2A3VA

Structural basis for broad dna-specificity in integron recombination
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
319
structure length
313
Chain Sequence
GSQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGAIRIWQGKGGKNRTVTLAKELYPHLKEQIALAKRYYDRDLHQKNYGGVWLPTALKEKYPNAPYEFRWHYLFPSFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKTVTCHTLRHSFATHLLEVGADIRTVQEQLGHTDVKTTQIYTHSGVLSPLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad DNA-specificity in integron recombination.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar eltor str. n16961
molecule tags Recombination
molecule keywords DNA (31-MER)
total genus 91
structure length 313
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00589 Phage_integrase Phage integrase family
A PF13495 Phage_int_SAM_4 Phage integrase, N-terminal SAM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.130 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2a3vA01
1.10.443.10 Mainly Alpha Orthogonal Bundle hpI Integrase; Chain A Intergrase catalytic core 2a3vA02
2KKPA 1P4EA 1CRXA 1Q3UA 1MA7A 2KHQA 3LYSA 1AIHA 5DCFA 2KJ9A 2KKVA 4ACOA 1KBUA 3VCFA 1OUQA 5C6KA 5DORA 2KOBA 1PVPA 1DRGA 2KJ5A 2HOFA 1AE9A 1NZBA 4DKSA 2CRXA 2KD1A 4CRXA 2A3VA 3CRXA 1M6XA 1XNSA 2KEYA 3NRWA 3NKHA 1PVRA 1P4EC 2OXOA 1Z19A 3UXUA 1FLOA 1PVQA 2KHVA 1XO0A 1M6XC 3MGVA 1Q3VA 3C29A 1Z1BA 2KIWA 2KJ8A 2HOIA 4A8EA 1P7DA 1A0PA 5CRXA 1F44A 3C28A
chains in the Genus database with same CATH superfamily
3K75D 3GZFA 3ORYA 3NS1A 2W3SA 4EYIB 2K60A 1FFVA 8ICGA 3K1RB 1RYUA 1RYRA 4M2YA 2KSOB 3C21A 2HBJA 4MF8A 1L3TA 5J0OA 1PVRA 3F5AA 8ICKA 2HHTA 4BWMA 5ALHA 4M9JA 3TACB 2OHFA 2XVTA 4F41A 5F3XB 2W7OA 1ZQNA 2ISOA 3SAGA 1UHUA 4KTQA 2H3QA 1IXRA 2FPLA 3SR6A 9ICUA 2G09A 4Q43A 4IR9A 4DOCA 3OSNA 2JRZA 3SYZA 2K8CB 2PMZC 4U6PA 3QU5A 4ED2A 4Q45A 5KFKA 1NK5A 1PVQA 2DPIA 4B9VA 4YVZA 5E79U 3QXGA 5B5EU 4IRKA 1SIJA 4K4IA 4ZH4A 2IHNA 1S76D 3B0YA 5J2EA 2F2AB 4PHAA 4ECXA 1A6SA 1N62A 5DQIA 1BGXT 4MF2A 4ED1A 1M6XA 1SWVA 3GIKA 4PGQA 3OSPA 4O3RA 4KLIA 3M9OB 4J9RA 4KLTA 3MC1A 2W8LA 1L3VA 3JPTA 1NJXA 5KFNA 5HHIA 2VIXA 2VKQA 2XGPA 3VCFA 3WK8A 3WU2U 1N63A 5ALIA 5CA7A 2DBYA 5AK5A 2Y1IA 3PSPA 1LV5A 1L8OA 5KG4A 1X9SA 2KVSA 5AI0A 2WFAA 8ICPA 3HJEA 4KLQA 5AKIA 2VJ4A 3TI0A 1ZYQA 2NRXA 5K4LA 1J2NA 1ZQCA 5J0TA 5J0PA 4CGZA 4M04A 2BCSA 2GH1A 3RH6A 4Z6EA 1HIWA 3VC8A 3ZDAA 1T8EA 3LK9A 1B4FA 1NK6A 4M6WB 3M9NB 1ZQDA 2ZIWA 2G0AA 1ZQFA 1S0NA 3C23A 4GXJA 4ECUA 4ICAA 4NV0A 4C7YA 1JXLA 1KW4A 5AM0A 3T5JA 3AM9A 3RB4A 3H0LB 4I2BA 1ZQ1C 1T4GA 5TISU 5ALMA 1ZQJA 5KFCA 2FMPA 3OJUA 5KFZA 3K4GA 3SAFA 1TFRA 1SGGA 4QNLA 1KL9A 2MUTB 3N4MB 5KFHA 3QZ7A 4DL2A 5ALTA 9ICSA 5AKJA 3NUQA 3OTQA 5KT5A 5EE3A 2E8NA 3O0FA 5ALLA 4CF4A 3TFRA 5KG3A 5AKEA 9ICWA 3C29A 3I76A 1FFUA 2IOHA 4B9NA 4ECVA 2QB1A 1KFSA 3F2DA 1IM4A 4EBDA 2KZZA 1VDVA 1TAUA 2EAMA 9ICNA 1FO4A 4Y2JA 1KDHA 7ICMA 3H0RB 3GIIA 4TUPA 1SV4A 3QUCA 4KITB 4F92B 1AROP 3NVZA 5ALDA 5KG0A 4QIWF 2HI0A 4I2EA 3JPRA 2MU2A 2EAPA 2WF6A 2ZIUB 4P0QA 8ICRA 4IQWA 2HVIA 1T3QA 3MFHA 1QH9A 3T79A 1TK8A 5J0XA 5AKKA 4E0DA 2KEYA 3RJKA 7ICLA 5B66U 3HPOA 8ICOA 4ED0A 3TADA 1X9MA 3FM9A 2G07A 5HHHA 3M8SA 4KMUA 4ACOA 3NVVA 3QE9Y 2M9NA 3ETLA 2V6EA 3HWTA 1DGJA 1ZXIA 3RJEA 2NRZA 3RRGA 2YX8A 4OCZA 1UCVA 5KFUA 1KSPA 9ICTA 5EOZA 3H0MB 5J0YA 2E8MA 3FAHA 5JU5A 4PHDA 2BZFA 4NJ8A 5KG6A 5ALYA 7ICTA 3IRUA 2ZXHA 1NJWA 2QLTA 1UT5A 2HVHA 2DWQA 2KD1A 8ICLA 1Z4NA 4B9TA 5CWRA 1VLBA 5KFDA 9ICKA 5KFVA 4Z6FA 5J2AA 2W7PA 2FPKA 1RYSA 4U7CA 4IC9A 3WKBA 5DB6A 4C4TA 4DQIA 2RP5A 4FBUA 4KLFA 1NI3A 2W54A 4G9BA 1NK9A 2I9GA 2Z7JA 4B6JA 4QZIA 4NLBA 4O9MA 3HT3A 1JRPA 4C8KA 4F4XA 3GV8B 5AIAA 4DWIA 2VA8A 3JPOA 3WK4A 2NRVA 1NKEA 1UA0A 1S9FA 5ALPA 4M9LA 4ELVA 3OHBA 5KFMA 4B9MA 4PPXA 4BUGA 2IA6A 1C7YA 1NKCA 4FBTA 1Q8KA 3BJYA 3EPGA 3KHHA 3IHQB 4ED3A 2WAQC 5AHXA 4P4MA 1MQ2A 4Y2RA 1L7NA 2R18A 1XO1A 3WK7A 1UT8A 4KLEA 5CHGA 4RQNA 1XSLA 4J9MA 2W43A 4CCHA 3GV7B 1DK2A 1S97A 4DFKA 2AHOB 1K1SA 2MSNA 3Q8QB 4ECRA 4K4HA 8ICCA 2KHVA 5KFWA 1PK1B 4YP3A 4UATA 3E2EA 1BPXA 5DG9A 5L1IA 5DG8A 1BPEA 3HKZC 3DV9A 9ICCA 8ICYA 2H5XA 1ZQWA 1ZQEA 2ZIXB 5T14A 4DFPA 1XNSA 1IG6A 4KMOB 5JUMA 1XC9A 3I28A 3D2SA 1NJYA 2KICA 4I27A 1S5LU 2K4HA 5ALFA 2E1FA 3BQ0A 4RQMA 1Z3EB 2JZBA 5J2JA 3J81j 5L1MA 2R8HA 5KFIA 5JRTA 3PX6A 4KX5A 2W04A 7ICGA 4LJXA 1HJPA 1TAQA 3G6XA 2Y9UA 2FLLA 2I5HA 2K8AA 3GFKB 2UVRA 4Q8EA 3KFUF 4RNMA 5J2GA 3L4PA 2W9CB 2AQ4A 3QUTA 5KTQA 