The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
QELTVPWDDIEALLKNNFENDQAAVRQVMERLQKGWSLAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Get5 Carboxyl-terminal Domain Is a Novel Dimerization Motif That Tethers an Extended Get4/Get5 Complex.
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
Ubiquitin-like protein MDY2
|
| total genus |
12
|
| structure length |
40
|
| sequence length |
40
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2012-01-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18514 | Get5_C | Get5 C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | GTP Cyclohydrolase I; Chain A, domain 1 | GTP Cyclohydrolase I; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 2LO0 A; 3VEJ A; 2LNZ A; #chains in the Genus database with same CATH topology 2WSC G; 4NE6 B; 4R8Q A; 4E45 B; 3VEJ A; 5DMZ A; 1N3S A; 2WSE K; 1WM9 A; 3LW5 K; 4DRA E; 4JA3 A; 2WSF G; 3B0B C; 1FBX A; 4Q7J A; 1WPL A; 2LNZ A; 1A8R A; 2WSE G; 2LO0 A; 1FB1 A; 1EL6 A; 3LW5 G; 1WUQ A; 4DU6 A; 2KR1 A; 1IS8 A; 1GTP A; 4QPM A; 1N3R A; 2PN0 A; 2O01 G; 1TFE A; 2WSC K; 4DRB J; 1N3T A; 4E44 B; 4NE3 B; 1IS7 A; 1WUR A; 2P11 A; 1AIP C; 4NE5 B; 1EFU B; 1A9C A; 3BMB A; 2WSF K; #chains in the Genus database with same CATH homology 4NE6 B; 4R8Q A; 4E45 B; 3VEJ A; 5DMZ A; 1N3S A; 1WM9 A; 4DRA E; 4JA3 A; 3B0B C; 1FBX A; 4Q7J A; 1WPL A; 2LNZ A; 1A8R A; 2LO0 A; 1FB1 A; 1EL6 A; 4DU6 A; 1WUQ A; 2KR1 A; 1IS8 A; 1GTP A; 4QPM A; 1N3R A; 2PN0 A; 1TFE A; 4DRB J; 1N3T A; 4E44 B; 4NE3 B; 1IS7 A; 1WUR A; 2P11 A; 1AIP C; 4NE5 B; 1EFU B; 1A9C A; 3BMB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
