The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
48
|
sequence length |
270
|
structure length |
256
|
Chain Sequence |
EIRGQVASGFGDQSWDASSFAGFYYDIDDNVSTETLTVSDLDGNVIPEGGLVYTTTIADVDFEYYNPDAGWDQYPVMGFFAEEYIPINPDKADKIAKLVLDSDDKYTIRTGEMLDLGEGYAIEAKQVDVDGEKVWLEFTKDGEFVDDEIINTWDVELDDIEDEDDVVVLKVHVNQVFQIAQIEGLWLIDYANAMTIESDDEFGNLDDVSIDGDTLKISNEDTFTLTRDSEEEIGEGMYFMIADTSSSDLRYYPYVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of the surface layer of the methanogenic archaean Methanosarcina acetivorans.
pubmed doi rcsb |
| molecule keywords |
S-layer protein MA0829
|
| molecule tags |
Structural protein
|
| source organism |
Methanosarcina acetivorans
|
| total genus |
48
|
| structure length |
256
|
| sequence length |
270
|
| ec nomenclature | |
| pdb deposition date | 2011-10-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07752 | S-layer | S-layer protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Tick-borne Encephalitis virus Glycoprotein; domain 1 | Tick-borne Encephalitis virus Glycoprotein; domain 1 | ||
| Alpha Beta | 2-Layer Sandwich | YehR-like fold | YehR-like fold |
#chains in the Genus database with same CATH superfamily 3U2H A; 3U2G A; #chains in the Genus database with same CATH topology 3C6E A; 5GZN A; 1OK8 A; 1URZ A; 3UAJ A; 3G7T A; 1UZG A; 2HG0 A; 3C5X A; 3U2H A; 5JHM A; 3N41 F; 3U2G A; 4UTA A; 5H37 A; 4HJ1 A; 4GT0 A; 3P54 A; 2I69 A; 3N44 F; 4GSX A; 1OAN A; 2ALA A; 4OJD H; 4UT9 A; 2JOE A; 1TG8 A; 4UTC A; 3N42 F; 3UC0 A; 4FG0 A; 4ADG A; 4UT6 A; 5LBS A; 1OKE A; 4ADJ A; 1SVB A; 3J27 A; 3I50 E; 1WLG A; 5IZ7 A; 5JHL A; 5GZO A; 4OJE H; 3J2P A; 4OJC A; 3N40 F; 3N43 F; 4ADI A; 4UTB A; 1RER A; 5LBV A; 4B3V A; 5IRE A; 5LCV A; #chains in the Genus database with same CATH homology 4OJD H; 4ADJ A; 4B3V A; 4OJE H; 3U2H A; 3U2G A; 4OJC A; 4ADG A; 4ADI A; 4HJ1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...