5DMZA

Structure of human bub1 kinase domain phosphorylated at ser969
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
349
structure length
339
Chain Sequence
NFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Mitotic checkpoint serine/threonine-protein kinase BUB1
publication title Role of Intrinsic and Extrinsic Factors in the Regulation of the Mitotic Checkpoint Kinase Bub1.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 339
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.80 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 5dmzA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5dmzA02
3ROYA 5FGKA 5AA9A 4I6HA 4RZWA 4WUAA 4ZTQA 3ITZA 4ZK5A 2W9FB 5F94A 3CTHA 3WYYA 4F7SA 3QX4A 4DLJA 1W84A 3QKLA 2F57A 4LM5A 4L68A 2X8DA 2J51A 4I93A 5KZIA 3BYSA 3MA6A 4O6EA 1H1QA 2XYUA 3BU3A 4DFZE 5CU0A 1YDRE 4ZTHA 1P4OA 2X4FA 3BHVA 3MDYA 3EFJA 3IO7A 5L6WL 4HVIA 3HA8A 3NAXA 4F1OA 2PUUA 1Q4LA 4EOQA 4Y95A 3FMHA 4TNBA 5F4NA 1BYGA 4AT4A 5JEBA 5CENA 2ZVAA 4I22A 4JDHA 4UXLA 4D58A 3MFSA 3VWAA 1HOWA 3Q3BA 3Q4UA 1M2QA 2GNJA 2X6DA 2YCRA 3GFEA 3QA8A 3HYHA 1K3AA 1XH9A 5HG7A 2R7IA 1GIJA 4U5JA 2CJMA 1U5RA 4W9WA 4P90A 3R9HA 5M53A 1DI8A 3R7EA 4I23A 2JDVA 4EOLA 4NUSA 4IWQA 5HESA 3W2QA 3QFVA 4BDGA 5HG9A 2WTKB 1ZOEA 2X1NA 2EB2A 3FC2A 4C4HA 2GTMA 3GXLA 4Q5HA 4L00A 2A27A 5DT3A 2C5NA 2GNLA 3TJCA 2H34A 2IWIA 5ANJA 4DAWA 1XHAA 3NW7A 4KINA 4QMMA 4UN0C 3RNIA 5DBXA 2B9JA 4ACDA 3V01A 4LV8A 2HZ4A 3VS5A 3OHTA 5CU2A 5AX3A 3TNQB 3GUBA 4AZSA 3ENHA 5KMKA 5L2SA 3SC1A 3I1AA 5C8MA 4PRJA 4IX5A 1STCE 2HCKA 2YWPA 3E92A 3I81A 1XO2B 4Q5EA 4EZ5A 2JBPA 2HZNA 4BBFA 4TPTA 4F0GA 5L8KA 2QCSA 3I5ZA 5H9BA 2YM8A 3M1SA 4CTBA 2J6MA 1WZYA 3ACKA 3TNIA 1PXPA 3GC0A 2OK1A 4KB8A 5FLFA 3U9CA 3AMYA 3QAME 2O63A 4RIOA 4U79A 3W10A 5H3QA 4FIJA 4ZSJA 3NW6A 2BRMA 3RPRA 2ZYBA 1QPDA 3VUHA 4C7TA 4DGOA 2J50A 4RX9A 3GC7A 3NIEA 1VJYA 1XH6A 3OY3A 3H10A 5A9UA 3ALOA 4RWIA 4ZLYA 2IVTA 3LJ1A 4S30A 2WTVA 4B7TA 2UW7A 2X9EA 4CYJA 2ETKA 3C5UA 2OSCA 3IDBA 3PSBA 4IAAA 2GNGA 4JRNA 5CLPA 3REPA 3P4KA 2J0MB 3PA4A 4MBLA 3W2RA 2CCHA 3ZZWA 2A2AA 3BGPA 2ZMCA 5D12A 3BE2A 4FC0A 2AC5A 2Y4IC 4IX6A 4MEDA 3AT3A 4ZSGA 4X3FC 5KZ0A 2I1MA 3HUBA 4F9AA 2QOCA 5CF6A 3LPBA 4F6WA 2J4ZA 2UZBA 4J99A 1UU3A 2C5VA 1OITA 4FTLA 4RFZA 3HLLA 4YJRA 4HPUE 3FQHA 3IS5A 4FL2A 2X4ZA 3ANQA 4XV3A 5FBOA 4O2PA 2OW3A 3POZA 3TNPC 3FZ1A 4CKJA 5ANKA 5IH4A 3NPCA 4MXZA 2R3HA 3IW8A 3VUDA 3GQIA 2F7XE 1GZKA 1XBAA 3DZOA 4CFFA 3E64A 2UW8A 3TUBA 4QP7A 1BKXA 4FSWA 3NW5A 4FYNA 4CCUA 2WU7A 3LFEA 4TT7A 5J5TA 2X6EA 3L8XA 3KXMA 4IBMA 5J7HA 2GDOA 3UVRA 4C59A 5JT2A 3TZMA 2IJMA 4J1RA 2VTJA 2XP2A 4KIKB 4DG3E 3F88A 4MBJA 2WIHA 3G6GA 4JQ7A 4RBLA 4D9UA 3HMMA 4FZFB 1H27A 3EFWA 3JPVA 3R7IA 1TQPA 3LM5A 3V5PA 2VWIA 4PDSA 3GGFA 4G3DA 4BI0A 2Z60A 3DCVA 3QWJA 5HOAA 4RFYA 1UNLA 2HELA 4AXAA 2WQNA 5EM8A 3WARA 2PVYA 4H3QA 4O91A 3W33A 1ZYCA 4FNXA 1CKIA 4JOAA 4WSQA 4GT4A 4FICA 5JH6A 3R01A 2OZOA 2WELA 3OOMA 4FSRA 4BHNA 3A8WA 4X6RA 1FMKA 1M2PA 2WMBA 4I92A 4DEDA 3RI1A 4AZFA 2Z7RA 3BEGA 4FKQA 3C50A 4QMYA 5ICPA 4PL3A 4P7EA 4L3PA 4DH3A 4E4LA 4A4XA 3BLHA 2AC3A 2OGVA 3D14A 1EH4A 1R78A 5D7AA 4CFNA 4FV2A 2SRCA 4HJOA 2NPQA 3ORZA 4X3FB 5C8NA 2XH5A 3AC8A 3C4CA 5EOLA 2WFYA 3AT2A 4XP0A 5CXHA 2EWAA 2XS0A 5HO8A 2XM9A 5EHYA 5K3YA 4B8MA 4RT7A 2R64A 3DAKA 5DI1A 3UMWA 3L8PA 5HCXA 4D2PA 5FP6A 4ASXA 3QUEA 1WVWA 2FUMA 2P33A 4RJ5A 4IX4A 1FPUA 4GEOA 1WBNA 5T3QA 3DAEA 1ZWSA 5HEZA 5L3AA 2DUVA 3DK7A 5H8GA 1F5QA 4LOPA 5EKOA 3NYNA 4TWPA 4QQJA 5ANEA 4AOJA 3GOPA 2WTCA 3QRJA 1URCA 3DKOA 3C51A 4JLCA 3WF8A 1ZOGA 2W17A 2WQMA 3MSSA 5EM6A 5HE2A 2YCFA 4H1MA 5HLWA 5EOBA 1J3HA 2F7EE 2EB3A 2X2KA 3B2TA 4G2FA 5FG8A 3RK5A 1X8BA 5A54A 5JN2A 3MFRA 3IGGA 1YXVA 2V7OA 5J95A 3GCUA 5I9WA 4G6OA 2J7TA 1ZMUA 5BVFA 2VWZA 5I9YA 4Y8DA 4KIKA 4KIQA 3RPVA 4EUUA 4UBAA 4FKSA 4L7SA 2GPHA 4PPAA 5DRBA 3VQHA 5E8VA 2J2IB 3KKVA 3QC4A 4O0TA 4BIDA 3FV8A 2C6OA 4MAOA 5IA3A 2B9FA 2ACXA 4USFA 3HKOA 4I0RA 4TWNA 3O51A 3L9NA 3PWYA 4E20A 3D7TB 3WILA 2XNNA 2UZUE 2C5YA 1CDKA 2R3MA 5HHWA 5LVLA 5JK3A 4XRLA 1YOLA 2VV9A 4TYEA 3MH0A 4ZY6A 4FYOA 2Y6MA 2XKEA 4WHZA 2ITVA 4QMLA 1REJA 1WVYA 3PXZA 3BU6A 3VF9A 4K1BA 3DBCA 3LJ2A 4FZDB 3C0HA 3EYGA 4GK4A 4MXAA 4F64A 4X3FA 3S0OA 3W1FA 3K5VA 3G6HA 3OMVA 2RG6A 4OAVB 4YC3A 3LAUA 5BVNA 3ZXZA 2Z2WA 5A4TA 3IOKA 3TV7A 5EH0A 1JWHA 3A2CA 3D2IA 5FQDC 4DLIA 3G9LX 3QTWA 5M4FA 4FX3A 4UEUA 4ALVA 4G5JA 1YXXA 3PSDA 3OY1A 4NKAA 4D55A 4K0YA 3TTIA 1J1CA 2JIUA 5C1QB 5CALA 1V0PA 2EVAA 1SZMA 4TKSA 3Q96A 3G51A 4BI1A 4ERKA 3CS9A 4FTTA 4K11A 3CTJA 4J8MA 4JAJA 4BRXA 2R3LA 3NUYA 4TY1A 4YO6A 4EHZA 2JFLA 1TVOA 3CQWA 4IJPA 3OUNB 3UPXA 3MJ2A 3ORTA 3ZBXA 1WBWA 1CKPA 2AUHA 3QYWA 2YIXA 2YDIA 3RM7A 4AAAA 5L2WA 4FA2A 1MRYA 3EQCA 3NDMA 2YM4A 4N70A 4R5YA 4BC6A 3HUCA 4IZ5A 4KKGA 2JDTA 1OIQA 5DEWA 3PJ1A 4PDPA 1E1XA 1GNGA 3MA3A 5GJFA 2RFSA 3HMNA 4O0SA 4OTIA 3MN3A 3UTOA 2X2LA 3WIGA 3EZRA 2F49A 3C0GA 2VTSA 2R3NA 3VS7A 3S95A 3KK8A 3EN4A 5KMNA 3COMA 4YPSA 4DEHA 3WZJA 3CKXA 3Q4ZA 3UNKA 2C6MA 3L9PA 3D7TA 2HXQA 5HCZA 2WIPA 2YIWA 2FSLX 3TN8A 2C6LA 4PY1A 1OL7A 2PZRA 3BEAA 3DFAA 3FE3A 3RM6A 