1OK8A

Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
394
structure length
380
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR ENVELOPE PROTEIN E
publication title Structure of the Dengue Virus Envelope Protein After Membrane Fusion
pubmed doi rcsb
source organism Dengue virus type 2
molecule tags Viral protein
total genus 68
structure length 380
sequence length 394
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ok8A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1ok8A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1ok8A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1ok8A03
2JSFA 1OANA 2JQMA 2I69A 4UT9A 1RERA 5JHLA 3UC0A 4AL8C 4UTBA 2R29A 4BZ1A 5AAWC 5LCVA 4ALAC 3WE1A 3J27A 5GZOA 5GZNA 1SVBA 5LBSA 5KVDE 4FFZA 5AAMC 5H37A 3N43F 2P5PA 5IREA 3UZVA 5KVEE 1Z3RA 2V33A 3P54A 3N41F 1OKEA 3UZEC 3N42F 4GT0A 5B1CA 3C6EA 5IZ7A 2R69A 5LBVA 3C5XA 4BZ2A 2GG1A 2JV6A 4FG0A 3I50E 5JHMA 1TG8A 3N44F 1S6NA 4AM0Q 4FFYA 3UZQB 4UTCA 1URZA 1OK8A 2HG0A 4L5FE 3UYPB 1UZGA 3G7TA 4GSXA 4UTAA 4UT6A 5KVGE 5KVFE 2ALAA 1PJWA 1ZTXE 3J2PA 3MUUA 1Z66A 3UAJA 3N40F 2H0PA 3VTTA 4X42A 3IRCA
chains in the Genus database with same CATH superfamily
2ARWA 4N2EA 1I3VA 3FTGB 2PPDA 3JUZA 5E95B 3WDIA 3QJVB 4PRHE 1RIUL 5IEHB 3AU0A 3IRPX 1DBMH 1RU9L 4LB8A 3FT2A 5D55A 4TNEA 5HVFB 1OM3H 4V11A 4UBDD 3HC3H 3PL6C 3UEQA 2YWYA 1S3KH 1A3RL 4N8CL 4PW3A 3N0AA 3FQWA 1WTGT 4X2UA 5KYYB 3MBEB 1XSIA 4NYLA 3QG7H 2GJZA 3DX1A 2YWZA 3LEYH 5DQDL 4GO8A 5J1AB 3VXSA 3MBED 5B1AB 4WW2A 3FPYA 3MROB 4R90L 4OF8A 4Z95H 3MKKA 3IKCB 3VFSA 3D3VE 2BSRB 2LVCA 3MV8D 2OL3H 3ECWA 4Z7OB 4YXLL 5HI5C 2Z6FA 1B2WH 3QDMD 1EHNA 4BD4A 5C09E 5D7LE 2CAKA 1A5FH 3M1CA 4KUCF 5CSGA 3U1PA 2XBZA 2WPGA 4LEBA 2QKIC 2OJEB 4DO4A 1SMDA 2F7IA 3HNVL 4FLSA 4UT6H 1DFXA 4MJID 3ZUCA 2FO4B 3KYNB 3G5WA 2DD8L 1O9VA 4LSUL 3D0LB 4GW4B 4D94A 3BP7B 4W4OC 1QATA 3QRFM 1RJYB 2DM4A 5IFAL 4DKFH 1KCRL 4PJ9A 2WNKA 1ILUA 5B7EA 1BD2B 2D7NA 3FO2B 2FDBP 3I50E 2VDRH 1AP2A 3T1FB 3GTVA 3B5HA 5FYJH 5E9DB 4L8SC 3JV6B 5ICXA 2GKIA 3RP1A 3RA7H 5IR1A 3VH8B 1AGDA 1T1WA 4JFXB 4HMCA 4I0PD 3T3MB 2CCWA 4R97C 4GAFB 3IF1A 1FNSL 1QPXA 3B9KC 4MRCA 5E2VH 2NTFA 1S7VB 4KROC 4XMLH 2E3VA 1AO7E 2DTMH 5K1NA 2VN5A 4KXDA 5DS8A 5T1LD 3G9AB 5AWNH 1E8ZA 4XTRC 3VFPA 1NGYA 5E08H 4TKWA 3MGAA 1Q9OA 2R0ZH 2AJZA 2EC9U 5DK2B 1ZLVH 3FFCB 2DLHA 3H7BA 3FT2B 4U1JA 4X6EA 1IARB 5HHOB 2VR9A 1MWOA 1F42A 1HEHC 2F0CA 2Y1VA 3ARRA 1IL1B 3ZE2B 4N2NA 4PVLA 4WI6A 3FFCD 4ZDHA 1ZEAL 5I16A 3KM1A 4PY8J 3N1MC 2HZHA 3K8KA 5E99L 3R8BB 3NQKA 4RGNE 1BJ1H 4BE5A 5T5NG 4U6XA 1BVNP 4QKXB 3FONA 3L3IB 3BGMA 4KKPA 1JK9A 3RKDD 1J9CT 1FVDB 5F6HI 4LVEA 4P2QD 4DH2A 1ZD6A 2ADJA 4Q97A 4ONHA 5T3XH 1FFNB 4MQ7B 2EILB 2NY6C 4QO1A 2X40A 4HZLB 4HWUA 4RDQG 5D72H 3QUGA 3LRLA 1LWJA 3LDBB 3PV6B 2FR4A 5EIQA 1AACA 2VM4A 2JWYA 1EVUA 1F4XL 2BP0A 1I9EA 1UOVA 1XTMA 2XA3A 3MRLB 4K5OA 4PRHB 2X42A 3ARBA 5LGHH 3KAAA 1VADA 2I26N 1ND0A 2ZAGA 5BRQA 1M71B 2GUYA 5E4EC 2OYLA 4POYA 2NNXA 1TZOA 5F0MB 3B6SA 3X13A 1WG3A 1T3FB 2EXSA 2KKQA 4PRHD 3VXQA 3OR6A 2DMKA 2D4DA 4PJ9B 4G7VL 1XF3B 4Q52A 2JF1A 1XV8A 2XC8A 5A1AA 3N41B 3X12B 5CZXC 1NFKA 4JFVA 1JHTA 1ZSDB 4JZOA 4XBPA 5ICXB 4PJBF 5DMGC 3N2JA 1R6VA 1JZ5A 2NUPA 1KTBA 1BMGA 4OZ4A 3G5XB 4KKCD 3GMOB 2WLHA 1P6AB 5KUKA 3OSVA 3BPCB 5I19H 3QULB 1BLNA 2LAAA 3D3VB 1HSBB 1B90A 2QGBA 3OLIA 3OL2A 5J4MA 1WZMA 1LEIA 2O1AA 4YPGA 4OCMC 3D3VD 3OR7B 5D7LB 3OLGA 4XNDA 4TRPL 1JDAA 2BHFA 2QMKA 1JZFA 2XG5B 5KOMC 2X4UB 2YQ3A 4FTVA 5C09D 5D7LD 1DUYA 1DQJA 2VJ0A 3FT1A 2OK0L 1MF2L 1ZT4A 5HGHA 1JP5A 2AQ2A 4X6EB 4LSDA 1OP4A 2VXUL 3ZTEA 4LRNL 5F6IB 1T2QH 4WUUE 2IH1A 4ZDHB 5T33L 4N2KA 2L0DA 5EIVA 1Z32X 2XKSA 4X99A 4MTMA 3VRLF 3PRZA 5I8KL 4QTIL 1DQIA 1NDMB 3P0GB 4CKVX 5T1KA 4AV5A 3HMWL 4DP7X 2J2ZA 2OMVB 5C6TH 4PMEA 4PRDB 5D2NC 2ADJB 3PIQB 4ONHB 2H5UA 5BO1L 4JAMB 3WXVH 5LJYH 1JPFA 3POCA 3CDZA 4RBPH 1NEZA 1Z5LB 3VFRA 1A14L 4UTAL 3JZ7A 3O0RL 4AXWA 4KI5D 3VXRD 1A22B 1JS4A 2DKMA 2AQRA 3WKML 3MV11 4WHCA 1M42A 5F7NC 2CKBL 2FLRT 3HKZA 1AO7B 2BP0B 2BSSB 1E8YA 4N0UE 1A3ZA 4R8WL 1I9RL 4N3TA 4YDMA 5TDPB 4ZX6A 1EO8L 4P5TA 2LFGA 1ZJBA 4G59C 5IT2H 1DDHB 3MX0A 1X9RA 1ND0B 1BZ7B 4RGOH 1NSNH 1S8DA 3ULUC 2GSIA 3UZEA 1L9QA 4FZ8L 4DKEL 3QEQE 1HH6B 2DWSA 4GXVL 2WC7A 3QJOA 4PVBA 3HG1B 1AFVH 2XWBA 4G3YL 1VFBB 3QFJB 2JJWA 2NY3C 2DMCA 4LSTH 2P46B 3G5VA 1NMAL 3TCTA 4JZOB 4XBPB 2R59A 3V2AR 4BYHA 5JQ6L 3VD2A 3NZ8A 1GTNA 3S37H 4RGND 3RWHA 4BH8A 2VXSL 5FV2A 4QRPA 2ESVA 2HX8A 3U7YH 4N6RB 1U8IA 2C1OB 4U6HB 2EDRA 4TULL 4F58L 3CXDL 1CGUA 3T2OA 3F58H 3KH3A 4PS4H 1UKSA 4YHMH 5C0BA 3K74B 1NGWB 4B95C 5B1JA 2HT3C 2VW6A 4EI5B 4D0DA 1BXVA 3C8DA 3RUGE 3SDCD 3BVXA 1U2YA 4ACTA 4HULB 3QDHA 4JANB 3I6GA 2DDQL 5IHBA 4FTVB 5F9OH 4ZMPA 4PJEA 1FNHA 3VRIA 2ADIA 3VA2C 5A3ID 4YSSA 3Q2NA 3CVIL 3NJLA 1ANUA 1IIIA 4XWGH 3CJJA 5HHQB 1X4YA 2BSTA 2WSKA 3PNWA 5GRYA 4X9YA 1S5HA 5TF1H 4GI6A 4GMSL 1YNLH 3T09A 1XTLA 3CNKA 3PGCA 3U2IA 1KACB 4KXZI 4H1LA 1ZTXH 1A9EB 2WW8A 5FYLL 1N5YH 3FT3A 1YDPA 4JREC 1WLHA 3MUGB 4PY8I 4R4FH 3BUBA 4BFKA 1CUOA 5GS1A 5E1AA 1KB9J 1OSPH 2JKWA 4YBQC 