2A3VA

Structural basis for broad dna-specificity in integron recombination
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
319
structure length
313
Chain Sequence
GSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHSGVLSPLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (31-MER)
publication title Structural basis for broad DNA-specificity in integron recombination.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Recombination
total genus 91
structure length 313
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00589 Phage_integrase Phage integrase family
A PF13495 Phage_int_SAM_4 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2a3vA01
1.10.443.10 Mainly Alpha Orthogonal Bundle hpI Integrase; Chain A Intergrase catalytic core 2a3vA02
1M6XA 1F44A 1Z1BA 3CRXA 5CRXA 1M6XC 5DORA 3NRWA 2KIWA 4A8EA 2KEYA 1XNSA 1XO0A 2A3VA 5C6KA 1CRXA 1FLOA 2KHVA 3UXUA 4ACOA 1OUQA 1Q3UA 1P7DA 2HOFA 1Q3VA 1DRGA 2KD1A 3C29A 1AE9A 3VCFA 2HOIA 1P4EA 2OXOA 1P4EC 1Z19A 1NZBA 2KOBA 1PVQA 3NKHA 3C28A 2KKPA 1KBUA 1A0PA 2KJ5A 2KJ9A 4CRXA 5DCFA 2KJ8A 2CRXA 3LYSA 1MA7A 3MGVA 4DKSA 1PVRA 1PVPA 2KKVA 2KHQA 1AIHA
chains in the Genus database with same CATH superfamily
4DQSA 3CNHA 2PFNA 5KFFA 5DDYA 5AI0A 2Y1JA 4M47A 5AI6A 5EE3A 3UMBA 1K1QA 4ECZA 1ZJNA 2ZIWA 4KX5A 5DGBA 3KHHA 4DF8A 2HOQA 4P0PA 2YMQA 4GXKA 1SL1A 1ZD4A 2H5XA 3HKZC 2C22A 1PK1A 3ETRA 4O3PA 1ZQPA 4KN4A 2GLEA 4OO1J 3VCBA 2BCRA 9ICIA 3NKHA 2JRZA 2MUTA 1NK4A 4K4HA 2H3ZA 2F76X 2VJ4A 3PW7A 4F43A 5AM1A 2KKVA 5J2CA 3K1ZA 1X42A 3GV5B 4UATA 4Y2XA 5AI9A 4O3NA 2IMWP 2A3VA 1ECWA 3RRHA 4C8LA 3PW2A 2R8JA 4DO9A 4J9SA 3ICXA 3PSPA 3L4PA 4YVZA 1BPYA 4FZNA 2JZBB 3MR2A 1O08A 4M9NA 3FYHA 4DQQA 2F8LA 2XY6A 4I2EA 4B6JA 4EZ9A 2E1FA 4EEKA 2W55A 2JEFA 8ICIA 1A77A 3VCFA 2JEJA 3OPXA 4F72A 1J97A 4I2BA 2AGPA 5KFUA 5AKLA 3PR4A 4DLGA 1X2IA 3IG8A 3TACB 3RBDA 4GFJA 1BVSA 5AHXA 2M9NA 3N4MB 4R8UA 2WF5A 1SL0A 1L8LA 1B4FA 4DQRA 1RDFA 4QZHA 2ISPA 5ALRA 4UB8U 3KFUF 5GTIU 2LM4A 1ZQZA 2XICA 3DV9A 3QUQA 3GDXA 3LDAA 5BOMA 2FMSA 3BQ2A 4TQSA 2A19A 1UA0A 4GXIA 3PX4A 2QKQA 3RH4A 8ICVA 1N2XA 4BX9C 7ICJA 2RQ5A 2ZIXB 2HHWA 3H40A 3JPTA 1COKA 3OTQA 1Z00B 4YFKA 2ZJAA 8ICQA 5AKKA 5AKZA 3C2LA 4YR2A 2GOLA 3PX6A 5C0YA 1A6SA 4QZIA 2IBKA 2KE7A 3ZD8A 4ZH4A 5L1IA 4QJFB 3Q8RB 3UXOA 3H4DA 5AKEA 2ASJA 2BCQA 2H3VA 4LZDA 4KLUA 3M6KA 1VDVA 4NY8A 2KEYA 4JMUA 4RQ1A 5KG3A 4I2CA 1T3QA 1SV0C 3T79A 5D46A 2NYVA 4ECRA 3NGDA 1S77D 5KNIA 2BQRA 1IG6A 5GTHU 5FP0A 8ICAA 2B6GA 2KSOA 4IR1A 1MSWD 5AIAA 3U26A 4JWMA 3TARA 4UQGA 1LV5A 2LPEA 3RJGA 8ICOA 3IRUA 1PK3A 3F2DA 4B9TA 4FZMA 2YN4A 1LKYA 3C21A 3F5EA 5HMLA 4F71A 4EBDA 2JGAA 1Z1BA 4TURA 1NK5A 1SL2A 1CRXA 2K89A 3B0YA 3KZXA 4Y2SA 3NUQA 2BZFA 4F2SA 1SKSA 5J0YA 3M8RA 3FAHA 4NJ8A 4UAYA 4O5CA 3GFKB 8ICYA 2ZIUB 5CP2A 4C80A 4KX3A 1HUOA 1JROA 4YD1A 3O0FA 5ALOA 4ECXA 2CXYA 3WK7A 2YX8A 4YCXA 4MEXA 4ECWA 1S76D 4NLCA 3RJKA 3GIKA 1TK0A 1FFUA 2BQUA 1OW5A 1SV4A 5KFZA 4F5QA 5J2FA 1NKEA 2E3TA 4O0IA 5J0OA 3A0BU 2NO5A 5AK5A 4UB6U 2W9CA 3BDPA 4PHDA 2R8HA 5IIOA 4RUCA 2RDJA 3E2EA 3UXNA 3PMLA 1NJZA 5ALVA 1MN8A 4BXOA 4F92B 4TQRA 3HT3A 4PL2A 3WU2U 2EZZA 5KTQA 5TZVA 3JPQA 2Y9TA 5KG1A 5JTIA 1XU4A 1YT3A 1LVHA 2DL0A 4NM1A 3LYSA 4FBUA 2FJ6A 3ZDBA 1AIHA 5EWGA 4US9A 4F5NA 5EE1A 4B9NA 3KBBA 1BNOA 1QCKA 5J0SA 4DS4A 3FC4A 2EZXA 3PY8A 4JK1A 4G9BA 4DCCA 3RB6A 5DCFA 2EANA 1IIPA 4M9HA 4Q45A 2ES6A 4PHEA 3F2BA 2KFNA 2FLLA 4I29A 5AK4A 3GILA 2KZZA 9ICHA 1JXEA 4YQWA 3I76A 1QQ5A 4NV0A 5J2DA 3V7LA 1EXNA 4UB4A 1T94A 2I9GA 3V6JA 4RQ7A 4RQ0A 2PFPA 3WK8A 3IV6A 2F44A 3GIJA 2FI1A 1ZQXA 3BQ1A 2C2RA 3QUBA 4ECVA 4ELTA 2P66A 5DGAA 4JB3A 2XC9A 1F5SA 2JH7A 2ZIVA 1OUQA 3PNCA 1Q3UA 4YR0A 2W9BA 9ICSA 5ALJA 2LYHA 1P4EA 4BWMA 5KFIA 1TE2A 1NZPA 3KTQA 2KJ8A 4PJ0U 3ZDEA 8ICNA 5DDMA 3M9NB 3J81j 3D2NA 2KIWA 4Z6FA 5KFCA 1DK2A 5KT7A 3OHBA 1S0OA 3IP4B 1PUZA 5KAIU 1ZQOA 4J9PA 5KT5A 3ZDCA 2A1AA 1KRPA 1IXRA 2HMXA 5T14A 2FPMA 1UPHA 2EH9A 5F9NA 3GIMA 3TADC 3C5GA 9ICNA 4KLOA 3V72A 3DDHA 4EELA 4UBBA 7ICUA 3K4GA 2J6TA 2NV3A 4F5RA 3E58A 2DPJA 1TV9A 2W9MA 5G5GA 5ALIA 2VA2A 1WUDA 5BPCA 4F5OA 2E5SA 4DSFA 5DLFA 4DS5A 1NNLA 2Y0SF 1ZQYA 1Z4OA 1COOA 5KT3A 3RH5A 4Q43A 4RQ8A 1URJA 3BZKA 2LBOA 5CA7A 8ICLA 2MRLA 4UB1A 2BPCA 2BCSA 5KFMA 1NJXA 4EEYA 3LVWA 4NL9C 1ZOLA 3H8SA 4P4OA 4Z6DA 2AXTU 2FPLA 1L7OA 4RNMA 1XC9A 3A0HU 2BPGA 1RYUA 2P6RA 1KQQA 2KHVA 4PPXA 3TFRA 1NK8A 3AQEA 4OJ5A 1SIJA 3UMCA 2W8KA 