4CFVA 4EOPA 5HBEA 4D2SA 4QYFA 4FKIA 3C13A 5IA4A 2VWBA 2CGWA 2UUEA 4MD7E 2XJ1A 2GS7A 4QMVA 3PZHA 2QKRA 4CZYB 5HO7A 2C3JA 4OTDA 5BMMA 4U3ZA 4CZUA 4F9CA 3BZ3A 5E8TA 5IDPA 2W4JA 4TTHB 3KRLA 2VO3A 3MB7A 4GYGA 2OJGA 3S2PA 3FZRA 3JUHA 3O96A 4MK0A 4ANNA 4RC4A 4ITHA 2B55A 4K33A 5HI2A 3VBWA 1H07A 2F9GA 3A7JA 3PIXA 2VTHA 4L42A 3QGWA 4IAYA 3RJCA 4J98A 4NM3A 3ZLXA 3GCSA 3QTUA 1REKA 5I9VA 5HO6A 3F82A 2C0OA 3NNWA 3PRFA 4QTAA 4JJRA 2C5OA 3NUNA 4QYGA 4RWKA 4H58A 4Z55A 1ZZLA 2HAKA 4MX9A 5LXMA 1PJKA 3I7CA 4RPVA 3NNVA 4ZP5A 4EQUA 3OCBA 3DBFA 3MJ1A 4IANA 4IM3A 2P0CA 3UE4A 3ZYAA 4E1ZA 2H9VA 3QKMA 4U8ZA 1LEZA 3LFNA 3S1HA 4R3CA 2CDZA 1DAYA 2PMOX 3TUCA 4J97A 4QTCA 5AR8A 4Q9SA 5CZIA 3R8VA 5BVDA 4FOCA 4IJ9A 4A7CA 3DT1A 3PTGA 5C03A 2C0IA 3EMGA 3O7LD 1DAWA 2C1BA 2FH9A 3GFWA 3TV4A 3PZEA 2BTSA 1YHVA 4EOSA 3RAKA 2C6IA 4CD0A 2G9XA 3RHXA 4EYJA 3WZUA 2XVDA 5J9YA 1H0VA 1R1WA 5E1EA 4UMPA 4FSYA 3EKKA 5AP6A 3KU2A 4LUDA 4F08A 5DR9A 2R3RA 4JX3A 4EK8A 1BL7A 2YITA 3FPMA 1Q97A 3LCKA 5I5ZA 3DNDA 1VEBA 2GS2A 2VGPA 3BGQA 3D15A 3UO6A 2JDRA 3UNJA 5JRSA 2X7OA 5AUWA 3TUDA 3R9NA 3R28A 2UZVA 4C4GA 3BQCA 3GBZA 4NW5A 3LOKA 3F7WA 4ZLZA 5E8WA 4LGHA 3U87A 1Q8WA 2C6EA 4YZNA 3R1YA 2WMVA 3GQLA 5FTOA 4IQ6A 4FKVA 2VTQA 3IW5A 5K0KA 3OW4A 1WBPA 3RMFA 4G9RA 4JBPA 3V6RA 2JC6A 3QTXA 1YI4A 2W1EA 3LFAA 2JIIA 4FK3A 4YBJA 2OF2A 1MQ4A 1GY3A 3FBVA 4OBQA 3RHKA 2QVSE 1YVJA 3AOXA 2X7FA 5DLSA 2R2PA 2VTAA 4AUAA 4IWOA 3UO4A 4XLVA 2JKOA 3L9MA 4I24A 4MWIA 3WYXA 4CCBA 2PVMA 2QURA 4XG8A 4DG0E 5L6OA 4C2WA 4NK9A 5KE0A 4PTEA 1DM2A 1FVRA 3A99A 4EH6A 3ZO2A 1YW2A 1I09A 4FT0A 5HTIA 1MRUA 2B54A 3AMAA 4CXAA 4UMQA 1RQQA 4RVTA 2XK8A 4AN2A 5AUUA 1CSNA 3LCDA 3GB2A 5J9LA 4ANQA 2Z7QA 4HCVA 2W05A 2PY3A 4O1PA 4HVHA 2RKUA 3DDPA 2UZDA 3BGZA 3RPYA 4F63A 4ZZNA 2BUJA 3R21A 3ORKA 4JAIA 5HBHA 3WF6A 5J79A 1BX6A 1KOAA 1SNXA 2XK6A 2R0UA 4G16A 5AR2A 5EW8A 2GHMA 3PE2A 3CR0A 3W16A 4BKYA 5AP4A 4AGWA 1UVRA 5CVFA 5BVWA 4DTKA 3HV5A 5KHWA 1YXSA 3ZEWA 1W82A 2X8IA 2LAVA 2QR8A 2CN8A 2VZ6A 3E3BX 4FVQA 4YTHA 3H9RA 3RALA 3UNZA 3GU8A 2CPKE 4ZZMA 2YJSA 2VUWA 2YDKA 3TZ8A 1W0XC 4IFGA 4BIEA 1RE8A 3ZRKA 3AQVA 4BN1A 3FLYA 2V22A 3WI6A 5HD7A 3LXPA 4MCVA 2E9UA 2BAKA 2QHMA 3TNWA 4Z7GA 5CQWA 5A4EA 3LQ5A 4YHTA 4U9AA 3TNHA 4PMMA 3HMIA 5GZ9A 3Q5IA 1JKSA 2BRNA 2PZPA 4YJQA 5AUTA 3F3VA 4GUBA 5JQ5A 4LRMA 3HNGA 2QOOA 4O22A 4B8LA 5AAGA 2R3JA 1ERKA 3NYXA 5C9CA 3Q2MA 4IZ7A 5EW9A 4OTHA 2VWYA 4I5CA 4BDFA 3FMNA 5TR6A 3H30A 2RFNA 3G90X 5CYIA 4OTWA 5HTCA 2R5TA 3TKIA 2XNOA 2WMUA 4GFMA 4E5AX 2ZM3A 3AXWA 4MNEB 4QMUA 5CEIA 2Y4PA 4ALWA 5DT0A 4E26A 4FVPA 2R7BA 4P5QA 4PP9A 4ACGA 3MW1A 1K2PA 3DS6A 3CLYA 4ZSEA 5HX8A 2V5QA 2PVNA 5CAPA 2QOBA 3FMEA 3GVUA 3HV6A 1PXNA 3CD8A 3BCEA 3QKKA 3DDQA 4FTUA 3P79A 4J8NA 3EIDA 4D5KA 4EQMA 4Z9LA 2ZV7A 4GFOA 3Q6WA 5M4IA 2BHHA 5J1WA 1W83A 3CE3A 4HVSA 1OL5A 1JSTA 3R0TA 1NVSA 3RVGA 4D4VA 5EI6A 4LYNA 1WBTA 2XM8A 4HGEA 4UZDA 5E8ZA 4R7IA 3VJOA 3ZHPC 4BCKA 4E6AA 4R1YA 4RC3A 3E8NA 4AE9A 2YCSA 3FZPA 3DQXA 5B0XA 3OROA 5F20A 4O0YA 5DG5A 3FZOA 2GQGA 1M7NA 1M14A 3QALE 1R3CA 3NS9A 4ARKA 3MIYA 4C8BA 1GZOA 2HY81 4W4XA 3QQFA 3QXPA 4FL3A 3IDPA 2X8EA 1Z5MA 3TWJA 4QTBA 4EHVA 3F61A 2Y6OA 4I5HA 3S00A 4G3EA 5HIEA 4IH8A 4NTTA 2YZAA 3DXNA 1HCKA 1FMOE 4JG7A 4JI9A 4N6YA 4FG8A 4YSMA 5I9UA 3JVSA 5FBNC 1YWRA 3MI9A 3FXZA 1SVHA 3UOKA 4M3QA 4Y73A 3ZZEA 4HYIA 2PTKA 4DH1A 5J1VA 5IPJA 1ZARA 3ORPA 3CJFA 3NUSA 4XOYA 2ITTA 1UNHA 2W0JA 1PYXA 3QYZA 3Q6UA 3FY0A 2XJ0A 4A9RA 3F6XA 5HU3A 5DIAA 3HP5A 5AP3A 2P3GX 2YIQA 3FAAA 5IKWA 3VS6A 4WNMA 2BKZA 4UALA 5AUXA 2BFYA 4RJ7A 4ID7A 3R1QA 3U8WA 3P78A 4G6LA 4MKCA 4MNEA 3ZUTA 5EKNA 5IISA 5LWNA 4M66A 4IMYA 4QNYA 5EYCA 3BX5A 2JKKA 4B99A 2WOTA 5AV0A 1E9HA 4G1WA 4EL9A 3WOWA 2H8HA 4P2KA 4MYGA 2XIYA 3VULA 5F95A 3W8LA 4O0UA 2C6KA 4JDJA 4FG9A 3ZDIA 2FA2A 1O6KA 1XBBA 2YJRA 2ZOQA 4ZSAA 3BYVA 3GEQA 4WNPA 3DNEA 5CAUA 3QQUA 4TYIA 4KKEA 5GZAA 2WTKC 4IVBA 4GJ2A 4BCHA 4M68A 4FOBA 3EN5A 1YI6A 3LMGA 4XG4A 2VTMA 4JQ8A 4C0TA 2WMQA 4BDHA 4CKRA 1H8FA 2BZKB 5EDRA 4ZSLA 3Q4CA 3BELA 4BF2A 4OTPA 1QMZA 4V05A 3ZFXA 3MFTA 4X0MA 4H1JA 3LIJA 4NZWB 4QMWA 4EYMA 5LMBA 2ITYA 1T45A 4XMOA 3UO5A 1JPAA 1PMEA 3F69A 4IM2A 3PA5A 1RJBA 4RJ8A 3VUGA 3BRBA 5FM2A 3ZC6A 4CTCA 2O0UA 3OFMA 1JNKA 5H8EA 4IVDA 3FMJA 4QTDA 5B7VA 4YJPA 1OPKA 1BI8A 2FSOX 2YEXA 3D83A 4QD6A 4MF1A 2R3FA 5J87A 4TYHB 5BVKA 5J7BA 1P5EA 2J5EA 4NJ3A 4JIKA 2CLQA 1M2RA 3CP9A 4AOIA 2XJ2A 5IEYA 1Z9XA 3FL5A 3UP2A 4QO9A 4IZAA 2HWOA 4A9UA 5IA1A 4S32A 3PXKA 3BHYA 2XNBA 5AIKA 4EOMA 3FQEA 2GMXA 1H00A 3SHEA 5L6PA 1AD5A 3KY2A 5LMKA 4I41A 2NRUA 1PY5A 3UYTA 3K3IA 2VWUA 4ZAUA 3L8VA 3NR9A 5LJJA 1J91A 2ERZE 4YTIA 2YACA 3V5JA 3CY2A 5DGZA 4DEIA 4EEVA 4XHKB 2BCJA 1G3NA 3P86A 2CLXA 3HV4A 4EK6A 3WBLA 2Z8CA 2VTNA 3KXGA 3KF4A 3DKFA 1ZY5A 3Q9XA 2W96B 4FV1A 5AP5A 3MTFA 5DFPA 5LOHA 4UYNA 4XV2A 1KE5A 3BYUA 3DBQA 4FF8A 1WBOA 3MPAA 4ENXA 5LCKA 3QLFA 3M11A 2ONLC 1LPUA 2C5XA 2XNPA 3E7OA 2C1AA 4FNWA 4PWNA 1YHSA 2QO9A 4QYEA 3R7UA 3COHA 4YR8A 2BRGA 1JAMA 3M42A 5JZJA 4FZAB 3FQSA 2Y0AA 4YGAA 5CEOA 5IMXA 4ITIA 3OT8A 4V04A 4BGQA 5IUIA 3QZGA 5CNOA 2A0CX 2XA4A 5J8IA 3W18A 3KXZA 3T9TA 4Q9ZA 5CEMA 