2W9AA 4O3PA 3V6KA 2AJQA 4OD0A 1WCLA 2QB0A 4KLJA 3MR5A 2QB0B 2ZJ8A 3H4BA 2HBLA 1IV8A 3AQFA 3UXOA 2V9WA 2J6UA 4P4OA 8ICWA 1S0MA 5HR6A 5DBBA 3WKCA 2WTFA 2PFOA 2VJ5A 1ZQIA 4I28A 2KHQA 3V72A 5J2DA 4RQ0A 2ASLA 3MBYA 4YMMA 2HOFA 3MGHA 4O3MA 5DGBA 5KFSA 3LDAA 3C5GA 3BS5B 1D8YA 4C4SA 3GDXA 3N7RC 2RLTA 3EUB2 5ALRA 5KNIA 4FZMA 2ZTEA 2GWSA 2YB1A 4RPXA 1O03A 3UQ0A 2YMMA 4KLDA 4I2GA 3SV3A 5J2HA 4DSLA 4NL9C 3PMLA 5KL1B 3SI8A 1ZQPA 2IOFA 4QW9A 3GILA 5J8YC 2KKPA 3UXNA 4I2FA 4DSJA 2H3IA 1DXSA 5J0RA 1SB3C 1ZQGA 4Y2XA 1ECWA 4ELUA 8ICFA 2FMSA 3T5HA 4DO9A 4DS5A 3QEBZ 5TZVA 4UBBA 1ZQSA 9ICOA 3LVVA 1SV0C 1BVSA 3UMGA 3G6YA 2HBMA 2XI9A 4C8OA 3PW5A 5ALQA 3EW9A 2E8OA 3PSIA 2HHUA 1L3UA 4XQ8A 3GQCA 4FS2A 3AQEA 4E0PA 4YFKA 3Q8MA 2F76X 4O3NA 2E8PA 5D4BA 4EEKA 3HRDD 5H2FU 2ZIWB 4C8MA 4BDPA 2H3ZA 2EZYA 4RQ8A 1J97A 1RZTA 3N28A 2G5HB 5KFXA 5J0WA 3KZIU 2EDUA 3M6KA 5L1JA 1KTQA 3BQ2A 5J2FA 5EE1A 5AI9A 1QTMA 7ICIA 1ZD4A 4IQUA 4PGXA 1RPLA 4QZCA 5DORA 2ZXIA 2AH5A 5AM1A 2W9BA 3ZDBA 1Y88A 1X66A 2CRXA 5AICA 4GXIA 4RNNA 1LKYB 3BQ7A 3BQTA 2AGQA 2FLNA 3KHGA 5DDMA 3TAQA 2UVUA 7ICEA 5AK4A 1L5UA 3LVWA 4DL7A 3UM9A 1NJZA 2LYBA 1ZQMA 2N1RA 1DGSA 4QWEA 2Q0ZX 3ZDCA 5GTIU 2KE7A 7ICPA 1HEKA 3PW0A 5EE0A 3HW8A 2NO5A 4J9QA 1NZPA 2BCQA 5L9XA 4UW9A 2MA1A 1U45A 1P7DA 4UB5A 4LZGA 5J0UA 2E1EA 2DQNB 4DLGA 2KJ9A 2P6RA 4PL1A 1RXVA 1NNLA 2H3VA 4XRHA 3AMZA 3OHAA 2A3VA 3B0XA 3H7IA 4O3SA 7ICHA 2ZTCA 4EEYA 2CPRA 2ZUBA 4QZ9A 2EZZA 1FIQA 2OH2A 2KN7A 1NK0A 2DFLA 4IRCA 4KLLA 2E3TA 4PJ0U 4Y2SA 3RTVA 5KFGA 4US8A 3PW4A 2QARB 1P4EC 2B0CA 4MEYA 4O3QA 3RAXA 3UMCA 4QWCA 1DK3A 1N60A 4EZ6A 5EWGA 5KG2A 3C28A 2RRDA 4GXKA 2NRTA 5ALEA 3QU4A 2I1QA 1BPBA 4F43A 4AYBF 4QWAA 3BZKA 1SZPA 4M9NA 1KKXA 4DL4A 2ZIUA 3PV8A 3SQIA 4DL3A 2MAXA 4F2SA 3C5FA 2WF8A 1YT3A 1S8OA 3SMVA 4XUSA 1L3SA 1ZQBA 1BPDA 5CRXA 3ALRA 5KFQA 4NL9A 1SL2A 4M9GA 3RB3A 4PZNA 4UAWA 1BPYA 4YXMA 1K1QA 5KAIU 4KLOA 1S10A 1RM6C 1ZQOA 5KFBA 2XO7A 5AKHA 1SL1A 2LMRA 3WKEA 3BZCA 4F72A 2FI1A 1F0MA 3NTUA 5F9LA 3LWMA 3DEEA 5DB7A 3UMBA 2A1AA 3JPNA 2DKZA 4PZOA 2W8KA 2JEGA 5KG7A 3EWAA 5KG5A 3SV4A 3QUBA 5KFEA 4FS1A 2NRWA 4DL6A 2Q4TA 5CEHA 3MFIA 9ICBA 1T94A 4IQTA 4B9SA 5ALSA 5DBAA 4DSKA 3ICXA 2JH1A 4NLGA 3HKZF 2BHNA 1M6XC 4A8EA 1JX4A 4DOAA 4UB3A 2ASJA 4F5RA 4I2IA 4DL5A 1YZ7A 3TADC 1D8BA 1KEJA 1N2XA 3M1YA 3MR2A 5L1LA 4G3IA 2XGQA 2R8KA 2BKEA 4DSEA 2F1IA 9ICLA 1S77D 4UARA 2JGAA 4XA5A 4MFFA 5J0QA 3F53A 3TFSA 1TK0A 1NK4A 4JMUA 4J9NA 2C2EA 1PVPA 4MHVA 2C2RA 4GLXA 2F44A 4CRXA 4YD2A 2XICA 2LI6A 5KFRA 4E0GA 9ICAA 3T5LA 5KT2A 4P2HA 1FEZA 5ALUA 1RQLA 1WG8A 3N7PD 1ZQZA 2ATLA 4IR1A 1ZQRA 9ICHA 3AEVA 7ICKA 1V38A 4EX7A 3PR4A 1ZQTA 2LM1A 2LBOA 1ZQXA 2YQEA 2J6SA 3OPXA 1BNOA 2ZJ5A 2AXTU 1X6JA 2JZBB 2KJ5A 1AE9A 4JWNA 1Q46A 2D8CA 4I2AA 4QW8A 2KFZA 4P0PA 2OXOA 1Z19A 3ZDEA 4ECYA 5KFJA 3RJJA 3KKAC 3AU2A 3RBEA 3H8WA 3SAHA 3C2KA 1ZQQA 3RR7A 3RJIA 1U47A 4PL2A 5KFAA 4TUQA 2OWOA 1X9XA 5HP4A 4Y2UA 2XCPA 4UB4A 1NZBA 4DKSA 1N48A 2LKYA 4O5CA 2HOQA 2XC9A 2O6KA 3AU6A 4F5OA 3ZD9A 3MABA 2BCRA 2KJ8A 3A0BU 1LB2B 4C8LA 1L7OA 3THVA 2AGOA 4GC6A 3IV6A 2BCUA 2HSZA 3KHLA 4E0ZA 4F91B 2KZMA 1ED1A 1AQ6A 4QWBA 3QU7A 2YMPA 4MFAA 2C28A 1WCNA 3IDWA 2HHVA 1WWUA 1XSNA 2B6GA 4RT3A 5DB9A 1JI7A 4RNOA 5IILA 4R65A 3IN5A 4DQSA 2A19A 5DG7A 2BQRA 4UB2A 2LHTA 5J0SA 4M0AA 1K5OA 3AL0B 4RPYA 4C4RA 1SXDA 2WHEA 4ELTA 1ZQAA 1MSWD 4YR2A 3NKHA 5AKLA 1QQ7A 2FDRA 2EANA 4NXZA 1ZOLA 4EELA 5ALNA 4E0JA 2W55A 4R8UB 1A0PA 2KSOA 4DCCA 4F5NA 4YCXA 4F4YA 2IBKA 2WB1F 2VANA 5AKZA 4NLZA 8ICSA 7ICNA 4JB3A 1TE2A 3GIJA 4IS7A 5IINA 1RQNA 3I1YA 4GIBA 4J9LA 2HOIA 4DEZA 5DGAA 4QZHA 2VA3A 2W11A 4DQRA 5EE9A 4GFJA 2HHWA 1TV9A 2DL0A 1XWLA 4YN4A 1BPZA 8ICNA 4NY8A 3PX0A 2BPGA 1ZETA 4TQRA 2KMDA 2IOFK 2PMZF 1Z4OA 1PK1A 4EBEA 4B9LA 2JEIA 9ICJA 1KBUA 2ODGA 2VA2A 1ZD3A 4RQ4A 3MR6A 3UXPA 2RHFA 1UA1A 3Q8LA 4P0QB 3HX0A 1S0OA 4QZGA 4RUAA 2KV2A 3PO5A 5ALJA 4UB1A 4NM1A 3NGDA 4HYKA 2JMGA 3S6JA 3TANA 4C80A 1XSPA 5KFTA 3IG8A 5F9NA 4RPZA 2MUTA 2WF9A 1UQVA 2KIVA 5C5JA 3F2CA 5J2KA 1X2IA 3LYSA 5IIIA 1NKBA 2BQUA 2K4EA 5D49A 3UPQA 4DLEA 5ALWA 5DLFA 2DGZA 3SENA 1Z1BA 1COOA 1C20A 2OEHA 3PR5B 1PK3A 3TARA 2DKXA 4F93B 4DFMA 3QNMA 4OJLA 4RU9A 5HR7A 1KFTA 3FC4A 1J2MA 2ZUCA 4RQ2A 1ZJMA 2KNJA 3V7KA 1P4EA 3OGUA 5KT6A 4E0YA 2JR5A 4BWJA 2UVVA 4O5KA 1GO3F 2F8KA 4Z6DA 3F5EA 3RFAA 7ICUA 1D9FA 1QQ5A 1QCKA 4RQ6A 1ZQHA 2PXIA 2Y9TA 5AKXA 4OJ5A 2FMQA 3Q8PB 3AUOA 2HBKA 2GO7A 1T3NA 2C22A 5AK6A 3D6JA 4RUCA 1N5WA 5DBCA 4I2JA 1X42A 7ICSA 