4J9MA 5DKWA 4QWBA 3ZDAA 4IRCA 3F53A 4X5VA 1JRPA 2MSNA 1KKXA 1NJWA 3RFAA 2QARB 4NLBA 4R63A 8ICMA 2H3QA 1L3VA 2GWSA 3LVVA 2OM6A 4C8NA 2HHVA 1SGGA 2HHTA 4E0DA 4DSLA 1NKBA 4DWPA 1UT5A 3QNMA 1D9FA 9ICMA 3K1RB 1Q46A 2R18A 2V6EA 1BGXT 3KHRA 3UPQA 1RYRA 2XCPA 4P4MA 1QSYA 3SV3A 1M6XA 2W04A 4J03A 1L7NA 5D4BA 4F4XA 4M9GA 5J2IA 4QWDA 3EUB2 3PMNA 3T5JA 1DGSA 4NLNA 4LJXA 9ICWA 4EYIB 4KMOB 5H2FU 8ICGA 4USAA 3IN5A 4RQ2A 4F50A 5EE9A 5ALEA 4TUQA 2ZTDA 2K4IA 4QIWF 4DL6A 1SWVA 1ZQEA 5KL8B 2ZUCA 4IQWA 3MR5A 4Y2JA 4RPZA 3UMGA 1ZJMA 4UAVA 1SZPA 1QSSA 3RR8A 4QZFA 3QZ7A 2PKEA 2ZXHA 2E8OA 1KEJA 1ZQAA 2BPFA 1MQ3A 2CN1A 2VA3A 2JR5A 1RG6A 2DKZA 4US8A 4C8KA 3WKCA 4ED1A 1TAUA 4C0ZA 4F4WA 2UVWA 2DUYA 4XRHA 1TAQA 4RU9A 4M0AA 4UB2A 3AQFA 4DF4A 1KL9A 4RPXA 2A1JA 2KMDA 5AICA 3LWMA 2AU0A 4RNNA 2KJ9A 3EYZA 3C5FA 2UVUA 4KLQA 1ZRMA 2YB1A 2VANA 4DL3A 2XI9A 3GV8B 4RT3A 4EZ6A 1V97A 2HI0A 4F41A 2WFAA 4YN4A 4ED3A 4JV2A 3OSPA 4OJPA 3R9KA 3NRZA 4OCZA 2IHMA 4DEZA 3C1YA 1KFDA 3PW5A 4KLMA 9ICGA 2E8PA 8ICHA 3TADA 4NLZA 2V4RA 4IQVA 5KT4A 5EWFA 5DORA 4GXJA 3RRGA 5KFDA 1U49A 2O6KA 2DFLA 4E10A 5DQGA 2KTQA 1AE9A 3EPGA 7ICGA 2DBYA 3BJYA 1VJ5A 1B43A 1KSPA 9ICOA 1DOQA 1X6IA 1QLNA 2AQ0A 9ICAA 2N1RA 4R66A 2FLNA 1FEZA 2G5HB 4DFJA 4UW9A 4DOAA 2BGWA 1XSPA 3Q8MA 3LWLA 3KZIU 2ZIWB 4P2HA 9ICFA 2NRTA 4P0PB 1T3NA 2HBJA 1S8OA 1N48A 4NL9A 1PK1B 1HIWA 3QZ8A 2DWQA 3PW4A 4J9QA 2D6FC 3LK9A 3UQ0A 3TQ1A 5CB1A 4ACOA 1TFRA 3NTUA 2MUTB 1ZD3A 2FDRA 3NVZA 4I28A 5KFQA 3THVA 5ALUA 1Y88A 4J9LA 5TISU 5ALHA 4F2RA 5ALFA 4FS1A 1ZQMA 8ICBA 4F91B 2FMPA 4I2FA 4NLGA 2DQNB 3TKAA 2PI4A 4EBEA 3TI0A 3V6KA 4DOCA 8ICJA 3AUOA 5CWRA 4RPYA 1SKRA 2KG5A 5KFEA 4DFMA 2IHNA 3MGIA 1N56A 2EAOA 1P4EC 4GIBA 2JH1A 3WKDA 2PI5A 2YMPA 4EX7A 2KKPA 2J6UA 3QUTA 2BHNA 3AMZA 3N28A 4C7YA 3SEIA 4AYBF 2ZUDA 1JIHA 2EAMA 5KG5A 3WKAA 5HR6A 3OJSA 4C4SA 3UXPA 2WF9A 5C6KA 3B0XA 2EZYA 1N61A 2RP5A 2NRZA 5AM3A 2WAQC 2WTFA 5DLGA 3ONNA 4IR9A 1XO1A 5KFWA 9ICCA 3EWAA 1JXLA 1PZNA 3AM9A 4ED7A 4Q44A 4I2DA 4R8UB 1UA1A 4DLEA 1L3SA 2OYYA 5ALTA 3ORYA 2JEGA 2XGPA 1TKDA 5KFJA 3PO5A 3PO4A 1FO4A 3HPOA 1S10A 1WWUA 3UM9A 1ZQDA 5KAFU 2XVTA 4JV0A 2OCEA 3CP8A 5AM0A 2WB1C 2W9AA 1KFTA 3N7SC 4DOBA 2YTUA 2AHOB 4QZDA 5HMMA 3WKEA 4KLGA 4OD0A 5J2EA 2ATLA 2LM1A 4YMOA 3V7KA 2GH1A 4O3OA 7ICKA 3EW9A 2XY5A 3RB0A 5J2GA 2AGQA 1XSLA 2QB0A 5KFYA 4MFAA 2MA1A 5D49A 2ZJ5A 3M9MB 1NK9A 1ZQUA 4NM2A 2UVVA 3PW0A 2KNJA 2PMZC 2HHUA 2W3SA 5KFXA 2XY7A 3AU2A 9ICLA 5EE0A 1MQ2A 3TAPA 1XO0A 3MDAA 5J2KA 1ZD2P 4BDPA 1ZXIA 4FFDA 4YP3A 4RZRA 3HRDD 2BKEA 4RQ4A 3SI8A 2NRXA 3QE9Y 3Q8KA 1X9MA 2LMRA 2BDUA 4J9NA 4MFFA 5KFHA 7ICNA 2XO7A 4YG2A 4QNLA 2HHQA 1B0XA 2G08A 2BCVA 3SYZA 9ICKA 1D8BA 4Z6EA 1OXJA 3BS7A 1LKYB 3H0RB 2ESEA 3FDSA 4PH5A 1S0MA 3TANA 1UCVA 1PVQA 3K75D 3QEAZ 1V38A 4Y2QA 5ALSA 1M6XC 5CHGA 2I1QA 4YXMA 5J0UA 2W7OA 4O9MA 2NO4A 2Y9UA 1J2NA 2RHFA 4FS2A 1S9FA 2HOIA 9ICJA 5ALWA 3UQ2A 4DQIA 4Y2PA 1JI7A 2W03A 1WCNA 2EAPA 2VIXA 1HJPA 1JX4A 1T8EA 5AK3A 3HWTA 4QZAA 1KFSA 9ICBA 4EENA 7ICEA 1K5OA 3C29A 7ICTA 3QU7A 2MAXA 4CDGA 1ZQHA 4FZLA 2W11A 3MBYA 2AQ4A 4IC9A 3OHAA 2W9CB 2YMLA 1IM4A 1RYSA 1PVPA 4EYHB 1LB2B 4DSIA 4M2YA 4ZOHC 1RXVA 4BXOB 5DG8A 2KIVA 3HJEA 3PVXA 1U4BA 4RNOA 1P7DA 4O5EA 4O3RA 8ICZA 2R8KA 4BWJA 5KFKA 4O3SA 4RQ5A 4KMUA 3PR5B 8ICRA 3ETLA 2HVHA 3AU6A 1KLNA 2W3RA 3G6VA 3AEVA 2B21A 4QW8A 1N60A 1O03A 1XNSA 2K8BB 3WKBA 2ZXIA 4RQMA 2YB4A 1BNPA 3D2SA 4M6WA 3GIIA 4JWNA 3ZDDA 4QWCA 1XWLA 2PXIA 2J6SA 5IIMA 1BPBA 2KICA 4HAIA 3M6ZA 5J2AA 1UT8A 2HHSA 1X40A 4KLLA 1ZQGA 1ZQJA 5J8YA 3OGUA 1TK8A 4ELVA 7ICLA 7ICFA 1RQLA 3G6XA 3M1YA 4KLJA 4PGXA 1MC8A 1X9WA 2YQEA 2BCUA 5KG2A 2DF4B 1IV8A 1DGJA 4P0QA 1L3TA 3RJJA 1Z4NA 5CEHA 1J2MA 2KVSA 4HYKA 2KJ5A 4E0GA 7ICIA 5KFTA 1WCLA 1TVAA 4YD2A 3RB3A 3TFSA 2ZIVB 3MR3A 1F44A 9ICTA 2Z7JA 3S6JA 1HEKA 4OJLA 5DQIA 3QEBZ 3SAFA 4ED0A 4KLHA 4MFCA 3V6HA 5ALZA 3SAGA 5G5HA 3KKAA 3BQ7A 1BPDA 1SXDA 4GC6A 4G3IA 3M7DA 1SXEA 2F3NA 2OEHA 5HR7A 1ZQRA 2PFOA 2F1HA 2OHFA 4XUSA 1WYGA 3C23A 2I5HA 3F5AA 2V4QA 2ZUBA 5AK6A 3GV7B 3RB4A 3RBEA 4QZCA 9ICRA 1N63A 1SWWA 2ODGA 2Y0SC 5KT2A 3G6YA 3OSNA 2AH5A 4LZGA 1QQ7A 3BS5A 7ICPA 3NRWA 1ZQBA 5L1KA 1BPXA 4E0YA 4RT2A 1N62A 4DFKA 3RR7A 5KG0A 1B22A 1ZETA 9ICUA 4J9RA 4E0PA 4UAUA 4E0ZA 2LKYA 4IQUA 1V85A 1KBUA 4PGQA 4PHPA 2E8NA 3C2MA 2RLTA 4KLDA 4PZOA 1D8LA 5KFOA 1L8OA 3PZPA 5ALGA 4BJQA 4IRKA 4I2AA 2AGOA 3H8MA 3Q8LA 4I2JA 2K8AA 4UARA 1NK0A 4C4TA 3L5KA 5ALMA 4QW9A 4B9UA 