3ORNA 3OTUA 3NWWA 3TKUA 1PYEA 2Y8OA 1YWNA 4CFXA 1OPLA 2Q0NA 3C4EA 5M57A 3UJGA 3OC1A 3QQHA 2WMAA 4WD5A 5CANA 5FP5A 2PVFA 3FI4A 3GI3A 2PMNX 2PWLA 3ZO3A 5HZNA 2YFXA 4RMZA 5HNIX 2E9VA 4ANBA 1H01A 3DK3A 3UC3A 4AACA 4TL0A 3DZQA 1R39A 3AC4A 3E8CA 4IVCA 2C0TA 3HV3A 3VHEA 3UOHA 4XH6A 4CLIA 4U6RA 4PNKA 2BILB 5M44A 4R8QA 3FKLA 4TYHA 5GHVA 4YUQA 1Q8UA 4LMNA 5EM5A 4ZY4A 2YIRA 4F1MA 3NLBA 5EK7A 5C27A 3PRIA 4F1TA 5LWMA 2NRYA 5EI2A 4GMYA 3SOAA 3FMKA 4RSSA 4NH1A 3ELJA 3KFAA 2XIRA 3AC2A 4J96A 3QD3A 5E91A 4AW1A 4M97A 3DV3A 4HYHA 1UU9A 4NFNA 3NYOA 3RAWA 2QQ7A 4AN9A 5DA3A 2VX0A 2OFVA 3DTCA 5AR7A 2XBJA 2C68A 5A3XA 3VBTA 5J5SA 4MBIA 1GIHA 3PVGA 4FTNA 4L43A 4BYIA 4OLIA 3T3UA 3IW6A 5L2TA 4MHAA 5DOSA 2J5FA 5KMOA 3UP7A 4M7IA 5CF4A 3OWLA 3EQFA 4QP3A 4H36A 5BYZA 5IUHA 3UIBA 2OFUA 3PPKA 1B38A 3LE6A 4RGJA 4AOTA 2JKQA 3MYGA 3WIKA 5F1ZA 4JDIA 2FVDA 3KRWA 2BDFA 4L7FA 5ANGA 3R7VA 4O96A 2XIXA 5KUPA 3BHUA 2UZNA 5IA5A 3H9FA 4EI4A 5ANIA 3SQQA 4WO5A 2FB8A 1IEPA 4FL1A 4JT3A 2QOLA 3VUMA 3OG7A 3WZDA 2BPMA 2QOFA 4APPA 3TTJA 3KXHA 3WF5A 4ITJA 2BALA 1CMKE 4FK6A 5FTQA 4CMUA 4YO4A 5KO1A 3Q60A 2QO2A 4O0RA 4IAZA 4DEAA 4EH8A 1WAKA 3QCYA 4RIWB 4BZOA 4BVUA 1PXLA 5AV1A 3KMUA 1U46A 4CZTA 3ZH8A 4OAUC 4Y83A 2UW5A 5D1JA 2A4LA 4S2ZA 3FSKA 1JBPE 4QMPA 2XKDA 2NO3A 2GFCA 1JKKA 3W2CA 3HGKA 5BNJA 4ZJVA 3AGMA 5CWZA 3PXYA 4LL5A 4EHEA 5IZFA 2I0YA 4L3LA 3Q9ZA 2QOKA 3HRFA 4XBRA 5A4CA 4TZRA 1IRKA 3FXXA 4DH5A 4EQCA 1PKGA 2IZUA 4XBUA 4QP9A 3QRUA 4DC2A 3NNUA 1RW8A 2ZDTA 4R3PA 2V55A 4MXCA 3JS2A 3HECA 4CSVA 3MY5A 1OB3A 3QTQA 3NUUA 1LR4A 4WIHA 1PXKA 3CPBA 4BBEA 5CF5A 1J1BA 4MXOA 1UU7A 2HZ0A 4E4XA 2ONLA 1OIRA 3CIKA 3D5XA 3IG7A 4IB5A 5DVRA 3VJNA 4R6VA 3HRBA 4JR7A 4MNFA 4FVRA 3EL7A 5CS6A 2BFXA 3AD5A 2WMXA 4OBOA 5E92A 1IR3A 5EHLA 4BCJA 3DJ6A 4NJDA 4H3PA 1PW2A 3F5XA 3D4QA 5FWKK 2FO0A 1H4LA 2B1PA 4I4EA 4QOXA 4AZVA 4X2JA 3CQEA 4DINA 3LM0A 1ZOHA 2WQOA 3QXOA 4FKRA 3ZC5A 1TKIA 3GU4A 4DN5A 4IDTA 5FXQA 4YHJA 4C34A 1UKIA 3II5A 2WTJA 4QMXA 4Z16A 3V8TA 3OCTA 4RVMA 4A07A 2XEYA 4A06A 5CXZA 3ALNA 2EUFB 2JBOA 3ORXA 4IACA 3EH9A 3ORLA 1Q3WA 5AAFA 1JKTA 4X21A 3RKBA 4L8MA 3CEKA 3K2LA 4HNIA 4QP2A 2WOUA 3AC1A 5AP1A 3S3IA 1B6CB 2QG5A 3EHAA 4K9YA 4XX9A 4BKZA 1SNUA 4RIWA 1Y8YA 3W2PA 2G01A 4R1VA 2YHVA 4D4RA 4KBCA 4FKTA 5J9ZA 5EM7A 4D4YA 1ZMWA 4YNOA 4RA4A 2XUUA 3P0MA 3VAPA 2ZDUA 4K2RA 2ITWA 3MY0A 3EN6A 3R6XA 1KE7A 4IE9A 4M12A 2PE1A 5CSHA 5HE3A 4AWIA 4D28A 4ZTMA 3KVXA 2JITA 5CX9A 4FIFA 4CFWA 4I20A 4QNAA 3A7GA 4AP7A 3BLQA 4RC2A 4ONAA 2B9IA 2XRUA 4FTJA 3KXXA 4ALUA 3C9WA 5CEQA 2W1HA 4OTRA 2W5AA 3ZLSA 1BI7A 3EFKA 3EQRA 2OJ9A 3PY3A 3R2BA 3V5QA 4W8EA 4FUXA 4FNYA 2Y9QA 4UYAA 3EQDA 3RTPA 4K18A 4CRLA 3VNTA 3ZFYA 1NVQA 1V1KA 2BTRA 3QHRA 4I21A 5H8BA 3WE8A 5EI8A 4J71A 1GZNA 2O3PA 4XCUA 2OIQA 3Q9WA 4F65A 4D9TA 3PVUA 3MTLA 1KSWA 2R3KA 5FEDA 4TW9A 3OOGA 4ANSA 3VF8A 2XB7A 4JBVA 5KBQA 3Q52A 4NKSA 2XNEA 2W1FA 4NTSA 3BYOA 1RDQE 3FHRA 3PYYA 3BV3A 1QPCA 3KCKA 3E5AA 3FZSA 3UC4A 5HICA 4D2RA 1VR2A 4EWQA 4O27B 3O8UA 4NCTC 3PG1A 2P4IA 4C4EA 3C7QA 4F0IA 4GUEA 1JQHA 2HZIA 4USEA 3FLWA 3U4UA 3MVMA 4YZCA 3RAIA 3NX8A 3VUIA 3Q9YA 3FXWA 4FZ7A 4IZYA 3VUTA 4BDJA 5IA0A 5CSXA 4H3BA 5E8XA 4IB3A 3OW3A 4ZY5A 4XG2A 3KEXA 4FKPA 3IECA 3LLTA 4GFGA 4BCNA 4M0YA 1LEWA 4RJ3A 4ZS0A 3MH1A 4PUZA 4Z3VA 4C62A 4IIRA 5HNGA 3QF9A 4GU6A 5FEEA 3TZ9A 3ZSGA 3SVVA 1NXKA 3EQHA 4WG5A 3VBQA 1Q8ZA 5G6VA 4LMUA 2V0DA 4B9DA 3QTZA 1IG1A 4FKLA 5M51A 5K5XA 3WZEA 3OXTA 4CV8A 3R8PA 2X2MA 5G1XA 3Q32A 4IB0A 3Q5ZA 4M84A 4JG6A 3RNYA 4O0VA 4FSZA 4ACCA 4E5WA 1UKHA 2ETMA 5JZNA 3R8UA 4YURA 3IOPA 3O50A 4UY9A 2OZAA 3VUKA 4EC9A 4PNIA 2DWBA 4LG4A 1OUYA 3HL7A 2BIKB 2B53A 3K54A 3O17A 3L8SA 3F3TA 2Z7LA 2HW6A 4C37A 1GAGA 1Y91A 3FPQA 4AZTA 4APCA 5EHOA 4QQ5A 3UIXA 3D5WA 2GHGA 4J7BA 3TI1A 5TO8A 4BCIA 4ZJIA 3SXFA 4DHFA 2O2UA 2PSQA 3ZOSA 2XKCA 5CEPA 2UW9A 3ZO1A 3I60A 4G3CA 3NCZA 1GJOA 4AA5A 5EYDA 5EG3A 2WHBA 3EQIA 3QCSA 2G2HA 1UA2A 5KNJA 2PL0A 4DG2E 3A4OX 3P5KA 4HYUA 1U54B 2BAJA 4I0SA 3ODZX 4AU8A 1M17A 2ZM4A 4YSJA 2R9SA 4WG3A 3RCDA 2WAJA 2BRBA 2QOHA 5BYYA 3R9OA 3CQUA 2OICA 3EOCA 4W9XA 1OKZA 2WNTA 4C57A 5CSPA 3CGFA 3A62A 3IPHA 4I4FA 5K9IA 4FV5A 3SOCA 3UMXA 4LUEA 4XG9A 3C4ZA 4YP8A 5DR2A 3SV0A 3R8ZA 2RSVA 2QNJA 2F7ZE 2WTDA 4FIHA 4M14A 4FNZA 2FGIA 3R9DA 5HIDA 3RP9A 4W8DA 4CEGA 1Z57A 3W8QA 2BIYA 3TEIA 1OM1A 4HZSA 3RBWA 3AT4A 5FDPA 4JBQA 3QHWA 4BCGA 4CQGA 3S4QA 3U6HA 3F5PA 3R2YA 3OUKA 4U40A 4ANOA 2VAGA 3IW7A 3D2KA 4O2ZA 4WRGA 2WMTA 3CD3A 3A7IA 4RJ4A 3W32A 4KD1A 4DYMA 2HXLA 3EN7A 4JIAA 4YBKA 4E7WA 4AGCA 1BL6A 4XV9A 3WZKA 1OZ1A 5HBJA 4GG7A 1OIUA 3D5VA 3I6UA 3TXOA 4AA4A 4DEBA 2W1GA 2YM5A 5LVPA 3FI2A 2JLDA 3I4BA 2UZTA 3R1SA 2VNWA 3NCGA 3PSCA 5EDQA 2J0LA 1ZYDA 3EQPA 3LFCA 4O21A 4RFMA 2EXEA 5A46A 2PE2A 4JS8A 3ZRMA 4F4PA 2PZYA 2XK3A 3PIZA 3FLNC 2YA9A 4XG7A 3G33A 4RX8A 4JG8A 2CGXA 2REIA 4YLKA 2QODA 5IDNA 1ZY4A 3UBDA 3CXWA 5IA2A 4MVFA 3MV5A 4DGMA 4AS0A 4NCTA 2E9PA 3V04A 5FRIA 4YTFA 5GJDA 3BE9A 3Q53A 4BL1A 3FSFA 3GT8A 4BCPA 2GTNA 2XYNA 3HV7A 3KMMA 4C3FA 4CFUA 4ZTLA 2BMCA 2YM3A 4RIXB 4FIEA 3CY3A 1U54A 4GT3A 4EH2A 4F9WA 5IG1A 4PDOA 5AX9A 1APME 3MVHA 1QCFA 