5AI6A 1QLNA 2F1JA 5IIOA 4WJ3B 3ZD8A 3RB6A 4DS4A 5AIBA 1ZJNA 4YR3A 3ONNA 2BPFA 2P6UA 9ICXA 2YB4A 1QQ6A 2B21A 1Q3UA 3NVYA 4X5VA 3H8MA 5L1KA 1COKA 2D3DA 1SWWA 1KLNA 3PSTA 2F3NA 3JPSA 1B43A 4I29A 4KLMA 2XY5A 4NM2A 4R64A 2PI5A 2DUYA 2K8BB 2BDUA 2W03A 4UASA 2PKEA 3C2MA 3ISCA 3PO4A 5DCFA 3MR3A 3T3FA 1WYGA 3D2QA 4E10A 3CRXA 3RJHA 2JV3A 3ED5A 4MFCA 3H40A 4BX9C 2AGPA 1XS9D 2KP7A 2ESEA 3GV5B 2PFQA 4Y2VA 1HUZA 4LVSA 2A1JA 3RB0A 4JV1A 2ZTDA 1JXEA 2IHMA 2WF7A 3RBDA 1U48A 2K89A 2JHDA 2FLPA 4KN7A 3LWLA 2R8IA 4J03A 1ZD2P 2C2DA 1URJA 4BJQA 4K4GA 2W3RA 3AN1A 3PSFA 1L8LA 2ASDA 5DKWA 3Q8KA 8ICJA 5CP2A 1M6YA 4QWDA 1LKYA 3GU3A 1RDFA 4RZRA 5AI4A 4FFDA 4P0PB 1NOMA 2BPCA 2CN1A 4F5QA 2YMQA 3R9KA 3G6VA 4DWPA 4TURA 3QEAZ 4YMNA 3QU2A 5J8YA 3NRWA 4RQ7A 5KAFU 4DFJA 2HW3A 4DSIA 3L5KA 2G06A 3HILA 4FZNA 1SXEA 3ZDDA 5DDYA 5AKYA 3WKDA 5KL8B 3ZI4A 4NWIA 8ICUA 1OXJA 4NLCA 4ECZA 1AIHA 3K1ZA 2KKVA 2WAQF 4I2DA 5KFOA 4YQWA 2PFPA 5A0LA 2XCAA 2WB1C 5AK3A 9ICEA 1UPHA 1MQ3A 4KLSA 1SV0A 2JXJA 4ED7A 4KLUA 2W9MA 3H4DA 5AI8A 5ALGA 2FPMA 2XY6A 5ALOA 3RF9A 2J6TA 3WK9A 4TQSA 2BR0A 4AYBC 2KOBA 9ICMA 2YTUA 1Z00B 1SKRA 2AU0A 4YMOA 4F2RA 4RT2A 1JROA 4US9A 1V97A 9ICFA 4QZBA 3KD3A 2LYHA 4DSFA 3D2NA 8ICQA 5CJ7A 2HHSA 3PMNA 5AM5A 1JMSA 5CR0A 4R8UA 1ZQVA 5HMLA 3KTQA 3WK6A 4F4ZA 5J29A 1ZQYA 2ZUDA 4F5PA 2ZIVA 3RH5A 4M47A 2NO4A 4UAVA 4DF8A 1QSSA 1MC8A 2ISPA 3A0HU 4F71A 4RQ3A 4EENA 3UQ2A 1WUDA 4DQPA 3IP4B 2AQ0A 3N7SC 9ICVA 1HUOA 1T7PA 2E5SA 5G5GA 4UB6U 5ALKA 1XO0A 3OJSA 4F4WA 2MRLA 4J9OA 1SKSA 3M7DA 1D9DA 4JUZA 5J2IA 2JH7A 2GLEA 5AM4A 1F5SA 5IIJA 1Z1VA 1CUKA 1U49A 4GC7A 4M9HA 2QARA 2ZG6A 5EWEA 3BS7A 1N56A 3ETRA 2QKQA 3TAPA 8ICAA 2G08A 3GIMA 3E58A 2F1HA 4UBCA 5CB1A 2RQ5A 1JUDA 2BDPA 2XIDA 5KG1A 5ALZA 4QIWC 4DQQA 4J9KA 4P4PA 1SKWA 4B9UA 2KTQA 4BXOB 2DF4B 4Y2QA 3MGVA 3QZ8A 5IIMA 2OYYA 4KLHA 2F77X 4Q44A 4FO6A 4NLNA 4Y2YA 5JTIA 4OO1J 3BS5A 1U9LA 3KKAA 5BPCA 4C0ZA 1OUQA 2NV3A 1RG6A 8ICZA 3V7LA 3ISDA 4IQVA 2L5YA 2A1JB 3BQ1A 4IRDA 2KZ3A 2HMXA 3C1YA 1B22A 3JPQA 1ZQLA 2HHQA 8ICXA 4AP9A 2FJ6A 4JV0A 1IIPA 4ED6A 5EWFA 7ICQA 5HMMA 2HDOA 9ICQA 1CRXA 5BOMA 1ZQUA 4Q8FA 4YG2A 1TKDA 1XU4A 4ED8A 3WKAA 4KX3A 4C8NA 1CEZA 3M9MB 4FZLA 1N5XA 3FYHA 1KRPA 4F4KA 4PGYA 4BXOA 3EYZA 2GOLA 4EZ9A 2WF5A 4ZOHC 3KBBA 5ALXA 2KFNA 3WK5A 4QZDA 8ICHA 5AM3A 5KFYA 7ICOA 2W9CA 9ICIA 5KT7A 2OCEA 3Q8SB 4UAUA 1Z00A 5DQGA 3MGIA 1L7MA 3V6HA 4Y2TA 5FP0A 4TUSA 1F44A 2EH9A 1H38A 5DB8A 2EAOA 3SD7A 8ICEA 2UVWA 3H8JA 3QX7A 8ICIA 5AI5A 1Q3VA 2ALZA 7ICRA 3RR8A 3CYMA 2ZJAA 4YXJA 2ZIXA 3IG5A 2HCFA 3BDPA 2KVCA 1L6NA 1MA7A 5HNKA 4QZFA 3PZPA 2FE9A 3PW2A 4DF4A 1KQQA 1O08A 1RXWA 8ICTA 2JEFA 2DPJA 2JEJA 7ICJA 2LM4A 3N97B 3UXUA 4UQGA 1TAMA 2Y0SC 2W9BB 1JALA 1QSLA 5ALVA 3H8SA 5BOLA 8ICBA 4PHPA 1L7PA 4USAA 3V7JA 4QZ8A 3DDHA 4IL6U 3RJGA 1V85A 4HAIA 3HP6A 4ECWA 1SL0A 2IMWP 2Y1JA 3VCBA 1JN3A 3SEIA 4RQ1A 3PY8A 5C0YA 2BGWA 4MEXA 1JIHA 3IM1A 2OM6A 4F50A 4ECTA 4PH5A 4ECSA 3U26A 1TK5A 3E0FA 4I2HA 8ICVA 5C6KA 1NK8A 4QJFB 3CP8A 3MDCA 4QZEA 3PNCA 4NLKA 5GTHU 4O3OA 2ZIVB 3PX4A 3C1ZA 3L3FX 1ZRNA 4J9SA 1A76A 4J9PA 4ECQA 4KLGA 9ICGA 2KIWA 4F8RA 3KOOA 2CXYA 2RDJA 3RH4A 4UAYA 4CNQA 4UAZA 4OJOA 4C7ZA 4CDGA 2KG5A 4O5EA 5KFLA 4I2CA 3EZ5A 5KFPA 4OJPA 1X6IA 2EQYA 7ICVA 4Z6CA 4R66A 1TVAA 3NRZA 1QSYA 4FE3A 7ICFA 3TQ1A 4RQ5A 1WWVA 3C2LA 1N61A 1A77A 2Y0SF 3SZ2A 5D46A 2HHXA 2P35A 3PVXA 3V6JA 2YMLA 9ICRA 4F3OA 3CNHA 2NYVA 4PHEA 3Q8RB 2R8GA 2I6XA 4DFDA 4KN4A 5DLGA 1EXNA 1PUZA 1DRGA 3KHRA 1D8LA 3QYPA 4CE6A 1MN8A 2V4RA 2M0NA 4QZAA 2PFNA 1LVHA 5AKGA 2ES6A 2V4QA 9ICPA 2YN4A 1VJ5A 1X40A 2P66A 2H3FA 2BCVA 2EZXA 5KT4A 2F8LA 1KFDA 2K4IA 3JPPA 3QUQA 4LZDA 5IIKA 4DOBA 1S0VA 5G5HA 1NK7A 5J2BA 1U4BA 1B0XA 1SZHA 3FDSA 2K4PA 4EBCA 5AM2A 4JWMA 1PZNA 3RRHA 4EYHB 2R8JA 1ZD5A 1ZRMA 4OJ6A 1X9WA 1V9PA 4CF5A 3MDAA 1KN5A 3T5KA 1DOQA 1BNPA 3B9JA 2LYAA 3RJFA 1OW5A 2D6FC 3F2BA 3QU9A 4YR0A 2G5IB 4YD1A 3CW2C 1CI4A 1ZQKA 4M6WA 5KFFA 2KK0A 2PI4A 5KT3A 2XY7A 3PW7A 2RDIA 3NVWA 4R63A 3RAQA 4EX6A 2BQ3A 2YY6A 1YZ6A 4O0IA 4JK1A 5DQHA 3EPIA 8ICMA 4JV2A 3KZXA 1FLOA 2LPEA 3TKAA 4CF3A 3ISBA 3M6ZA 4BGDA 5J2CA 3M8RA 3NASA 4Y2PA 4UB8U
chains in the Genus database with same CATH topology