1SZHA 9ICQA 3MABA 3IDWA 2KV2A 2VKQA 5CR0A 3Q8SB 5DB8A 4IQTA 4DWIA 1CUKA 4ECYA 3DEEA 3RJEA 3EZ5A 4RQNA 2ZTCA 2Y1IA 2W43A 3MGVA 3BQTA 1K1SA 3ISDA 2G07A 5CJ7A 3QX7A 4CCHA 4U7CA 2IOHA 1FLOA 3QXGA 4QZGA 3HKZF 2ASDA 1KTQA 4ECSA 1X9XA 3HP6A 1NK6A 4PHAA 3SR6A 4QIWC 1RZTA 4Y2YA 5KT6A 4ECUA 4CGZA 1ZQVA 2JZBA 4QZ8A 5IINA 5JU5A 4KTQA 2EQYA 2F1JA 4RQ3A 2P35A 1YZ6A 1UHUA 4Y2TA 4DL2A 8ICPA 2KP7A 1JN3A 1C7YA 4Y2UA 5HHIA 2E1EA 3SAHA 3JPNA 5JUMA 4C8OA 1XSNA 1HUZA 1ZQLA 4O3MA 3KHLA 4F4KA 2KZ3A 5AM2A 1BPZA 4UAWA 2BDPA 1L7PA 1T4GA 2ZG6A 4CE6A 1ZD5A 2G5IB 3SMVA 2JXJA 5KFBA 3H4BA 2A1JB 2ZIXA 1Z00A 4R64A 9ICPA 3RTVA 3IG5A 3H7IA 5EOZA 5KFPA 3ED5A 2EDUA 4F3OA 3C28A 3SQIA 4B9LA 1ZQCA 2DPIA 3N97B 7ICQA 5DBAA 2DGZA 1Z1VA 1ZQTA 4YXJA 4KITB 3RAQA 2ZJ8A 4IRDA 4XA5A 3MFHA 4K4IA 4MF2A 4ED6A 2VJ5A 4C4RA 4KLSA 1ED1A 5AKXA 4CF3A 5F3XB 1ZQQA 3H8WA 2CPRA 4BGDA 2HBKA 4O3QA 5HP4A 5DB9A 1GO3F 8ICSA 4K4GA 3HX0A 2W54A 5JRTA 2FPKA 5IILA 2W8LA 4CNQA 8ICWA 3F2CA 2LYAA 2WAQF 4NWIA 3MFIA 1SKWA 2C2EA 3SENA 3ALRA 2K4HA 5ALNA 1S0NA 3QUCA 1KDHA 2KFZA 3CRXA 2RRDA 1KW4A 5CRXA 3Q8PB 4FBTA 2G0AA 1M6YA 1L5UA 5KFSA 4UAZA 1WG8A 1QQ6A 5AKJA 3T5LA 3RH6A 2Q4TA 4XQ8A 5DG9A 1S5LU 2WF8A 2WB1F 2K8CB 1U48A 4IS7A 1N5XA 3AL0B 2NRVA 5J8YC 3C2KA 2XCAA 4I2IA 2ZIUA 2D8CA 4DSEA 4CF5A 8ICCA 4KLFA 2ZTEA 2BR0A 2HOFA 3HILA 2KD1A 1RXWA 2R8IA 3JPPA 1CI4A 4YMMA 5ALKA 2WF6A 4AYBC 2L5YA 3WK5A 1BPEA 1H38A 2PMZF 4CF4A 1S97A 1NI3A 5C5JA 5AM4A 4ECQA 3RAXA 3MR6A 2WHEA 4MEYA 2YMMA 2F8KA 3V7JA 3AN1A 4GLXA 5K4LA 1TAMA 1Z19A 5AKGA 4PGYA 4ICAA 2OWOA 2C28A 1A76A 4QZBA 4QWEA 2C2DA 5DBCA 3H0MB 3PSIA 3KKAC 3M9OB 1S0VA 2VA8A 2LI6A 2M0NA 3H0LB 2QB1A 4Q8EA 4KN7A 4NLKA 2UVRA 5L1JA 1NZBA 4LVSA 4OJOA 4F8RA 3D2QA 4CRXA 2KSOB 3WK4A 3NS1A 2JMGA 2W7PA 3SD7A 1MA7A 2IA6A 8ICEA 2E8MA 2H3FA 3SZ2A 4GC7A 7ICOA 3PSTA 1KN5A 3IM1A 2ALZA 2HCFA 4DFPA 2F77X 2LHTA 3I28A 1A0PA 1JMSA 1RPLA 2QB0B 4M9JA 5KFAA 4QZEA 1QH9A 2ASLA 2OH2A 4DL4A 3RJIA 2JEIA 5KFVA 3ISBA 4MHVA 1X6JA 3NVWA 5ALLA 3M8SA 2QLTA 2JV3A 2KK0A 7ICMA 3E0FA 2P6UA 3PSFA 1JUDA 4RUAA 3JPRA 5DBBA 4EBCA 4M9LA 4R65A 2IOFA 3ZD9A 3MDCA 4QZ9A 1NOMA 4Y2RA 5J29A 5J0WA 2MU2A 3BZCA 5J0RA 4DFDA 3I1YA 1DXSA 5F9LA 2FMQA 1SB3C 9ICXA 8ICFA 2BQ3A 2RDIA 1T7PA 5DB7A 3KHGA 3KD3A 2I6XA 4I2GA 4ECTA 2LYBA 2V9WA 4B9SA 4BUGA 5ALQA 1FFVA 3QU4A 1X66A 3C1ZA 5J0QA 2H3IA 3IHQB 1L7MA 5J2JA 5HNKA 4U6PA 1ZRNA 4TUSA 3EPIA 5HHHA 1CEZA 2KVCA 4JUZA 5J0TA 4Q8FA 1NKCA 3OJUA 3T5KA 5AKIA 4UB3A 1DRGA 3KOOA 7ICHA 5J2BA 4TUPA 5L1LA 2KOBA 1QSLA 4DQPA 4B9VA 3SV4A 1F0MA 1U45A 5A0LA 3RJHA 2WF7A 4Z6CA 3NASA 4J9OA 3RJFA 5L9XA 8ICKA 5ALPA 2Q0ZX 2K4PA 4DL7A 1SV0A 3N7PD 2HW3A 3UXUA 2G06A 3WK9A 5B5EU 5KL1B 4UBCA 2PFQA 1QTMA 5KFLA 4AP9A 2KN7A 1D8YA 3T5HA 5KG7A 1WWVA 4MF8A 2FE9A 1JALA 1PVRA 4DSKA 3L3FX 4B9MA 4FO6A 2HDOA 3GQCA 1N5WA 3QU9A 3CW2C 1V9PA 3QYPA 2W9BB 1L3UA 8ICXA 2QARA 5AI5A 3ZI4A 2D3DA 2FLPA 5KFGA 1ZQFA 1Q8KA 2ISOA 5IIIA 4ELUA 2K60A 4QWAA 3QU2A 5KFRA 4ED8A 1FIQA 5AI4A 4DKSA 2JHDA 4PZNA 4F5PA 2R8GA 4M6WB 1NJYA 5AKYA 4A8EA 4I27A 4EX6A 4C8MA 3PV8A 4E0JA 2F1IA 5BOLA 1U9LA 5ALDA 4KLEA 3BQ0A 4UB5A 1D9DA 2B0CA 2HVIA 5KFNA 5J2HA 7ICRA 2AJQA 1TK5A 4F4ZA 5J0XA 2DKXA 3NVYA 2CRXA 4M04A 4KLTA 2HSZA 4O5KA 5AKHA 1AQ6A 1L6NA 2F2AB 1RQNA 4P0QB 4IL6U 5EWEA 1Q3VA 4OJ6A 4PL1A 5DQHA 4WJ3B 3WK6A 3CYMA 4I2HA 5L1MA 1YZ7A 4JV1A 5ALYA 1U47A 1ZYQA 1ZQSA 4FE3A 1AROP 3VC8A 2KHQA 5IIKA 5DG7A 3GU3A 2HHXA 2HBMA 4KLIA 3MC1A 2NRWA 1ZQ1C 4DL5A 4J9KA 2OXOA 7ICVA 1DK3A 4F93B 3JPOA 3N7RC 5DB6A 8ICUA 3D6JA 1ZQKA 5AIBA 4NXZA 3T3FA 2G09A 3RF9A 5KG4A 5J0PA 2XGQA 1C20A 2XIDA 1Z3EB 2YY6A 5AI8A 3PX0A 4DSJA 4UASA 4Y2VA 3MGHA 1XS9D 3QU5A 3Q8QB 8ICTA 7ICSA 2K4EA 5IIJA 1X9SA 3BS5B 3JPSA 3FM9A 2HBLA 3ISCA 1ZQWA 3GZFA 1VLBA 3NVVA 4YMNA 5E79U 9ICVA 1NK7A 5ALXA 5AM5A 4RQ6A 5B66U 4YR3A 4F4YA 1ZQNA 2KZMA 4C7ZA 3H8JA 3B9JA 1ZQIA 9ICEA 2GO7A 3HW8A 1RM6C 4ED2A 1UQVA 3TAQA 4P4PA 5KG6A 2IOFK
chains in the Genus database with same CATH topology