3ULVC 4AXWB 3KLKA 1PY4A 3RGVB 4A6YA 12E8H 4EE2A 2JB5H 4OD3L 3VGDA 2YPLE 1XX9C 3HN5A 4JKMA 2DQFA 1DQML 5F89A 1E4HA 4E5XB 3B2VL 2XDHA 1QHQA 4OF6A 3RGVD 2QQNH 4P5TB 5F7DA 2ZX6A 1LQSR 4OFIA 3MX0B 2W07B 4B9JA 3F84A 1OEZW 4FLOA 4U4BA 4AYDC 4PHZA 1SHXA 2WMPB 3BQUB 1U3HB 3C6SA 1A21A 1QFWM 1YN7B 4R5TA 4TNVK 2WV3A 2ATPA 3HE7C 1KB9K 1ILSA 1Q9LA 3NJHA 1MWAH 3BQUD 5BRPA 3U0WH 5CBEA 5AZUA 2XWBB 1U3HD 4WUUB 1LO5B 5HD8D 3MLZH 3BDYH 4HGWA 3EJZD 6PCYA 3BPLB 4YL4A 1AGFB 3TU6A 3EGSA 4ODXA 5DHDA 3G5VB 5LDUA 2I69A 5FB8B 4F37K 2NX5A 3BHBB 3MRBA 1T83C 4NAJA 2ZUQC 3FBKA 4X8JB 5DC4B 5IESH 2VDLB 4WI4A 4HXAH 5IG7A 2Y6TE 1JI1A 3FZUD 3FW6A 3HFMH 1TO5A 1UXWB 3VI4E 4JY6A 2X2YA 1K2DA 5GZNA 1ZLEA 1GKEA 2YZ8A 3EH2A 2VYRE 1U42A 2VR4A 4PRIE 5L4MA 2OZNA 3MODH 5KJ7E 4XWOC 4ZXBA 3PAVA 1JYWA 1JG9A 4N0UB 1INDL 4NAQA 4RMUA 4PJEB 4CRPA 3DV4A 3EBAA 2GBVA 1HNGA 3ME0A 2OX5A 2BIOA 1G9MC 1H3PL 3PNWB 3K8LA 4G43A 4JE4B 4TYUA 3UZVB 4X9IA 5DK3A 5LNEA 2BNRE 4PLJD 3A6CH 2VAAB 2FBJL 1RZIA 3GD1C 3QEQD 5JHDA 4PP1D 4H1LB 1MNUL 1WBYB 4WHTA 2ICES 4QRSA 3DJTA 2YEZA 3FT3B 1VCAA 2ZSVA 4N5ED 6FABH 1I53A 4EDWH 1YYLL 3RHWK 1BYOA 2Q7YA 1JNJA 3SDXA 2V5MA 3P77A 3EXLA 5L2JB 5E1AB 4L29A 5TK4A 2IPKB 3X3FL 1R75A 5K1JA 3DOIA 1QTPA 5ERWB 3S35X 2P9RA 3CFBA 3MUZ1 3N0PB 4UOW1 5CZVH 1NGXA 1J88A 4LVHB 3ROOB 4Z7AA 4ORZC 1S7UA 3K7UA 3H1ZA 4BBWA 2APTA 5D5ME 5A6MA 3O6LL 4WLCA 3BD5A 5AD0B 1WUNT 5E6IB 1IAKB 2H3NB 3MNZA 1F56A 5BUGA 2PTUA 3LNHA 1XAUA 4HKJA 3DRQB 5FKPA 2N4IA 3BD4A 1BF8A 2FYYB 5E6ID 4DEUA 5FO9A 2R9HC 5EORH 2HYMA 2ZD0A 3C8HA 1AQHA 4P4KC 3US9A 4A7SA 3RVWD 2DBLL 3G3LA 4X0NA 5JXAL 3H4HA 5CBEB 3GMPB 3MYJA 5D7JA 3BCFA 4WV1B 2ZICA 4I0KA 1IUZA 4FQIL 3C60D 1ZY9A 4KRPC 1HSAB 3G6JF 4DO6A 8FABA 2FEEL 4HALA 1RSFA 1UWEH 4LP4A 4KNTA 3SGDI 1Q72H 3DYMA 1UH3A 3NSJA 2YPVL 1UA7A 4JPSA 4ETQA 1BV8A 1CI3M 3QXWA 1DN0B 3ARDC 1II4E 3RAJH 2Z8VC 5FM4A 1NCDH 4ETYA 2OM5A 5DJ8A 2J8HA 2XUWA 5I6LA 2CKNA 1SXCA 4OCXH 1HOCA 2DLEA 2YPLD 3F83A 4FFZH 1YNTB 2YUZA 4NCC1 4JFEE 4NM4L 5DT1L 3WOVA 3ME0B 3QCVL 4JM2C 2E0PA 5MI0B 3GSUA 2N7BA 3NAAL 3JWOH 4DEPC 2VE6A 5LO7A 4J3SA 3RI5K 3Q5TA 5F7YC 3ARFC 1T7WA 5F1IA 4AZ8B 4RMTA 4P4RB 1AQDB 2CJUH 1FNEA 1CFQB 5JHDB 4NC1C 3WIHL 4J4PA 2EDJA 2VIRA 3SQRA 2B7DT 4A2FA 1G7HB 2A5UA 2VLJA 2YEZB 3OAZK 1T7YA 2JXMB 3WD5L 4APXB 3ZW3A 4BGLA 2HSIA 1CLZL 2Q7YB 3F2LA 5C0JB 3MA9H 4HQQL 5BW7C 4HFUL 3GINA 1ODAA 1FH2A 2VDNH 3TVMC 1X4ZA 3QP3A 4WF7A 3Q05A 2VZTA 2MNWA 2Y5TB 1N6QH 3UTTE 1B3JA 1NGXB 1XF5A 4DAGH 5J6HB 2Y5QA 5JPMA 3OG4B 3TWCH 4PRPA 5GQBA 1XGPB 4PRIB 4F57H 2H8PA 4P46B 3KPSA 3S37X 3IEAA 1NC4A 4MQTB 1MN4A 4NP9A 5FUZH 4E9LA 3MNZB 3KPMB 4PRID 2J56A 5ECJE 5FKPB 1RIUH 4JJ5B 4ENZA 3INUL 4FQ1L 2G75A 1GGUA 1KPRB 3FTVA 2VWEC 3AWGA 3QNFA 4F9PC 3QUML 2WZPD 5D7JB 1CYGA 2BNRB 3BUTA 3QIWB 1UXMA 1A3RH 1NPNA 4N8CH 2QEJA 4JVPA 4M00A 5FLUA 4Z3TA 4E68A 2YD1A 3W9DB 1RKRA 1WCBA 1I7ZB 1TCMA 4MA7L 2FSEA 3QIUC 3WHXB 5CGYC 1YLBB 4N87A 5PAZA 3OZLA 1WUZA 1X9UA 1FBIH 1SXAA 1IKNC 4GKZA 3CFKA 5BS0A 3KLAA 3DJZA 2EO1A 4LL9A 1YEIH 5J6GB 1HZLA 2NXZC 5DJ8B 1QQDA 3DO4A 3MJGX 4UCFA 4JRLA 2EZ0C 4JQVC 7PCYA 5GRUH 2YKLH 2Z35A 3F6LA 5ISZA 5IK3A 3HNVH 4MASA 4DO5A 4CVUA 1BFSA 3U2SA 2DD8H 2IH9A 4TTGA 4DOHE 2G4EA 4GBXC 3G04B 4N2DA 3VCLA 4PGBA 1VZGA 4QJ3B 3GSNL 5IFAH 3O2VL 2QTEA 4HSAC 1KCRH 4KKBC 4GRWE 1FNEB 2AEOA 3KDMA 3MBWA 4N9OB 4W93A 2BW5A 5T3ZL 5SWZE 2VLJB 1H6UA 4XN7A 4EIUA 3MOAL 5I0WA 1ASPA 5IQMA 1ONQA 4YNYA 2Z93A 1G1CA 2FIKB 2VITA 4LVNB 2CUMA 1U8LA 1FNSH 3QUXA 2EH7H 4OD2B 2R29L 2X87A 3PL6D 4HLEA 4TOYL 2H8PB 1NIBA 4H40A 3V6OE 3AAZB 3BRGC 3TCXA 2VW7A 2Q6WA 4PJCA 3DHJA 1OF0A 4GG6E 5IFJA 3GTTA 3OMZA 2DQEL 3CUPA 1QSZA 2CA3A 3QDAA 4YFLF 5EIIB 5BQDA 4HUXA 3OAWA 4MNHB 5FDWA 1OTUC 3ETBF 1DJWA 1M7DB 3SD2A 4DGYH 4JFED 2WSDA 4XO4A 4FFWC 2P8MB 1XF1A 2MNUA 5HI5D 1DO6A 5E99H 3ZT5A 3NCWA 2HTKC 1BBDH 3QGVA 5JW4N 5HDLA 2IDFA 2I85A 3REWA 3OKLA 3CCHB 4HKXA 3KGRA 1VIWA 2CHNA 2H26B 4ABQA 1AI1L 1ZT7A 1O7SA 3ULVL 3ARGA 5JHMA 4TUOB 4EUPH 4XPBL 5K9OA 3L5JA 1Q1JL 1BMZA 1L0YA 2GUOA 2NYKA 1NEZG 4PP2A 1A3LL 3UTTB 4GKZB 2XY2A 5BS0B 4OFYD 5ALBL 4XAKD 1B0GA 2MHAA 1QQDB 4FNQA 2XXMB 1F4XH 3GZKA 4Z7VF 3KWUA 4ZNCD 5DJYB 3HJ0A 4L5FE 3BWUC 1JVKA 1N7ML 3L8QA 3GK8L 4NRYA 5I1HL 3MRIA 1WIPA 2H32A 2X0VA 3Q6GL 3R06A 1MLCA 3L3JA 2YAFA 4NO2A 3RG1C 2KUTA 3MBWB 3OD3A 4CVZB 3MRHB 3BMVA 2AI0L 5A6IA 4IRZL 4LHUA 3BFQG 3ULUE 4TVPH 4XP9L 4UQBA 1J05A 4X6BA 2IANA 4WI5A 1P5VA 1M7IB 2GBAA 4NNYA 2FBOJ 2VITB 3KPNB 4MJ4A 2CHDA 3QUXB 1ZTMA 4LFHG 1ETJA 3ARVA 4QKTA 3M1BA 2IVFC 2VRQA 4PVMA 1A6UL 2ZYHA 4RH4A 1XGZA 1OAJA 1BMWA 4OB5L 4Z18A 1UCBL 3CVHL 2IOIA 3DIDA 4NRXA 4UTBA 1EK3A 4ZO7A 4R5XA 4OJCA 1UCTA 4TRPH 3TV8A 1CC3A 4V1DA 1G9ML 2WYZA 3P3SA 3QARA 4J3UA 2QADC 1I8LC 4A39A 2OK0H 3S3PA 3F00A 4G6KL 4XNBA 2HJFB 5E6RB 1JVLA 1SVBA 4OY9A 4LRNH 1QRNA 1SM3L 2N7AA 3RL2B 2IDUA 5T33H 1TZIB 1BX2B 4GRWB 4AVJA 4HX1A 1RZ8B 4W1TA 5I8KH 3QEHA 2J6EA 4QTIH 3U2HA 2XXCB 3EJRA 1E28B 5CINL 5SWZB 3AREC 4FQXB 3REWB 3OKLB 1ADQL 3HMWH 4H1LG 1CIUA 1V05A 4M02A 2XA8L 3OJMB 1H6TA 5BO1H 5AW5B 2FGWL 5SWZD 3QZMA 3S48A 4ELKA 4AQOA 4FQXD 4GP4B 1A14H 