3LVVA 1P4EA 3GZFA 2E1EA 2ZIXA 3IG5A 3D2NA 3KFUF 4PL2A 2DQNB 4OO1J 4P0QA 2KVCA 2K89A 2JHDA 2VJ4A 2ZIUB 1MA7A 1L6NA 2KJ9A 4PL1A 2HBMA 3PZPA 1GO3F 2XI9A 4C0ZA 1OUQA 1DRGA 2NV3A 1URJA 2H3VA 4GFJA 4BJQA 3F5EA 3T79A 4CGZA 1NZBA 3RFAA 4DKSA 2A3VA 2HBJA 2LKYA 2GH1A 2HOQA 3PSFA 2KEYA 3PSIA 4OJ5A 4BUGA 1PVRA 1HIWA 2M0NA 3F5AA 3UXUA 2HBLA 2Q4TA 2HBKA 2HMXA 3AQFA 3VC8A 1T94A 3AQEA 2ZIVA 3GU3A 2CPRA 2KJ8A 1TAMA 2Y0SC 2PMZF 2F76X 2XVTA 3ICXA 2W7OA 2WAQC 2JH1A 2H3FA 1IIPA 3SAGA 2G07A 3HKZF 2OH2A 5HR6A 1M6XC 2R18A 4A8EA 2F8LA 2ZIWA 2G0AA 2K4IA 1CRXA 2H3QA 2CN1A 4P0PB 2ZIWB 2VJ5A 4QIWC 1WUDA 2H3ZA 2KHQA 4ACOA 1ED1A 1KBUA 3IP4B 2G09A 3N7SC 4ICAA 4NV0A 4WJ3B 1D8BA 2HOFA 4O3MA 2K8CB 2G5HB 2E5SA 2PMZC 2RHFA 3H0LB 4U6PA 1ZQ1C 3NRWA 1P4EC 3VCBA 1SZHA 4P0QB 4KX3A 1PVQA 2KHVA 1XO0A 3M6KA 2KV2A 2YX8A 2G06A 5C0YA 3N7RC 2MRLA 4FZLA 3IN5A 3ONNA 2JMGA 4FZNA 3H0MB 3M7DA 2OM6A 4OJ6A 4U7CA 4FZMA 3HKZC 2JH7A 2YB4A 3IG8A 2JGAA 2RRDA 4NWIA 4QNLA 2F2AB 5KL8B 3SAFA 3C28A 3F2CA 1Q3UA 2GOLA 4NLCA 3LYSA 3F53A 1A6SA 3K1ZA 2KKVA 1AIHA 2WAQF 2LHTA 2YB1A 2ZXHA 3E0FA 4JMUA 2ZG6A 5A0LA 2ZXIA 2ZIXB 3CP8A 4QJFB 1PVPA 5C6KA 5DORA 4AYBF 5T14A 2K4EA 3AL0B 2LYAA 2WB1C 2KD1A 2CRXA 3F2BA 3NUQA 1UPHA 4CRXA 2D6FC 1M6XA 3PSTA 1XNSA 2G5IB 2ZIVB 3NKHA 2XICA 3O0FA 2G08A 2ZIUA 2DGZA 3L3FX 4KMOB 5KL1B 3SQIA 3C29A 1Z1BA 3DEEA 2KIWA 3D2SA 3N7PD 3SMVA 1YT3A 2KICA 1A0PA 3LVWA 2W7PA 2K8BB 5CRXA 1F44A 2BDUA 3ALRA 2KKPA 2W03A 4OJOA 3RF9A 2XIDA 2H3IA 2K4HA 2VIXA 2VKQA 2LYBA 2LBOA 4CDGA 2E1FA 2N1RA 4IC9A 3OPXA 4AYBC 3F2DA 5DCFA 2WB1F 4OJPA 3VCFA 2KOBA 2RP5A 2KJ5A 1AE9A 3D2QA 4OJLA 3H0RB 3CRXA 3KZXA 4BX9C 3PSPA 2OXOA 2Z7JA 1Z19A 4P0PA 5HR7A 1ECWA 1FLOA 4FE3A 1HEKA 2DF4B 4KX5A 3MGVA 1Q3VA 2W04A 4NLBA 3M6ZA 2OYYA 2Y0SF 2HOIA 2KNJA 2MA1A 1P7DA 3SAHA 3CYMA 2F77X 4QIWF 2K8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKP A;  1P4E A;  1CRX A;  1Q3U A;  1MA7 A;  2KHQ A;  3LYS A;  1AIH A;  5DCF A;  2KJ9 A;  2KKV A;  4ACO A;  1KBU A;  3VCF A;  1OUQ A;  5C6K A;  5DOR A;  2KOB A;  1PVP A;  1DRG A;  2KJ5 A;  2HOF A;  1AE9 A;  1NZB A;  4DKS A;  2CRX A;  2KD1 A;  4CRX A;  2A3V A;  3CRX A;  1M6X A;  1XNS A;  2KEY A;  3NRW A;  3NKH A;  1PVR A;  1P4E C;  2OXO A;  1Z19 A;  3UXU A;  1FLO A;  1PVQ A;  2KHV A;  1XO0 A;  1M6X C;  3MGV A;  1Q3V A;  3C29 A;  1Z1B A;  2KIW A;  2KJ8 A;  2HOI A;  4A8E A;  1P7D A;  1A0P A;  5CRX A;  1F44 A;  3C28 A; 
#chains in the Genus database with same CATH topology
 3K75 D;  3GZF A;  3ORY A;  3NS1 A;  2W3S A;  4EYI B;  2K60 A;  1FFV A;  8ICG A;  3K1R B;  1RYU A;  1RYR A;  4M2Y A;  2KSO B;  3C21 A;  2HBJ A;  4MF8 A;  1L3T A;  5J0O A;  1PVR A;  3F5A A;  8ICK A;  2HHT A;  4BWM A;  5ALH A;  4M9J A;  3TAC B;  2OHF A;  2XVT A;  4F41 A;  5F3X B;  2W7O A;  1ZQN A;  2ISO A;  3SAG A;  1UHU A;  4KTQ A;  2H3Q A;  1IXR A;  2FPL A;  3SR6 A;  9ICU A;  2G09 A;  4Q43 A;  4IR9 A;  4DOC A;  3OSN A;  2JRZ A;  3SYZ A;  2K8C B;  2PMZ C;  4U6P A;  3QU5 A;  4ED2 A;  4Q45 A;  5KFK A;  1NK5 A;  1PVQ A;  2DPI A;  4B9V A;  4YVZ A;  5E79 U;  3QXG A;  5B5E U;  4IRK A;  1SIJ A;  4K4I A;  4ZH4 A;  2IHN A;  1S76 D;  3B0Y A;  5J2E A;  2F2A B;  4PHA A;  4ECX A;  1A6S A;  1N62 A;  5DQI A;  1BGX T;  4MF2 A;  4ED1 A;  1M6X A;  1SWV A;  3GIK A;  4PGQ A;  3OSP A;  4O3R A;  4KLI A;  3M9O B;  4J9R A;  4KLT A;  3MC1 A;  2W8L A;  1L3V A;  3JPT A;  1NJX A;  5KFN A;  5HHI A;  2VIX A;  2VKQ A;  2XGP A;  3VCF A;  3WK8 A;  3WU2 U;  1N63 A;  5ALI A;  5CA7 A;  2DBY A;  5AK5 A;  2Y1I A;  3PSP A;  1LV5 A;  1L8O A;  5KG4 A;  1X9S A;  2KVS A;  5AI0 A;  2WFA A;  8ICP A;  3HJE A;  4KLQ A;  5AKI A;  2VJ4 A;  3TI0 A;  1ZYQ A;  2NRX A;  5K4L A;  1J2N A;  1ZQC A;  5J0T A;  5J0P A;  4CGZ A;  4M04 A;  2BCS A;  2GH1 A;  3RH6 A;  4Z6E A;  1HIW A;  3VC8 A;  3ZDA A;  1T8E A;  3LK9 A;  1B4F A;  1NK6 A;  4M6W B;  3M9N B;  1ZQD A;  2ZIW A;  2G0A A;  1ZQF A;  1S0N A;  3C23 A;  4GXJ A;  4ECU A;  4ICA A;  4NV0 A;  4C7Y A;  1JXL A;  1KW4 A;  5AM0 A;  3T5J A;  3AM9 A;  3RB4 A;  3H0L B;  4I2B A;  1ZQ1 C;  1T4G A;  5TIS U;  5ALM A;  1ZQJ A;  5KFC A;  2FMP A;  3OJU A;  5KFZ A;  3K4G A;  3SAF A;  1TFR A;  1SGG A;  4QNL A;  1KL9 A;  2MUT B;  3N4M B;  5KFH A;  3QZ7 A;  4DL2 A;  5ALT A;  9ICS A;  5AKJ A;  3NUQ A;  3OTQ A;  5KT5 A;  5EE3 A;  2E8N A;  3O0F A;  5ALL A;  4CF4 A;  3TFR A;  5KG3 A;  5AKE A;  9ICW A;  3C29 A;  3I76 A;  1FFU A;  2IOH A;  4B9N A;  4ECV A;  2QB1 A;  1KFS A;  3F2D A;  1IM4 A;  4EBD A;  2KZZ A;  1VDV A;  1TAU A;  2EAM A;  9ICN A;  1FO4 A;  4Y2J A;  1KDH A;  7ICM A;  3H0R B;  3GII A;  4TUP A;  1SV4 A;  3QUC A;  4KIT B;  4F92 B;  1ARO P;  3NVZ A;  5ALD A;  5KG0 A;  4QIW F;  2HI0 A;  4I2E A;  3JPR A;  2MU2 A;  2EAP A;  2WF6 A;  2ZIU B;  