4YHFA 3L9LA 1BUHA 1GOLA 3LW0A 3F3UA 1DI9A 3MY1A 4BGGA 2C47A 5CSVA 4BDDA 2BR1A 4CMTA 2XMYA 2OIBA 4HPTE 1PKDA 4S31A 1XBCA 4G9CA 4RRVA 3FMLA 3WE4A 3QQLA 4FGBA 3VS3A 2VO0A 2QI8A 4QP8A 3I5NA 3PY0A 5CTPA 4NIFB 4EKLA 3ODYX 1VYWA 3ANRA 4KIOA 5A14A 5LCJA 2VTLA 2BZJA 1KOBA 4C38A 3QD2B 3VHKA 4UX9A 3DA6A 4L3JA 2RIOA 5JFSA 4UB7A 2VU3A 4WBOA 4JBOA 1Q8YA 3DLZA 3QZIA 3ZO4A 2CN5A 4OGRA 3OXZA 3V8WA 5HE1A 5LVMA 4I6FA 5LMAA 2ZB0A 3ETAA 2OU7A 4WRSA 4JVGA 1KE9A 4C4IA 5I9XA 2VTRA 5HIBA 4U80A 3E93A 3ET7A 4DCEA 1Q99A 2AYPA 1M7QA 4FIIA 4K6ZA 5I3RA 3PXFA 4KRCA 1H25A 4ANMA 4PL5A 1VZOA 4HOKA 3RZFA 1U59A 3FC1X 2GSFA 4X3JA 1Q3DA 1R0EA 2IZSA 4XP2A 5H2UA 3HEGA 3U6JA 3GOKA 3IONA 4UZHA 2XRWA 2YERA 3HRCA 5DHJA 3D5UA 2J0JA 3AC3A 3KVWA 5FEQA 3PJ2A 3BV2A 3WF7A 5A4QA 2UW0A 5IF1A 3VS4A 5LMKC 4M0ZA 2Q0BA 2YAKA 2CGUA 3OT3A 2HW7A 2VTPA 1UNGA 4BKJA 4KKHA 4O1OA 3R8LA 1UWJA 4PMPA 4Y85A 4NM7A 4S34A 5TF9A 4L67A 2W1ZA 5AUYA 3P23A 3R02A 3DJ7A 2XF0A 1PXJA 4QRCA 4BDBA 1OKWA 3UQCA 1YOJA 2F4JA 3ZLYA 1IASA 3DTWA 2BRHA 4RIXA 5CSWA 5AM6A 5HG5A 4I0TA 5JGAA 4X2FA 5CU3A 3MFUA 1SVEA 3ENMA 2VGOA 1FINA 3UG1A 4AW2A 4EOKA 5KKRC 5IH6A 4I6QA 4QPSA 3TKHA 4FKJA 4IAIA 3E3PA 4JDKA 2W4KA 1YOMA 4FV3A 5ETAA 4TRLA 2A1AB 4U7ZA 4YJSA 2ZAZA 3VS2A 1OIYA 2ITPA 4NIFA 4TWOA 5HX6A 3PVBA 3F2AA 3LHJA 3H0ZA 2I0EA 3FYJX 1PMVA 2R3PA 5JRQA 4QMSA 4TN6A 2RG5A 2CSNA 2UZLA 4F7LA 4AGDA 2G1TA 5DE2A 3WF9A 3C4FA 3RZBA 3OEFX 4OT5A 3EFLA 4WOVA 2XNMA 4FTMA 4BTMA 4D1XA 4G34A 2WQBA 2QOIA 5AR3A 1XH8A 3B2WA 3ULIA 3V5WA 2GS6A 2YISA 2Z7SA 4DFYA 5TKDA 3VBXA 2OXDA 4DEEA 3UZTA 1V0BA 3HA6A 3VIDA 3VC4A 1XKKA 5DN3A 2PVKA 4C58A 4KBKA 4ANLA 5AAEA 5DMZA 3FLQA 4RJ6A 2WO6A 3VS1A 3ZCLA 2VWWA 4WKQA 4CRSA 3LFDA 2BDWA 3DKCA 2QO7A 4HW7A 4RQKA 4DGGA 3PXRA 2C69A 3CKWA 3OVVA 4NEUA 3VRYA 5CEKA 4C35A 4QMNA 5CI6A 3THBA 4AT5A 4ZLOA 4WT6A 3A7HA 4G17A 4IEBA 5M4CA 3R1NA 4BTKA 3U9NA 1XR1A 5TT7A 1NVRA 5BVOA 4AGUA 3ZBFA 1UWHA 1SM2A 2IW6A 2UW4A 3PJCA 4KS7A 2EXMA 4LOOA 2NP8A 4MWHA 5GZ8A 1Y8GA 3BU5A 3D9VA 4OTGA 5K4IA 3P7BA 5KKRB 4AW0A 4LFIA 1Y6BA 3DU8A 1F3MC 4FSQA 4DBNA 1W98A 2R0IA 4II5A 3HMPA 4WG4A 2ZMDA 4C3RA 2GU8A 3R63A 2W1DA 3V6SA 4QMTA 3F3ZA 5BUIA 3BBWA 4FKOA 4B0GA 4E4MA 4I94A 2OBJA 4L9IA 3QTSA 5LVOA 4BI2A 1BLXA 4IDVA 5ITAA 4RIYB 4G31A 4FTCA 3LFFA 3HZTA 3UYSA 5EYKA 1W8CA 3G0FA 2XZSA 4FKWA 3NEWA 3SW7A 4QQTA 5M4UA 4G6NA 1OL2A 1NY3A 3E88A 4LGGA 3BHTA 3LCOA 2X7GA 3EL8A 5BVEA 4J53A 3T9IA 4HZRA 1R0PA 4LL0A 3GC8A 4EH5A 4EOIA 4M13A 5CVGA 4YNEA 1B39A 3V5LA 3SDJA 3EZVA 3BKBA 3TIYA 3QTRA 2X0GA 5IMEA 4V01A 4O38A 3EQBA 3OWKA 4I1ZA 3UQGA 4FG7A 3KB7A 4EK3A 4UMTA 3CBLA 4FSMA 4QT1A 4Z7HA 3QL8A 3C0IA 5KMLA 4L45A 1YXUA 2BZHB 1S9JA 3PP1A 4FT3A 4IXPA 1CM8A 3ORMA 3COIA 5CU6A 2BROA 2VX1A 4IAKA 4RWLA 4GRBA 5HNBA 3QWKA 2VWXA 1MP8A 3ZXTA 4U45A 2VTIA 3BPRA 3KCFA 3KULB 2J90A 3OD6X 3PUPA 4KIPA 4X6QC 4AQCA 4N4SA 2I6LA 2WXVA 5ETIA 4BB4A 3QZHA 4E73A 5KHXA 2W1IA 2OXXA 4EBWA 5EW3A 4GW8A 3UODA 4YJNA 5CNNA 3FWQA 4XS2A 4IHPA 2R3GA 5HTBA 4C61A 1O9UA 1P14A 3O2MA 4X2NA 1W7HA 2XK4A 3BI6A 4D2VA 4ERWA 3KC3A 3DLSA 3AMBA 4EH3A 3C1XA 5HLNA 1AGWA 2O5KA 4KNBA 2FYSA 4G3GA 4QYHA 4OUCA 4XP3A 4TYJA 3F5GA 4FTAA 4G3FA 3TJDA 3CPCA 3AGLA 4YU2A 4X7QA 3UIMA 3DGKA 2YAAA 4EJNA 1DS5A 3O0GA 2I0HA 4RIYA 1FGIA 3IDCA 5AV3A 4GU9A 4RQVA 5D7VA 4ACHA 5LQFA 1YDSE 2YLFA 3POOA 2ETRA 2IVSA 4EH7A 5FXRA 3C4WA 5CY3A 3ZU7A 1FQ1B 1KE8A 4L6QA 4XJ0A 4U43A 1M52A 1YQJA 1G5SA 2R3OA 3I79A 4IC7A 3KRRA 5JSMA 2B4SB 3LXKA 4JX7A 4OTQA 4UWCA 4WA9A 5E7RA 5KMMA 4FR4A 2YIYA 1SYKA 4AZWA 2JGZA 4XV1A 1WVXA 3FL4A 3IGOA 2OF4A 2YM6A 3GCQA 4AW5A 3C4XA 5L2IA 3R7GA 2ZB1A 3QCQA 3Q4TA 3LXNA 2XNGA 4CNHA 4FSTA 3W2OA 1ZAOA 3SAYA 4E93A 4IWDA 3UG2A 3QX2A 2WMWA 4FTRA 4EWHA 5JKGA 3ZFMA 3A4PA 5C26A 2IZRA 1PXOA 4YLLA 5HG8A 5FM3A 4CYIA 4DEGA 3QQJA 4PPCA 1Q8TA 4DITA 5HE0A 1H24A 4AT3A 4RWJA 4D2WA 4X2KA 3FDNA 3UOJA 1MUOA 3QZFA 5JMSA 1ZXEA 5DNRA 3RCJA 3BLRA 1OGUA 4RVLA 3KULA 3PJ3A 5AADA 3MIAA 3NUPA 2ITUA 4ZTSA 3UIUA 2JFMA 1K9AA 1YHWA 3HVCA 4PMTA 1KV2A 5DPVA 5C01A 3TACA 3OBGA 3OWJA 3QRIA 1YI3A 3PP0A 1ZYSA 3W55A 4FT9A 4XLIA 4E6CA 4FV8A 3TZ7A 4UV0A 3DFCB 3KN5A 3BQRA 4QPAA 5IUGA 3D94A 5I0BA 4DFNA 3L1SA 2CHLA 5CAQA 1WBVA 1O6YA 2VD5A 2C3IB 4O0XA 4QTEA 4YJOA 5ACKA 2W99B 1ZYJA 3HX4A 4KABA 5FXSA 2KTYA 1H1PA 2F2CB 4PV0A 4KA3A 5KX8A 4L53A 1PMNA 2QC6A 4HYSA 5E8UA 4ASDA 4QPMA 4IFCA 4EOOA 3QBNA 1PF8A 2OJJA 3SLSA 3AC5A 4A9YA 5L2QA 3VBYA 4HVDA 3DB8A 5GNKA 5L8JA 2EXCX 2E9OA 3DQWA 4GL9A 3E7VA 3R83A 5HVJA 2QONA 4ZJJA 3SRVB 3GU6A 4WBBB 4BCFA 4F99A 1ZMVA 4AG8A 3PPZA 4FI1A 5CF8A 5AMNA 5BQ0A 4P4CA 3IKAA 3U6IA 4Y72A 2WZJA 3BBTB 3GP0A 4AF3A 5BPYA 4Y46A 2PZ5A 5DH3A 4FUYA 1MRVA 4D5HA 3R7YA 3K3JA 4OW8A 4AA0A 4GK2A 3SXRA 1Y57A 2V62A 4HGSA 3F5UA 2UVZA 2OH4A 1A9UA 1YXTA 2DQ7X 2EU9A 2WEVA 3FI3A 3LQ8A 3NYVA 4LRJA 4MD9E 4BDCA 4AFJA 5CI7A 2GNFA 3QU0A 3EYHA 4RG0A 4GIIA 4IAFA 3DY7A 3GCPA 1P2AA 5CQUA 2C4GA 2QKWB 4FV6A 3EKNA 3H0YA 2WD1A 5B2KA 2PMIA 2Y4IB 3G5DA 4TYGA 4ZEGA 4BWKA 4D0WA 3AD4A 3R71A 4E5BA 3E62A 3Q04A 3DPKA 2QOQA 3TV6A 4L46A 3E8EA 4QMZA 5AA8A 3H4JA 3CGOA 2CKEA 3ZRLA 1IA8A 2IW9A 4F9YA 3EB0A 1FGKA 1YKRA 3PWDA 1JSUA 2XCHA 