2G5HB 2JGAA 2K4IA 4GFJA 4QIWF 2RRDA 4U6PA 1Z1BA 3CRXA 5CRXA 2Y0SF 1M6XC 2KVCA 4O3MA 2G0AA 3PSTA 3F2BA 1L6NA 2F2AB 3PZPA 5KL8B 4BJQA 1CRXA 4P0QB 2W7OA 2F77X 1A6SA 3KFUF 1Q3VA 1DRGA 2K89A 2RHFA 2LHTA 2ZIWB 2DF4B 3KZXA 2XICA 4OJ6A 2XVTA 3NUQA 4PL1A 4NV0A 1URJA 2N1RA 2ZG6A 2ZXHA 2LBOA 2HOIA 4P0PB 3CP8A 4P0QA 2Q4TA 2WB1C 2HBJA 4WJ3B 2G5IB 3N7SC 1T94A 2K8AA 2KOBA 3SMVA 2CN1A 2ZIWA 2MRLA 1A0PA 2KJ5A 3CYMA 4KX5A 2WB1F 2K8CB 3LVWA 2HOQA 1SZHA 2ZIUB 2W03A 4BX9C 5A0LA 4P0PA 3AL0B 2VIXA 4KX3A 2ZIXB 4FE3A 1HIWA 4C0ZA 3O0FA 3VC8A 2KHQA 2GH1A 2ZIVB 2D6FC 1F44A 2KV2A 2Z7JA 2ZIUA 2VKQA 1HEKA 4OJLA 2YX8A 3HKZC 3GU3A 2ZIXA 2OH2A 2HBMA 2GOLA 3AQFA 3N7PD 2JH7A 2KHVA 3SAFA 5C0YA 2ZIVA 4ACOA 1OUQA 1Q3UA 3AQEA 2G06A 4OJ5A 2HOFA 2MA1A 1ZQ1C 3IG5A 2KD1A 3C29A 5KL1B 4NLCA 1P4EA 2OXOA 4CDGA 4OO1J 3DEEA 4FZLA 3VCBA 3N7RC 4AYBC 3NKHA 2KNJA 2PMZC 3C28A 3SQIA 3E0FA 2KJ9A 4IC9A 3SAGA 3F53A 2KJ8A 4QJFB 3PSFA 2PMZF 2H3ZA 2DGZA 2F76X 2G09A 2VJ4A 2YB1A 3RF9A 3MGVA 1PVRA 1PVPA 2KKVA 3L3FX 3RFAA 2XIDA 3K1ZA 4NLBA 2H3VA 3M7DA 2XI9A 2G07A 2DQNB 2H3QA 3M6KA 3UXUA 5HR7A 3D2NA 2KIWA 4U7CA 2KEYA 4JMUA 1ECWA 1XO0A 2A3VA 2VJ5A 3LVVA 1FLOA 3T79A 1ED1A 2OM6A 1P7DA 3HKZF 3IP4B 3F5AA 4OJPA 1TAMA 1P4EC 3ICXA 4PL2A 1Z19A 2JH1A 2K4EA 2HMXA 4ICAA 3PSPA 2KKPA 5T14A 2R18A 1YT3A 4FZNA 2CPRA 2HBLA 2HBKA 4QIWC 3LYSA 1UPHA 2Y0SC 3GZFA 3H0MB 3PSIA 4AYBF 4CGZA 1GO3F 2JHDA 4DKSA 2BDUA 2F8LA 1AIHA 1M6XA 2W04A 5HR6A 2E1FA 5DORA 3NRWA 4A8EA 5C6KA 2M0NA 3H0LB 1XNSA 4QNLA 2K8BB 2G08A 2RP5A 2WAQC 1D8BA 2ZXIA 3F2DA 2YB4A 3H0RB 3ONNA 3F2CA 3D2SA 2LYAA 2WAQF 4NWIA 1AE9A 3VCFA 3OPXA 2NV3A 2LKYA 1NZBA 2KICA 4OJOA 3M6ZA 2E1EA 3ALRA 4FZMA 2K4HA 2LYBA 3SAHA 1PVQA 1KBUA 4KMOB 3D2QA 4BUGA 4CRXA 5DCFA 1WUDA 3IN5A 3F5EA 2E5SA 2JMGA 2W7PA 2CRXA 1IIPA 1MA7A 3IG8A 2H3FA 2H3IA 2OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M6X A;  1F44 A;  1Z1B A;  3CRX A;  5CRX A;  1M6X C;  5DOR A;  3NRW A;  2KIW A;  4A8E A;  2KEY A;  1XNS A;  1XO0 A;  2A3V A;  5C6K A;  1CRX A;  1FLO A;  2KHV A;  3UXU A;  4ACO A;  1OUQ A;  1Q3U A;  1P7D A;  2HOF A;  1Q3V A;  1DRG A;  2KD1 A;  3C29 A;  1AE9 A;  3VCF A;  2HOI A;  1P4E A;  2OXO A;  1P4E C;  1Z19 A;  1NZB A;  2KOB A;  1PVQ A;  3NKH A;  3C28 A;  2KKP A;  1KBU A;  1A0P A;  2KJ5 A;  2KJ9 A;  4CRX A;  5DCF A;  2KJ8 A;  2CRX A;  3LYS A;  1MA7 A;  3MGV A;  4DKS A;  1PVR A;  1PVP A;  2KKV A;  2KHQ A;  1AIH A; 
#chains in the Genus database with same CATH topology
 4DQS A;  3CNH A;  2PFN A;  5KFF A;  5DDY A;  5AI0 A;  2Y1J A;  4M47 A;  5AI6 A;  5EE3 A;  3UMB A;  1K1Q A;  4ECZ A;  1ZJN A;  2ZIW A;  4KX5 A;  5DGB A;  3KHH A;  4DF8 A;  2HOQ A;  4P0P A;  2YMQ A;  4GXK A;  1SL1 A;  1ZD4 A;  2H5X A;  3HKZ C;  2C22 A;  1PK1 A;  3ETR A;  4O3P A;  1ZQP A;  4KN4 A;  2GLE A;  4OO1 J;  3VCB A;  2BCR A;  9ICI A;  3NKH A;  2JRZ A;  2MUT A;  1NK4 A;  4K4H A;  2H3Z A;  2F76 X;  2VJ4 A;  3PW7 A;  4F43 A;  5AM1 A;  2KKV A;  5J2C A;  3K1Z A;  1X42 A;  3GV5 B;  4UAT A;  4Y2X A;  5AI9 A;  4O3N A;  2IMW P;  2A3V A;  1ECW A;  3RRH A;  4C8L A;  3PW2 A;  2R8J A;  4DO9 A;  4J9S A;  3ICX A;  3PSP A;  3L4P A;  4YVZ A;  1BPY A;  4FZN A;  2JZB B;  3MR2 A;  1O08 A;  4M9N A;  3FYH A;  4DQQ A;  2F8L A;  2XY6 A;  4I2E A;  4B6J A;  4EZ9 A;  2E1F A;  4EEK A;  2W55 A;  2JEF A;  8ICI A;  1A77 A;  3VCF A;  2JEJ A;  3OPX A;  4F72 A;  1J97 A;  4I2B A;  2AGP A;  5KFU A;  5AKL A;  3PR4 A;  4DLG A;  1X2I A;  3IG8 A;  3TAC B;  3RBD A;  4GFJ A;  1BVS A;  5AHX A;  2M9N A;  3N4M B;  4R8U A;  2WF5 A;  1SL0 A;  1L8L A;  1B4F A;  4DQR A;  1RDF A;  4QZH A;  2ISP A;  5ALR A;  4UB8 U;  3KFU F;  5GTI U;  2LM4 A;  1ZQZ A;  2XIC A;  3DV9 A;  3QUQ A;  3GDX A;  3LDA A;  5BOM A;  2FMS A;  3BQ2 A;  4TQS A;  2A19 A;  1UA0 A;  4GXI A;  3PX4 A;  2QKQ A;  3RH4 A;  8ICV A;  1N2X A;  4BX9 C;  7ICJ A;  2RQ5 A;  2ZIX B;  2HHW A;  3H40 A;  3JPT A;  1COK A;  3OTQ A;  1Z00 B;  4YFK A;  2ZJA A;  8ICQ A;  5AKK A;  5AKZ A;  3C2L A;  4YR2 A;  2GOL A;  3PX6 A;  5C0Y A;  1A6S A;  4QZI A;  2IBK A;  2KE7 A;  3ZD8 A;  4ZH4 A;  5L1I A;  4QJF B;  3Q8R B;  3UXO A;  3H4D A;  5AKE A;  2ASJ A;  2BCQ A;  2H3V A;  4LZD A;  4KLU A;  3M6K A;  1VDV A;  4NY8 A;  2KEY A;  4JMU A;  4RQ1 A;  5KG3 A;  4I2C A;  1T3Q A;  1SV0 C;  3T79 A;  5D46 A;  2NYV A;  4ECR A;  3NGD A;  1S77 D;  5KNI A;  2BQR A;  1IG6 A;  5GTH U;  5FP0 A;  8ICA A;  2B6G A;  2KSO A;  4IR1 A;  1MSW D;  5AIA A;  3U26 A;  4JWM A;  3TAR A;  4UQG A;  1LV5 A;  2LPE A;  3RJG A;  8ICO A;  3IRU A;  1PK3 A;  3F2D A;  4B9T A;  4FZM A;  2YN4 A;  1LKY A;  3C21 A;  3F5E A;  5HML A;  4F71 A;  4EBD A;  2JGA A;  1Z1B A;  4TUR A;  1NK5 A;  1SL2 A;  1CRX A;  2K89 A;  3B0Y A;  3KZX A;  4Y2S A;  3NUQ A;  2BZF A;  4F2S A;  1SKS A;  5J0Y A;  3M8R A;  3FAH A;  4NJ8 A;  4UAY A;  4O5C A;  3GFK B;  8ICY A;  2ZIU B;  5CP2 A;  4C80 A;  4KX3 A;  1HUO A;  1JRO A;  