1UWFA 4A2MA 5FGBA 1HHGA 1NM9A 4JFWA 2YD8A 3O0RH 3D52A 1I1FB 3WTYA 3CK0L 1QEXA 1S5IL 3ZIYA 1COBA 3WKMH 5J0BA 5LHDA 5AW9B 1MFCL 5FUCE 2MHAB 4BGDA 2LW5A 4JCMA 3V10A 3KWVA 3UTSE 4R8WH 4QHMB 3UBXI 1I9RH 1AD0A 1EO8H 4GG6B 2R56H 1YZZA 1Z9SB 2R23B 4S1SL 4QLRA 5GRJL 2CUIA 5DMGD 4WW2C 2WXLA 4B41A 1CXLA 1X5AA 2IXQA 4JL2A 3HI5L 4NRYB 5HGBA 1E9OA 2K78A 2Y23A 2DLGA 3QWOA 2ENQA 5IVXE 3R06B 4DKEH 3SDYH 1MLCB 3TXAA 3VD0A 1CGWA 1R33A 1XAKA 4AW4A 4WSKA 4G3YH 4JO4H 2WANA 4YIQB 5D7KE 3UYPA 2IH3A 4LHUB 5FCSH 2AS5M 1VSCA 3V0EA 3VI3E 1NMAH 3MJ8A 4ALAH 2QBWA 3B83A 2WYIA 5JQ6H 2AMUA 1L7IL 4XZUB 1HXYA 3FBQA 2VXSH 1HHHB 4BCZA 4Z5RA 1XCQB 4EZMA 4F2MA 2HVKA 4ODUA 1NPJA 2HJLB 4NOFA 2WKLA 5JA8B 1HHJB 4X9HA 4TULH 4YBLC 3K0YA 4ZOBA 5EO0A 3CXDH 3X1BA 3FO0L 2R27A 3DSNA 1FL3B 5HVHC 3P73A 3KPLB 2HKHL 4MD0B 3QDJA 1RJLB 3CSTA 2HG5A 2AV7B 1CXKA 4KV5E 3RX5A 4HD9A 2UUDK 4QXWA 2DDQH 1FVCA 2H0PA 4FULA 1BPVA 3TNMB 5B8CB 4AYID 1BREA 2UXTA 4Y9BA 1BOYA 1LNUB 1YQVH 2NPLX 1HINL 3BGFB 4WNSA 1G7QA 1NBVL 5CBAA 4GMSH 3B9VA 5JIHA 2E4TA 4W70A 1GS6X 4ZJ9A 4HX1B 4UV4L 3UL4A 3QEHB 3VYPA 4ZODA 3EHBC 1QPKA 5FYLH 5B3NA 1H8SA 3WIFA 3EOTL 1IC7H 4JKWA 5F93C 2OV0A 3SPJA 3FSZA 3QIBB 1NCHA 4O9HL 5C7XL 4U2YA 5HHNA 3P4NA 3ULUD 4HT1L 2WBXA 4G9FE 5LBSA 5IJKA 1ET7A 2AMGA 2XBDA 4DSYA 4F9LA 3EOYG 4ONFH 2ZOOA 4OD3H 1AQMA 2NY3D 2XX1A 1DQMH 2VLKE 3B2VH 3O9WB 3QK0A 3VFTA 3PQYA 4FLRA 1MCFA 4NIKB 5T3ZD 2DI7A 4AQ1A 3O9WD 3ZKQD 1OARL 4EOWH 4HIHB 4ELMA 4NQDA 5DLML 3PGFL 1FZMA 1BA9A 3MGOA 1GS7A 3DUHA 3LVEA 4N2FA 1GXEA 2BPBA 3NN8A 1CFNA 3D39A 1CGTA 4K23L 3CBKB 4PRBB 5EDSA 3GI9H 2ATKB 4WWID 1XZ0A 3KHOA 1AQKL 4PB9H 3EYVB 3ARBC 4UUJA 5DUPH 2BSEA 3T0BA 1MFMA 5FWRA 1HXYB 3MRRA 4U1GC 3WTUA 3K6OA 4ODUB 1CBJA 5AOJA 1NCBL 3GLZA 1OLZA 3K81A 4Q74A 3O3BA 3WNIA 1ROWA 2H6PB 5DS2A 4N9GA 3T08A 3C5SA 1EPFA 2A6DA 5CD3A 5I73B 2K3HA 2ZF8A 3P9WB 4LKXB 1BFVL 1HNYA 2DRUA 2DWDB 4HOMA 1INDH 3JVGA 1DVXA 3B34A 4K8RC 4DPBX 1LEKA 1TZAA 2VDOH 3UTSD 1UWXH 2F54E 1W72H 2X89A 4M6NH 4RISH 1OGAA 4YHNA 4AQ8A 3UYRL 5FM5O 1K3ZA 1H3PH 1L6XA 2GW5A 2I9LB 4NQVA 4YBQD 3FT0A 2QFPA 2EJ1A 4OLXL 2X3AA 3AG2B 1DQDL 1U8JA 2KDGA 2FBJH 4KBPA 3GRGA 4DP2X 4XHQA 5C0FA 1F13A 4HPOL 3GSWA 4XN5A 2OSLB 5D7KD 1M05B 1YYLH 4JDZB 1RUAL 5F3HB 5HHNB 4F1SA 2WLIA 3O6ML 2IV8A 5E03A 3T8XA 3X14A 2H2SC 4X6DE 5C0GA 3O2DA 4HJIA 3WTSA 2M2DA 3FB8A 1X3DA 3L7EB 1MDAA 1I7UB 4YSTA 2I9TA 3HE7D 2Z91A 1FIGL 1IGJA 4E9YA 1DANT 5HHPA 1BZQK 2DQUL 1YYCA 3H3KA 4ZMAT 3F7RA 4D8PB 4XH2B 3A21A 5EF2A 3O6LH 3MQIA 3BAEL 2ZX8A 3PQYB 1TT6A 4QRFA 4RRPA 1UD3A 4XNXL 5GHWL 2AK4A 2WNXA 4AQ1B 4ZUVA 4WI8A 3RZWA 4ELMB 2WXIA 4WY7L 5I0VA 1BLIA 1FZMB 1KCBA 2ICEB 3MGOB 5CR1A 1AIZA 2DBLH 4G1EA 5JXAH 1SF3A 2KMWA 5DWPA 2Y2YA 4FQQA 4RCAA 5TTRA 1N5AB 3FTSA 4JR9L 2UY7A 5KVEE 4FDWA 1GGTA 5EWIL 3ZDXB 4U3SB 4FXGB 1XZ0B 3F5WA 5IHUL 3D9AH 4FQIH 3E80A 4LKCA 2HT2D 2W94A 3DX0A 4UUJB 1KFAL 3L5XL 2NNAA 3MREA 2CO7A 5F96L 3UZEC 1O9WA 2BVPB 4N2OA 1KB3A 3FQYA 3OB0H 4HISA 4G9FB 4WIQA 5DVPA 2YPVH 3LRKA 1I7RA 4WI9A 5E8EB 4N9GB 2WB7A 3LN5B 2RR3A 1KXQE 1FJ1B 2C9PA 3WJLA 4AMWA 4G9FD 1A1OA 2Z31A 3DUSB 3JBG7 4OQTL 2F8OA 3LNDA 4XVUC 3VWJA 5IB2A 1DCEA 4K5MA 2ZKHH 2C3XA 4P5MA 4MZIA 4NM4H 2VLKD 1SHSA 5DT1H 3IFNH 1QSFA 3QCVH 1J9RA 5G5DB 4XN8A 2NW3B 4MBOA 5HSFA 1AXSB 3NAAH 2A73B 2YD0A 4WKZA 4QOKE 1AAJA 3R8QA 1ZCRA 4AT6B 4ZK8A 3EKCA 4XNZB 3BRDA 1U8PB 3OG6B 2UWEF 3LRMA 1I85A 4HK3N 4NGHH 2WQAA 2X1PA 3K72A 1R17A 1CLZH 5EUKB 2WLIB 4HQQH 4S1RL 5MERB 3X14B 2YBGA 4HFUH 4KVCH 2HRPH 2CRMA 2R9HD 3UTOA 1P4IH 3FB8B 4P4KD 5CN2A 1TZHA 4LLVA 2J1XA 2Z91B 2I9TB 2CUHA 5I9QB 1KEGL 5EBGA 5DHVB 3UAEA 3IWUA 3W9EA 1NFAA 3M1OA 1UURA 3RVXC 2C26A 3P0YH 3JTTB 5A2JH 4IEFA 2RMNA 4K5NA 4P0DA 1V5JA 3QHTC 2EC8A 4ZUVB 3FAXA 3FTYA 5GS1C 4NERA 4ZYKB 3ILEA 5C0CE 1YMHA 1UM6L 2F54B 3INUH 1D6EB 3GJFA 4K15A 3QQ4A 4AM0A 3TJEL 3UPRB 4G1EB 2KPNA 3QUMH 5C9JA 1O5PA 2F54D 3MO1B 1U58B 4RA3A 3U6XS 3LKQB 3CHPA 3U0TB 4ELDA 3VM7A 3F5WB 1S9YB 3ZDYF 3UTZA 2AJVL 3A4EA 4CNIB 4LKCB 5IMMB 1FP5A 1U92A 2AQQA 2ODHA 2R39A 2X5PA 3NSCA 5AG9A 5IMLB 1K5NA 4OZGE 4N22A 2FLMA 2WBKA 1G9HA 1KCUH 3GJEB 2AKRB 2V4LA 5CSZA 5JOEA 1ZHNB 1PZDA 4QNPF 4C4BA 4TUJA 1ET5A 4UDUB 1KLFB 3MCYA 5IB2B 3CZFB 4NXSA 2Z8WC 3AG4B 1X5XA 4MMZA 4PYHA 3LZLA 2GJRA 4PCKA 1Z9OA 2DMBA 4JRXA 1N4XH 4CVWA 2APBA 4OH2A 4A63A 2VC2B 5GZNC 1MW1A 4WKZB 1MJUL 1KWKA 5F1NA 4EQ3A 5L2KA 3M6DA 3O2VH 1OP3H 3EYQD 4ZXBC 3LVTA 3I6KA 5TGBA 4KPHH 1I8AA 2Y69B 1Z0MA 3A6BL 4R3SA 4U0RB 4FG4A 2VR5A 3IN2A 4YH6A 5EZPA 3LV3A 3MOAH 4MNGE 1Z9LA 4LHUG 4ES9A 5ESVB 2MTPA 1SGKA 2L7QA 1ZMYA 1XD0A 4BSVB 4LLVB 1R47A 1OT1A 3FOMA 4J7RA 5D1ZB 2P28B 1IC4H 4FZEH 2R29H 3LZPA 2R1WA 1K6QL 4HMEA 2C7FA 5GGSY 3PE9A 1U2HA 1D2PA 4IBSA 4TOYH 4TQHA 3QJZA 4IOIA 3VX1A 4WWPA 2YA0A 4YLCA 4XVJL 4GIAA 2DQEH 1IGIL 1WISA 2VLRA 1DBJL 1YMHB 5IVOA 1CGYA 3TT3L 3TBVB 2AZUA 3GJFB 1E3FA 4ZOCA 3VD1A 4G7SB 4K2UL 1DUZB 1MCIA 1Q94A 1QACA 1WBXA 4LRIA 2PCFA 5ALCH 3UC0H 3L4YA 2NXZD 2PCPB 2H1XA 2EO7A 3UTZB 4QOKD 5L4IA 3AU1A 1VERA 3RNKB 5KBPA 2X6VA 1X5MA 2TRYA 1U0QA 2FJGB 4X7FC 3WEMA 1JZ8A 1F3DH 1AI1H 2ZOLA 2DMGA 4PV8A 3ULVH 2P5WA 