2VWVA 2O65A 2IZTA 3DK6A 2UV2A 4O6LA 4WNKA 2VRXA 5I3OA 3UVPA 4CFMA 4GS6A 2JAMA 3NZ0A 4K77A 3QA0A 5ETFA 4D1SA 5CASA 5K4JA 3MPMA 5BMSA 4F70A 3PIYA 3MVJA 2ESMA 3ERKA 1YRPA 4AZEA 1YDTE 2W5BA 3KL8A 2ZV8A 3T3VA 4NFMA 5F9EA 1Y6AA 5JGDA 4GG5A 2UVYA 4D0XA 4RX5A 2ZV9A 4O0WA 4R3RA 5DT4A 1ATPE 4EUTA 2O8YA 3LVPA 4J52A 2I0VA 4YJTA 4E6QA 3DBDA 3EJ1A 3LJ0A 3KXNA 3MB6A 4JQEA 5LARA 3SRVA 4F09A 3F2NA 1WBSA 1QPJA 4V0GB 4B4LA 3VVHA 3ZUVA 4A9SA 1KE6A 2OO8X 3BYMA 2XK9A 4BWPA 3COKA 4YMJA 4HCTA 4OT6A 3OTVA 4EZ3A 3LCSA 3PPJA 1JKLA 3KRXA 5IH5A 3RAHA 2QLQA 3A7FA 3OCSA 2WMRA 3G0EA 5DWRA 3ZSHA 4BIBA 2VNYA 4WNOA 3VBVA 4HNFA 4NW6A 2VTOA 1MQBA 5L4QA 5EFQA 4BYJA 4CV9A 2OH0E 2WB8A 2B52A 3VQUA 4MF0A 4OBPA 4PX6A 3O8PA 4MH7A 3CTQA 4C4FA 4YTCA 2OZAB 1PXMA 2IVVA 2GFSA 4R5SA 4YZDA 4U41A 5HKMA 4BDAA 3MBLA 4DH8A 5LVNA 4L52A 2ITNA 3PXQA 1FVVA 2YN8A 4U42A 4XG3A 4EKKA 2B7AA 5E1SA 3QQKA 5K0XA 3N51A 4HCUA 2PVHA 3UDBA 4P5ZA 4CQEA 3RPOA 2QR7A 3FMDA 5CT7A 3MH2A 3VS0A 1O6LA 5KCVA 3IW4A 5ACBC 5M56A 2OWBA 5FDXA 5AJQA 1JLUE 3SW4A 4FTIA 2XIKA 2G2IA 4R7HA 3NIZA 3A60A 5DEYA 5L8LA 2P2HA 3FY2A 3ZS5A 4BDEA 1U5QA 4OR5A 2KULA 5FD2A 3KMWA 3NUXA 3RGFA 3P7AA 2QHNA 5HQ0A 4PMSA 4QYYA 4ZOGA 5C8KA 5JFWA 4DGLC 2GHLA 2OJFE 3RINA 5D41A 2RFEA 4FBXA 4I6BA 4E8AA 3SX9A 3OBJA 3A8XA 4BDKA 1YWVA 5E8SA 2PVLA 3BHHA 3MWUA 2CMWA 4IC8A 4KS8A 5EYMA 4M67A 3ZDUA 1ZRZA 3IK3A 2XBAA 3VW8A 1KWPA 5A6NA 4HGLA 3JY0A 4BCMA 4BHZA 3TT0A 4V0GA 4FTOA 3UPZA 2OXYA 5HCYA 2V7AA 1SVGA 1Q24A 4IW0A 4BICA 5ANOA 4GH2A 2P55A 4FV9A 3ZLWA 4FT7A 3QUPA 2PE0A 4IVAA 1CTPE 3UOLA 4WSYA 3B8QA 4GIHA 1WCCA 3FZTA 5GJGA 4A4LA 5A4LA 4AE6A 2HYYA 5JQ8A 1XH4A 4FEQA 4H39A 4ZXTA 2IN6A 3NAYA 4W4YA 3ZEPA 3EN9A 4N6ZA 2PHKA 4YZMA 3MGYA 4JL9A 4NSTA 3RWQA 4QMOA 3P08A 1ZLTA 1OVEA 3O8TA 4EORA 3TIZA 5AV2A 2W1CA 3GU7A 4KSPA 1AQ1A 3ULZA 4EK4A 2YLEA 1LUFA 2PVRA 4E3CA 2VX3A 3KA0A 2C30A 3M2WA 3QD4A 2UW6A 4U81A 2X39A 4I5PA 4U0IA 2GNIA 4TXCA 1UV5A 3U51A 3NSZA 2JDSA 3I6WA 2ZM1A 5HLPA 3PFQA 2RL5A 5T6KA 3P7CA 1OL6A 1QL6A 2W06A 5AIRA 1A06A 3P1AA 2XIZA 1H0WA 2HOGA 1KV1A 5TOZA 2XEZA 3KGAA 1S9IA 5JGBA 1ZZ2A 4D4SA 2JKMA 4KSQA 2BDJA 2XK7A 4BBMA 4ENYA 4D1ZA 5B2LA 3QTIA 1GIIA 3LFSA 5I4NA 1Q41A 2RF9A 3BIZA 4PF4A 5CU4A 1BMKA 4KBAA 4K8AA 1FOTA 2RGPA 1GZ8A 3EQGA 5IEVA 2WTIA 3OP5A 4AX8A 4JRVA 3R30A 3DJ5A 3RK7A 4B6LA 3ZONA 3O71A 4PQNA 2YM7A 1OKVA 3JVRA 4G5PA 3DBEA 4IX3A 3ROCA 4MD8E 3QD0A 3NRMA 3OZ6A 3MVLA 4JR3A 2F2UA 1OL1A 4ZIMA 3IQ7A 2JDOA 2XKFA 4NM0A 2C3KA 2JD5A 4EBVA 4EK5A 5HGIA 2QD9A 2R3QA 2YDJA 1WFCA 3QUDA 3H9OA 3QRTA 2ZV2A 3DOGA 5T68A 3KK9A 2P2IA 3V51A 4Q2AA 3PY1A 2YCQA 4RA5A 3OXIA 3TG1A 5ETCA 4OTFA 4LQMA 2WMSA 4NWMA 5D9HA 4KRDA 4L44A 2C6TA 1TQMA 3GNIB 3I0QA 3LCTA 3MS9A 4BFMA 2DS1A 3FHIA 3LXLA 4GVAA 4IB1A 1JVPP 3R22A 2JIVA 2UZEA 1SMHA 1OKYA 4AFEA 1PXIA 3E63A 1WMKA 4C4JA 2ITZA 1XJDA 4IADA 3NNXA 2W4OA 2LGCA 3MH3A 1LP4A 3CC6A 4BZDA 4GSBA 4N0SA 4UWYA 4W4VA 2Y7JA 5AWMA 5HVYA 3U4WA 3F3WA 3K5UA 4FTQA 4GCJA 4GT5A 1PHKA 2PK9A 2X9FA 4KWPA 3ZTXA 4UMRA 3KN6A 4QQCA 4Y5HA 1H1SA 3GCVA 4PTGA 4YZBA 4BWXA 2ITQA 4A9TA 2G2FA 2UW3A 3OEZA 1P4FA 4FIGA 4XNEA 5JFVA 3PLSA 5DRDA 2XCKA 4YC6A 4LRKA 3DB6A 4FSNA 3BWFA 5JFXA 2X81A 5HORA 3LZBA 2HY0A 1OPJA 4RX7A 4RVKA 4USDA 5BUJA 4TNDA 4ZZOA 1CKJA 3HDMA 4GV1A 3BWJA 4GK3A 3UGCA 4EC8A 3I7BA 2W5HA 3QLGA 4XRJA 1L3RE 1XQZA 1XWSA 3AD6A 3PE1A 3R73A 3FLZA 3FLSA 3LFBA 4X2GA 3KQ7A 4XG6A 2GCDA 5CT0A 3SD0A 4NM5A 2PVJA 5D11A 4CKIA 4E4NA 4EHGA 4F9BA 3V8SA 2PZIA 5AP2A 4RLKA 4M8TA 4MQ2A 3QRKA 5K5NA 1ZYLA 2OKRA 2E2BA 3HMOA 4JXFA 4KAOA 4ASEA 2OJIA 3F9NA 4RZVA 4CLJA 4XEYA 4FT5A 2WPAA 2A19B 4J95A 2WU6A 3SKCA 2R4BA 3UQFA 4BZNA 4L01A 4C3PA 4M69B 1H26A 2YABA 3FMMA 4IWPA 3H3CA 2ZJWA 4U3YA 4EH9A 2J9MA 3GU5A 3QGYA 4EONA 1NA7A 3HDNA 4C2VA 3OCGA 3P9JA 3VW6A 3NGAA 4GJ3A 1HCLA 2VO6A 5B2MA 3ZM4A 1T46A 4F6UA 4W4WA 4HGTA 3B8RA 3G2FA 4LGDA 2FSTX 4FKUA 4ZTRA 4FSUA 2OG8A 4MQ1A 2CGVA 2ERKA 4F7NA 4MXXA 5CAVA 3FKOA 1I44A 3T8OA 4BCQA 5HD4A 2ITOA 1OUKA 1OMWA 2WQEA 3W2SA 2JEDA 4FV0A 5A6OA 5D10A 1JOWB 3MPTA 4YZ9A 3AG9A 1JSVA 4RLLA 4E6DA 3I0OA 4YLJA 3SXSA 3TL8A 4Y5QA 4BTFA 2UZWE 4FODA 3ZSIA 4EH4A 4AN3A 5CZHA 3PA3A 3D7ZA 1Q62A 4JNWA 4ASZA 3KRJA 2H96A 5AP7A 4CMOA 3OS3A 3FJQE 4DGNA 1H1WA 3A61A 5E8YA 5HVKA 3RPSA 1F0QA 4F0FA 3V3VA 5AUVA 4MTAA 1PMUA 2C3LA 3D0EA 2I40A 3FKNA 2WKMA 3PVWA 5TE0A 4F6SA 3ACJA 3HP2A 2QU5A 4QMQA 2WEIA 4DFXE 4BTJA 5HU9A 2BVAA 4YC8A 5I9ZA 3CCNA 4FMQA 5BX0A 1H08A 3PG3A 5ANDA 2CCIA 4I3ZA 4QP4A 4FV7A 3UZPA 3JXWA 2HENA 4CT2A 4DFLA 2RFDA 3LFQA 1UU8A 5EDPA 2HWPA 4ACMA 3SA0A 2VO7A 5KBRA 3OWPA 4BCOA 2GNHA 2JAVA 4IM0A 4XUFA 3GC9A 1U4DA 4GYIA 3V5TA 3TCPA 4HVGA 4F7JA 1H1RA 4M15A 4C33A 3JYAA 4CT1A 4U97A 5KMIA 4M69A 4C36A 3R00A 4PPBA 2PMLX 4I5MA 4XYFA 2G15A 3G9NA 4UXQA 2J0IA 2IVUA 3R7OA 3ZUUA 2OI4X 1FVTA 3VO3A 2W9ZB 4YJVA 5KMJA 4YJUA 1TQIA 3R04A 1OI9A 5CVHA 2IW8A 2UVXA 3UVQA 4LI5A 1XH5A 4S33A 2B9HA 3GENA 3QC9A 2J0KA 1VYZA 3RWPA 3VRZA 2FSMX 2BAQA 5E90A 2VN9A 1URWA 3E8DA 3DAJA 4TWCA 3VN9A 4MXYA 3KF7A 3ZMMA 3JY9A 2QU6A 2BHEA 4LOQA 5IU2A 3PJ8A 5AEPA 4EZ7A 3E87A 2IO6A 3O7LB 3ORIA 4FTKA 5AUZA 4UMUA 1OECA 5AR4A 2O64A 4QP1A 4BGHA 2E9NA 2H6DA 4PP7A 4CVAA 1E1VA 3F66A 3R8MA 3RK9A 2C6DA 4YPDA 2BZIB 2QLUA 2DYLA 2W7XA 3DKGA 4FZ6A 2OIDA 5AM7A 5M55A 4ZTNA 3F7ZA 4DH7A 4FKGA 1QPEA 3O23A 2HIWA 5AV4A 2VTTA 2WGJA 2WTWA 3N9XA 1V0OA 2HK5A 4PL4A 4PTCA 1H28A 3FYKX 4NU1A 4NT4A 5AP0A 4BDIA 4A4OA 5BUEA 5CAOA 4EOJA 2ITXA 2R3IA 3FUPA 2UZOA 4C02A 5IEXA 1XH7A 4UWBA 4GVJA 4FV4A 3OF0A 4U44A 5AR5A 4LV5A 1Q61A 4WUNA 5DR6A 4QP6A 3EWHA 4XOZA 3QQGA 3CJGA 1Q5KA 3QCXA 4D2TA