4YD1 A;  3O0F A;  5ALO A;  4ECX A;  2CXY A;  3WK7 A;  2YX8 A;  4YCX A;  4MEX A;  4ECW A;  1S76 D;  4NLC A;  3RJK A;  3GIK A;  1TK0 A;  1FFU A;  2BQU A;  1OW5 A;  1SV4 A;  5KFZ A;  4F5Q A;  5J2F A;  1NKE A;  2E3T A;  4O0I A;  5J0O A;  3A0B U;  2NO5 A;  5AK5 A;  4UB6 U;  2W9C A;  3BDP A;  4PHD A;  2R8H A;  5IIO A;  4RUC A;  2RDJ A;  3E2E A;  3UXN A;  3PML A;  1NJZ A;  5ALV A;  1MN8 A;  4BXO A;  4F92 B;  4TQR A;  3HT3 A;  4PL2 A;  3WU2 U;  2EZZ A;  5KTQ A;  5TZV A;  3JPQ A;  2Y9T A;  5KG1 A;  5JTI A;  1XU4 A;  1YT3 A;  1LVH A;  2DL0 A;  4NM1 A;  3LYS A;  4FBU A;  2FJ6 A;  3ZDB A;  1AIH A;  5EWG A;  4US9 A;  4F5N A;  5EE1 A;  4B9N A;  3KBB A;  1BNO A;  1QCK A;  5J0S A;  4DS4 A;  3FC4 A;  2EZX A;  3PY8 A;  4JK1 A;  4G9B A;  4DCC A;  3RB6 A;  5DCF A;  2EAN A;  1IIP A;  4M9H A;  4Q45 A;  2ES6 A;  4PHE A;  3F2B A;  2KFN A;  2FLL A;  4I29 A;  5AK4 A;  3GIL A;  2KZZ A;  9ICH A;  1JXE A;  4YQW A;  3I76 A;  1QQ5 A;  4NV0 A;  5J2D A;  3V7L A;  1EXN A;  4UB4 A;  1T94 A;  2I9G A;  3V6J A;  4RQ7 A;  4RQ0 A;  2PFP A;  3WK8 A;  3IV6 A;  2F44 A;  3GIJ A;  2FI1 A;  1ZQX A;  3BQ1 A;  2C2R A;  3QUB A;  4ECV A;  4ELT A;  2P66 A;  5DGA A;  4JB3 A;  2XC9 A;  1F5S A;  2JH7 A;  2ZIV A;  1OUQ A;  3PNC A;  1Q3U A;  4YR0 A;  2W9B A;  9ICS A;  5ALJ A;  2LYH A;  1P4E A;  4BWM A;  5KFI A;  1TE2 A;  1NZP A;  3KTQ A;  2KJ8 A;  4PJ0 U;  3ZDE A;  8ICN A;  5DDM A;  3M9N B;  3J81 j;  3D2N A;  2KIW A;  4Z6F A;  5KFC A;  1DK2 A;  5KT7 A;  3OHB A;  1S0O A;  3IP4 B;  1PUZ A;  5KAI U;  1ZQO A;  4J9P A;  5KT5 A;  3ZDC A;  2A1A A;  1KRP A;  1IXR A;  2HMX A;  5T14 A;  2FPM A;  1UPH A;  2EH9 A;  5F9N A;  3GIM A;  3TAD C;  3C5G A;  9ICN A;  4KLO A;  3V72 A;  3DDH A;  4EEL A;  4UBB A;  7ICU A;  3K4G A;  2J6T A;  2NV3 A;  4F5R A;  3E58 A;  2DPJ A;  1TV9 A;  2W9M A;  5G5G A;  5ALI A;  2VA2 A;  1WUD A;  5BPC A;  4F5O A;  2E5S A;  4DSF A;  5DLF A;  4DS5 A;  1NNL A;  2Y0S F;  1ZQY A;  1Z4O A;  1COO A;  5KT3 A;  3RH5 A;  4Q43 A;  4RQ8 A;  1URJ A;  3BZK A;  2LBO A;  5CA7 A;  8ICL A;  2MRL A;  4UB1 A;  2BPC A;  2BCS A;  5KFM A;  1NJX A;  4EEY A;  3LVW A;  4NL9 C;  1ZOL A;  3H8S A;  4P4O A;  4Z6D A;  2AXT U;  2FPL A;  1L7O A;  4RNM A;  1XC9 A;  3A0H U;  2BPG A;  1RYU A;  2P6R A;  1KQQ A;  2KHV A;  4PPX A;  3TFR A;  1NK8 A;  3AQE A;  4OJ5 A;  1SIJ A;  3UMC A;  2W8K A;  4J9M A;  5DKW A;  4QWB A;  3ZDA A;  4IRC A;  3F53 A;  4X5V A;  1JRP A;  2MSN A;  1KKX A;  1NJW A;  3RFA A;  2QAR B;  4NLB A;  4R63 A;  8ICM A;  2H3Q A;  1L3V A;  2GWS A;  3LVV A;  2OM6 A;  4C8N A;  2HHV A;  1SGG A;  2HHT A;  4E0D A;  4DSL A;  1NKB A;  4DWP A;  1UT5 A;  3QNM A;  1D9F A;  9ICM A;  3K1R B;  1Q46 A;  2R18 A;  2V6E A;  1BGX T;  3KHR A;  3UPQ A;  1RYR A;  2XCP A;  4P4M A;  1QSY A;  3SV3 A;  1M6X A;  2W04 A;  4J03 A;  1L7N A;  5D4B A;  4F4X A;  4M9G A;  5J2I A;  4QWD A;  3EUB 2;  3PMN A;  3T5J A;  1DGS A;  4NLN A;  4LJX A;  9ICW A;  4EYI B;  4KMO B;  5H2F U;  8ICG A;  4USA A;  3IN5 A;  4RQ2 A;  4F50 A;  5EE9 A;  5ALE A;  4TUQ A;  2ZTD A;  2K4I A;  4QIW F;  4DL6 A;  1SWV A;  1ZQE A;  5KL8 B;  2ZUC A;  4IQW A;  3MR5 A;  4Y2J A;  4RPZ A;  3UMG A;  1ZJM A;  4UAV A;  1SZP A;  1QSS A;  3RR8 A;  4QZF A;  3QZ7 A;  2PKE A;  2ZXH A;  2E8O A;  1KEJ A;  1ZQA A;  2BPF A;  1MQ3 A;  2CN1 A;  2VA3 A;  2JR5 A;  1RG6 A;  2DKZ A;  4US8 A;  4C8K A;  3WKC A;  4ED1 A;  1TAU A;  4C0Z A;  4F4W A;  2UVW A;  2DUY A;  4XRH A;  1TAQ A;  4RU9 A;  4M0A A;  4UB2 A;  3AQF A;  4DF4 A;  1KL9 A;  4RPX A;  2A1J A;  2KMD A;  5AIC A;  3LWM A;  2AU0 A;  4RNN A;  2KJ9 A;  3EYZ A;  3C5F A;  2UVU A;  4KLQ A;  1ZRM A;  2YB1 A;  2VAN A;  4DL3 A;  2XI9 A;  3GV8 B;  4RT3 A;  4EZ6 A;  1V97 A;  2HI0 A;  4F41 A;  2WFA A;  4YN4 A;  4ED3 A;  4JV2 A;  3OSP A;  4OJP A;  3R9K A;  3NRZ A;  4OCZ A;  2IHM A;  4DEZ A;  3C1Y A;  1KFD A;  3PW5 A;  4KLM A;  9ICG A;  2E8P A;  8ICH A;  3TAD A;  4NLZ A;  2V4R A;  4IQV A;  5KT4 A;  5EWF A;  5DOR A;  4GXJ A;  3RRG A;  5KFD A;  1U49 A;  2O6K A;  2DFL A;  4E10 A;  5DQG A;  2KTQ A;  1AE9 A;  3EPG A;  7ICG A;  2DBY A;  3BJY A;  1VJ5 A;  1B43 A;  1KSP A;  9ICO A;  1DOQ A;  1X6I A;  1QLN A;  2AQ0 A;  9ICA A;  2N1R A;  4R66 A;  2FLN A;  1FEZ A;  2G5H B;  4DFJ A;  4UW9 A;  4DOA A;  2BGW A;  1XSP A;  3Q8M A;  3LWL A;  3KZI U;  2ZIW B;  4P2H A;  9ICF A;  2NRT A;  4P0P B;  1T3N A;  2HBJ A;  1S8O A;  1N48 A;  4NL9 A;  1PK1 B;  