4P0Q A;  8ICR A;  4IQW A;  2HVI A;  1T3Q A;  3MFH A;  1QH9 A;  3T79 A;  1TK8 A;  5J0X A;  5AKK A;  4E0D A;  2KEY A;  3RJK A;  7ICL A;  5B66 U;  3HPO A;  8ICO A;  4ED0 A;  3TAD A;  1X9M A;  3FM9 A;  2G07 A;  5HHH A;  3M8S A;  4KMU A;  4ACO A;  3NVV A;  3QE9 Y;  2M9N A;  3ETL A;  2V6E A;  3HWT A;  1DGJ A;  1ZXI A;  3RJE A;  2NRZ A;  3RRG A;  2YX8 A;  4OCZ A;  1UCV A;  5KFU A;  1KSP A;  9ICT A;  5EOZ A;  3H0M B;  5J0Y A;  2E8M A;  3FAH A;  5JU5 A;  4PHD A;  2BZF A;  4NJ8 A;  5KG6 A;  5ALY A;  7ICT A;  3IRU A;  2ZXH A;  1NJW A;  2QLT A;  1UT5 A;  2HVH A;  2DWQ A;  2KD1 A;  8ICL A;  1Z4N A;  4B9T A;  5CWR A;  1VLB A;  5KFD A;  9ICK A;  5KFV A;  4Z6F A;  5J2A A;  2W7P A;  2FPK A;  1RYS A;  4U7C A;  4IC9 A;  3WKB A;  5DB6 A;  4C4T A;  4DQI A;  2RP5 A;  4FBU A;  4KLF A;  1NI3 A;  2W54 A;  4G9B A;  1NK9 A;  2I9G A;  2Z7J A;  4B6J A;  4QZI A;  4NLB A;  4O9M A;  3HT3 A;  1JRP A;  4C8K A;  4F4X A;  3GV8 B;  5AIA A;  4DWI A;  2VA8 A;  3JPO A;  3WK4 A;  2NRV A;  1NKE A;  1UA0 A;  1S9F A;  5ALP A;  4M9L A;  4ELV A;  3OHB A;  5KFM A;  4B9M A;  4PPX A;  4BUG A;  2IA6 A;  1C7Y A;  1NKC A;  4FBT A;  1Q8K A;  3BJY A;  3EPG A;  3KHH A;  3IHQ B;  4ED3 A;  2WAQ C;  5AHX A;  4P4M A;  1MQ2 A;  4Y2R A;  1L7N A;  2R18 A;  1XO1 A;  3WK7 A;  1UT8 A;  4KLE A;  5CHG A;  4RQN A;  1XSL A;  4J9M A;  2W43 A;  4CCH A;  3GV7 B;  1DK2 A;  1S97 A;  4DFK A;  2AHO B;  1K1S A;  2MSN A;  3Q8Q B;  4ECR A;  4K4H A;  8ICC A;  2KHV A;  5KFW A;  1PK1 B;  4YP3 A;  4UAT A;  3E2E A;  1BPX A;  5DG9 A;  5L1I A;  5DG8 A;  1BPE A;  3HKZ C;  3DV9 A;  9ICC A;  8ICY A;  2H5X A;  1ZQW A;  1ZQE A;  2ZIX B;  5T14 A;  4DFP A;  1XNS A;  1IG6 A;  4KMO B;  5JUM A;  1XC9 A;  3I28 A;  3D2S A;  1NJY A;  2KIC A;  4I27 A;  1S5L U;  2K4H A;  5ALF A;  2E1F A;  3BQ0 A;  4RQM A;  1Z3E B;  2JZB A;  5J2J A;  3J81 j;  5L1M A;  2R8H A;  5KFI A;  5JRT A;  3PX6 A;  4KX5 A;  2W04 A;  7ICG A;  4LJX A;  1HJP A;  1TAQ A;  3G6X A;  2Y9U A;  2FLL A;  2I5H A;  2K8A A;  3GFK B;  2UVR A;  4Q8E A;  3KFU F;  4RNM A;  5J2G A;  3L4P A;  2W9C B;  2AQ4 A;  3QUT A;  5KTQ A;  2W9A A;  4O3P A;  3V6K A;  2AJQ A;  4OD0 A;  1WCL A;  2QB0 A;  4KLJ A;  3MR5 A;  2QB0 B;  2ZJ8 A;  3H4B A;  2HBL A;  1IV8 A;  3AQF A;  3UXO A;  2V9W A;  2J6U A;  4P4O A;  8ICW A;  1S0M A;  5HR6 A;  5DBB A;  3WKC A;  2WTF A;  2PFO A;  2VJ5 A;  1ZQI A;  4I28 A;  2KHQ A;  3V72 A;  5J2D A;  4RQ0 A;  2ASL A;  3MBY A;  4YMM A;  2HOF A;  3MGH A;  4O3M A;  5DGB A;  5KFS A;  3LDA A;  3C5G A;  3BS5 B;  1D8Y A;  4C4S A;  3GDX A;  3N7R C;  2RLT A;  3EUB 2;  5ALR A;  5KNI A;  4FZM A;  2ZTE A;  2GWS A;  2YB1 A;  4RPX A;  1O03 A;  3UQ0 A;  2YMM A;  4KLD A;  4I2G A;  3SV3 A;  5J2H A;  4DSL A;  4NL9 C;  3PML A;  5KL1 B;  3SI8 A;  1ZQP A;  2IOF A;  4QW9 A;  3GIL A;  5J8Y C;  2KKP A;  3UXN A;  4I2F A;  4DSJ A;  2H3I A;  1DXS A;  5J0R A;  1SB3 C;  1ZQG A;  4Y2X A;  1ECW A;  4ELU A;  8ICF A;  2FMS A;  3T5H A;  4DO9 A;  4DS5 A;  3QEB Z;  5TZV A;  4UBB A;  1ZQS A;  9ICO A;  3LVV A;  1SV0 C;  1BVS A;  3UMG A;  3G6Y A;  2HBM A;  2XI9 A;  4C8O A;  3PW5 A;  5ALQ A;  3EW9 A;  2E8O A;  3PSI A;  2HHU A;  1L3U A;  4XQ8 A;  3GQC A;  4FS2 A;  3AQE A;  4E0P A;  4YFK A;  3Q8M A;  2F76 X;  4O3N A;  2E8P A;  5D4B A;  4EEK A;  3HRD D;  5H2F U;  2ZIW B;  4C8M A;  4BDP A;  2H3Z A;  2EZY A;  4RQ8 A;  1J97 A;  1RZT A;  3N28 A;  2G5H B;  5KFX A;  5J0W A;  3KZI U;  2EDU A;  3M6K A;  5L1J A;  1KTQ A;  3BQ2 A;  5J2F A;  5EE1 A;  5AI9 A;  1QTM A;  7ICI A;  1ZD4 A;  4IQU A;  4PGX A;  1RPL A;  4QZC A;  5DOR A;  2ZXI A;  2AH5 A;  5AM1 A;  2W9B A;  3ZDB A;  1Y88 A;  1X66 A;  2CRX A;  5AIC A;  4GXI A;  4RNN A;  1LKY B;  3BQ7 A;  3BQT A;  2AGQ A;  2FLN A;  3KHG A;  5DDM A;  3TAQ A;  2UVU A;  7ICE A;  5AK4 A;  1L5U A;  3LVW A;  4DL7 A;  3UM9 A;  1NJZ A;  2LYB A;  1ZQM A;  2N1R A;  1DGS A;  4QWE A;  2Q0Z X;  3ZDC A;  5GTI U;  2KE7 A;  7ICP A;  1HEK A;  3PW0 A;  5EE0 A;  3HW8 A;  2NO5 A;  4J9Q A;  1NZP A;  2BCQ A;  5L9X A;  4UW9 A;  2MA1 A;  1U45 A;  1P7D A;  4UB5 A;  4LZG A;  5J0U A;  2E1E A;  2DQN B;  4DLG A;  2KJ9 A;  2P6R A;  4PL1 A;  1RXV A;  1NNL A;  2H3V A;  4XRH A;  3AMZ A;  3OHA A;  2A3V A;  3B0X A;  3H7I A;  4O3S A;  7ICH A;  2ZTC A;  4EEY A;  2CPR A;  2ZUB A;  4QZ9 A;  2EZZ A;  1FIQ A;  2OH2 A;  2KN7 A;  1NK0 A;  2DFL A;  4IRC A;  4KLL A;  2E3T A;  4PJ0 U;  4Y2S A;  3RTV A;  5KFG A;  4US8 A;  3PW4 A;  2QAR B;  1P4E C;  