chains in the Genus database with same CATH superfamily
3ROYA 5FGKA 5AA9A 4I6HA 4RZWA 4WUAA 4ZTQA 3ITZA 4ZK5A 2W9FB 5F94A 3CTHA 3WYYA 4F7SA 3QX4A 4DLJA 1W84A 3QKLA 2F57A 4LM5A 4L68A 2X8DA 2J51A 4I93A 5KZIA 3BYSA 3MA6A 1GTPA 1H1QA 2XYUA 3BU3A 4O6EA 4DFZE 1YDRE 4ZTHA 5CU0A 1P4OA 2X4FA 3BHVA 3MDYA 3EFJA 3IO7A 5L6WL 4HVIA 3HA8A 3NAXA 4F1OA 2PUUA 1Q4LA 4EOQA 4Y95A 3FMHA 4TNBA 5F4NA 1BYGA 4AT4A 5JEBA 5CENA 2ZVAA 4I22A 4JDHA 4UXLA 4D58A 3MFSA 3VWAA 1HOWA 3Q3BA 3Q4UA 1M2QA 2GNJA 2X6DA 2YCRA 3GFEA 3QA8A 3HYHA 1K3AA 1XH9A 5HG7A 2R7IA 1GIJA 4U5JA 2CJMA 1U5RA 4W9WA 4P90A 3R9HA 5M53A 1DI8A 3R7EA 2PN0A 4I23A 2JDVA 4EOLA 4NUSA 4IWQA 5HESA 3W2QA 3QFVA 4BDGA 5HG9A 2WTKB 1ZOEA 2X1NA 2EB2A 3FC2A 4C4HA 2GTMA 3GXLA 1N3RA 4Q5HA 4L00A 2A27A 5DT3A 2C5NA 2GNLA 3TJCA 2H34A 2IWIA 5ANJA 4DAWA 1XHAA 3NW7A 4KINA 4QMMA 4UN0C 3RNIA 5DBXA 2B9JA 4ACDA 3V01A 3TUBA 4LV8A 2HZ4A 3VS5A 3OHTA 5CU2A 5AX3A 3TNQB 3GUBA 4AZSA 3ENHA 5KMKA 5L2SA 3SC1A 3I1AA 5C8MA 4PRJA 4IX5A 1STCE 2HCKA 2YWPA 3E92A 3I81A 1XO2B 4Q5EA 4EZ5A 4E45B 2JBPA 2HZNA 4BBFA 4TPTA 4F0GA 5L8KA 2QCSA 3I5ZA 1AIPC 2YM8A 3M1SA 5H9BA 2J6MA 1WZYA 3ACKA 4CTBA 3TNIA 1PXPA 3GC0A 2OK1A 4KB8A 5FLFA 3U9CA 3AMYA 3QAME 2O63A 4RIOA 4U79A 3W10A 5H3QA 4FIJA 4ZSJA 3NW6A 2BRMA 3RPRA 2ZYBA 1QPDA 3VUHA 4C7TA 4DGOA 2J50A 1IS7A 4RX9A 3GC7A 3NIEA 1VJYA 1XH6A 3OY3A 3H10A 5A9UA 3ALOA 4RWIA 4ZLYA 2IVTA 3LJ1A 4S30A 2WTVA 4B7TA 2UW7A 2X9EA 4CYJA 2ETKA 3C5UA 2OSCA 3IDBA 3PSBA 4IAAA 2GNGA 1WUQA 4JRNA 5CLPA 3P4KA 2J0MB 3PA4A 4MBLA 3W2RA 2CCHA 3ZZWA 2A2AA 3BGPA 2ZMCA 5D12A 3BE2A 4FC0A 2AC5A 2Y4IC 4IX6A 4MEDA 3AT3A 4ZSGA 4X3FC 5KZ0A 2I1MA 3HUBA 4F9AA 2QOCA 5CF6A 3LPBA 4F6WA 2J4ZA 2UZBA 4J99A 1UU3A 2C5VA 1OITA 4FTLA 4RFZA 3HLLA 4YJRA 4HPUE 3FQHA 3IS5A 4FL2A 2X4ZA 3ANQA 4XV3A 5FBOA 4O2PA 2OW3A 3POZA 3TNPC 3FZ1A 4CKJA 5ANKA 5IH4A 3NPCA 4MXZA 2R3HA 3B0BC 3IW8A 3GQIA 2F7XE 1GZKA 1XBAA 3DZOA 3VUDA 3E64A 2UW8A 4CFFA 4QP7A 1BKXA 4FSWA 3NW5A 4FYNA 4CCUA 2WU7A 3LFEA 4TT7A 5J5TA 2X6EA 3L8XA 3KXMA 4IBMA 5J7HA 2GDOA 3UVRA 4C59A 5JT2A 3TZMA 2IJMA 4J1RA 2VTJA 2XP2A 4KIKB 1FB1A 4DG3E 3F88A 4MBJA 2WIHA 3G6GA 4JQ7A 4RBLA 4D9UA 3HMMA 4FZFB 1H27A 3EFWA 3JPVA 3R7IA 1TQPA 3LM5A 3V5PA 2VWIA 4PDSA 3GGFA 4G3DA 4BI0A 2Z60A 3DCVA 3QWJA 5HOAA 4RFYA 1UNLA 2HELA 4AXAA 2WQNA 5EM8A 3WARA 2PVYA 4H3QA 4O91A 3W33A 1ZYCA 4FNXA 1CKIA 4JOAA 4WSQA 4GT4A 4FICA 5JH6A 3R01A 2OZOA 2WELA 3OOMA 4FSRA 4BHNA 3A8WA 4X6RA 1FMKA 1M2PA 2WMBA 4I92A 4DEDA 3RI1A 4AZFA 2Z7RA 3BEGA 4FKQA 3C50A 4QMYA 5ICPA 4PL3A 4P7EA 4NE5B 4L3PA 4DH3A 4E4LA 4A4XA 3BLHA 2AC3A 2OGVA 3D14A 1R78A 1EH4A 5D7AA 4CFNA 4FV2A 2SRCA 4HJOA 2NPQA 3ORZA 4X3FB 5C8NA 2XH5A 3AC8A 3C4CA 5EOLA 2WFYA 3AT2A 4XP0A 5CXHA 2EWAA 2XS0A 5HO8A 2XM9A 5EHYA 5K3YA 4B8MA 4RT7A 2R64A 3DAKA 5DI1A 3UMWA 3L8PA 5HCXA 4D2PA 5FP6A 4ASXA 3QUEA 1WVWA 2FUMA 2P33A 4RJ5A 4IX4A 1FPUA 4GEOA 1WBNA 5T3QA 3DAEA 2X0OA 1ZWSA 5HEZA 5L3AA 2DUVA 3DK7A 5H8GA 1F5QA 4LOPA 5EKOA 3NYNA 4TWPA 4QQJA 5ANEA 4AOJA 3GOPA 2WTCA 3QRJA 1URCA 3DKOA 3C51A 4JLCA 3WF8A 1ZOGA 2W17A 2WQMA 3MSSA 5EM6A 5HE2A 2YCFA 4H1MA 5HLWA 5EOBA 1J3HA 2F7EE 2EB3A 2X2KA 3B2TA 4G2FA 5FG8A 3RK5A 1X8BA 5A54A 5JN2A 3MFRA 3IGGA 1YXVA 2V7OA 5J95A 3GCUA 5I9WA 4G6OA 2J7TA 1ZMUA 5BVFA 2VWZA 5I9YA 4Y8DA 4KIKA 4KIQA 3RPVA 4EUUA 4UBAA 4FKSA 4L7SA 2GPHA 4PPAA 5DRBA 3VQHA 5E8VA 2J2IB 3KKVA 3QC4A 4O0TA 4BIDA 3FV8A 2C6OA 4MAOA 5IA3A 2B9FA 2ACXA 4USFA 3HKOA 4I0RA 4TWNA 3O51A 3L9NA 3PWYA 4E20A 3D7TB 3WILA 2XNNA 2UZUE 2C5YA 1CDKA 2R3MA 5HHWA 5LVLA 5JK3A 4XRLA 1YOLA 2VV9A 4TYEA 3MH0A 4ZY6A 4FYOA 2Y6MA 2XKEA 4WHZA 2ITVA 4QMLA 1REJA 1WVYA 3PXZA 3BU6A 3VF9A 4K1BA 3DBCA 3LJ2A 4FZDB 1WM9A 1A8RA 3C0HA 3EYGA 4GK4A 4MXAA 4F64A 4X3FA 3S0OA 3W1FA 3K5VA 3G6HA 3OMVA 2RG6A 4OAVB 4YC3A 3LAUA 5BVNA 3ZXZA 2Z2WA 5A4TA 3IOKA 3TV7A 5EH0A 1JWHA 3A2CA 3D2IA 5FQDC 4DLIA 3G9LX 3QTWA 5M4FA 4FX3A 4UEUA 4ALVA 4G5JA 1YXXA 3PSDA 3OY1A 4NKAA 4D55A 4K0YA 3REPA 1J1CA 2JIUA 3TTIA 5C1QB 1V0PA 2EVAA 5CALA 1SZMA 4TKSA 3Q96A 3G51A 4BI1A 4ERKA 3CS9A 4FTTA 4K11A 3CTJA 4J8MA 4JAJA 4BRXA 2R3LA 3NUYA 4TY1A 4YO6A 1WURA 4EHZA 2JFLA 1TVOA 3CQWA 4IJPA 3OUNB 3UPXA 3MJ2A 3ORTA 3ZBXA 1WBWA 1CKPA 2AUHA 3QYWA 2YIXA 2YDIA 3RM7A 2AQXA 4AAAA 5L2WA 4FA2A 1MRYA 3EQCA 3NDMA 2YM4A 4N70A 4R5YA 4BC6A 3HUCA 4IZ5A 4KKGA 2JDTA 1OIQA 5DEWA 3PJ1A 4PDPA 1E1XA 1GNGA 3MA3A 5GJFA 2RFSA 3HMNA 4O0SA 4OTIA 3MN3A 3UTOA 2X2LA 3WIGA 3EZRA 2F49A 3C0GA 2VTSA 2R3NA 3VS7A 3S95A 3KK8A 3EN4A 5KMNA 3COMA 4YPSA 4DEHA 3WZJA 3CKXA 3Q4ZA 3UNKA 2C6MA 3L9PA 3D7TA 2HXQA 5HCZA 2WIPA 2YIWA 2FSLX 3TN8A 2C6LA 4PY1A 1OL7A 2PZRA 3BEAA 3DFAA 3FE3A 3RM6A 4CFVA 4EOPA 5HBEA 4D2SA 4QYFA 4FKIA 3C13A 5IA4A 2VWBA 