1ZYQ A;  3C21 A;  1TV9 A;  1ZD2 P;  3VCB A;  2HHQ A;  4MF2 A;  2K4P A;  3MFH A;  4B9V A;  4O3N A;  5ALK A;  5EE1 A;  3T3F A;  3NVZ A;  2Z7J A;  4DWI A;  2BKE A;  2ZJA A;  3N97 B;  3Q8Q B;  5HNK A;  2M9N A;  3M6Z A;  3M8S A;  2FMS A;  1NJX A;  2KTQ A;  4C4S A;  4IQU A;  2KD1 A;  4EX6 A;  5DBB A;  2AJQ A;  2ZXH A;  1NK5 A;  3TAC B;  5J0Q A;  3T5K A;  2FLP A;  3G6X A;  3AU2 A;  5KG2 A;  5B66 U;  2C2R A;  4M9G A;  5KFF A;  1ZJM A;  5DQG A;  4KX3 A;  3WK8 A;  5DLG A;  2KFZ A;  7ICO A;  2KNJ A;  2WF8 A;  3AN1 A;  5EOZ A;  4UB4 A;  2W43 A;  2HHT A;  4OJO A;  2F3N A;  4RQ5 A;  4DSJ A;  4UQG A;  1IXR A;  3C2M A;  4FZL A;  9ICL A;  4NJ8 A;  3A0B U;  3IG5 A;  3GZF A;  1NK8 A;  3RH4 A;  3QZ7 A;  3WK6 A;  4TQR A;  3RH6 A;  4Y2Y A;  4DOC A;  3IP4 B;  3UMG A;  2E8M A;  4RUC A;  4RUA A;  2RRD A;  3B0X A;  4J9M A;  3SMV A;  2XY5 A;  2LHT A;  3UM9 A;  1RM6 C;  1Z19 A;  1Z00 B;  2DGZ A;  4C7Y A;  1V97 A;  4IL6 U;  2A1J B;  7ICS A;  2HDO A;  2A19 A;  4F71 A;  4QNL A;  2BCU A;  4KLE A;  3IHQ B;  2K4I A;  3PVX A;  4UBC A;  1IIP A;  1NNL A;  4YN4 A;  3ZDD A;  5AI4 A;  4RQ4 A;  4BXO B;  2I6X A;  4EBE A;  1ECW A;  1DXS A;  3PW0 A;  1KEJ A;  2WB1 C;  4JV1 A;  5GTI U;  3GU3 A;  3LK9 A;  2V9W A;  5DB9 A;  1BNP A;  4ED0 A;  2QB0 B;  4DSF A;  3ETR A;  4IQV A;  5AIB A;  5B5E U;  2OYY A;  5AI5 A;  4NY8 A;  1AE9 A;  1ZQR A;  4F2S A;  3MGH A;  2XCA A;  1SL2 A;  4OJ5 A;  1XS9 D;  2AHO B;  5ALE A;  2FLN A;  2JRZ A;  1B43 A;  4C4T A;  4TUP A;  2HHX A;  1L8L A;  3N7R C;  4QWE A;  4QZF A;  2YMP A;  4PHE A;  3UXN A;  2I5H A;  5KT6 A;  3C5G A;  4ED3 A;  4QWA A;  1ZQL A;  2H3V A;  5AM2 A;  4RQ3 A;  2NYV A;  1RG6 A;  4E0G A;  2ZTD A;  4J9P A;  5CRX A;  4YQW A;  2BPF A;  2HVH A;  2HBM A;  1Q8K A;  1DK2 A;  1FLO A;  3V7K A;  1NZB A;  2MUT B;  5KFW A;  4DQP A;  4YMM A;  4J9O A;  5F9L A;  2W9B B;  5KG7 A;  4GLX A;  5EWG A;  1ZOL A;  4F5Q A;  3EW9 A;  5AKE A;  2Y9U A;  4BDP A;  4CRX A;  1ZQQ A;  2W9C A;  4ED2 A;  3KFU F;  2MUT A;  1LVH A;  1COO A;  2EZY A;  4F2R A;  5DBC A;  3Q8R B;  2KIW A;  4P4O A;  3AQE A;  2CN1 A;  3CRX A;  4YD1 A;  2P66 A;  1IG6 A;  3L5K A;  4FS1 A;  4YVZ A;  5KG4 A;  2JR5 A;  5D4B A;  2HBJ A;  1BPE A;  2VAN A;  4R63 A;  5L9X A;  2A3V A;  4Z6F A;  4ICA A;  2W9B