4DRBJ

The crystal structure of fancm bound mhf complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
b'SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The structure of the FANCM-MHF complex reveals physical features for functional assembly
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 22
structure length 74
sequence length 74
chains with identical sequence K, L, M, N, O
ec nomenclature
pdb deposition date 2012-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.100 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4drbJ02
4NE5B 4DRAE 4E45B 4NE6B 4E44B 4NE3B 4DRBJ 3B0BC
chains in the Genus database with same CATH superfamily
4NE5B 3LW5G 1IS8A 2P11A 1WURA 2WSFK 5DMZA 1WPLA 1N3RA 4NE3B 1WM9A 1TFEA 2KR1A 2O01G 3VEJA 1WUQA 1AIPC 4DRAE 4NE6B 4QPMA 3LW5K 2LO0A 4Q7JA 4DU6A 1FBXA 3B0BC 1N3SA 2WSCG 2WSEG 4R8QA 1A8RA 4JA3A 1IS7A 3BMBA 4E45B 1N3TA 2PN0A 1A9CA 2LNZA 2WSCK 2WSEK 1EL6A 2WSFG 1FB1A 4E44B 1EFUB 4DRBJ 1GTPA
chains in the Genus database with same CATH topology
4NE5B 1IS8A 2P11A 1WURA 5DMZA 1WPLA 1N3RA 4NE3B 1WM9A 1TFEA 2KR1A 3VEJA 1WUQA 1AIPC 4DRAE 4NE6B 4QPMA 2LO0A 4Q7JA 4DU6A 1FBXA 3B0BC 1N3SA 4R8QA 1A8RA 4JA3A 1IS7A 3BMBA 4E45B 1N3TA 2PN0A 1A9CA 2LNZA 1EL6A 1FB1A 4E44B 1EFUB 4DRBJ 1GTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE5 B;  4DRA E;  4E45 B;  4NE6 B;  4E44 B;  4NE3 B;  4DRB J;  3B0B C; 
#chains in the Genus database with same CATH topology
 4NE5 B;  3LW5 G;  1IS8 A;  2P11 A;  1WUR A;  2WSF K;  5DMZ A;  1WPL A;  1N3R A;  4NE3 B;  1WM9 A;  1TFE A;  2KR1 A;  2O01 G;  3VEJ A;  1WUQ A;  1AIP C;  4DRA E;  4NE6 B;  4QPM A;  3LW5 K;  2LO0 A;  4Q7J A;  4DU6 A;  1FBX A;  3B0B C;  1N3S A;  2WSC G;  2WSE G;  4R8Q A;  1A8R A;  4JA3 A;  1IS7 A;  3BMB A;  4E45 B;  1N3T A;  2PN0 A;  1A9C A;  2LNZ A;  2WSC K;  2WSE K;  1EL6 A;  2WSF G;  1FB1 A;  4E44 B;  1EFU B;  4DRB J;  1GTP A; 
#chains in the Genus database with same CATH homology
 4NE5 B;  1IS8 A;  2P11 A;  1WUR A;  5DMZ A;  1WPL A;  1N3R A;  4NE3 B;  1WM9 A;  1TFE A;  2KR1 A;  3VEJ A;  1WUQ A;  1AIP C;  4DRA E;  4NE6 B;  4QPM A;  2LO0 A;  4Q7J A;  4DU6 A;  1FBX A;  3B0B C;  1N3S A;  4R8Q A;  1A8R A;  4JA3 A;  1IS7 A;  3BMB A;  4E45 B;  1N3T A;  2PN0 A;  1A9C A;  2LNZ A;  1EL6 A;  1FB1 A;  4E44 B;  1EFU B;  4DRB J;  1GTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...