2CGWA 2UUEA 4MD7E 2XJ1A 2GS7A 4QMVA 3PZHA 2QKRA 4CZYB 5HO7A 2C3JA 4OTDA 5BMMA 4U3ZA 4CZUA 4F9CA 3BZ3A 5E8TA 5IDPA 2W4JA 4TTHB 3KRLA 2VO3A 3MB7A 4GYGA 2OJGA 3S2PA 3FZRA 3JUHA 3O96A 4MK0A 4ANNA 4RC4A 4ITHA 2B55A 4K33A 5HI2A 3VBWA 1H07A 2F9GA 3A7JA 3PIXA 2VTHA 4L42A 3QGWA 4IAYA 3RJCA 4J98A 4NM3A 3ZLXA 3GCSA 3QTUA 1REKA 5I9VA 5HO6A 3F82A 2C0OA 3NNWA 3PRFA 4QTAA 4JJRA 2C5OA 3NUNA 4QYGA 4RWKA 4H58A 4Z55A 1ZZLA 2HAKA 4MX9A 5LXMA 1PJKA 3I7CA 4RPVA 3NNVA 4ZP5A 4EQUA 3OCBA 3DBFA 3MJ1A 4IANA 4IM3A 2P0CA 3UE4A 3ZYAA 4E1ZA 2H9VA 3QKMA 4U8ZA 1LEZA 3LFNA 3S1HA 4R3CA 2CDZA 1DAYA 2PMOX 3TUCA 4J97A 4QTCA 5AR8A 4Q9SA 5CZIA 3R8VA 5BVDA 4FOCA 4IJ9A 4A7CA 3DT1A 3PTGA 5C03A 2C0IA 3EMGA 3O7LD 1DAWA 2C1BA 2FH9A 3GFWA 3TV4A 3PZEA 2BTSA 1YHVA 4EOSA 3RAKA 2C6IA 4CD0A 2G9XA 3RHXA 4EYJA 3WZUA 2XVDA 5J9YA 1H0VA 1R1WA 5E1EA 4UMPA 4FSYA 3EKKA 5AP6A 3KU2A 4LUDA 4F08A 5DR9A 2R3RA 4JX3A 4EK8A 1BL7A 2YITA 3FPMA 1Q97A 3LCKA 5I5ZA 3DNDA 1VEBA 2GS2A 2VGPA 3BGQA 3D15A 3UO6A 2JDRA 3UNJA 5JRSA 2X7OA 5AUWA 3TUDA 3R9NA 3R28A 2UZVA 4C4GA 3BQCA 3GBZA 4NW5A 3LOKA 3F7WA 4ZLZA 5E8WA 4LGHA 3U87A 1Q8WA 2C6EA 4YZNA 3R1YA 2WMVA 3GQLA 5FTOA 4IQ6A 4FKVA 2VTQA 3IW5A 5K0KA 3OW4A 1WBPA 3RMFA 4G9RA 4JBPA 3V6RA 2JC6A 3QTXA 1YI4A 2W1EA 3LFAA 2JIIA 4FK3A 4YBJA 2OF2A 1MQ4A 1GY3A 3FBVA 4OBQA 3RHKA 2QVSE 1YVJA 3AOXA 2X7FA 5DLSA 2R2PA 2VTAA 4AUAA 4IWOA 3UO4A 4XLVA 2JKOA 3L9MA 4I24A 4MWIA 3WYXA 4CCBA 2PVMA 2QURA 4XG8A 4DG0E 5L6OA 4C2WA 4NK9A 5KE0A 4PTEA 1DM2A 1FVRA 3A99A 4EH6A 3ZO2A 4E44B 1YW2A 1I09A 4FT0A 5HTIA 1MRUA 2B54A 3AMAA 4CXAA 4UMQA 1RQQA 4RVTA 2XK8A 4AN2A 5AUUA 1CSNA 3LCDA 3GB2A 5J9LA 4ANQA 2Z7QA 4HCVA 1W2FA 2W05A 2PY3A 4O1PA 4HVHA 2RKUA 3DDPA 2UZDA 3BGZA 3RPYA 4F63A 4ZZNA 2BUJA 3R21A 3ORKA 4JAIA 5HBHA 3WF6A 5J79A 1BX6A 1KOAA 1SNXA 2XK6A 2R0UA 4G16A 5AR2A 5EW8A 2GHMA 3PE2A 3CR0A 3W16A 4BKYA 5AP4A 4AGWA 1UVRA 5CVFA 5BVWA 4DTKA 3HV5A 5KHWA 1YXSA 3ZEWA 1W82A 2X8IA 2LAVA 2QR8A 2CN8A 2VZ6A 3E3BX 4FVQA 4YTHA 3H9RA 3RALA 3UNZA 3GU8A 2CPKE 4ZZMA 2YJSA 2VUWA 2YDKA 3TZ8A 1W0XC 4IFGA 4BIEA 1RE8A 3ZRKA 3AQVA 4BN1A 3FLYA 2V22A 3WI6A 5HD7A 3LXPA 4MCVA 2E9UA 2BAKA 2QHMA 3TNWA 4Z7GA 5CQWA 5A4EA 3LQ5A 4YHTA 4U9AA 3TNHA 4PMMA 3HMIA 5GZ9A 3Q5IA 1JKSA 2BRNA 2PZPA 4YJQA 5AUTA 3F3VA 4GUBA 5JQ5A 4LRMA 3HNGA 2QOOA 4O22A 4B8LA 5AAGA 2R3JA 1ERKA 3NYXA 5C9CA 3Q2MA 4IZ7A 5EW9A 4OTHA 2VWYA 4I5CA 4BDFA 3FMNA 5TR6A 3H30A 2RFNA 3G90X 5CYIA 4OTWA 5HTCA 2R5TA 3TKIA 2XNOA 2WMUA 4GFMA 4E5AX 2ZM3A 3AXWA 4MNEB 4QMUA 5CEIA 2Y4PA 4ALWA 5DT0A 4E26A 4FVPA 2R7BA 4P5QA 4PP9A 4ACGA 3MW1A 1K2PA 3DS6A 3CLYA 4ZSEA 5HX8A 2V5QA 2PVNA 5CAPA 2QOBA 3FMEA 3GVUA 3HV6A 1PXNA 3CD8A 3BCEA 3QKKA 3DDQA 4FTUA 3P79A 4J8NA 3EIDA 4D5KA 4EQMA 4Z9LA 2ZV7A 4GFOA 3Q6WA 5M4IA 2BHHA 5J1WA 1W83A 3CE3A 4HVSA 1OL5A 1JSTA 3R0TA 1NVSA 3RVGA 4D4VA 5EI6A 4LYNA 1WBTA 2XM8A 4HGEA 4UZDA 5E8ZA 4R7IA 3VJOA 3ZHPC 4BCKA 4E6AA 4R1YA 4RC3A 3E8NA 4AE9A 2YCSA 3FZPA 3DQXA 5B0XA 3OROA 5F20A 4O0YA 5DG5A 3FZOA 2GQGA 1M7NA 1M14A 3QALE 1R3CA 3NS9A 1EFUB 4ARKA 3MIYA 4C8BA 1GZOA 2HY81 4O4FA 4W4XA 3QQFA 3QXPA 4FL3A 3IDPA 2X8EA 1Z5MA 3TWJA 4QTBA 4EHVA 3F61A 2Y6OA 4I5HA 3S00A 4G3EA 5HIEA 4IH8A 4NTTA 2YZAA 3DXNA 1HCKA 1FMOE 4JG7A 4JI9A 4N6YA 4FG8A 4YSMA 5I9UA 3JVSA 5FBNC 1YWRA 3MI9A 3FXZA 1SVHA 3UOKA 4M3QA 4Y73A 3ZZEA 4HYIA 2PTKA 4DH1A 5J1VA 5IPJA 1ZARA 3ORPA 3CJFA 3NUSA 2WSFG 4XOYA 2ITTA 1UNHA 2W0JA 1PYXA 3QYZA 3Q6UA 3FY0A 2XJ0A 4A9RA 3F6XA 5HU3A 5DIAA 3HP5A 5AP3A 2P3GX 2YIQA 3FAAA 5IKWA 3VS6A 4WNMA 2BKZA 4UALA 5AUXA 2BFYA 2IF8A 4RJ7A 4ID7A 3R1QA 3U8WA 3P78A 4G6LA 4MKCA 4MNEA 3ZUTA 5EKNA 5IISA 5LWNA 4M66A 4IMYA 4QNYA 5EYCA 3BX5A 2JKKA 4B99A 2WOTA 5AV0A 1E9HA 4G1WA 4EL9A 3WOWA 2H8HA 4P2KA 4MYGA 2XIYA 3VULA 5F95A 3W8LA 4O0UA 2C6KA 4JDJA 4FG9A 3ZDIA 2FA2A 1O6KA 1XBBA 2YJRA 2ZOQA 3LW5G 4ZSAA 3BYVA 3GEQA 4WNPA 3DNEA 5CAUA 3QQUA 4TYIA 4KKEA 5GZAA 2WTKC 4IVBA 4GJ2A 4BCHA 4M68A 4FOBA 3EN5A 1YI6A 3LMGA 4XG4A 2VTMA 4JQ8A 4C0TA 2WMQA 4BDHA 4CKRA 1H8FA 2BZKB 5EDRA 4ZSLA 3Q4CA 3BELA 4BF2A 4OTPA 1QMZA 4V05A 3ZFXA 3MFTA 4X0MA 4H1JA 3LIJA 4NZWB 4QMWA 4EYMA 5LMBA 2ITYA 1T45A 4XMOA 3UO5A 1JPAA 1PMEA 3F69A 4IM2A 3PA5A 1RJBA 4RJ8A 3VUGA 3BRBA 5FM2A 3ZC6A 4CTCA 1N3SA 2O0UA 3OFMA 1JNKA 5H8EA 4IVDA 3FMJA 4QTDA 5B7VA 4YJPA 1OPKA 1BI8A 2FSOX 2YEXA 3D83A 4QD6A 4MF1A 2R3FA 5J87A 4TYHB 5BVKA 5J7BA 1P5EA 2J5EA 4NJ3A 4JIKA 2CLQA 1M2RA 3CP9A 4AOIA 2XJ2A 5IEYA 1Z9XA 3FL5A 3UP2A 4QO9A 4IZAA 2HWOA 4A9UA 5IA1A 4S32A 3PXKA 3BHYA 2XNBA 5AIKA 4EOMA 3FQEA 2GMXA 1H00A 4DRBJ 3SHEA 1AD5A 3KY2A 5L6PA 4I41A 2NRUA 1PY5A 5LMKA 3UYTA 3K3IA 2VWUA 4ZAUA 3L8VA 3NR9A 5LJJA 1J91A 2ERZE 4YTIA 2YACA 3V5JA 3CY2A 5DGZA 4DEIA 4EEVA 4XHKB 2BCJA 1G3NA 3P86A 2CLXA 3HV4A 4EK6A 3WBLA 2Z8CA 2VTNA 3KXGA 3KF4A 3DKFA 1ZY5A 3Q9XA 2W96B 4FV1A 5AP5A 3MTFA 5DFPA 5LOHA 4UYNA 4XV2A 1KE5A 3BYUA 3DBQA 4FF8A 1WBOA 3MPAA 4ENXA 5LCKA 3QLFA 3M11A 2ONLC 1LPUA 2C5XA 2XNPA 3E7OA 2C1AA 4FNWA 4PWNA 1YHSA 2QO9A 4QYEA 3R7UA 3COHA 4YR8A 2BRGA 1JAMA 3M42A 5JZJA 4FZAB 3FQSA 2Y0AA 4YGAA 5CEOA 5IMXA 4ITIA 3OT8A 4V04A 4BGQA 5IUIA 3QZGA 5CNOA 2A0CX 2XA4A 5J8IA 3W18A 3KXZA 3T9TA 4Q9ZA 