1OK8A

Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
394
structure length
380
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR ENVELOPE PROTEIN E
publication title Structure of the Dengue Virus Envelope Protein After Membrane Fusion
pubmed doi rcsb
source organism Dengue virus type 2
molecule tags Viral protein
total genus 68
structure length 380
sequence length 394
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ok8A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1ok8A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1ok8A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1ok8A03
5LBSA 5JHMA 1TG8A 4GSXA 3C5XA 3N40F 3IRCA 2HG0A 2I69A 3N42F 2GG1A 3UAJA 2R29A 3I50E 3N43F 1URZA 4UTBA 3C6EA 4AL8C 5H37A 1Z66A 4GT0A 5KVEE 5KVDE 2JV6A 3UC0A 5IZ7A 3N44F 4AM0Q 5LBVA 5LCVA 1UZGA 4FFZA 1OKEA 5KVFE 5JHLA 4L5FE 2JSFA 4FG0A 1Z3RA 3P54A 3UZEC 2V33A 4ALAC 5IREA 4BZ2A 5AAWC 2H0PA 2ALAA 5GZNA 4UTAA 3UZVA 1SVBA 1RERA 2JQMA 4UT6A 5KVGE 1PJWA 4FFYA 3UZQB 3N41F 4UT9A 3VTTA 5B1CA 3J27A 5GZOA 3J2PA 5AAMC 1OANA 2R69A 3UYPB 4UTCA 3WE1A 1OK8A 3MUUA 1ZTXE 4BZ1A 2P5PA 4X42A 3G7TA 1S6NA
chains in the Genus database with same CATH superfamily
4QRRE 3QFDA 4XP4L 4JY4B 3ZKMD 1VADA 4O02L 1GAFH 3ECUA 3PQYD 2BO0A 2C3VA 4PCKA 3W38A 2JJWA 1KNOA 2J73A 3A3YB 4QHUA 4LAJH 3VUAA 4AGQA 4XP6H 1WFTA 4TQIA 4BGLA 5FO9B 3VD0A 1DLFH 4BCXA 4K7PY 1P7HL 4DN3H 3S3CB 4E5XA 1ZE3C 3FKUS 2NY3C 5CFHA 4OJAA 4FNLL 3RUGE 2R27A 5K9KA 4NNPL 1W0WB 5FYLD 5B22A 3PWUA 4HK3N 3EJZC 4ZNEA 2OXGA 4L4VA 1CFVL 1TLMA 5E1IA 1O9ZA 4M7JH 1I3RA 2QQKH 1TQWA 2IAMC 4IU2B 4JB9L 4WEMB 3PXHA 4JN2B 5JLZB 4N0FB 4Y5XC 5BUAA 2E7DA 4KRMB 2XTJE 4HH9A 4Y8AA 4R5XA 2O61A 2AITA 2JV6A 1ZGLB 1DEEA 1MCOH 5D2LB 4AM0Q 2ZYIA 3QWOA 1A7NH 3SD2A 5KANI 5DT1H 5CS7A 1AS6A 1NPUA 2J8UF 2WMPA 4KGJA 1CFSB 4MYPA 4PY7B 5DYOB 4AT6A 4IMKA 4YVNA 1BJ1J 1WWWX 2DM3A 4PGDB 1G7LA 5I0WA 1WZLA 3R4RA 5CBEA 5DQDL 3IDIB 5DI8B 5ALBH 4HDIA 5B3JE 1X9UA 1KB9K 1XEUA 4Z8FH 1GHFL 4GPVA 1ZA6B 4CU7A 3CCHB 4UTAH 3LZFH 1I75A 1QEXA 3VXRE 4ZAKB 5DHYA 4XNBA 3MGTB 2XBTA 3QUXA 3G5ZB 4FFWD 5FHAH 1E4WL 2XBZA 4P9HH 5TQ0L 3VCLA 5E08H 1IIIA 1YAZA 3PAYA 3V0GA 4F7CB 5CEZL 5T1DH 2EDHA 5HDQH 4X9YA 2OJ1A 1FVCA 3OAYH 5E94B 4CSPA 1PFOA 4HIXH 1UCBH 4LCWA 2VZ3A 5DYFA 4HK3J 2YA1A 3AXLB 1WFOA 3NCXA 