4BV1A 5ANHA 3SYPA 3DO7A 4XPBH 4N3UA 5T5NF 4GBXD 4JDEA 5CSZB 1Q1JH 2R0WL 5D7JC 2ED9A 2BJML 4XN2A 3TFKC 5AG8A 3KYAA 1LM8V 5J5EA 2C3WA 2HKFL 2Q76A 4UIMB 1XGUB 1UZ6F 3MKGA 4IRSB 4KKBD 2W5PA 1ZHLB 4UYPA 3BT0A 3IJSA 4PJDE 4XP5L 3TFBA 4WWKA 3IAQA 3K4ZA 4CW1A 3RY4A 4EXKA 1GAFL 1IBFA 1NH6A 3L45A 4PG9A 3TBCA 3WJMA 2EE6A 4X4YA 1BEXA 2YKKA 1UKQA 3KXFA 4YHKL 4DKDC 4TPRL 3VFOB 5EEWA 1N7MH 2N59A 3DJSA 3GK8H 4PJAE 1BQHB 5I1HH 3BZ4A 1KNOA 5KSVA 2GJ6A 4N2MA 5AVRB 3Q6GH 2Z9TA 3Q3GB 1JSYA 1N2RA 5C0CD 5J13B 5KS9F 1SYSA 3ECVA 5L2KB 1C16B 3E1F1 1SBSH 1WZAA 5FW8A 1W80A 3S34L 1BVOA 1OAYL 4JFPA 5IFHL 3UGUA 2AI0H 1SZNA 2DWEB 5B4MC 4NFBA 5DHYA 1I4FA 3LV3B 1CFMA 5EO1A 1HU8A 1FV1A 3IDXL 4PRNA 4U1IB 1RK0A 3OXRA 2MQ3A 2V9UA 2P47B 4QY8B 4OZGB 2FTAA 4YC2C 1OTUD 3DX8A 3FUJA 2KC0A 1LO3L 3FH7A 3S5LB 1JYNA 1NAKL 5KVDL 3PHOB 1MAML 1X7QB 3G6DL 4FFWD 4HH9A 2Y07L 3F7YB 1A6UH 1MIEH 1S78C 4J4PC 4IOIB 1BVKB 3VGEA 5ID1A 3BT2L 4PJGA 4MDRA 3U4AA 1PLGL 4K8RL 1AZRA 2VQUA 4QCIB 5HI3C 2IDSA 3ILDA 4HFWB 2CIIB 5DD3L 4Z3JA 3Q2VA 3SQBA 1G9MH 1SUHA 2R4SL 4FI6A 4UQEA 4GUPB 2IBZY 1FYTE 3EFDL 3ARTA 3T4AB 1MI5E 4S1QL 5KYWA 2BS9A 5C70A 3VJ6A 1SM3H 5JPMC 4F15C 1Q94B 1RULH 4CJ1A 4XMPL 2G2NA 2ZOUA 1NJ9B 4GYBA 3GKWH 3MCKA 5IMOA 1ICTA 1J5CA 3MJ9L 2D2OA 1FVEA 1ACCA 1ADQH 3MMEA 4Q0XL 4MNGB 5CJ8A 2E9IA 1T5WB 4X5QA 2XA8H 3QQDB 3NTCL 3FQ2A 4PV8B 3PFQA 1NC2A 2FGWH 4X4KA 2I7SA 1AG0A 5FF6A 4KNUA 3U9UA 3CK0H 2Q76B 2NR6C 1G1YA 5DZPA 3WEBA 1DJIA 1KPUB 1N64L 3CSPA 5DUJA 1MFCH 4JPIA 1I1YB 5I28A 4W6YB 1DVSA 4XPHH 1F3JA 2A9BA 5HJ3B 2E9GA 1WEJL 3K3QA 4IOSA 4UQ3B 4PG9B 3UBHA 5I2IA 1QUNB 2ZNWA 3RIAK 2V5YA 4S1SH 5GRJH 1J1OL 1U93A 3DECA 2NSQA 3VXTB 2FRGP 1KYDA 1S9XB 3HI5H 1ES0A 3QB7C 1KNOB 2A4CA 4OCRL 4D7PA 4IJ3B 1IEHA 5BVPL 3CC5B 1WCQA 3BOVA 1WYJA 3KYKH 3J27A 2BERA 4FEMA 5T1MA 2V3EA 3V4PH 3IJEA 5DD0H 5FK9A 3QUKB 4KX8A 5EO1B 4N20A 1YAIA 3FCUB 3PY9A 4G8GA 1JF6A 1L7IH 3O2WH 4RAVB 4MVBD 2XIDA 1ZPLA 2ZG3A 3MPCA 4QD2E 2X53A 1INQA 5DMKB 4WCYL 4AX3A 1YG9A 4XVOA 1HL8A 2NYYC 3RWGA 4HF5H 3FO0H 3LZQA 4LSQH 3EGDA 2C7UA 3CFNA 3DVNB 5GJSL 3QHFH 1Q9WA 2GABA 3QXDA 4AMKL 3DX9B 2CR0A 1QHPA 2N1TE 4PJDB 4M1CC 4X7SL 5EBWB 3ARED 4IQHA 1MJ7H 1X5ZA 6TAAA 4YVUA 3NRFA 4RFEB 3ZO0A 5F9AC 2UX6A 3D0AA 3KD4A 4H5SA 5SX5H 4MD4B 1V3MA 4H44C 4PJAB 2UYLA 3K6SB 2C8NA 5KYWB 3KGUA 1QYGH 3VJ6B 4HOWA 1A6AB 1UM5L 1UTDA 1HINH 3FTUA 1NBVH 2CJTA 4UQ2A 4Z0BL 3QPQD 4D7BA 3K71A 1FAIL 2WWNA 4FTDA 2DBJA 3DBXA 4LEOB 3MMEB 2FJHB 3EOTH 1CO1A 5IVZA 3VXSD 4O9HH 1UHVA 5C7XH 4AL8H 4Q9RL 2DN7A 4UZSA 3NIFF 4HEMA 1QKZL 5FF6B 5H94B 2DQIL 3TURA 5KEZA 3CHXA 2AQPA 4I89A 4IK7A 1FNAA 4NO5A 5DTFA 3AXLB 1MUJA 3U9UB 1XR9B 3AWEA 2APXA 3MLSL 3P3YA 2YJLA 4M7LT 4K5LA 2N3JA 3EYSL 2A6JA 3G7TA 4GMTL 1OB1B 4XO9A 1ADWA 3HA0A 3HMXH 2X4RB 4L23A 5I2IB 4JFOB 5F7AA 5DVKA 1J8RA 1U93B 5J9PA 1P5UB 3ARGC 2BNUB 3EH4B 4J2XA 3PDOB 1CBVH 1OARH 4A6YL 3M46A 2VOTA 5DLMH 1FYTB 4HJEA 3EXJA 1MI5B 1NFDA 2NUTA 3B9DA 25C8L 3GF8A 4DK3A 1IC0A 1KJ3H 2K9UA 3R1GH 1KV3A 3LKRA 1HE7A 1HTYA 4DIXA 3ZKXC 3SGDH 4FKKA 1L0PA 1AQKH 4QHNA 5DFWH 2B0SH 3PAYA 2VCOA 2F18A 4FJYA 3WYRA 5MENE 4LPTA 2CDFA 2FJSA 3DHPA 5D7SL 5A6LA 3QORA 2FEJA 1T0MA 3L54A 1LWHA 4ZPVB 2BOBA 3NPZB 2Q3ZA 1E9PA 3WIIL 4GQPH 4N1EA 3ZPDA 3P2TA 1BFVH 3IM1A 1PZAA 5DK0A 1EAQA 2GTWA 2NY0B 4K5PA 5IM7B 3LEVL 3FO9B 3UBXB 2UYLB 3S0PA 3F12A 4L9LA 3UYRH 4AKOA 3A23A 1LGVA 2NY0D 1RUPL 3F01A 4Z7OF 2ZUSA 1OOAA 3O0LA 1IU1A 1QLFB 3MA7B 4M6AA 3RIKA 1NCWL 4N2CA 4HPOH 5GS2H 3FUFA 1GJUA 5IVZB 1V7NH 4MDIA 4Y16C 3X11A 1USQA 1MRFL 2BZCA 1HJBC 4OAWA 3KJ6L 3EDDA 4QRRB 5D1XE 1FNFA 4JS7A 2QVTA 3QZWA 2AGJL 2DPKA 2CALA 1FIGH 2YGOA 4I3GA 3SCMA 5BJTA 5DZLA 3GMRA 4NRZB 3SGEI 3BAEH 5EU3A 4XNMB 4MDJA 1T2XA 1EAJA 3SYQA 3UERA 2HXAA 4AIOA 5FECB 3ARBD 1JFHA 4XNXH 1I8IA 3T3MF 1CXEA 4GJTB 5FOBA 4QRTB 2KYIA 4XB8A 4EIGB 1G7IB 1MCLA 1GZQB 4WY7H 5FGBC 3TEWA 3OGCA 5I5JA 1KBPA 1QW9A 3HRPA 4GLRH 1Y6KR 5E1HB 4XNQB 3EFOA 1H15A 4JR9H 4WU5B 1MVFA 4ZW7A 5GS0C 4YHLL 1FO0A 3QI9A 5EWIH 4UDTB 4BXVA 2DLFH 1JE6A 5IHUH 5EC2A 4J23A 3INOA 4JMXA 1KFAH 3T04D 1XIWA 3RDTA 4EF3A 2ZCZA 4K8RD 1CWVA 2V9QA 4M9OA 4LLWA 1F58H 3ZE2F 5EOTA 1T0MB 3RI5F 3ARXA 2NY1B 3QJHB 4MJ5A 5LQBL 1OHZA 3FB7A 3IVKB 4EN2A 4X42A 4Q58C 1ZJAA 2NY1D 3P30L 1DVYA 4OQTH 2K3TA 2IQAB 4AEFA 4Q56A 2YN3A 5AVZB 4IKJA 3O4LA 1F8TL 4B7IA 3D4ZA 3GJFK 3S9DB 4ZBJA 5K59E 4L9LB 2H0EA 2H2SD 1CFBA 4MD5A 3UJTH 3LSOA 4ZZFA 1RMFL 1MREL 2LU4A 4WI7A 4Z7WE 1BQHG 1NKOA 4L48A 2BHYA 1UFUA 5LGKA 3U46A 4L8CA 4PJ5E 1JGEB 2H7WA 3KW7A 5T1KD 4NQXB 1AOZA 1DSFL 3QYNA 3WN5A 3WHE1 3ZOAA 4F7CA 4HV8B 3QUHA 3VD3A 5AVVB 2V3DA 5C6PB 3KW8A 4S1RH 5C86A 2YA2A 3ALXA 4BINA 4F91B 5F72S 3Q8FA 1ZS8A 1BIIB 5MEND 1JZ6A 1ZIAA 3N41F 4OW6A 3S5LG 1KEGH 3V6FB 4E9TA 5JOFB 2UV3A 4FG6C 3UG5A 2V2TA 3GMRB 3K4DA 2IWKA 3PPSA 2GYSA 3UFIA 3U4BL 4OSUL 3O81A 3GMLA 4PJFA 4X5LA 1I8MA 2VN4A 1HILA 1GIGH 1JI2A 3MLVL 1UM6H 2VRAA 5IJKC 3OGCB 5ITBL 5M7QA 1P2CA 4F9LC 3MRPB 4ATWA 2DJ4A 3JT0A 3VYNA 3TJEH 2PLTA 3PWLA 1QLEL 4PCYA 5AKSA 5EZJA 6CGTA 5KN5B 4J3VA 5CIPB 2QVFB 1JYXA 3M17B 5FPIA 4ANVA 4KO9A 4XVUD 1IFHL 2AJVH 1T4KA 2OCFD 4JFFA 