5CEMA 3ORNA 3OTUA 3NWWA 3TKUA 1PYEA 2Y8OA 1YWNA 4CFXA 1OPLA 2Q0NA 3C4EA 5M57A 3UJGA 3OC1A 3QQHA 2WMAA 4WD5A 5CANA 5FP5A 2PVFA 3FI4A 3GI3A 2PMNX 2PWLA 3ZO3A 5HZNA 2YFXA 4RMZA 5HNIX 2X0QA 2E9VA 4ANBA 1H01A 3DK3A 3UC3A 4AACA 4TL0A 3DZQA 1R39A 3AC4A 3E8CA 4IVCA 2C0TA 3HV3A 3VHEA 3UOHA 4XH6A 4CLIA 4U6RA 4PNKA 2BILB 5M44A 4R8QA 3FKLA 4TYHA 5GHVA 4YUQA 1Q8UA 4LMNA 5EM5A 4ZY4A 2YIRA 4F1MA 3NLBA 5EK7A 5C27A 3PRIA 4F1TA 5LWMA 2NRYA 5EI2A 4GMYA 3SOAA 3FMKA 4RSSA 4NH1A 3ELJA 3KFAA 2XIRA 3AC2A 4J96A 3QD3A 5E91A 4AW1A 4M97A 3DV3A 4HYHA 1UU9A 4NFNA 3NYOA 3RAWA 2QQ7A 4AN9A 5DA3A 2VX0A 2OFVA 3DTCA 5AR7A 2XBJA 2C68A 5A3XA 3VBTA 5J5SA 4MBIA 1GIHA 3PVGA 4FTNA 4L43A 4BYIA 4OLIA 3T3UA 3IW6A 5L2TA 4MHAA 5DOSA 2J5FA 5KMOA 3UP7A 4M7IA 5CF4A 3OWLA 3EQFA 4QP3A 4H36A 5BYZA 5IUHA 2P11A 3UIBA 2OFUA 3PPKA 1B38A 3LE6A 4RGJA 4AOTA 2JKQA 3MYGA 3WIKA 5F1ZA 4JDIA 2FVDA 3KRWA 2BDFA 4L7FA 5ANGA 3R7VA 4O96A 2XIXA 5KUPA 3BHUA 2UZNA 5IA5A 3H9FA 4EI4A 5ANIA 3SQQA 4WO5A 2FB8A 1IEPA 4FL1A 4JT3A 2QOLA 3VUMA 3OG7A 3WZDA 2BPMA 2QOFA 4APPA 3TTJA 3KXHA 3WF5A 4ITJA 2BALA 1CMKE 4FK6A 5FTQA 4CMUA 4YO4A 5KO1A 3Q60A 2QO2A 4O0RA 4IAZA 4DEAA 4EH8A 1WAKA 2WSFK 3QCYA 4RIWB 4BZOA 4BVUA 1PXLA 5AV1A 3KMUA 1U46A 4CZTA 3ZH8A 4OAUC 4Y83A 2UW5A 5D1JA 2A4LA 4S2ZA 3BMBA 3FSKA 1JBPE 4QMPA 2XKDA 2NO3A 2GFCA 1JKKA 3W2CA 3HGKA 5BNJA 4ZJVA 3AGMA 5CWZA 3PXYA 4LL5A 4EHEA 5IZFA 2I0YA 4L3LA 3Q9ZA 2QOKA 3HRFA 4XBRA 5A4CA 4TZRA 1IRKA 3FXXA 4DH5A 4EQCA 1PKGA 2IZUA 4XBUA 4QP9A 3QRUA 4DC2A 3NNUA 1RW8A 2ZDTA 4R3PA 2V55A 3LW5K 4MXCA 3JS2A 3HECA 4CSVA 3MY5A 1OB3A 3QTQA 3NUUA 1LR4A 4WIHA 1PXKA 3CPBA 4BBEA 5CF5A 1J1BA 4MXOA 1UU7A 2HZ0A 4E4XA 2ONLA 1OIRA 3CIKA 3D5XA 3IG7A 4IB5A 5DVRA 3VJNA 4R6VA 3HRBA 4JR7A 4MNFA 4FVRA 3EL7A 5CS6A 2BFXA 3AD5A 2WMXA 4OBOA 5E92A 1IR3A 5EHLA 4BCJA 3DJ6A 4NJDA 4H3PA 1PW2A 3F5XA 3D4QA 5FWKK 2FO0A 1H4LA 2B1PA 4I4EA 4QOXA 4AZVA 4X2JA 3CQEA 4DINA 3LM0A 1ZOHA 2WQOA 4DRAE 3QXOA 4FKRA 3ZC5A 1TKIA 3GU4A 4DN5A 4IDTA 5FXQA 4YHJA 4C34A 1UKIA 3II5A 2WTJA 4QMXA 4Z16A 3V8TA 3OCTA 4RVMA 4A07A 2XEYA 4A06A 5CXZA 3ALNA 2EUFB 2JBOA 3ORXA 4IACA 3EH9A 3ORLA 1Q3WA 5AAFA 1JKTA 4X21A 3RKBA 4L8MA 3CEKA 3K2LA 4HNIA 4QP2A 2WOUA 3AC1A 5AP1A 3S3IA 1B6CB 2QG5A 3EHAA 4K9YA 4XX9A 4BKZA 1SNUA 4RIWA 1Y8YA 3W2PA 2G01A 4R1VA 2YHVA 4D4RA 1N3TA 4KBCA 1A9CA 4FKTA 5J9ZA 5EM7A 4D4YA 1ZMWA 4YNOA 4RA4A 2XUUA 3P0MA 3VAPA 2ZDUA 4K2RA 2ITWA 3VEJA 3MY0A 3EN6A 3R6XA 1KE7A 4IE9A 4M12A 2PE1A 5CSHA 5HE3A 4AWIA 4D28A 4ZTMA 3KVXA 2JITA 5CX9A 4FIFA 4CFWA 4I20A 4NE6B 4QNAA 3A7GA 4AP7A 3BLQA 4RC2A 4ONAA 2B9IA 2XRUA 4FTJA 3KXXA 4ALUA 3C9WA 5CEQA 2W1HA 4OTRA 2W5AA 3ZLSA 1BI7A 3EFKA 3EQRA 2OJ9A 3PY3A 3R2BA 3V5QA 4W8EA 4FUXA 4FNYA 2Y9QA 4UYAA 3EQDA 3RTPA 4K18A 4CRLA 3VNTA 3ZFYA 1NVQA 1V1KA 2BTRA 3QHRA 4I21A 5H8BA 3WE8A 5EI8A 4J71A 1GZNA 2O3PA 4XCUA 2OIQA 3Q9WA 4F65A 4D9TA 3PVUA 3MTLA 1KSWA 2R3KA 5FEDA 4TW9A 3OOGA 4ANSA 3VF8A 2XB7A 4JBVA 5KBQA 3Q52A 4NKSA 2XNEA 2W1FA 4NTSA 3BYOA 1RDQE 3FHRA 3PYYA 3BV3A 1QPCA 3KCKA 3E5AA 3FZSA 3UC4A 5HICA 4D2RA 1VR2A 4EWQA 4O27B 3O8UA 4NCTC 3PG1A 2P4IA 4C4EA 3C7QA 4F0IA 4GUEA 1JQHA 2HZIA 4USEA 3FLWA 3U4UA 3MVMA 4YZCA 3RAIA 3NX8A 3VUIA 3Q9YA 3FXWA 4FZ7A 4IZYA 3VUTA 4BDJA 5IA0A 5CSXA 4H3BA 5E8XA 4IB3A 3OW3A 4ZY5A 4XG2A 3KEXA 4FKPA 3IECA 3LLTA 4GFGA 4BCNA 4M0YA 1LEWA 4RJ3A 4ZS0A 3MH1A 4PUZA 4Z3VA 4C62A 4IIRA 5HNGA 3QF9A 4GU6A 5FEEA 3TZ9A 3ZSGA 3SVVA 1NXKA 3EQHA 4WG5A 3VBQA 1Q8ZA 5G6VA 4LMUA 2V0DA 4B9DA 3QTZA 1IG1A 4FKLA 5M51A 5K5XA 3WZEA 3OXTA 4CV8A 3R8PA 2X2MA 5G1XA 3Q32A 4IB0A 3Q5ZA 4M84A 4JG6A 3RNYA 4O0VA 4FSZA 4ACCA 4E5WA 1UKHA 2ETMA 5JZNA 3R8UA 4YURA 3IOPA 3O50A 4UY9A 2OZAA 3VUKA 4EC9A 4PNIA 2DWBA 4LG4A 1OUYA 3HL7A 2BIKB 2B53A 3K54A 3O17A 3L8SA 3F3TA 2Z7LA 2HW6A 4C37A 1GAGA 1Y91A 3FPQA 4AZTA 4APCA 5EHOA 4QQ5A 3UIXA 3D5WA 2GHGA 4J7BA 3TI1A 5TO8A 4BCIA 4ZJIA 3SXFA 4DHFA 2O2UA 2PSQA 3ZOSA 2XKCA 5CEPA 2UW9A 3ZO1A 3I60A 4G3CA 3NCZA 1GJOA 4AA5A 5EYDA 5EG3A 2WHBA 3EQIA 3QCSA 2G2HA 1UA2A 5KNJA 2PL0A 4DG2E 3A4OX 3P5KA 4HYUA 2O01G 1U54B 2BAJA 4I0SA 3ODZX 4AU8A 1M17A 2ZM4A 4YSJA 2R9SA 4WG3A 3RCDA 2WAJA 2BRBA 2QOHA 5BYYA 3R9OA 3CQUA 2OICA 3EOCA 4W9XA 1OKZA 2WNTA 4C57A 5CSPA 3CGFA 3A62A 3IPHA 4I4FA 5K9IA 4FV5A 3SOCA 3UMXA 4LUEA 4XG9A 3C4ZA 4YP8A 5DR2A 3SV0A 3R8ZA 2RSVA 2QNJA 2F7ZE 2WTDA 4FIHA 4M14A 4FNZA 2FGIA 3R9DA 5HIDA 3RP9A 4W8DA 4CEGA 1Z57A 3W8QA 2BIYA 3TEIA 1OM1A 4HZSA 3RBWA 3AT4A 5FDPA 4JBQA 3QHWA 4BCGA 4CQGA 3S4QA 3U6HA 3F5PA 3R2YA 3OUKA 4U40A 4ANOA 2VAGA 3IW7A 3D2KA 4O2ZA 4WRGA 2WMTA 3CD3A 3A7IA 4RJ4A 3W32A 4KD1A 4DYMA 2HXLA 3EN7A 4JIAA 4YBKA 4E7WA 4AGCA 1BL6A 4XV9A 3WZKA 1OZ1A 5HBJA 4GG7A 1OIUA 3D5VA 3I6UA 3TXOA 4AA4A 4DEBA 2W1GA 2YM5A 5LVPA 3FI2A 2JLDA 3I4BA 2UZTA 3R1SA 2VNWA 3NCGA 3PSCA 5EDQA 2J0LA 1ZYDA 2X0PA 3EQPA 3LFCA 4O21A 4RFMA 2EXEA 5A46A 2PE2A 4JS8A 3ZRMA 4F4PA 2PZYA 2XK3A 3PIZA 3FLNC 1WPLA 2YA9A 4XG7A 3G33A 4RX8A 4JG8A 2CGXA 2REIA 4YLKA 2QODA 5IDNA 1ZY4A 3UBDA 3CXWA 5IA2A 4MVFA 3MV5A 4DGMA 4AS0A 4NCTA 2E9PA 3V04A 5FRIA 4YTFA 5GJDA 3BE9A 3Q53A 4BL1A 3FSFA 3GT8A 4BCPA 2GTNA 2XYNA 3HV7A 3KMMA 4C3FA 4CFUA 4ZTLA 2BMCA 2YM3A