A;  4QIW F;  5KFY A;  4UAV A;  5KFR A;  2PKE A;  4E0Y A;  4IR9 A;  4E0P A;  4MFF A;  1MSW D;  2KZ3 A;  2YB1 A;  3A0H U;  1Q3U A;  2J6S A;  3G6V A;  3EZ5 A;  4IR1 A;  3H7I A;  1N2X A;  4KMO B;  2MAX A;  3AUO A;  4Y2S A;  1NK4 A;  5F3X B;  2RDJ A;  1JIH A;  2KIV A;  1JX4 A;  2JEJ A;  3ED5 A;  1U9L A;  3F5E A;  2C2D A;  3WKB A;  5DB8 A;  4FFD A;  2WF9 A;  1QSL A;  4YR0 A;  1A0P A;  1BPX A;  3HIL A;  3PZP A;  4YD2 A;  2LPE A;  3C23 A;  3GIK A;  5KT5 A;  3SEN A;  7ICM A;  3IN5 A;  4O0I A;  2OEH A;  1SGG A;  1M6X A;  3MR3 A;  3RR7 A;  4KLS A;  1N48 A;  4F93 B;  1P4E A;  1JMS A;  1D9D A;  3NKH A;  5DB7 A;  2KSO A;  3UXP A;  4Y2J A;  1S97 A;  2ZIV B;  3FC4 A;  9ICT A;  2KJ5 A;  3NGD A;  5AHX A;  1TK0 A;  3PMN A;  4KN4 A;  4UB1 A;  3N7P D;  4I2G A;  5KFT A;  3HT3 A;  1SKR A;  2K4E A;  4EYI B;  4PH5 A;  4F50 A;  5J0U A;  2LM4 A;  4ECX A;  4NV0 A;  1ZQF A;  1V85 A;  3PW7 A;  3KD3 A;  5AIC A;  4AP9 A;  4CGZ A;  2RP5 A;  5KG5 A;  2ZG6 A;  2WF7 A;  2HHW A;  3JPN A;  4HAI A;  2BGW A;  4DCC A;  2V6E A;  2EH9 A;  3IG8 A;  3BQ2 A;  4RT3 A;  5AKG A;  5AM3 A;  4U7C A;  5BPC A;  4DQQ A;  3N7S C;  4EEK A;  2BHN A;  2QAR A;  4NL9 A;  4USA A;  1ZJN A;  1K1Q A;  2DQN B;  3LWL A;  1ZQJ A;  3ISB A;  3C5F A;  2IHN A;  2LBO A;  2DPI A;  1LKY B;  3AMZ A;  3RRH A;  3THV A;  4DFP A;  4FS2 A;  4DFM A;  3KKA A;  4NM1 A;  3FDS A;  4C8N A;  4F4Z A;  4ECU A;  4GFJ A;  3IV6 A;  5D46 A;  1F44 A;  4DO9 A;  5CB1 A;  8ICP A;  1ZQZ A;  4Y2X A;  4CDG A;  4ED1 A;  4ZOH C;  1HUZ A;  2ASL A;  4XA5 A;  3BS5 A;  3RJI A;  2FPM A;  5J8Y C;  1NK0 A;  8ICT A;  2GLE A;  2D3D A;  5GTH U;  1CI4 A;  4JV2 A;  2R8J A;  1SV0 C;  7ICI A;  3EUB 2;  5C6K A;  3WKD A;  1WG8 A;  2EAN A;  4YXM A;  1RXV A;  3M9O B;  2IOH A;  3SD7 A;  1ZQH A;  3QU2 A;  3DV9 A;  3TAD C;  1RYS A;  3RJE A;  5ALH A;  4E10 A;  4BGD A;  5KAI U;  3MDC A;  1QQ7 A;  3RBD A;  4C7Z A;  1BGX T;  4LJX A;  3PSF A;  2BQR A;  3T79 A;  2E8O A;  1VLB A;  1S0M A;  4P0Q B;  4NWI A;  2NV3 A;  1ZQB A;  8ICI A;  5ALP A;  4OD0 A;  4PL1 A;  3KZI U;  4P4P A;  3RFA A;  3D6J A;  5AIA A;  4ELU A;  2XID A;  3TAP A;  4JV0 A;  3IDW A;  4GC7 A;  1L3S A;  4PL2 A;  1ZQI A;  3E2E A;  2OHF A;  8ICX A;  3PR4 A;  3PW4 A;  2AH5 A;  3UMC A;  1F5S A;  2V4Q