3FF7A 2Z3FA 2XWZA 2DEXX 3RDTB 2A9NL 4A2EA 4ZFOB 4KHTL 2ESVD 5AB0A 3VDAA 1Z3GL 1WGOA 2BY3A 3TYFA 2ZF9A 1LL1A 2FIRT 4LLWB 5KYXB 2F2HA 4AZUA 5D1XB 1RK7A 5J12C 1AZNA 4MJ5B 1KTRL 3FB7B 2AFNA 4GSXA 1X5GA 4JO3L 2ZXAA 4UM9A 5D1XD 3UJJL 3HZMA 3OAZH 4Z7IA 2WM0A 3A22A 4TL4A 3OKYA 3BFOA 3RL1A 4DP5X 5CEYA 1GOGA 1TEGA 3HB3D 3MLRL 5F8QC 4M61B 4Y9EA 1BG1A 2B39A 3TBTA 2IMNA 3MOBL 1MJUH 2JQAA 4NO3B 1S9WB 5IJBC 4FCHA 5EPMA 1H5BA 4AG4L 1HT6A 3QG6B 1E2ZA 2IQ9H 1XF4A 2W0KA 5A43C 2ZWKA 3RVXD 5B39B 4RMBA 4WDIA 1ORQA 1Z9PA 3E8UH 2ITDA 3W56A 4BQ8A 3L7FB 4IHBA 1N68A 2O5YL 4WHDA 4WGVB 3TN0A 5C9KA 4AQ8C 4JO5A 2VDQL 3TF7C 3D08A 1AXTL 4Y19E 4ZTPL 1KYFA 1BPLB 3EG9A 4XN4A 5ESQA 5KBLA 2EVHA 1NL0H 1HYSD 1K6QH 2V2TB 2ZONA 3E6FA 4AV4A 2ADGA 3L48A 3ZKNC 3TO4B 4XVJH 1I8MB 4YWGL 4M5YL 2F7OA 1DBJH 3RPIB 2ENYA 3ZE0E 3PHAA 3G5YA 1EQWA 3IJYA 3WFHA 3IBEA 1AYOA 5EZJB 4GRLA 1RZFL 4K2UH 3ZYJA 4Z7WB 1B4TA 4G1MB 4I9WE 4Y9CA 3SHSA 1MKFA 1ZXKA 4R4NC 3GEFA 3K8MA 1B6UA 4O58H 1RHFA 3GHBL 4N5UA 1QWHA 4KGLA 4HIEA 4LCUA 4NWTL 3NACL 1GHFH 2ZWSA 2R83A 2J8UB 4HK0B 3FCTA 4NEHB 4PJ5D 3NJKA 1VKXB 1Z5HA 5E7BA 4N2BA 1T5XA 4Q9QH 1CFTB 2X6CA 4Y88A 3VQ1C 1KN2L 5MP6L 4FHJA 2R0WH 4H25B 1P4LB 2BJMH 4NC0B 1IAII 5E1IA 1KJ2B 2HKFH 4EIZC 1YEJH 4ZXBD 4UM9B 2C4XA 4H2AA 5IB4A 3HZMB 4XCEA 3S97C 2QZQA 2VABB 3GMMB 5MHSD 2XTJE 1CN4A 1EZVY 1QPPA 4FMKA 1GAFH 4R5VA 4Y0GA 1KB5B 3VG9B 3KPPA 4YHKH 1SLXA 4TPRH 1CYWA 1B3IA 3WJLC 4XVSL 3PHQA 5EPMB 2Z31C 3N91A 3S34H 4OZHA 3VWJC 4DP9X 1OAYH 4PWJA 1P7HL 1F4WL 2NYZA 2RHEA 4QRUB 5KBNC 4WDIB 1ORQB 4ISVB 1NBYB 2ITDB 5EU7C 4HCRA 5A40E 2FB4L 1BDYA 4K9JA 4K4KA 5ACZA 3IDXH 5L8KB 1CDBA 4RVBA 1PPIA 3U82B 4B5ZA 2LVEA 3A4FA 2ZCHL 3VA6A 3TV3H 3BH8B 4G82A 1HZHL 3FUHA 2ODIA 2QR0A 1MIML 1LO3H 5HDQH 3LZNA 3HLKA 4FX5A 5C7ZA 3JWNC 2BXYA 5ISZE 3V5HB 1UVQA 1I85C 1BSIA 3G6DH 3WY3A 1YCSA 3TT1H 4AGMA 3IN0A 1MJJA 5D4HA 4PJIE 5F7MC 1PLGH 4E36A 3MLTA 3KLQA 3KDPB 2XHNA 1WHPA 5DD3H 2V17L 3FCSA 2MWCA 4KKRA 4Y5VA 4G42A 1K8IA 4BK5A 1OCRB 1GYCA 3NJGA 4S1QH 4RQQA 1P84J 2DIBA 2EDKA 3TFKD 3NZSA 5MEPA 3LQAC 4XMPH 4UTBL 5HVGB 5BRZA 1ASOA 5HHMB 5INDA 1G7MA 3SPGA 4WTWA 2IGLA 4PV9A 1NLDL 4X7TA 5DJ0B 3BD3A 4A7UA 3T65A 2CO2A 4PJHE 2QL1A 1GGIH 3W3BA 4W81A 2OMTA 3T6ZA 3NTCH 1K4CB 2P8PA 2FJFB 2JLPA 5ID0A 4Y19B 1S7QA 2NT1A 3JYCA 1OSZB 3H6JA 4PJBA 1FC1A 1P84K 2J6EL 1BECA 2UZIL 1EAOA 1WC7B 2CIKB 2HFGL 1DVUA 4RESB 3PUUA 4B5EA 5FM8A 1N64H 3HLAB 5DJAB 3D2UB 1TSHA 2P5EE 4NNPL 3MR9B 4XCEB 5IP4A 2V9TA 4JRFA 5E8PA 5B4MD 3BFWA 3WV0A 1WEJH 3D2UD 3KPPB 1J1OH 3MRFB 4L1SA 1IM3A 4YLBA 5FO7A 3L4WA 3ZE0B 2X70B 3OKOA 2ZUTA 1UB5B 3BDBA 1HQ4B 3KWTA 3EJCA 4OZHB 3MDJA 2IADA 3RUGF 4J39A 4MMZC 1S78D 3FN0L 1TXKA 1S4IA 3DDFA 4G7RB 2Y25A 4MSWB 4HS3A 1G7JA 4I9WD 1SHWA 5HI3D 4EMZA 3MRNB 4X8GA 1MFEH 3HUJE 5C0ND 1P1VA 3CSYA 4FL4B 4BSWA 1RZKC 1CQKA 3EJPA 4WCYH 2JIXA 3KL0A 4L4JA 4DNLA 4YDIL 3V5KB 2BS8A 3ZN6A 3U79A 2SEBA 5GJSH 1MQ8A 3KPSD 4B60A 4AMKH 4GQ9L 1MJJB 1MRCL 1A4CA 1Y6MR 1GZPB 1A47A 5J6SA 3MUUA 4BQ9A 1W0WB 3NJIA 2XTJB 3MLTB 4ZMTA 1RUMH 2N0MA 1BWMA 2J43A 1QFWH 1Z0NA 4NJAL 1AVAA 1L5GA 3IMVA 1IVTA 3AG3B 4G42B 1BVLB 4RFNC 3VMOA 5I74C 3LCYA 1GYAA 1BQUA 2VKXA 2NR6D 4Z0BH 5BRZB 2X0UA 1HN1A 3HPJA 2E27H 1MCOH 2X4TA 5HDOA 1TU2B 1FAIH 3V7AG 3WY1A 4EI6A 1THAA 4PV9B 1DJXA 1YNTF 4MGXA 1NINA 2D7TL 3WEXA 3NJVA 4HGKC 2BDNL 2UXFA 5I18L 3VWKB 5FDYA 3ZQXA 1A2YB 3SO3B 1QKZH 1KJVB 1MAJA 2DQIH 4NFDA 1EZSA 2NY2B 2VXTL 1T1ZA 4H1LH 5BUAA 2D3VA 4LRIC 3X2QB 3QZWG 5IEKA 4KKLD 3WLBA 2BNQE 3TPUA 1OAZH 2IPTL 2E9JA 3EYSH 4FXTA 4HS8H 5A2IH 4L3EE 4N25A 3ISRA 1YVLA 3QZOA 4CGTA 3G08B 5ISZD 1OGTA 3SBPA 4QF1A 5C07A 5LBSL 3BX7C 3X1FA 4HCGA 4AI7A 1CIDA 4D0CB 3VI4F 1J1XH 3RWFA 1MVUB 2DWTA 2JKNA 3QUZA 1ZV9A 4BKLA 1IM9B 3OKOB 2NYYD 5JHBA 3TIEB 2OLDA 4GEJA 2EINB 5HYSA 2IADB 1IM9D 2FATL 3QDGE 2XWRA 4WWKC 1K8DB 5CP3H 2FX8L 3CLEL 3P9MA 3MRQB 3D48R 1FZJB 2UUDH 3QXAA 1ROCA 4Q6IB 2L7JA 4PJHB 2EDNA 5ABDE 2YXWA 3F64A 1A6TA 1B4JL 4IJ3C 3FTWA 4PHXA 2Z92A 4I4WA 4BFOA 4MZ2A 1M9WA 3RZCC 4Z7UE 4PBXA 4MAYA 2B1AL 4X50A 2ORBH 5GJTH 1T7XA 2VMCA 4E2OA 35C8L 3QBTB 5IHZA 2XXFA 3WIIH 4IGBA 1ZKAA 2UVFA 1OK0A 3GXDA 4BFRA 2EYRA 2H9GA 3EH1A 1L6ZA 2CD0A 5A16B 2MKWA 5B3JE 2DOCA 2P5ED 2Z34A 4MNQE 2ZAIA 4DEWA 1IBHA 1NBZA 3LEVH 2YXMA 4IRJA 1P7KA 1T20A 3NP3A 3PJSA 1X7TA 4HS6A 2DQGL 1QSVA 4LIQL 1RUPH 5HGAA 1B0RB 5G4OA 2LV4A 5D5MF 3F04A 2YRLA 1TPXB 4U6TA 4XMKL 1U3ZA 5DEZA 1NCWH 1F1DA 5IIEA 1IBBA 4LVOB 3BAXA 4WW1A 3U36B 1UUSA 4APQC 2A83B 4L8DA 2NXYC 5B39G 3L2LA 1FGNL 1CTOA 3L2NA 2DQDL 1FCCA 3ARGD 1NKGA 4LCYA 3HUJB 5FM5M 1E3ZA 1TZGL 4BKTC 3EOAA 1O6SA 2I27N 5CO1A 2BIHA 5DFVD 4I5BB 4JM4L 2PTTA 1R3JA 1WFOA 3NG5A 4I2XA 2Y3AA 4J1UB 1LD9A 4YQXH 1SMAA 4LSVL 1ZGLB 5EZLB 4K3EH 4E9SA 3O2DL 3MNWB 5E2TL 5C07B 3ZHKA 5I5MA 1U8QA 1IGYB 1VGKB 2VXVH 4FNRA 4YSQA 1KTJA 5FUOL 1RK1A 1PS3A 1PQZB 4R2GC 1TJMA 1PVHA 2EIKB 4FFZA 3Q01A 3LPWA 1O0VA 5D9SB 4AYSA 1U8MB 3N85H 1IBGL 1TTGA 4YHLH 4LEEA 1R3LB 3BCDA 1CGXA 3DVGB 2IAND 3OF6A 3BH9A 4M43H 1QO3A 3CZEA 5D7EA 3I9PA 1IGTA 1A6TB 3LKSA 3JV4A 2Z92B 5E6UB 4I4WB 4JN2B 4L37A 4JZJB 1MQKL 4WUKL 2UZXA 4CSPA 