2B0C A;  4MEY A;  4O3Q A;  3RAX A;  3UMC A;  4QWC A;  1DK3 A;  1N60 A;  4EZ6 A;  5EWG A;  5KG2 A;  3C28 A;  2RRD A;  4GXK A;  2NRT A;  5ALE A;  3QU4 A;  2I1Q A;  1BPB A;  4F43 A;  4AYB F;  4QWA A;  3BZK A;  1SZP A;  4M9N A;  1KKX A;  4DL4 A;  2ZIU A;  3PV8 A;  3SQI A;  4DL3 A;  2MAX A;  4F2S A;  3C5F A;  2WF8 A;  1YT3 A;  1S8O A;  3SMV A;  4XUS A;  1L3S A;  1ZQB A;  1BPD A;  5CRX A;  3ALR A;  5KFQ A;  4NL9 A;  1SL2 A;  4M9G A;  3RB3 A;  4PZN A;  4UAW A;  1BPY A;  4YXM A;  1K1Q A;  5KAI U;  4KLO A;  1S10 A;  1RM6 C;  1ZQO A;  5KFB A;  2XO7 A;  5AKH A;  1SL1 A;  2LMR A;  3WKE A;  3BZC A;  4F72 A;  2FI1 A;  1F0M A;  3NTU A;  5F9L A;  3LWM A;  3DEE A;  5DB7 A;  3UMB A;  2A1A A;  3JPN A;  2DKZ A;  4PZO A;  2W8K A;  2JEG A;  5KG7 A;  3EWA A;  5KG5 A;  3SV4 A;  3QUB A;  5KFE A;  4FS1 A;  2NRW A;  4DL6 A;  2Q4T A;  5CEH A;  3MFI A;  9ICB A;  1T94 A;  4IQT A;  4B9S A;  5ALS A;  5DBA A;  4DSK A;  3ICX A;  2JH1 A;  4NLG A;  3HKZ F;  2BHN A;  1M6X C;  4A8E A;  1JX4 A;  4DOA A;  4UB3 A;  2ASJ A;  4F5R A;  4I2I A;  4DL5 A;  1YZ7 A;  3TAD C;  1D8B A;  1KEJ A;  1N2X A;  3M1Y A;  3MR2 A;  5L1L A;  4G3I A;  2XGQ A;  2R8K A;  2BKE A;  4DSE A;  2F1I A;  9ICL A;  1S77 D;  4UAR A;  2JGA A;  4XA5 A;  4MFF A;  5J0Q A;  3F53 A;  3TFS A;  1TK0 A;  1NK4 A;  4JMU A;  4J9N A;  2C2E A;  1PVP A;  4MHV A;  2C2R A;  4GLX A;  2F44 A;  4CRX A;  4YD2 A;  2XIC A;  2LI6 A;  5KFR A;  4E0G A;  9ICA A;  3T5L A;  5KT2 A;  4P2H A;  1FEZ A;  5ALU A;  1RQL A;  1WG8 A;  3N7P D;  1ZQZ A;  2ATL A;  4IR1 A;  1ZQR A;  9ICH A;  3AEV A;  7ICK A;  1V38 A;  4EX7 A;  3PR4 A;  1ZQT A;  2LM1 A;  2LBO A;  1ZQX A;  2YQE A;  2J6S A;  3OPX A;  1BNO A;  2ZJ5 A;  2AXT U;  1X6J A;  2JZB B;  2KJ5 A;  1AE9 A;  4JWN A;  1Q46 A;  2D8C A;  4I2A A;  4QW8 A;  2KFZ A;  4P0P A;  2OXO A;  1Z19 A;  3ZDE A;  4ECY A;  5KFJ A;  3RJJ A;  3KKA C;  3AU2 A;  3RBE A;  3H8W A;  3SAH A;  3C2K A;  1ZQQ A;  3RR7 A;  3RJI A;  1U47 A;  4PL2 A;  5KFA A;  4TUQ A;  2OWO A;  1X9X A;  5HP4 A;  4Y2U A;  2XCP A;  4UB4 A;  1NZB A;  4DKS A;  1N48 A;  2LKY A;  4O5C A;  2HOQ A;  2XC9 A;  2O6K A;  3AU6 A;  4F5O A;  3ZD9 A;  3MAB A;  2BCR A;  2KJ8 A;  3A0B U;  1LB2 B;  4C8L A;  1L7O A;  3THV A;  2AGO A;  4GC6 A;  3IV6 A;  2BCU A;  2HSZ A;  3KHL A;  4E0Z A;  4F91 B;  2KZM A;  1ED1 A;  1AQ6 A;  4QWB A;  3QU7 A;  2YMP A;  4MFA A;  2C28 A;  1WCN A;  3IDW A;  2HHV A;  1WWU A;  1XSN A;  2B6G A;  4RT3 A;  5DB9 A;  1JI7 A;  4RNO A;  5IIL A;  4R65 A;  3IN5 A;  4DQS A;  2A19 A;  5DG7 A;  2BQR A;  4UB2 A;  2LHT A;  5J0S A;  4M0A A;  1K5O A;  3AL0 B;  4RPY A;  4C4R A;  1SXD A;  2WHE A;  4ELT A;  1ZQA A;  1MSW D;  4YR2 A;  3NKH A;  5AKL A;  1QQ7 A;  2FDR A;  2EAN A;  4NXZ A;  1ZOL A;  4EEL A;  5ALN A;  4E0J A;  2W55 A;  4R8U B;  1A0P A;  2KSO A;  4DCC A;  4F5N A;  4YCX A;  4F4Y A;  2IBK A;  2WB1 F;  2VAN A;  5AKZ A;  4NLZ A;  8ICS A;  7ICN A;  4JB3 A;  1TE2 A;  3GIJ A;  4IS7 A;  5IIN A;  1RQN A;  3I1Y A;  4GIB A;  4J9L A;  2HOI A;  4DEZ A;  5DGA A;  4QZH A;  2VA3 A;  2W11 A;  4DQR A;  5EE9 A;  4GFJ A;  2HHW A;  1TV9 A;  2DL0 A;  1XWL A;  4YN4 A;  1BPZ A;  8ICN A;  4NY8 A;  3PX0 A;  2BPG A;  1ZET A;  4TQR A;  2KMD A;  2IOF K;  2PMZ F;  1Z4O A;  1PK1 A;  4EBE A;  4B9L A;  2JEI A;  9ICJ A;  1KBU A;  2ODG A;  2VA2 A;  1ZD3 A;  4RQ4 A;  3MR6 A;  3UXP A;  2RHF A;  1UA1 A;  3Q8L A;  4P0Q B;  3HX0 A;  1S0O A;  4QZG A;  4RUA A;  2KV2 A;  3PO5 A;  5ALJ A;  4UB1 A;  4NM1 A;  3NGD A;  4HYK A;  2JMG A;  3S6J A;  3TAN A;  4C80 A;  1XSP A;  5KFT A;  3IG8 A;  5F9N A;  4RPZ A;  2MUT A;  2WF9 A;  1UQV A;  2KIV A;  5C5J A;  3F2C A;  5J2K A;  1X2I A;  3LYS A;  5III A;  1NKB A;  2BQU A;  2K4E A;  5D49 A;  3UPQ A;  4DLE A;  5ALW A;  5DLF A;  2DGZ A;  3SEN A;  1Z1B A;  1COO A;  1C20 A;  2OEH A;  3PR5 B;  1PK3 A;  3TAR A;  2DKX A;  4F93 B;  4DFM A;  3QNM A;  4OJL A;  4RU9 A;  5HR7 A;  1KFT A;  3FC4 A;  1J2M A;  2ZUC A;  4RQ2 A;  1ZJM A;  2KNJ A;  3V7K A;  1P4E A;  3OGU A;  5KT6 A;  4E0Y A;  2JR5 A;  4BWJ A;  2UVV A;  4O5K A;  1GO3 F;  2F8K A;  4Z6D A;  3F5E A;  3RFA A;  7ICU A;  1D9F A;  1QQ5 A;  1QCK A;  4RQ6 A;  1ZQH A;  2PXI A;  2Y9T A;  5AKX A;  4OJ5 A;  2FMQ A;  3Q8P B;  3AUO A;  2HBK A;  2GO7 A;  1T3N A;  2C22 A;  5AK6 A;  3D6J A;  4RUC A;  1N5W A;  5DBC A;  4I2J A;  1X42 A;  7ICS A;  5AI6 A;  1QLN A;  2F1J A;  5IIO A;  4WJ3 B;  3ZD8 A;  3RB6 A;  4DS4 A;  5AIB A;  1ZJN A;  4YR3 