1HIW A;  3QZ8 A;  2DWQ A;  3PW4 A;  4J9Q A;  2D6F C;  3LK9 A;  3UQ0 A;  3TQ1 A;  5CB1 A;  4ACO A;  1TFR A;  3NTU A;  2MUT B;  1ZD3 A;  2FDR A;  3NVZ A;  4I28 A;  5KFQ A;  3THV A;  5ALU A;  1Y88 A;  4J9L A;  5TIS U;  5ALH A;  4F2R A;  5ALF A;  4FS1 A;  1ZQM A;  8ICB A;  4F91 B;  2FMP A;  4I2F A;  4NLG A;  2DQN B;  3TKA A;  2PI4 A;  4EBE A;  3TI0 A;  3V6K A;  4DOC A;  8ICJ A;  3AUO A;  5CWR A;  4RPY A;  1SKR A;  2KG5 A;  5KFE A;  4DFM A;  2IHN A;  3MGI A;  1N56 A;  2EAO A;  1P4E C;  4GIB A;  2JH1 A;  3WKD A;  2PI5 A;  2YMP A;  4EX7 A;  2KKP A;  2J6U A;  3QUT A;  2BHN A;  3AMZ A;  3N28 A;  4C7Y A;  3SEI A;  4AYB F;  2ZUD A;  1JIH A;  2EAM A;  5KG5 A;  3WKA A;  5HR6 A;  3OJS A;  4C4S A;  3UXP A;  2WF9 A;  5C6K A;  3B0X A;  2EZY A;  1N61 A;  2RP5 A;  2NRZ A;  5AM3 A;  2WAQ C;  2WTF A;  5DLG A;  3ONN A;  4IR9 A;  1XO1 A;  5KFW A;  9ICC A;  3EWA A;  1JXL A;  1PZN A;  3AM9 A;  4ED7 A;  4Q44 A;  4I2D A;  4R8U B;  1UA1 A;  4DLE A;  1L3S A;  2OYY A;  5ALT A;  3ORY A;  2JEG A;  2XGP A;  1TKD A;  5KFJ A;  3PO5 A;  3PO4 A;  1FO4 A;  3HPO A;  1S10 A;  1WWU A;  3UM9 A;  1ZQD A;  5KAF U;  2XVT A;  4JV0 A;  2OCE A;  3CP8 A;  5AM0 A;  2WB1 C;  2W9A A;  1KFT A;  3N7S C;  4DOB A;  2YTU A;  2AHO B;  4QZD A;  5HMM A;  3WKE A;  4KLG A;  4OD0 A;  5J2E A;  2ATL A;  2LM1 A;  4YMO A;  3V7K A;  2GH1 A;  4O3O A;  7ICK A;  3EW9 A;  2XY5 A;  3RB0 A;  5J2G A;  2AGQ A;  1XSL A;  2QB0 A;  5KFY A;  4MFA A;  2MA1 A;  5D49 A;  2ZJ5 A;  3M9M B;  1NK9 A;  1ZQU A;  4NM2 A;  2UVV A;  3PW0 A;  2KNJ A;  2PMZ C;  2HHU A;  2W3S A;  5KFX A;  2XY7 A;  3AU2 A;  9ICL A;  5EE0 A;  1MQ2 A;  3TAP A;  1XO0 A;  3MDA A;  5J2K A;  1ZD2 P;  4BDP A;  1ZXI A;  4FFD A;  4YP3 A;  4RZR A;  3HRD D;  2BKE A;  4RQ4 A;  3SI8 A;  2NRX A;  3QE9 Y;  3Q8K A;  1X9M A;  2LMR A;  2BDU A;  4J9N A;  4MFF A;  5KFH A;  7ICN A;  2XO7 A;  4YG2 A;  4QNL A;  2HHQ A;  1B0X A;  2G08 A;  2BCV A;  3SYZ A;  9ICK A;  1D8B A;  4Z6E A;  1OXJ A;  3BS7 A;  1LKY B;  3H0R B;  2ESE A;  3FDS A;  4PH5 A;  1S0M A;  3TAN A;  1UCV A;  1PVQ A;  3K75 D;  3QEA Z;  1V38 A;  4Y2Q A;  5ALS A;  1M6X C;  5CHG A;  2I1Q A;  4YXM A;  5J0U A;  2W7O A;  4O9M A;  2NO4 A;  2Y9U A;  1J2N A;  2RHF A;  4FS2 A;  1S9F A;  2HOI A;  9ICJ A;  5ALW A;  3UQ2 A;  4DQI A;  4Y2P A;  1JI7 A;  2W03 A;  1WCN A;  2EAP A;  2VIX A;  1HJP A;  1JX4 A;  1T8E A;  5AK3 A;  3HWT A;  4QZA A;  1KFS A;  9ICB A;  4EEN A;  7ICE A;  1K5O A;  3C29 A;  7ICT A;  3QU7 A;  2MAX A;  4CDG A;  1ZQH A;  4FZL A;  2W11 A;  3MBY A;  2AQ4 A;  4IC9 A;  3OHA A;  2W9C B;  2YML A;  1IM4 A;  1RYS A;  1PVP A;  4EYH B;  1LB2 B;  4DSI A;  4M2Y A;  4ZOH C;  1RXV A;  4BXO B;  5DG8 A;  2KIV A;  3HJE A;  3PVX A;  1U4B A;  4RNO A;  1P7D A;  4O5E A;  4O3R A;  8ICZ A;  2R8K A;  4BWJ A;  5KFK A;  4O3S A;  4RQ5 A;  4KMU A;  3PR5 B;  8ICR A;  3ETL A;  2HVH A;  3AU6 A;  1KLN A;  2W3R A;  3G6V A;  3AEV A;  2B21 A;  4QW8 A;  1N60 A;  1O03 A;  1XNS A;  2K8B B;  3WKB A;  2ZXI A;  4RQM A;  2YB4 A;  1BNP A;  3D2S A;  4M6W A;  3GII A;  4JWN A;  3ZDD A;  4QWC A;  1XWL A;  2PXI A;  2J6S A;  5IIM A;  1BPB A;  2KIC A;  4HAI A;  3M6Z A;  5J2A A;  1UT8 A;  2HHS A;  1X40 A;  4KLL A;  1ZQG A;  1ZQJ A;  5J8Y A;  3OGU A;  1TK8 A;  4ELV A;  7ICL A;  7ICF A;  1RQL A;  3G6X A;  3M1Y A;  4KLJ A;  4PGX A;  1MC8 A;  1X9W A;  2YQE A;  2BCU A;  5KG2 A;  2DF4 B;  1IV8 A;  1DGJ A;  4P0Q A;  1L3T A;  3RJJ A;  1Z4N A;  5CEH A;  1J2M A;  2KVS A;  4HYK A;  2KJ5 A;  4E0G A;  7ICI A;  5KFT A;  1WCL A;  1TVA A;  4YD2 A;  3RB3 A;  3TFS A;  2ZIV B;  3MR3 A;  1F44 A;  9ICT A;  2Z7J A;  3S6J A;  1HEK A;  4OJL A;  5DQI A;  3QEB Z;  3SAF A;  4ED0 A;  4KLH A;  4MFC A;  3V6H A;  5ALZ A;  3SAG A;  5G5H A;  3KKA A;  3BQ7 A;  1BPD A;  1SXD A;  4GC6 A;  4G3I A;  3M7D A;  1SXE A;  2F3N A;  2OEH A;  5HR7 A;  1ZQR A;  2PFO A;  2F1H A;  2OHF A;  4XUS A;  1WYG A;  3C23 A;  2I5H A;  3F5A A;  2V4Q A;  2ZUB A;  5AK6 A;  3GV7 B;  3RB4 A;  3RBE A;  4QZC A;  9ICR A;  1N63 A;  1SWW A;  2ODG A;  2Y0S C;  5KT2 A;  3G6Y A;  3OSN A;  2AH5 A;  4LZG A;  1QQ7 A;  3BS5 A;  7ICP A;  3NRW A;  1ZQB A;  5L1K A;  1BPX A;  4E0Y A;  4RT2 A;  1N62 A;  4DFK A;  3RR7 A;  5KG0 A;  1B22 A;  1ZET A;  9ICU A;  4J9R A;  4E0P A;  4UAU A;  4E0Z A;  2LKY A;  4IQU A;  1V85 A;  1KBU A;  4PGQ A;  4PHP A;  2E8N A;  3C2M A;  2RLT A;  4KLD A;  4PZO A;  1D8L A;  5KFO A;  1L8O A;  3PZP