3FYEB 1YUHB 3NRPA 5D70L 4MAYB 5LQBH 2R69A 4GAYB 1T4WA 4IGBB 1TQBB 3C75A 2L8AA 2HVJA 3P30H 4WGWB 3RDJA 2DYRB 1TTRA 4J3WA 3V0AC 4L3EB 4OCNC 3C2AL 4OGAC 2H9GB 1OLLA 1A9BA 1BVZA 2BIMA 2BNQD 5FAAA 4S1DC 1F8TH 3VFMB 4ZNEE 4Y16D 3NPSC 2ITCA 2YGNA 1OOWA 3IDIA 3PU7A 2CQVA 2BH0A 1FL5B 1RMFH 3DGGA 1IGCL 3TA4D 3ZTJG 2Q7NA 4C59B 3E9UA 1AG6A 4L1DA 1F02I 4U1KB 2WINB 5KSBE 4KGJA 1TQUA 3QDGB 1BZEA 4NT6B 4N0FB 1A4BA 4LDLB 1DSFH 1QEWA 4FXKB 5FYKU 2RALA 1WZLA 1MSPA 5B38B 3IDJA 1M6OA 2H45A 4M9PA 2V2XA 3FQTB 1C12B 3GIVB 3U7AA 5FO8B 3G6JA 4OIIH 1Z2KA 5KVGE 3Q6FB 2VDPB 2WWKT 4KXBA 4Z7UB 2PTTB 3OHXB 2EEAA 5KAQG 3QZNA 4UU9A 5GS0D 1LD9B 4M7LL 4RAUA 1PX8A 1H3TA 3IDYC 2F1BA 2QQKL 3U4BH 1FFQA 4JN1L 4K71B 3C5ZA 3MLUH 4IHOA 4IOFD 5EZIL 3SY0A 4P48A 4X6FA 2WAQA 1QNIA 2OMUA 3MLVH 5ITBH 1A8JH 3HC2A 4HUMB 4P23C 2X9XA 1L7TH 3MUHL 4LLQB 4MNQD 4YO0A 1E27B 5SWQA 4YDVA 1J5OL 2JB6A 4DGUA 1AGEA 2W9DL 1KYOJ 1IFHH 1UD5A 15C8H 3JZYA 1PLCA 1RIVL 1YEWA 1JAEA 4GIOA 4ZUWB 2A9NH 4KHTH 3LKSB 3B7YA 4RZKA 4U49A 5LNDA 1UACH 2O6FA 4HUUB 4PSRA 4XX1G 3D25A 1PW3A 2QDVA 2UZXB 2XZQL 4K3HA 3T0VA 4GRWF 3N43F 4J3TA 4HKBA 2QV2A 4HUKB 2CBPA 3GRBA 3U4KA 2XWCA 5I6NA 3DUUB 2HVJB 4X6CE 3UJJH 5I1IL 1UOLA 2PR4L 2YS4A 4URTB 43CAA 1E4XI 2CDEB 2GBUA 4X98A 1DCLA 2IDQA 5IB1B 1KG0A 3QORC 1CICB 2CHXA 2AQSA 3C9NA 3MLRH 4OZFB 1IQDB 3C6LA 4WK0B 5E6SB 4G7YL 1YEDB 1QP1A 4CSTA 3WHE0 1DEEB 4IBTA 3AQZA 3HS0A 2J3SA 3MV01 3IMBA 1IEBA 2NLJA 4FG6D 4EZJA 4GG6F 1F41A 1UGNA 5DQJB 3ARQA 3GSQA 5AUMA 4RSYA 3IDJB 1M6OB 1YECH 2O5YH 2Z4QA 1RZKL 1TG8A 2V2XB 2ZUWA 1XB8A 1A4JA 2L7EA 3GXIA 3OBAA 1AXTH 3WUWA 5K93A 5DZJA 3GDCA 4XODA 5F1OB 2E9WA 1G87A 3ENEA 4LBEA 1LWRA 4JFZL 5EU7E 4FMVA 3HHSA 3TYGL 1KLUA 4P3DB 1OVZA 1EO7A 4GKNB 4WNQA 3U4EB 4HIIA 1LVEA 4Y5YA 4P59L 3RJOA 1NICA 2IGTA 5HJBA 3R19A 2DW5A 3MRDB 2OULB 1JGLH 3SY0B 4AGPA 4G6FB 3JWNE 2OMUB 3FT9A 3I02B 1OAQH 3W0WA 5HYJE 3F7KA 3T0EE 3MRKB 4TXVB 4P2OB 2IWFA 1U33A 1BQ5A 5JR1H 3LN4B 3QH3B 3MLYH 3GMQA 3C5JB 4XR8C 3SCMC 3MGTB 1D9KC 1RZFH 2ED7A 4YDVB 3QQ9C 5C1MB 3T2NL 2W60B 3MI6A 1BXUA 1XL4A 4P2OD 5KSBB 1SVZA 2BK8A 1AGEB 5I1CL 2Y1ZA 4FA8A 1G6VK 2IC2A 3FU6A 2OMXA 2BSED 3CPUA 4P2RA 3NACH 4J6RL 5DQ9A 4AEEA 2DQ6A 4ABVA 1S7WB 4N2GA 1NZRA 3OXSA 3DXAE 1JZ7A 4ZFFA 4NHUB 4KOCA 1KN2H 3TZVA 3MRCB 3BIKA 5MP6H 1FFTB 1QZNA 5CJQH 4LCWB 4NJ9L 5HXMA 3QI9C 1IFRA 1NQBA 4OZIB 2GAZB 2X4SB 1X5HA 2F5AL 5AQ0A 4EN3C 3ULUF 3BZ5A 4AVKA 3HZVB 2G2RA 4BDVB 1TCRA 1XIWC 4GAAA 4K9EC 2JTYA 3FYIB 5TDNB 5HJDA 1GKOA 2X89D 3TA3B 3EYFA 1OGAD 4NUJA 3C9NB 4HETA 1F45A 5FHBL 4KK9D 2OI9B 3C6LB 2CG9X 2O6PA 2V5RA 5DRWA 3WY2A 1XGTB 4ERSL 2NY7L 2Y7QA 1T5KA 4UINL 3P4MB 4XVSH 1YEKH 2R4RL 5D1QA 3SKJH 2JCCE 4R7XA 3E2HC 1I31A 3O11A 1KENL 4HLZG 5ECGA 3M07A 5AUMB 3TNNA 2XY1A 2FB4H 4J3OD 3DHMA 4EJ1C 2H32H 1KIPA 5GGVY 4MMYA 1UD6A 3VW3H 4LDOB 2ZCHH 3C6EA 1HZHH 5TH2A 4FNPA 4L1HA 4PYGA 3S3CB 1R5VA 2JKJA 1YMME 3WXWL 1YY8B 4PJXB 4WNQB 1AS8A 1NA8A 5AL0A 2JJSC 3WN5C 4PEEA 4YHPA 4X6CB 2CLZB 2V7HB 3MV7B 5CAYB 1P1ZA 2LU7A 5AB1A 1I8KA 2DIEA 4LLDA 1BQLL 4GFTB 4ZUUA 3DC0A 1OY3B 4CMHC 1GRWA 2GITA 3NIDE 2PYEB 5I8EA 4UTBH 3FC8A 1ACYL 2CH8A 2WXGA 3BWZA 5DFTA 2XXGA 3W1ZA 3Q0HA 4NN7C 5G55A 5DJXB 4F33B 1NLDH 1ZA6A 3D69A 1FL6A 4L5FH 4RZCA 4FS0A 3SQOL 4BCXA 4OCYL 1JZDC 4HWEL 1C5DB 2W9EL 4NBZB 4WJ5A 3WS6A 3JWDH 4UOJA 3A67L 3AABA 5DRNA 5B7FA 2UZIH 1GPOL 2HFGH 1PG7W 4N8VA 1NMCB 4Y2DC 4CMMA 4NNPH 5DURB 2G2RB 2J71A 3OLEA 3VTTA 1MW0A 3ZL2A 4AC4A 1R3HB 3H2WA 3JTSA 4MHHG 4KNQA 2YIHA 3FU7A 1HVXA 4TNGA 5AW7B 4KKQA 1CDCA 5DURD 3EYFB 4PCSA 5AZEL 4A66A 1DJGA 3CSBA 5HYJB 1KCSL 4FLQA 3T0EB 5KYUB 1ZXQA 5ACLA 4OLUL 1EDYA 3FUDA 3NGBC 4IDLA 3F62A 4GO6B 4WRLA 5HYJD 3UH8A 1XB6A 3PHSA 4YSEA 3T0ED 2OMZB 3BN9C 3E38A 4P57B 5D1QB 1S9KC 3ELQA 1RV6X 2FT7A 3DBSA 4H8HA 4KV5F 3FUEA 3TNNB 2AXFB 4QGTA 2YMOA 5HYSG 3BZEB 4FNTA 3QRGL 1N3NA 4J8RA 4ELMF 1AE6L 3MTRA 4G7QB 5CHNB 2GTZB 2L3BA 3TBSA 3MNMA 4D9LL 4WFGE 2EVJA 4NZJA 5AVSB 5CMAB 3DXAB 5TH2B 1R5VB 1RIHL 4PGEB 1H5BC 4YDIH 2VISB 5CCGE 3T4YA 5HI4C 3DXAD 3MFFB 1YAZA 4IK6A 1EFXA 1ZANL 2HFFB 4GQ9H 1KTLB 1MRCH 2DIJA 3GUTB 2WUCL 3JQOB 1ED3B 2XZCH 1P1ZB 4NKOB 3TN0C 3R4DA 1NAMA 5JDSA 3FT4A 1DQVA 5DI8B 4ZUSA 3ARZA 1YN6A 2PP7A 3FRUA 1KIUB 1SJEB 3ZGHA 2PW1A 1CDHA 2XSKA 3DX7B 1YEGL 5FA3A 5I8EB 2R2HA 4LK4A 2OMWB 4XBGA 2JKRM 3HI1B 5GSVA 5I1AA 3EGXB 2WVVA 1BF5A 4ZO9A 1AANA 1ZA6B 1UOKA 3D69B 2GQHA 4JEGB 3ZL4L 4DTGH 4OJYA 1EJOL 1J8HE 3L4XA 5DHXB 4ZTEA 5FXCH 5I18H 5BVJB 5I8OH 3H9SA 3ECUA 2HP4A 4MKTA 4GRLC 1AH1A 2FECL 1KIRB 2RGSA 5DJ2A 2VXTH 1X44A 2W65A 1YMMB 3EBGA 2BINA 3NFNA 4IIQA 4M8VA 3VXUE 1JV2B 2ERJB 2H1PL 4LLUB 4ADIA 4CMMB 2IPTH 2FAUA 4NKMB 5CLYA 2O6CA 1YMMD 3QWRA 4L9DA 4GP8B 1GY1A 2FT8A 3DVIA 3FUNA 3BUYA 4JRXD 5LBSH 1CCZA 4OI7A 4NDMB 1P4BL 3SD5A 1D5MA 5LXGL 5A2AA 3JVFC 4ENEC 3U6RB 5KBDA 2XZAL 1SEQL 1W72A 2Z0UA 5FHAL 5EU4A 3S88L 3GRWH 2FATH 3LEXA 1P7BA 4L2YA 2FX8H 3CLEH 4X0KB 4AJVA 4HOZA 5LAPA 5JLZB 5DRZB 1Z7JA 2JSFA 5ESAA 1S7RA 5CEZL 1UG9A 2WBJB 4BIKA 2BRQA 1B4JH 2ZG1A 4IS6A 1HC1A 2ARJA 3IDUA 4KTDL 1LLAA 3V6ZA 2ZX5A 4M1GL 4UILL 1LILA 4PCTA 4QYOA 3A0OA 