A;  3ONN A;  2BPF A;  2P6U A;  9ICX A;  2YB4 A;  1QQ6 A;  2B21 A;  1Q3U A;  3NVY A;  4X5V A;  3H8M A;  5L1K A;  1COK A;  2D3D A;  1SWW A;  1KLN A;  3PST A;  2F3N A;  3JPS A;  1B43 A;  4I29 A;  4KLM A;  2XY5 A;  4NM2 A;  4R64 A;  2PI5 A;  2DUY A;  2K8B B;  2BDU A;  2W03 A;  4UAS A;  2PKE A;  3C2M A;  3ISC A;  3PO4 A;  5DCF A;  3MR3 A;  3T3F A;  1WYG A;  3D2Q A;  4E10 A;  3CRX A;  3RJH A;  2JV3 A;  3ED5 A;  4MFC A;  3H40 A;  4BX9 C;  2AGP A;  1XS9 D;  2KP7 A;  2ESE A;  3GV5 B;  2PFQ A;  4Y2V A;  1HUZ A;  4LVS A;  2A1J A;  3RB0 A;  4JV1 A;  2ZTD A;  1JXE A;  2IHM A;  2WF7 A;  3RBD A;  1U48 A;  2K89 A;  2JHD A;  2FLP A;  4KN7 A;  3LWL A;  2R8I A;  4J03 A;  1ZD2 P;  2C2D A;  1URJ A;  4BJQ A;  4K4G A;  2W3R A;  3AN1 A;  3PSF A;  1L8L A;  2ASD A;  5DKW A;  3Q8K A;  8ICJ A;  5CP2 A;  1M6Y A;  4QWD A;  1LKY A;  3GU3 A;  1RDF A;  4RZR A;  5AI4 A;  4FFD A;  4P0P B;  1NOM A;  2BPC A;  2CN1 A;  4F5Q A;  2YMQ A;  3R9K A;  3G6V A;  4DWP A;  4TUR A;  3QEA Z;  4YMN A;  3QU2 A;  5J8Y A;  3NRW A;  4RQ7 A;  5KAF U;  4DFJ A;  2HW3 A;  4DSI A;  3L5K A;  2G06 A;  3HIL A;  4FZN A;  1SXE A;  3ZDD A;  5DDY A;  5AKY A;  3WKD A;  5KL8 B;  3ZI4 A;  4NWI A;  8ICU A;  1OXJ A;  4NLC A;  4ECZ A;  1AIH A;  3K1Z A;  2KKV A;  2WAQ F;  4I2D A;  5KFO A;  4YQW A;  2PFP A;  5A0L A;  2XCA A;  2WB1 C;  5AK3 A;  9ICE A;  1UPH A;  1MQ3 A;  4KLS A;  1SV0 A;  2JXJ A;  4ED7 A;  4KLU A;  2W9M A;  3H4D A;  5AI8 A;  5ALG A;  2FPM A;  2XY6 A;  5ALO A;  3RF9 A;  2J6T A;  3WK9 A;  4TQS A;  2BR0 A;  4AYB C;  2KOB A;  9ICM A;  2YTU A;  1Z00 B;  1SKR A;  2AU0 A;  4YMO A;  4F2R A;  4RT2 A;  1JRO A;  4US9 A;  1V97 A;  9ICF A;  4QZB A;  3KD3 A;  2LYH A;  4DSF A;  3D2N A;  8ICQ A;  5CJ7 A;  2HHS A;  3PMN A;  5AM5 A;  1JMS A;  5CR0 A;  4R8U A;  1ZQV A;  5HML A;  3KTQ A;  3WK6 A;  4F4Z A;  5J29 A;  1ZQY A;  2ZUD A;  4F5P A;  2ZIV A;  3RH5 A;  4M47 A;  2NO4 A;  4UAV A;  4DF8 A;  1QSS A;  1MC8 A;  2ISP A;  3A0H U;  4F71 A;  4RQ3 A;  4EEN A;  3UQ2 A;  1WUD A;  4DQP A;  3IP4 B;  2AQ0 A;  3N7S C;  9ICV A;  1HUO A;  1T7P A;  2E5S A;  5G5G A;  4UB6 U;  5ALK A;  1XO0 A;  3OJS A;  4F4W A;  2MRL A;  4J9O A;  1SKS A;  3M7D A;  1D9D A;  4JUZ A;  5J2I A;  2JH7 A;  2GLE A;  5AM4 A;  1F5S A;  5IIJ A;  1Z1V A;  1CUK A;  1U49 A;  4GC7 A;  4M9H A;  2QAR A;  2ZG6 A;  5EWE A;  3BS7 A;  1N56 A;  3ETR A;  2QKQ A;  3TAP A;  8ICA A;  2G08 A;  3GIM A;  3E58 A;  2F1H A;  4UBC A;  5CB1 A;  2RQ5 A;  1JUD A;  2BDP A;  2XID A;  5KG1 A;  5ALZ A;  4QIW C;  4DQQ A;  4J9K A;  4P4P A;  1SKW A;  4B9U A;  2KTQ A;  4BXO B;  2DF4 B;  4Y2Q A;  3MGV A;  3QZ8 A;  5IIM A;  2OYY A;  4KLH A;  2F77 X;  4Q44 A;  4FO6 A;  4NLN A;  4Y2Y A;  5JTI A;  4OO1 J;  3BS5 A;  1U9L A;  3KKA A;  5BPC A;  4C0Z A;  1OUQ A;  2NV3 A;  1RG6 A;  8ICZ A;  3V7L A;  3ISD A;  4IQV A;  2L5Y A;  2A1J B;  3BQ1 A;  4IRD A;  2KZ3 A;  2HMX A;  3C1Y A;  1B22 A;  3JPQ A;  1ZQL A;  2HHQ A;  8ICX A;  4AP9 A;  2FJ6 A;  4JV0 A;  1IIP A;  4ED6 A;  5EWF A;  7ICQ A;  5HMM A;  2HDO A;  9ICQ A;  1CRX A;  5BOM A;  1ZQU A;  4Q8F A;  4YG2 A;  1TKD A;  1XU4 A;  4ED8 A;  3WKA A;  4KX3 A;  4C8N A;  1CEZ A;  3M9M B;  4FZL A;  1N5X A;  3FYH A;  1KRP A;  4F4K A;  4PGY A;  4BXO A;  3EYZ A;  2GOL A;  4EZ9 A;  2WF5 A;  4ZOH C;  3KBB A;  5ALX A;  2KFN A;  3WK5 A;  4QZD A;  8ICH A;  5AM3 A;  5KFY A;  7ICO A;  2W9C A;  9ICI A;  5KT7 A;  2OCE A;  3Q8S B;  4UAU A;  1Z00 A;  5DQG A;  3MGI A;  1L7M A;  3V6H A;  4Y2T A;  5FP0 A;  4TUS A;  1F44 A;  2EH9 A;  1H38 A;  5DB8 A;  2EAO A;  3SD7 A;  8ICE A;  2UVW A;  3H8J A;  3QX7 A;  8ICI A;  5AI5 A;  1Q3V A;  2ALZ A;  7ICR A;  3RR8 A;  3CYM A;  2ZJA A;  4YXJ A;  2ZIX A;  3IG5 A;  2HCF A;  3BDP A;  2KVC A;  1L6N A;  1MA7 A;  5HNK A;  4QZF A;  3PZP A;  2FE9 A;  3PW2 A;  4DF4 A;  1KQQ A;  1O08 A;  1RXW A;  8ICT A;  2JEF A;  2DPJ A;  2JEJ A;  7ICJ A;  2LM4 A;  3N97 B;  3UXU A;  4UQG A;  1TAM A;  2Y0S C;  2W9B B;  1JAL A;  1QSL A;  5ALV A;  3H8S A;  5BOL A;  8ICB A;  4PHP A;  1L7P A;  4USA A;  3V7J A;  4QZ8 A;  3DDH A;  4IL6 U;  3RJG A;  1V85 A;  4HAI A;  3HP6 A;  4ECW A;  1SL0 A;  2IMW P;  2Y1J A;  3VCB A;  1JN3 A;  3SEI A;  4RQ1 A;  3PY8 A;  5C0Y A;  2BGW A;  4MEX A;  1JIH A;  3IM1 A;  2OM6 A;  4F50 A;  4ECT A;  4PH5 A;  4ECS A;  3U26 A;  1TK5 A;  3E0F A;  4I2H A;  8ICV A;  5C6K A;  1NK8 A;  4QJF B;  3CP8 A;  3MDC A;  4QZE A;  3PNC A;  4NLK A;  5GTH U;  4O3O A;  2ZIV B;  3PX4 