A;  3C29 A;  4F4X A;  4GC6 A;  1LV5 A;  2HOI A;  1L7M A;  3N4M B;  5AKX A;  4RPY A;  5ALS A;  4F8R A;  5K4L A;  4O3O A;  3OHA A;  2FMP A;  5L1M A;  4K4H A;  1B0X A;  2DF4 B;  4M6W A;  5JU5 A;  3RJH A;  1XNS A;  2ATL A;  5BOM A;  3T5J A;  3RB6 A;  3UXU A;  3DEE A;  1TFR A;  4EZ9 A;  1ZQS A;  1WCL A;  1KDH A;  2E8P A;  3LVV A;  4DF4 A;  5AKL A;  3CYM A;  1SXE A;  2W3S A;  3KTQ A;  2WB1 F;  9ICE A;  4ED8 A;  4YMO A;  4RPX A;  2YY6 A;  5KT2 A;  3QUC A;  2WAQ C;  5AK5 A;  4YP3 A;  3K1Z A;  1KFS A;  5KFL A;  5F9N A;  4J9L A;  3MGI A;  3M8R A;  4UBB A;  4FZM A;  4ECQ A;  3EPI A;  1PK1 A;  5J0P A;  1YZ7 A;  4QWB A;  5ALX A;  1TK5 A;  2B6G A;  4ECR A;  5H2F U;  4F4Y A;  2R18 A;  2DWQ A;  1ZQ1 C;  3QU7 A;  1MQ3 A;  4DQR A;  4GXK A;  1KW4 A;  5TIS U;  5J2C A;  5KG1 A;  4TUR A;  8ICO A;  3H0R B;  4MEX A;  2RDI A;  3RJF A;  2YML A;  5DBA A;  3QEB Z;  1U47 A;  4C4R A;  1UT8 A;  4P2H A;  3OHB A;  1JAL A;  1S5L U;  3QUB A;  4E0D A;  2H3F A;  4O3Q A;  4UB2 A;  3BQ1 A;  2NRW A;  8ICS A;  1NJW A;  2YQE A;  4KN7 A;  4OJ6 A;  4ECW A;  1ZQU A;  3V6J A;  4BUG A;  3C1Z A;  2XC9 A;  2XY7 A;  2KV2 A;  1ZQX A;  4RNM A;  4LZG A;  4C8K A;  1PUZ A;  2XVT A;  5DLF A;  1BPZ A;  1ZD4 A;  5KT3 A;  1S10 A;  1UCV A;  4I2A A;  1FEZ A;  4I27 A;  1KTQ A;  1DOQ A;  2RLT A;  1NK6 A;  2K8B B;  1BPY A;  2KKP A;  1MC8 A;  2RHF A;  3GIL A;  5KFS A;  2DL0 A;  4C0Z A;  4UAW A;  1WUD A;  1KN5 A;  1X6I A;  1GO3 F;  3Q8L A;  1MA7 A;  4NM2 A;  4RQ6 A;  1SB3 C;  2H3Z A;  4KLI A;  3E0F A;  3Q8M A;  2JH7 A;  1EXN A;  1D8Y A;  2G08 A;  1X42 A;  2VIX A;  2JMG A;  2W3R A;  3HRD D;  5IIK A;  4QIW C;  2ZJ5 A;  5CP2 A;  3R9K A;  3ISD A;  5J29 A;  1U45 A;  1JRO A;  8ICW A;  4P0Q A;  1XO0 A;  5ALI A;  3MAB A;  5KFO A;  3RRG A;  2W7P A;  4B9N A;  5J8Y A;  4Q8F A;  3C2L A;  2MRL A;  1C20 A;  2JV3 A;  4NLN A;  4QW8 A;  1URJ A;  5EE9 A;  1TKD A;  1UPH A;  1IV8 A;  3BDP A;  4J9Q A;  5ALU A;  5JUM A;  4QZB A;  1KSP A;  2E5S A;  4R65 A;  1S76 D;  4UAR A;  3BZK A;  5ALT A;  5KFD A;  5D49 A;  3WKE A;  4TUQ A;  4Y2Q A;  2ZUC A;  5HHH A;  7ICJ A;  3KHG A;  5DGB A;  4DLG A;  3Q8S B;  3OJS A;  3F2D A;  2KHV A;  4O9M A;  1ZQK A;  3RB4 A;  5JRT A;  2Q4T A;  1ZQP A;  3KHR A;  2IA6 A;  9ICJ A;  3SAF A;  3QUQ A;  