4OJFH 2HUHA 2PO6A 4NIYE 2B1AH 5KVFL 5F3BB 4IU3A 35C8H 2BCKA 4N8PA 3DPDA 2I07B 1SPDA 2P7TB 5FYJU 2CDGA 2M26A 1AGCA 4GI8A 5IMKA 3BO8A 4X6DF 4CBPA 1CD8A 3AC0A 3QCUL 4ZUSB 1LDPL 4FL4C 3S98A 1RUKL 3GSXB 4KMLB 2G9HB 4UWQB 4MCMA 4LIQH 1ZHKA 2DYPA 4N26A 4M5TA 4OZFG 2YOCA 4GIPD 4XMKH 3FNKA 1FZOB 1PD1A 3O3UN 4KAQL 3M88A 4FKHA 4XI5C 3VNYA 1YEFH 2V7NB 1I9JH 2HN7A 1KTDB 3QJUB 5F88A 1NOFA 4EO5A 3WNJA 4YHOL 4Y5VC 1WQVT 4O2CA 1FGNH 4JHWH 3PWPA 2DQDH 2P5WD 5DA0B 4BK5C 4A55A 4C56B 1KCKA 3VFGL 2XJKA 1IKFL 1E9QB 1TZGH 4GS7C 1QABA 1W0YT 1PYWA 3FQNA 4JM4H 1NLBL 4WFGD 1ZE3H 4BFFA 4DGIL 3PGDB 5KSAB 1NDGA 3NCJL 3APDA 1CMOA 3FQ4A 2K6ZA 4FABL 4LSVH 5A2CA 4KNSA 3QA3A 2P80D 4Y4KA 4XOAA 4TQIA 3O2DH 5E2TH 4DCQA 5D7IE 5GGVH 4Q9BA 3V0DA 4E41E 1DBKL 1K4DB 3CVCA 4GAGL 2Y3NA 5DHVH 5LAXA 4XOEA 3ETSA 3RZCD 5EF1A 4PBVC 1J8KA 1U8OB 4WO0A 3D30A 1UQSB 2Z7UA 2YQ2A 5FA4A 4ZTOH 4IBLT 4K7PL 1IGML 1AHKA 4U1SA 4JHAL 1IBGH 1JV5A 2EE9A 4R0LA 4IMLB 3QS2A 1J5IA 3RVTD 3K6NA 1OD7A 3KBFA 1K3IA 1SVCP 1J8HB 1GYVA 4ABUA 3HBZA 2BC4A 2YC1B 4W68A 4NBYB 2NSXA 4GKSB 2HX7A 4WUKH 4Z1PA 1H6FA 1FO0L 1PFCA 2UZPA 1E4XL 3GSRA 2G0LA 4QRQA 5L9DL 3EJSA 3QZLA 3ZRSA 4MA1C 4OGQC 5DZAA 3LZRA 3QWNA 3Q1SH 2CDGB 2HUEA 3HZKA 3T9WA 2W81C 1RSYA 2EYTB 3C2AH 3VXUD 2EXYC 5IMKB 1C08B 4APQD 5IV2A 2EKSB 1CDGA 2KZBA 2NY5H 2HRGA 2ZKYA 5KBKA 3AS3A 3B7TA 4GXUN 4QRBA 4QYAA 3ZRFC 3KEDA 4E9XA 1UJ3B 1GY2A 4HDIA 2DYPB 1LHZA 3NT0A 2QZ5A 2D0HA 1AR1C 4I48A 4AVHA 4AQEB 1G4RA 1KXVC 2MOQA 4XXDA 3HIZA 1PU0A 3TIDA 3RTQA 4S11A 5JORA 3STLB 5HP5A 4X83A 1OP9A 3L1EA 1E65A 3A47A 4OLWL 2FZ3A 4MKMA 4LNRB 4KRMB 2H2PC 5L0QC 2QT6A 1IRAY 3LMJH 1XCWA 4ZAKA 5JO5B 2G2PA 1DBML 4PJ8A 4A2HA 1N0XL 1Z3RA 3AG1B 5GRXG 3QUYC 3FQNB 2OR9L 3WUWG 3DYOA 4V2CB 1OM3L 3BSHA 3ESPA 5JQIB 1NEUA 3HC3L 5JXEA 1OF2A 2HAZA 3SDAA 4ABWA 4B96A 2QJDA 4ONGL 4BXSV 1KCLA 1OV8A 1MH5A 4MX7A 4X8CA 3US1A 2CLVA 1QA9B 4B97A 4JN1H 3OZ9H 4OZGF 3TM6A 2QGEA 1MLBB 4QT5B 4BUHA 5KZCD 5EZIH 3LEYL 5IGXL 2G3XA 4XMXA 1C5CL 3OQ3B 3TJHC 3ZHFA 1F11A 5LKNA 3AB0C 2GC4C 2CLRA 4A37A 3DROA 3O6KH 4QWWD 1DBBL 1A4KA 4G8FB 3T2PA 4ZW5A 3T1WA 1LXMA 4BUQA 3G6AA 3FOLA 2W9DH 1B2WL 3C8KA 2E8YA 2J44A 2FUTA 1A5FL 1IC1A 1G7LA 2MFNA 2AXGA 3DX6B 4ICWA 3GJFH 4J12A 2CK0L 4RSVA 3RWDA 5IY5B 2FQFA 2BP8B 1U30A 2UWEA 3QUZC 4BK8A 3GSOB 3ZDWA 2BC4B 2R2EA 5I17B 1KELH 2Y24A 2XZQH 2ZTBA 5DYFA 3ZE1E 5JQHC 1A9VA 4JK0D 4L4VA 1R1CA 3HG0A 4HHWA 1E6JH 4DKFL 3BWUF 3HAEB 4NN5C 1BEYH 2DEWX 5I1IH 5IKCB 5A2LH 2PR4H 3ATAA 5CGTA 2VQ4A 5B1BB 1ZHBB 2WY3B 4NO0B 1K85A 2CRYA 4NQEA 2LTQC 3O45B 2IOMA 4BE6A 1M7XA 2FHCA 5C8JA 5D7IB 1O5DT 4MAUL 4F8TA 5K9KA 1X6NA 3RA7L 3VRJA 1KJ2L 4NO0D 3DK2A 4PB0L 3QPXL 4MAYC 2AJYL 1NWPA 4NX0A 3MUJA 1OE2A 4E41D 4H0IA 5SWSE 4XMLL 1KB5L 1Q9KB 2A74B 5EHFA 5FV1L 5J7CC 4QXTA 3VNZA 5JORB 1AGBA 5C0IB 1U8HA 4AIZA 3CTTA 4PS3A 3QNYA 4LP5A 5C97A 2D31A 1YA5A 1RERA 4L0ZA 5E08L 3N1QC 4IRJC 1RZKH 3UC0A 2RQ8A 4PJ8B 1JGDA 3IPBA 4P23D 1KXHA 1O7VA 1XGRA 4FFVC 1E2VA 3TYGH 1QHOA 3X3GL 3L5HA 3GMNA 4QHPA 3U0PA 1PIFA 1TETL 1QTYT 2CLVB 4HBCH 1FNGB 3QO1A 2APVA 2NW2B 2OXHA 1UENA 2BXZA 2XVKA 4KK5C 4FG2A 1DVTA 5DSCB 2XFXA 2EO9A 5T3XL 1O6VA 3L13A 5EBLA 4K94H 1VB9A 4L3AA 3RNQA 5DMYA 1Q8MA 2C9XA 3DROB 5IW6A 2PWHA 5D72L 1FH5L 3PWNB 1LE9A 1W6LA 3T2NH 4PJDF 3SJVE 3I6SA 2PETA 4U6YA 5T1DL 3S2CA 3QAZB 3N42B 3VXPA 4RMRA 2FWOA 4J6RH 3L6FA 3HEIB 1MPAL 3H0TB 4PJAF 5D4QA 2FNWA 1TTAA 3V8OA 4LT7A 1T0NA 3U9WA 3WFBH 4FYRA 2R2BA 4YUEL 1TLMA 3BPOB 43C9A 4XP1H 4IBYA 4NJ9H 4HKZA 1XCTB 4JG1H 3K0WA 5DRXB 3STZA 4MS8D 2JELH 1F3RB 4YR6A 3QNXA 4EKJA 2F19H 2B2XL 3HG5A 5MEOA 2CM6A 1WZKA 2R1XB 4W9LC 5IJCC 2FWLB 1E90A 3LNIA 2FGZA 3DX2A 3ECBA 4OUUB 4R83A 4PREB 2PW2B 4Y4HB 4XCFL 1PNDA 2E7LC 3GSVB 5DJ6A 4C4UA 2XWTA 4N0YL 4ERSH 2NY7H 2IFFL 1EVTC 4UINH 1N0LA 1U36A 4Y4HD 5DJDA 4ZFGH 1MZZA 3BEWB 4JGUA 1MCDA 1E4JA 2KQMA 4NKDA 1P7QA 4CGUB 1QASA 2GHWB 4L05A 3LKNA 3LHPH 5FYJE 3L3DB 3SPCA 2WZ5A 1RJZA 3ZKSD 1T1YB 2AJ3A 1KDJA 2PPAA 3S3DB 1HWGB 4UM8B 5I6XC 3VFWA 1ADQA 4IU2A 1XGRB 4CSSA 1HHKA 1D9KD 1NCAL 1T2QL 4HCRL 4JY5H 1F2QA 2EEDA 5A2KH 5CCJA 3IFOA 1QFHA 3LZOA 3KPRB 3GUFA 1VFAA 2YD9A 4ODHL 4NQCA 4DZ8A 3LH8A 4C47A 1DVFB 4A38A 1EDHA 2P24A 3EFFA 4GXFA 1BQLH 4KOBA 1URLA 2HFEB 4Z0XA 2XFXB 4B9PA 2A9MH 5EBLB 2QVKA 3W57A 2Z0BA 3VGBA 1A1MB 4OKDA 3NRQA 5AKTA 2VL5A 3AY2A 3QI9D 1ACYH 5JNYA 2CU9A 5IOKA 2XIBA 4JB9L 4HGMA 5SWSB 4EN3D 4L0PB 2D9QB 5KS9A 3C5ZC 3SQOH 4A68A 5FO2A 4P2AA 2FWOB 3IGAB 5I1GH 4L4TA 5DVLA 2XVLA 1DZBA 4HWEH 4X4XA 3MNVA 5I75C 3MJWA 5DDHB 1T0NB 2BVOA 2AAVA 1WGVA 2XWJA 3V4PA 5J1TC 3DA0A 1DO5A 1IV8A 5E5MA 2FHBA 1OP5H 3A67H 3IU3A 1D7BA 4W9ZA 5DD1L 5FW7A 3BISA 4K3DL 1BW8A 5CNHA 3DTXA 2XIIA 3TONA 2WIMA 4XPAL 5ETUA 3Q2LA 4OI9A 4HZ1A 5INCA 3HG4A 3O3EA 1PAMA 2WNGA 3EYOA 3BKCL 5I0YA 3UP1A 1R46A 3EJYC 5AZEH 3AS2A 1QI5A 3LQZB 2AXWA 1J0IA 3DRTB 1HESA 2J1WA 3KPOA 3LPPA 1VGEH 4OLUH 3QEGL 5CJBA 2PPCA 2WUBH 4ODSL 2O4EA 5IOPB 2VLLA 4AJYV 2V2WA 3L3OA 1FSKB 4PS4L 3SJVB 2LLLA 3MXWL 2WGXA 4LBAA 2O61A 3QJFA 1WA2X 3F6JA 3QRGH 1RJZB 2YUVA 2EDBA 3IDMA 4NQUA 1AE6H 3I2CH 3SJVD 3IMSA 2XZZA 1MEXH 3C6LC 5F9OL 4ZX4A 