A;  5ALG A;  4BJQ A;  4IRK A;  4I2A A;  2AGO A;  3H8M A;  3Q8L A;  4I2J A;  2K8A A;  4UAR A;  1NK0 A;  4C4T A;  3L5K A;  5ALM A;  4QW9 A;  4B9U A;  1SZH A;  9ICQ A;  3MAB A;  3IDW A;  2KV2 A;  2VKQ A;  5CR0 A;  3Q8S B;  5DB8 A;  4IQT A;  4DWI A;  1CUK A;  4ECY A;  3DEE A;  3RJE A;  3EZ5 A;  4RQN A;  2ZTC A;  2Y1I A;  2W43 A;  3MGV A;  3BQT A;  1K1S A;  3ISD A;  2G07 A;  5CJ7 A;  3QX7 A;  4CCH A;  4U7C A;  2IOH A;  1FLO A;  3QXG A;  4QZG A;  3HKZ F;  2ASD A;  1KTQ A;  4ECS A;  1X9X A;  3HP6 A;  1NK6 A;  4PHA A;  3SR6 A;  4QIW C;  1RZT A;  4Y2Y A;  5KT6 A;  4ECU A;  4CGZ A;  1ZQV A;  2JZB A;  4QZ8 A;  5IIN A;  5JU5 A;  4KTQ A;  2EQY A;  2F1J A;  4RQ3 A;  2P35 A;  1YZ6 A;  1UHU A;  4Y2T A;  4DL2 A;  8ICP A;  2KP7 A;  1JN3 A;  1C7Y A;  4Y2U A;  5HHI A;  2E1E A;  3SAH A;  3JPN A;  5JUM A;  4C8O A;  1XSN A;  1HUZ A;  1ZQL A;  4O3M A;  3KHL A;  4F4K A;  2KZ3 A;  5AM2 A;  1BPZ A;  4UAW A;  2BDP A;  1L7P A;  1T4G A;  2ZG6 A;  4CE6 A;  1ZD5 A;  2G5I B;  3SMV A;  2JXJ A;  5KFB A;  3H4B A;  2A1J B;  2ZIX A;  1Z00 A;  4R64 A;  9ICP A;  3RTV A;  3IG5 A;  3H7I A;  5EOZ A;  5KFP A;  3ED5 A;  2EDU A;  4F3O A;  3C28 A;  3SQI A;  4B9L A;  1ZQC A;  2DPI A;  3N97 B;  7ICQ A;  5DBA A;  2DGZ A;  1Z1V A;  1ZQT A;  4YXJ A;  4KIT B;  3RAQ A;  2ZJ8 A;  4IRD A;  4XA5 A;  3MFH A;  4K4I A;  4MF2 A;  4ED6 A;  2VJ5 A;  4C4R A;  4KLS A;  1ED1 A;  5AKX A;  4CF3 A;  5F3X B;  1ZQQ A;  3H8W A;  2CPR A;  4BGD A;  2HBK A;  4O3Q A;  5HP4 A;  5DB9 A;  1GO3 F;  8ICS A;  4K4G A;  3HX0 A;  2W54 A;  5JRT A;  2FPK A;  5IIL A;  2W8L A;  4CNQ A;  8ICW A;  3F2C A;  2LYA A;  2WAQ F;  4NWI A;  3MFI A;  1SKW A;  2C2E A;  3SEN A;  3ALR A;  2K4H A;  5ALN A;  1S0N A;  3QUC A;  1KDH A;  2KFZ A;  3CRX A;  2RRD A;  1KW4 A;  5CRX A;  3Q8P B;  4FBT A;  2G0A A;  1M6Y A;  1L5U A;  5KFS A;  4UAZ A;  1WG8 A;  1QQ6 A;  5AKJ A;  3T5L A;  3RH6 A;  2Q4T A;  4XQ8 A;  5DG9 A;  1S5L U;  2WF8 A;  2WB1 F;  2K8C B;  1U48 A;  4IS7 A;  1N5X A;  3AL0 B;  2NRV A;  5J8Y C;  3C2K A;  2XCA A;  4I2I A;  2ZIU A;  2D8C A;  4DSE A;  4CF5 A;  8ICC A;  4KLF A;  2ZTE A;  2BR0 A;  2HOF A;  3HIL A;  2KD1 A;  1RXW A;  2R8I A;  3JPP A;  1CI4 A;  4YMM A;  5ALK A;  2WF6 A;  4AYB C;  2L5Y A;  3WK5 A;  1BPE A;  1H38 A;  2PMZ F;  4CF4 A;  1S97 A;  1NI3 A;  5C5J A;  5AM4 A;  4ECQ A;  3RAX A;  3MR6 A;  2WHE A;  4MEY A;  2YMM A;  2F8K A;  3V7J A;  3AN1 A;  4GLX A;  5K4L A;  1TAM A;  1Z19 A;  5AKG A;  4PGY A;  4ICA A;  2OWO A;  2C28 A;  1A76 A;  4QZB A;  4QWE A;  2C2D A;  5DBC A;  3H0M B;  3PSI A;  3KKA C;  3M9O B;  1S0V A;  2VA8 A;  2LI6 A;  2M0N A;  3H0L B;  2QB1 A;  4Q8E A;  4KN7 A;  4NLK A;  2UVR A;  5L1J A;  1NZB A;  4LVS A;  4OJO A;  4F8R A;  3D2Q A;  4CRX A;  2KSO B;  3WK4 A;  3NS1 A;  2JMG A;  2W7P A;  3SD7 A;  1MA7 A;  2IA6 A;  8ICE A;  2E8M A;  2H3F A;  3SZ2 A;  4GC7 A;  7ICO A;  3PST A;  1KN5 A;  3IM1 A;  2ALZ A;  2HCF A;  4DFP A;  2F77 X;  2LHT A;  3I28 A;  1A0P A;  1JMS A;  1RPL A;  2QB0 B;  4M9J A;  5KFA A;  4QZE A;  1QH9 A;  2ASL A;  2OH2 A;  4DL4 A;  3RJI A;  2JEI A;  5KFV A;  3ISB A;  4MHV A;  1X6J A;  3NVW A;  5ALL A;  3M8S A;  2QLT A;  2JV3 A;  2KK0 A;  7ICM A;  3E0F A;  2P6U A;  3PSF A;  1JUD A;  4RUA A;  3JPR A;  5DBB A;  4EBC A;  4M9L A;  4R65 A;  2IOF A;  3ZD9 A;  3MDC A;  4QZ9 A;  1NOM A;  4Y2R A;  5J29 A;  5J0W A;  2MU2 A;  3BZC A;  5J0R A;  4DFD A;  3I1Y A;  1DXS A;  5F9L A;  2FMQ A;  1SB3 C;  9ICX A;  8ICF A;  2BQ3 A;  2RDI A;  1T7P A;  5DB7 A;  3KHG A;  3KD3 A;  2I6X A;  4I2G A;  4ECT A;  2LYB A;  2V9W A;  4B9S A;  4BUG A;  5ALQ A;  1FFV A;  3QU4 A;  1X66 A;  3C1Z A;  5J0Q A;  2H3I A;  3IHQ B;  1L7M A;  5J2J A;  5HNK A;  4U6P A;  1ZRN A;  4TUS A;  3EPI A;  5HHH A;  1CEZ A;  2KVC A;  4JUZ A;  5J0T A;  4Q8F A;  1NKC A;  3OJU A;  3T5K A;  5AKI A;  4UB3 A;  1DRG A;  3KOO A;  7ICH A;  5J2B A;  4TUP A;  5L1L A;  2KOB A;  1QSL A;  4DQP A;  4B9V A;  3SV4 A;  1F0M A;  1U45 A;  5A0L A;  3RJH A;  2WF7 A;  4Z6C A;  3NAS A;  4J9O A;  3RJF A;  5L9X A;  8ICK A;  5ALP A;  2Q0Z X;  2K4P A;  4DL7 A;  1SV0 A;  3N7P D;  2HW3 A;  3UXU A;  2G06 A;  3WK9 A;  5B5E U;  5KL1 B;  4UBC A;  2PFQ A;  1QTM A;  5KFL A;  4AP9 A;  2KN7 A;  1D8Y A;  3T5H A;  5KG7 A;  1WWV A;  4MF8 A;  2FE9 A;  1JAL A;  1PVR A;  4DSK A;  3L3F X;  4B9M A;  4FO6 A;  2HDO A;  3GQC A;  1N5W A;  3QU9 A;  3CW2 C;  1V9P A;  3QYP A;  2W9B B;  1L3U