2R8K A;  3I28 A;  5J2H A;  4F91 B;  5AKK A;  2K8A A;  1HEK A;  4KX5 A;  4MEY A;  2QLT A;  5JTI A;  2AGO A;  1TVA A;  4TQS A;  4F3O A;  1L8O A;  2G06 A;  3ZDC A;  4B9M A;  7ICG A;  4DL7 A;  5AI9 A;  3D2Q A;  3QU9 A;  2JZB A;  3V72 A;  2HVI A;  5KFM A;  2W9C B;  2M0N A;  1S0O A;  1ZRM A;  2HOQ A;  3UQ0 A;  4O3M A;  4KLQ A;  1D8B A;  1ZXI A;  4CCH A;  9ICW A;  8ICR A;  9ICQ A;  2Y0S F;  3HP6 A;  1WYG A;  1O03 A;  2H5X A;  4BWM A;  1ZQN A;  2GO7 A;  3SV3 A;  2G07 A;  8ICU A;  4NXZ A;  2W11 A;  4JWN A;  2KIC A;  2KG5 A;  2HI0 A;  1HUO A;  1KL9 A;  4F92 B;  2EZX A;  4KLG A;  3OTQ A;  1T8E A;  3RH5 A;  4I29 A;  3GQC A;  8ICM A;  4M9J A;  4KLF A;  2CPR A;  3MDA A;  7ICP A;  1BVS A;  2G0A A;  4ACO A;  3VCF A;  2XI9 A;  1D8L A;  4QJF B;  2EZZ A;  3QU4 A;  4M2Y A;  4YCX A;  1L3V A;  4PGX A;  3LDA A;  3GV5 B;  4RQ8 A;  4GIB A;  2K60 A;  5KFK A;  5DGA A;  4OCZ A;  5KFG A;  2K4H A;  4LVS A;  3ISC A;  4NLK A;  2W9M A;  3S6J A;  1MQ2 A;  2IHM A;  4F5P A;  1DGJ A;  5DG8 A;  4DL5 A;  1NOM A;  3AM9 A;  1X9W A;  3NRZ A;  4I2D A;  2BPC A;  7ICT A;  1XSP A;  3ICX A;  9ICG A;  4BXO A;  2UVR A;  1UA0 A;  2OM6 A;  1A6S A;  2F2A B;  5KFA A;  2PXI A;  2WF6 A;  3D2S A;  1DK3 A;  5IIJ A;  3AEV A;  4O3P A;  4IRK A;  2NO5 A;  1OUQ A;  3V7L A;  3TAN A;  2V4R A;  1H38 A;  5HR7 A;  1C7Y A;  4B9U A;  2H3I A;  1KFD A;  2KJ8 A;  3RR8 A;  2C28 A;  3I1Y A;  2NRV A;  4GXJ A;  1FO4 A;  4LZD A;  2NRZ A;  2F1I A;  2KSO B;  4UAS A;  4PGY A;  3FAH A;  3FM9 A;  4Q8E A;  5AM4 A;  4MFC A;  7ICH A;  2DUY A;  4PGQ A;  3HWT A;  1ZRN A;  1Z1V A;  2QKQ A;  1L7P A;  3NS1 A;  3PX0 A;  2J6U A;  1PK1 B;  2LYA A;  3V7J A;  2EAP A;  4US8 A;  4Y2V A;  3CNH A;  2BZF A;  1KKX A; 
#chains in the Genus database with same CATH homology
 2HOF A;  2Z7J A;  2HBK A;  3RF9 A;  3AL0 B;  1P4E A;  3AQF A;  2K4I A;  4U6P A;  2KIW A;  2W04 A;  2F8L A;  3NKH A;  4P0P A;  2GH1 A;  3AQE A;  2CN1 A;  1IIP A;  2E5S A;  2ZIV B;  3H0R B;  3M6Z A;  2KJ5 A;  3CRX A;  4BJQ A;  2CPR A;  2HMX A;  2KHQ A;  1YT3 A;  3PSF A;  3T79 A;  2PMZ F;  1L6N A;  2G0A A;  2KD1 A;  3SAG A;  4ACO A;  3VCF A;  4P0Q B;  3O0F A;  2GOL A;  4NLB A;  4FE3 A;  4NWI A;  1ED1 A;  2NV3 A;  2HBJ A;  2XI9 A;  1Z1B A;  3H0L B;  1ECW A;  2ZXH A;  3N7P