4QAMB 3F8UB 1MHHA 3VDBA 3DWTA 4FQ2L 2HLAA 3HS0C 4JW3A 1RIHH 2MQ0A 4KZCA 4XP6H 1HK6A 1KT2A 1MFBL 2VT0A 3KS0J 1FA4A 2OL3B 1DZ0A 2JTDA 2MJWA 1ZANH 4F92B 1YNLL 2EYSA 2WUCH 4NQCB 4R7VA 4DZ8B 3V0VA 1DLFL 1U95A 3TASA 3LXCA 1WZ1L 1ZRUA 2BWIA 4HP5A 1EDQA 2P24B 2PTVA 4E0RB 2F5BH 1I1RA 1P6WA 4RGMC 4X7CC 1LK2A 4MJHA 4BRVA 1OTTC 5LWYL 4NI6A 3HMXA 5JIIA 4LMQI 5TQ0H 1HX0A 3CXHJ 1YEGH 4B9ZA 3T77A 4Y5YC 4ODWA 4Y2DD 4Y4FB 1ETZA 3ATEA 3TO2B 2VJXA 1R5WB 1SJHB 3ZL4H 4Y9FA 1EJOH 4X5XA 5DVNA 3WDHA 4Y4FD 3PWJB 1OB0A 2AVFA 1EGJA 5FYJD 4YDJB 1ZLDA 3V9CA 1DQLH 4GQQA 1Q0EA 3GB7A 1J10A 3OX8B 3TEYA 4YK4B 3ISWA 2IDTA 3BEVB 2A9AA 4I18B 3OKNA 3CXHK 5F21B 3U0WL 3MLZL 4KX7A 3AZUA 4PW4A 3BAWA 2DB8A 1WFIA 3BE1L 1N26A 1F6FB 3V5DB 4YZWA 2YBRA 2XKNB 2D73A 2ATAA 1EHLH 1P4BH 4RMQA 3DHUA 5IESL 3TZVC 5HYEA 1WK0A 3KPOB 5LXGH 5AB2A 5CKAA 2YD4A 1LTXA 3QW9A 4QXUL 2XZAH 3KE0A 1SEQH 4BQCA 1F0LA 1MHCB 5FHAH 3S88H 2KBGA 3GZOA 5ABAA 1PZSA 2K6YA 4YDLC 1TQCB 3IAGC 3QO0B 3WTTA 2Z4TA 3PAUA 3TH4T 5D96C 3VGFA 3TN0D 2APFA 2WLLB 5MEQB 3LY6A 5CEZH 1LE5A 4K7FA 1YQ2A 3SE9L 2Z65C 2PXYB 3ARWA 2D7OA 4I8DA 1IZJA 4KTDH 3CFQA 1GGYA 4EVNB 4M1GH 2MSPA 4UILH 1VA9A 4ZMNA 5T3XD 2PXYD 3OB0K 1JNHA 5D1QC 5SV3A 5KVFH 4FFYA 3SKNA 3QQNA 1Y18B 3C09B 3UXFA 1I1AB 1UXSA 1A6ZA 1BXXA 1IZKA 3Q2CA 1IE5A 3LXUX 1MFDL 4N68A 1I1AD 4A7QA 3QCUH 6FABL 4NENB 1LDPH 3L3KA 4YSRA 1RUKH 2YPKA 5CCKL 1BXAA 1PZ5B 2IAMB 1JCKA 1UWGH 1LO2L 2Q3AA 3MV8E 4GRLD 2VERA 5ADOL 1I9IL 2C5DC 3Q8AA 1XF2A 1MFUA 2R1YB 2VZUA 3MJ6A 1ZTXE 5I1EH 1PGRB 4MJIE 5TD4A 1BFOB 1ZVSB 4YHOH 3LS5L 4AVIA 3GO1L 1UT1A 3NCBB 3FTGA 3N40F 4JJOA 5IEHA 1U91B 2ZXWB 4AQAB 4UF7C 2MKLC 1M56B 3E6HB 4XRCB 1URIA 2IAAC 3WI9A 4YHYC 1RPUA 4ENED 4M5ZL 1NLBH 3HE6B 4DGIH 5KG9B 3P4OB 5K9QI 4F7TA 2V5SA 4FABH 3EZ8A 2OJ1A 1IKOP 5KYYA 4NPYB 3MBEA 1U3NA 4PTUB 1TQWA 4JQXA 2NT0A 4GW1B 4ALAC 5J1AA 1JXGA 4MJ6B 4LCCB 1LDSA 1DBKH 2HJKB 2PPEA 1JZEA 2QHRL 4NZRL 5D4IA 2EDOA 4XZ4A 4ZS7L 2E74C 2WLYA 2YQGA 3KH4A 3MROA 1E4KC 5H2BA 3GNMH 3QDMA 4UAOC 2EXWD 3IKCA 1UM4L 3RAJL 5LLIC 5I8CB 4M6MH 1THCA 1CTNA 5K59F 2ID5A 5HYIA 5EUOA 2OJEA 4FFZL 3RWCB 1V3LA 4QXGL 2FO4A 3KYNA 4Z7WF 5CIPH 3ZTDC 2JMRA 3E1ZA 3D0LA 3KVPA 3BP7A 2W88A 1MCPL 1U8NA 1RJYA 4ICXA 4KJYA 5L9DH 3UO8B 2A38A 3NSXA 1NKRA 5D2LE 2J8UF 1S7SA 4B9KC 4XI5D 4P2QE 4C83B 2EICA 1JGUL 2PWFA 3T1FA 1T04B 3IJHB 3VD9A 5E9DA 2YD7A 3JV6A 3VH8A 2R69L 4LNVA 1FZKB 3HG2A 3TBWB 2VMFA 3U2JA 4JFXA 4M5SA 5DYOA 2ZCKL 1AC0A 4HJ0C 3ZDZE 4PAZA 1ITCA 3GPSA 4DAGL 1S7VA 3KG5A 1J8SA 5T1LA 2Z8SA 3RX8A 3TWCL 3KWWB 4P3CH 3NDZE 1PDKA 4KY1L 1ZLSL 3VX0A 1IX2A 2AEQH 3ATFA 1UT9A 4OLWH 4BFEA 1AHWB 5J56B 4MXVE 1R9FA 2CHZA 3UPAA 5AZ2L 2VSMB 3TBYB 4NKIH 1DN2A 5DK2A 1N0XH 3FFCA 2OR9H 5HHOA 1J1PL 3C87A 4JGMA 1IL1A 1C5BH 5AEAA 4F7TB 3VFVB 4YOKA 4ONGH 1MRDL 4HLJA 1EXUB 2ZT9C 3LRSB 3L3IA 5KAQF 3BXNB 1FVDA 5IGXH 4XO5A 1C5CH 1F3DJ 1WD8A 2XPZA 2Y36L 1FFNA 4IIQC 4MQ7A 5E8DL 3MV8B 5H2BB 4OBRA 4HZLA 1G0DA 3QDMB 1D2OA 2FL5A 2O26U 4LPVA 1DBBH 1FBIL 2FEEI 4XBMA 4F7PA 3OMAB 3PV6A 1YEIL 3PFUA 5JW3L 5C3IA 4MJIB 1SXZA 4DFIA 2CK0H 5EUOB 5GRUL 2VTFA 2YKLL 5J11C 3MRLA 1PKOA 2AXHA 3NA9H 4PRHA 2IIJA 2BOCB 4Y1SA 1AZBA 2JIXD 3V4VA 1R5IB 1M71A 3U1QA 4OBSA 5F9WC 1U8NB 1T3FA 4KJYB 8CGTA 1OCZB 3NEXA 3ZL1A 1AR1D 3LNFA 3DMMC 2CCLA 2ED6A 1JK8B 5JPNB 1S7SB 3FQXB 3K6IA 1XF3A 4FCAA 3X12A 5IQOA 4LF3B 1ZDQA 4PVNA 4I0PB 1ZSDA 3P54A 4MAUH 4XN9A 3AQYA 2H2PD 3FB6B 3RU8H 2XPYA 3WNLA 4KI5E 4HCIA 5C3TA 3VXRE 1KJ2H 4PB0H 3QPXH 1E5UI 5DYOB 4KZEH 1CDJA 2RCSH 2PO6C 4NBXB 2AJYH 1MG2C 2PCXA 3G5XA 1MWAB 3K4AA 3QUYD 3GMOA 5L4JA 2EH7L 2Q7AA 4K07A 4MB5A 5T1LB 3BPCA 3KGSA 3QULA 2TRHA 4G80B 3D3VA 2YXFA 4PJ7E 1HSBA 1KB5H 4JBSA 1PDKB 5CLTA 1MY7A 3ZZ1A 2FQDA 3C5XA 3ZTJH 4B3VA 5C09A 5D7LA 3OR7A 3ZE0F 3QQXA 2Z7YA 3ZY7A 1UA6L 2VQ1B 1XDTT 2XG5A 4BWUA 2X4UA 2VM3A 4NLHA 1CR9L 4I77H 4Y1AE 2WTRB 4OZHF 4ODBD 5F9JB 3P9LB 4H8VA 4NSKB 5EU5A 1DLHA 4DGYL 4UZUA 3ZQWA 3X3GH 2E76C 5EEXA 5D2LB 1TIUA 1TETH 4MMXA 4HJGB 4P2QB 1BBDL 1NDMA 3BP6B 4PRAB 4I7ZC 1JXJA 4JLRB 1E5CA 2F53E 3L4VA 1UB6B 1TEYA 2OMVA 4TNWF 2ZUVA 3QUZD 4PRDA 3D85B 3PIQA 4JAMA 3VSUA 4WWNA 2KPWA 1Z5LA 1SUJA 2FL5B 3ZDZB 4IKNA 2EDFA 3D85D 1SDYA 1FH5H 2Q8AL 4HD5A 4F7PB 4NQSB 4XCNB 4Y4KC 5T1DH 2WXOA 1KMGA 2WQRA 1AS7A 1AO7A 3KM2A 2BSSA 4LGSB 1CU4L 5TDPA 1MPAH 1CLCA 3V9FA 1JF1A 1XGQB 1CF1A 1DDHA 3GDBA 3MV9E 1WVZA 4P9ML 1KGWA 3V4VB 1FORL 1BZ7A 1Z1WA 3O8XC 1SMOA 4YUEH 4PM1A 3ZKMC 2RB8A 4IBZA 4NNXB 4PU2A 1HH6A 5CFHA 3CH1B 3SODB 1F4HA 4LHQB 3HG1A 4R0LC 2J6WA 5HHXL 3BRFA 1QBAA 4U1HB 2B2XH 3O4OC 1VFBA 1OQXA 4N0RA 3QFJA 2ENPA 3WELA 5KJRL 3ASNB 4TVPL 4LARL 4N6QA 2Q20A 4XCFH 1JN6A 4U3CA 3WMSA 2J1ZA 4N0YH 4A7GF 2IFFH 3OHMB 4N6RA 2C1OA 5IWLA 1OCCB 4U6HA 4MA3A 3ROLA 3ZYOA 2Z64C 2WLNA 4PJIF 4FFVD 1NGWA 2KZ1B 4EI5A 2W95A 5C09B 4JANA 2HT4C 3ILPB 5IQLA 4K7PX 3OLDA 4LL4A 4XHJC 4MJJA 3H9HB 5FGSA 3S96B 5EU5B 5HHQA 1RY7B 1DLHB 3QCTL 4YPJA 4DP6X 1NCAH 1H3VA 4HCRH 4PIBA 3RTQC 4PW9A 3HTLX 4IW4C 3KPQB 4MMXB 4ODHH 4PJHF 1MNNA 1R3KB 4MHHI 1A9EA 1M2OA 1MHPL 3FO1B 1XD1A 1AIFB 4ZAKC 1QR1B 3MUGA 3UMNA 1E6OH 2J5LB 3CFDB 2YUXA 4H2CA 3VXRB