A;  8ICX A;  2QAR A;  5AI5 A;  3ZI4 A;  2D3D A;  2FLP A;  5KFG A;  1ZQF A;  1Q8K A;  2ISO A;  5III A;  4ELU A;  2K60 A;  4QWA A;  3QU2 A;  5KFR A;  4ED8 A;  1FIQ A;  5AI4 A;  4DKS A;  2JHD A;  4PZN A;  4F5P A;  2R8G A;  4M6W B;  1NJY A;  5AKY A;  4A8E A;  4I27 A;  4EX6 A;  4C8M A;  3PV8 A;  4E0J A;  2F1I A;  5BOL A;  1U9L A;  5ALD A;  4KLE A;  3BQ0 A;  4UB5 A;  1D9D A;  2B0C A;  2HVI A;  5KFN A;  5J2H A;  7ICR A;  2AJQ A;  1TK5 A;  4F4Z A;  5J0X A;  2DKX A;  3NVY A;  2CRX A;  4M04 A;  4KLT A;  2HSZ A;  4O5K A;  5AKH A;  1AQ6 A;  1L6N A;  2F2A B;  1RQN A;  4P0Q B;  4IL6 U;  5EWE A;  1Q3V A;  4OJ6 A;  4PL1 A;  5DQH A;  4WJ3 B;  3WK6 A;  3CYM A;  4I2H A;  5L1M A;  1YZ7 A;  4JV1 A;  5ALY A;  1U47 A;  1ZYQ A;  1ZQS A;  4FE3 A;  1ARO P;  3VC8 A;  2KHQ A;  5IIK A;  5DG7 A;  3GU3 A;  2HHX A;  2HBM A;  4KLI A;  3MC1 A;  2NRW A;  1ZQ1 C;  4DL5 A;  4J9K A;  2OXO A;  7ICV A;  1DK3 A;  4F93 B;  3JPO A;  3N7R C;  5DB6 A;  8ICU A;  3D6J A;  1ZQK A;  5AIB A;  4NXZ A;  3T3F A;  2G09 A;  3RF9 A;  5KG4 A;  5J0P A;  2XGQ A;  1C20 A;  2XID A;  1Z3E B;  2YY6 A;  5AI8 A;  3PX0 A;  4DSJ A;  4UAS A;  4Y2V A;  3MGH A;  1XS9 D;  3QU5 A;  3Q8Q B;  8ICT A;  7ICS A;  2K4E A;  5IIJ A;  1X9S A;  3BS5 B;  3JPS A;  3FM9 A;  2HBL A;  3ISC A;  1ZQW A;  3GZF A;  1VLB A;  3NVV A;  4YMN A;  5E79 U;  9ICV A;  1NK7 A;  5ALX A;  5AM5 A;  4RQ6 A;  5B66 U;  4YR3 A;  4F4Y A;  1ZQN A;  2KZM A;  4C7Z A;  3H8J A;  3B9J A;  1ZQI A;  9ICE A;  2GO7 A;  3HW8 A;  1RM6 C;  4ED2 A;  1UQV A;  3TAQ A;  4P4P A;  5KG6 A;  2IOF K; 
#chains in the Genus database with same CATH homology
 2G5H B;  2JGA A;  2K4I A;  4GFJ A;  4QIW F;  2RRD A;  4U6P A;  1Z1B A;  3CRX A;  5CRX A;  2Y0S F;  1M6X C;  2KVC A;  4O3M A;  2G0A A;  3PST A;  3F2B A;  1L6N A;  2F2A B;  3PZP A;  5KL8 B;  4BJQ A;  1CRX A;  4P0Q B;  2W7O A;  2F77 X;  1A6S A;  3KFU F;  1Q3V A;  1DRG A;  2K89 A;  2RHF A;  2LHT A;  2ZIW B;  2DF4 B;  3KZX A;  2XIC A;  4OJ6 A;  2XVT A;  3NUQ A;  4PL1 A;  4NV0 A;  1URJ A;  2N1R A;  2ZG6 A;  2ZXH A;  2LBO A;  2HOI A;  4P0P B;  3CP8 A;  4P0Q A;  2Q4T A;  2WB1 C;  2HBJ A;  4WJ3 B;  2G5I B;  3N7S C;  1T94 A;  2K8A A;  2KOB A;  3SMV A;  2CN1 A;  2ZIW A;  2MRL A;  1A0P A;  2KJ5 A;  3CYM A;  4KX5 A;  2WB1 F;  2K8C B;  3LVW A;  2HOQ A;  1SZH A;  2ZIU B;  2W03 A;  4BX9 C;  5A0L A;  4P0P A;  3AL0 B;  2VIX A;  4KX3 A;  2ZIX B;  4FE3 A;  1HIW A;  4C0Z A;  3O0F A;  3VC8 A;  2KHQ A;  2GH1 A;  2ZIV B;  2D6F C;  1F44 A;  2KV2 A;  2Z7J A;  2ZIU A;  2VKQ A;  1HEK A;  4OJL A;  2YX8 A;  3HKZ C;  3GU3 A;  2ZIX A;  2OH2 A;  2HBM A;  2GOL A;  3AQF A;  3N7P D;  2JH7 A;  2KHV A;  3SAF A;  5C0Y A;  2ZIV A;  4ACO A;  1OUQ A;  1Q3U A;  3AQE A;  2G06 A;  4OJ5 A;  2HOF A;  2MA1 A;  1ZQ1 C;  3IG5 A;  2KD1 A;  3C29 A;  5KL1 B;  4NLC A;  1P4E A;  2OXO A;  4CDG A;  4OO1 J;  3DEE A;  4FZL A;  3VCB A;  3N7R C;  4AYB C;  3NKH A;  2KNJ A;  2PMZ C;  3C28 A;  3SQI A;  3E0F A;  2KJ9 A;  4IC9 A;  3SAG A;  3F53 A;  2KJ8 A;  4QJF B;  3PSF A;  2PMZ F;  2H3Z A;  2DGZ A;  2F76 X;  2G09 A;  2VJ4 A;  2YB1 A;  3RF9 A;  3MGV A;  1PVR A;  1PVP A;  2KKV A;  3L3F X;  3RFA A;  2XID A;  3K1Z A;  4NLB A;  2H3V A;  3M7D A;  2XI9 A;  2G07 A;  2DQN B;  2H3Q A;  3M6K A;  3UXU A;  5HR7 A;  3D2N A;  2KIW A;  4U7C A;  2KEY A;  4JMU A;  1ECW A;  1XO0 A;  2A3V A;  2VJ5 A;  3LVV A;  1FLO A;  3T79 A;  1ED1 A;  2OM6 A;  1P7D A;  3HKZ F;  3IP4 B;  3F5A A;  4OJP A;  1TAM A;  1P4E C;  3ICX A;  4PL2 A;  1Z19 A;  2JH1 A;  2K4E A;  2HMX A;  4ICA A;  3PSP A;  2KKP A;  5T14 A;  2R18 A;  1YT3 A;  4FZN A;  2CPR A;  2HBL A;  2HBK A;  4QIW C;  3LYS A;  1UPH A;  2Y0S C;  3GZF A;  3H0M B;  3PSI A;  4AYB F;  4CGZ A;  1GO3 F;  2JHD A;  4DKS A;  2BDU A;  2F8L A;  1AIH A;  1M6X A;  2W04 A;  5HR6 A;  2E1F A;  5DOR A;  3NRW A;  4A8E A;  5C6K A;  2M0N A;  3H0L B;  1XNS A;  4QNL A;  2K8B B;  2G08 A;  2RP5 A;  2WAQ C;  1D8B A;  2ZXI A;  3F2D A;  2YB4 A;  3H0R B;  3ONN A;  3F2C A;  3D2S A;  2LYA A;  2WAQ F;  4NWI A;  1AE9 A;  3VCF A;  3OPX A;  2NV3 A;  2LKY A;  1NZB A;  2KIC A;  4OJO A;  3M6Z A;  2E1E A;  3ALR A;  4FZM A;  2K4H A;  2LYB A;  3SAH A;  1PVQ A;  1KBU A;  4KMO B;  3D2Q A;  4BUG A;  4CRX A;  5DCF A;  1WUD A;  3IN5 A;  3F5E A;  2E5S A;  2JMG A;  2W7P A;  2CRX A;  1IIP A;  1MA7 A;  3IG8 A;  2H3F A;  2H3I A;  2OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...