D;  4QJF B;  3SAH A;  2K4E A;  2WB1 C;  3PSP A;  4OJP A;  4PL1 A;  2VJ4 A;  3RFA A;  4FZN A;  5HR6 A;  3C28 A;  2N1R A;  3GU3 A;  3OPX A;  3ALR A;  2XID A;  5C0Y A;  2H3F A;  2Y0S C;  3ONN A;  4PL2 A;  2A3V A;  1P4E C;  2BDU A;  2KOB A;  4ICA A;  2OXO A;  3F2D A;  2KHV A;  4P0P B;  3F2C A;  4QIW F;  4NLC A;  3C29 A;  1CRX A;  4NV0 A;  4OJ6 A;  4A8E A;  5DOR A;  2K4H A;  3NUQ A;  2K89 A;  1HIW A;  2HOI A;  2E1E A;  4BUG A;  2CRX A;  2OYY A;  1AE9 A;  1SZH A;  2KV2 A;  2YB1 A;  2KKV A;  4CGZ A;  2F76 X;  1M6X C;  2Q4T A;  2RP5 A;  2PMZ C;  3CP8 A;  4OJ5 A;  4OJL A;  1Q3V A;  1P7D A;  4KX3 A;  1Q3U A;  2ZG6 A;  3SAF A;  3H0M B;  3L3F X;  5KL8 B;  4AYB F;  2VJ5 A;  1TAM A;  2XVT A;  2G5I B;  4IC9 A;  2LKY A;  1T94 A;  2ZIU A;  3ICX A;  2K8A A;  2KVC A;  1HEK A;  2DF4 B;  2KNJ A;  3IG8 A;  2K8C B;  3N7R C;  4KX5 A;  5A0L A;  4KMO B;  4U7C A;  5DCF A;  1XNS A;  2JHD A;  3N7S C;  2E1F A;  2K8B B;  2OM6 A;  3KZX A;  3LYS A;  2KKP A;  2ZIX A;  2DQN B;  3M6K A;  2JH1 A;  3PSI A;  4OJO A;  2RHF A;  3F5A A;  5KL1 B;  1A6S A;  2F2A B;  2LBO A;  4BX9 C;  3M7D A;  3DEE A;  3UXU A;  2XIC A;  4DKS A;  4FZL A;  4C0Z A;  2G06 A;  3D2S A;  1WUD A;  3D2Q A;  3F5E A;  3IG5 A;  3LVW A;  3LVV A;  1OUQ A;  2WAQ F;  3GZF A;  2D6F C;  3F2B A;  3CYM A;  5HR7 A;  2ZIU B;  2H3V A;  2VKQ A;  2ZIW B;  2MA1 A;  1AIH A;  2H3I A;  3F53 A;  1GO3 F;  2M0N A;  1MA7 A;  4WJ3 B;  4GFJ A;  2KJ8 A;  2F77 X;  2WB1 F;  2H3Z A;  2HOQ A;  1A0P A;  2G5H B;  1F44 A;  4O3M A;  3E0F A;  1D8B A;  2YB4 A;  2JH7 A;  3PZP A;  5CRX A;  3IP4 B;  4CDG A;  2G08 A;  1PVQ A;  2ZXI A;  2VIX A;  2JMG A;  1DRG A;  2HBM A;  2Y0S F;  2HBL A;  2WAQ C;  3D2N A;  2ZIV A;  3PST A;  4QIW C;  1PVP A;  1FLO A;  3SQI A;  3K1Z A;  4AYB C;  2RRD A;  2JGA A;  3IN5 A;  1NZB A;  2H3Q A;  2LYB A;  4FZM A;  2G07 A;  2KJ9 A;  3SMV A;  3HKZ C;  2ZIX B;  4P0Q A;  2LHT A;  1XO0 A;  3VC8 A;  1Z19 A;  2KIC A;  2KEY A;  2W7P A;  2W03 A;  3MGV A;  2DGZ A;  2OH2 A;  2YX8 A;  3VCB A;  4JMU A;  5C6K A;  1M6X A;  2LYA A;  2ZIW A;  3NRW A;  2MRL A;  2W7O A;  4CRX A;  5T14 A;  1KBU A;  2R18 A;  1PVR A;  1ZQ1 C;  4QNL A;  1URJ A;  3HKZ F;  3KFU F;  2G09 A;  1UPH A;  4OO1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...