A;  3C1Z A;  3L3F X;  1ZRN A;  4J9S A;  1A76 A;  4J9P A;  4ECQ A;  4KLG A;  9ICG A;  2KIW A;  4F8R A;  3KOO A;  2CXY A;  2RDJ A;  3RH4 A;  4UAY A;  4CNQ A;  4UAZ A;  4OJO A;  4C7Z A;  4CDG A;  2KG5 A;  4O5E A;  5KFL A;  4I2C A;  3EZ5 A;  5KFP A;  4OJP A;  1X6I A;  2EQY A;  7ICV A;  4Z6C A;  4R66 A;  1TVA A;  3NRZ A;  1QSY A;  4FE3 A;  7ICF A;  3TQ1 A;  4RQ5 A;  1WWV A;  3C2L A;  1N61 A;  1A77 A;  2Y0S F;  3SZ2 A;  5D46 A;  2HHX A;  2P35 A;  3PVX A;  3V6J A;  2YML A;  9ICR A;  4F3O A;  3CNH A;  2NYV A;  4PHE A;  3Q8R B;  2R8G A;  2I6X A;  4DFD A;  4KN4 A;  5DLG A;  1EXN A;  1PUZ A;  1DRG A;  3KHR A;  1D8L A;  3QYP A;  4CE6 A;  1MN8 A;  2V4R A;  2M0N A;  4QZA A;  2PFN A;  1LVH A;  5AKG A;  2ES6 A;  2V4Q A;  9ICP A;  2YN4 A;  1VJ5 A;  1X40 A;  2P66 A;  2H3F A;  2BCV A;  2EZX A;  5KT4 A;  2F8L A;  1KFD A;  2K4I A;  3JPP A;  3QUQ A;  4LZD A;  5IIK A;  4DOB A;  1S0V A;  5G5H A;  1NK7 A;  5J2B A;  1U4B A;  1B0X A;  1SZH A;  3FDS A;  2K4P A;  4EBC A;  5AM2 A;  4JWM A;  1PZN A;  3RRH A;  4EYH B;  2R8J A;  1ZD5 A;  1ZRM A;  4OJ6 A;  1X9W A;  1V9P A;  4CF5 A;  3MDA A;  1KN5 A;  3T5K A;  1DOQ A;  1BNP A;  3B9J A;  2LYA A;  3RJF A;  1OW5 A;  2D6F C;  3F2B A;  3QU9 A;  4YR0 A;  2G5I B;  4YD1 A;  3CW2 C;  1CI4 A;  1ZQK A;  4M6W A;  5KFF A;  2KK0 A;  2PI4 A;  5KT3 A;  2XY7 A;  3PW7 A;  2RDI A;  3NVW A;  4R63 A;  3RAQ A;  4EX6 A;  2BQ3 A;  2YY6 A;  1YZ6 A;  4O0I A;  4JK1 A;  5DQH A;  3EPI A;  8ICM A;  4JV2 A;  3KZX A;  1FLO A;  2LPE A;  3TKA A;  4CF3 A;  3ISB A;  3M6Z A;  4BGD A;  5J2C A;  3M8R A;  3NAS A;  4Y2P A;  4UB8 U; 
#chains in the Genus database with same CATH homology
 3LVV A;  1P4E A;  3GZF A;  2E1E A;  2ZIX A;  3IG5 A;  3D2N A;  3KFU F;  4PL2 A;  2DQN B;  4OO1 J;  4P0Q A;  2KVC A;  2K89 A;  2JHD A;  2VJ4 A;  2ZIU B;  1MA7 A;  1L6N A;  2KJ9 A;  4PL1 A;  2HBM A;  3PZP A;  1GO3 F;  2XI9 A;  4C0Z A;  1OUQ A;  1DRG A;  2NV3 A;  1URJ A;  2H3V A;  4GFJ A;  4BJQ A;  3F5E A;  3T79 A;  4CGZ A;  1NZB A;  3RFA A;  4DKS A;  2A3V A;  2HBJ A;  2LKY A;  2GH1 A;  2HOQ A;  3PSF A;  2KEY A;  3PSI A;  4OJ5 A;  4BUG A;  1PVR A;  1HIW A;  2M0N A;  3F5A A;  3UXU A;  2HBL A;  2Q4T A;  2HBK A;  2HMX A;  3AQF A;  3VC8 A;  1T94 A;  3AQE A;  2ZIV A;  3GU3 A;  2CPR A;  2KJ8 A;  1TAM A;  2Y0S C;  2PMZ F;  2F76 X;  2XVT A;  3ICX A;  2W7O A;  2WAQ C;  2JH1 A;  2H3F A;  1IIP A;  3SAG A;  2G07 A;  3HKZ F;  2OH2 A;  5HR6 A;  1M6X C;  2R18 A;  4A8E A;  2F8L A;  2ZIW A;  2G0A A;  2K4I A;  1CRX A;  2H3Q A;  2CN1 A;  4P0P B;  2ZIW B;  2VJ5 A;  4QIW C;  1WUD A;  2H3Z A;  2KHQ A;  4ACO A;  1ED1 A;  1KBU A;  3IP4 B;  2G09 A;  3N7S C;  4ICA A;  4NV0 A;  4WJ3 B;  1D8B A;  2HOF A;  4O3M A;  2K8C B;  2G5H B;  2E5S A;  2PMZ C;  2RHF A;  3H0L B;  4U6P A;  1ZQ1 C;  3NRW A;  1P4E C;  3VCB A;  1SZH A;  4P0Q B;  4KX3 A;  1PVQ A;  2KHV A;  1XO0 A;  3M6K A;  2KV2 A;  2YX8 A;  2G06 A;  5C0Y A;  3N7R C;  2MRL A;  4FZL A;  3IN5 A;  3ONN A;  2JMG A;  4FZN A;  3H0M B;  3M7D A;  2OM6 A;  4OJ6 A;  4U7C A;  4FZM A;  3HKZ C;  2JH7 A;  2YB4 A;  3IG8 A;  2JGA A;  2RRD A;  4NWI A;  4QNL A;  2F2A B;  5KL8 B;  3SAF A;  3C28 A;  3F2C A;  1Q3U A;  2GOL A;  4NLC A;  3LYS A;  3F53 A;  1A6S A;  3K1Z A;  2KKV A;  1AIH A;  2WAQ F;  2LHT A;  2YB1 A;  2ZXH A;  3E0F A;  4JMU A;  2ZG6 A;  5A0L A;  2ZXI A;  2ZIX B;  3CP8 A;  4QJF B;  1PVP A;  5C6K A;  5DOR A;  4AYB F;  5T14 A;  2K4E A;  3AL0 B;  2LYA A;  2WB1 C;  2KD1 A;  2CRX A;  3F2B A;  3NUQ A;  1UPH A;  4CRX A;  2D6F C;  1M6X A;  3PST A;  1XNS A;  2G5I B;  2ZIV B;  3NKH A;  2XIC A;  3O0F A;  2G08 A;  2ZIU A;  2DGZ A;  3L3F X;  4KMO B;  5KL1 B;  3SQI A;  3C29 A;  1Z1B A;  3DEE A;  2KIW A;  3D2S A;  3N7P D;  3SMV A;  1YT3 A;  2KIC A;  1A0P A;  3LVW A;  2W7P A;  2K8B B;  5CRX A;  1F44 A;  2BDU A;  3ALR A;  2KKP A;  2W03 A;  4OJO A;  3RF9 A;  2XID A;  2H3I A;  2K4H A;  2VIX A;  2VKQ A;  2LYB A;  2LBO A;  4CDG A;  2E1F A;  2N1R A;  4IC9 A;  3OPX A;  4AYB C;  3F2D A;  5DCF A;  2WB1 F;  4OJP A;  3VCF A;  2KOB A;  2RP5 A;  2KJ5 A;  1AE9 A;  3D2Q A;  4OJL A;  3H0R B;  3CRX A;  3KZX A;  4BX9 C;  3PSP A;  2OXO A;  2Z7J A;  1Z19 A;  4P0P A;  5HR7 A;  1ECW A;  1FLO A;  4FE3 A;  1HEK A;  2DF4 B;  4KX5 A;  3MGV A;  1Q3V A;  2W04 A;  4NLB A;  3M6Z A;  2OYY A;  2Y0S F;  2HOI A;  2KNJ A;  2MA1 A;  1P7D A;  3SAH A;  3CYM A;  2F77 X;  4QIW F;  2K8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...