1IAIM 5AW0B 1MJ8H 2OYMA 2PWHA 3DVGA 4PLOB 1H0DB 4LCCB 2EZ0C 3OKLB 5J6HB 4LQ1A 5IESL 2I85A 1G7IA 3K2KA 1PAMA 3C5JB 1IGIH 4OGQC 5DHVB 2FNWA 1R46A 1JSYA 4P2OD 1U92A 2EEDA 4PPTA 3UG3A 3RVWC 1ASPA 4MJ5A 4KTDH 2HG5B 1G9NH 3SE9H 3MJWA 1FNSH 5JDSB 3CFIC 2VKXA 2UZPA 1T4KA 3O9WA 1MWAA 4G7YL 3L3IB 4I7ZC 4OD1H 2BS8A 1KXVC 4YDJA 3US9A 1X5HA 2BP8A 4WU7A 3W2DH 5E4EB 3B56A 3O6ML 5HI3D 2CCWA 4HWEL 3FH5A 4JANB 4LSPH 2Q0ZX 1WD8A 1LTXA 5MEPA 2DLGA 1IGMH 3GT6A 3WLWD 3N06B 3BPLB 2NPLX 4HHAB 3DTXB 4IBYA 4Y2DD 3T77A 5JXAL 3IGKA 3U7YH 3U6XA 4X8XA 3UMTA 4ABQA 5J5EA 3BQUA 3G9AB 4QHLA 4Z18A 3WKMH 3GSNB 1NBYA 3VFMB 4AL8C 4J4PA 5DA4A 3VXRD 4Z23A 1INQB 1U91B 4WNQB 3GS4A 3SOBH 2Z92A 5AVTB 2PR4H 4P23B 1MZYA 4FA7B 3S36H 1UB5B 3ZY7A 1TQUA 1OAKH 5DVLA 2X4QB 3QULA 3VH8G 1GYUA 4TL5A 1KPVB 2W92A 5B21A 4ENEC 5HPMB 1A02N 3RBGA 2OW7A 5LAXA 2GEEA 1MI5D 4LKCB 1G1KA 3U36A 4S1RH 4KJYB 4APXA 2D3VA 3DGCR 4JN1H 3LOWA 1E8WA 3MQIA 3X13B 4DEWA 2ZUVA 1QA9A 2XBDA 4R3SB 2E27L 3NJKA 1RUQH 3BUDA 1ADWA 2R2EB 4U1SB 1Q1JL 1PF3A 4IHOB 1IC0A 4GG6B 2BVPB 2FJSA 4AZUA 3LKNA 5KSVA 3V7AE 3ML9A 3D06A 4X6BA 1KPRA 5GGRB 4YEFA 3BUYA 1E7UA 2E7BA 3B37A 1LGVA 2EDYA 5F7UA 3C6LB 5KSBF 1KN2L 4TQ8A 1N59B 4MNQD 3V8CA 5F88B 5FM4A 2G60H 2H3KA 4ZSOE 3QDHA 4X6EB 1XF2B 3AWGA 4Y19E 1TJMA 2VJ8A 1F11A 4F15C 3BAEL 3RA7H 3CU7A 4C83B 4TSBH 4U6TA 5DCCA 2I7OA 5D4QA 2BCMA 1ML0A 1N2RA 4UTCA 4W9EC 3I02A 1J11A 4EUPB 4ZUVB 3MUUA 3HLKA 3L9RB 2AXFB 5KYWB 2OI9C 2OCJA 3G6DL 4QR7A 1OP3H 3SPHA 4AZ8B 1UXWB 1SQ2N 3FH8A 5C0NC 1Q0YL 4KNQA 4UZUA 1KIQB 1T1YA 2H26B 2UY7A 5HYFA 4U0RC 3P2TA 2RCSH 4P5RA 2PF6A 2VW7A 4RRPM 4AITA 3T08A 5AKTA 5ENWB 1MFDL 2HX9A 5IJVB 2N7BA 4LKXA 5DJCA 1LD9A 4M6OL 1DDHB 2YJQA 3GHPA 3KLHC 2Z0BA 1MFEL 2VTFA 3KPQA 3VH8A 3QI9D 2Z1KA 4YO0B 4G7RB 3VWJB 1HHHA 3LMJL 3E7JA 4O9HL 4XMVA 3QJXA 3WDHA 2OPCA 4JHBA 3L3KB 2ITEA 2XZZA 5F1KC 1TTUA 3TN0C 1KJ2H 2UVEA 3NP3A 3TCLB 1OD7A 1PW3A 3MR9B 1PQZA 4GQPH 1HK6A 3IDXH 4ZS6C 4WW1B 3L3JA 5L4IA 4N20A 4QTHA 4AKQA 1KB5B 1UEYA 3M8OH 2IANB 3MTXA 2VH5L 2D03H 3RG1C 1NCNA 4WFFE 3SBWA 1BSIA 2R9HD 2XI9A 4QJ3B 4GAJL 1CFNB 4NN6B 4EIZC 4U3HA 5ISZE 4ZX4A 1DL7L 3QUYB 5CNHA 1MRDH 3EO0B 3RNQB 5C07B 5KSUB 1INDL 1BEYL 2YMXH 3MV8E 1LWRA 1G7QA 1CXEA 4R4BB 4U7MA 5I6XC 1Z9MA 3DPDA 5L2KA 2NNCA 1YEFH 4A6YA 4PRHE 2F61A 5F9DC 3KD4A 1Q9OB 3DJ9A 1SF3A 4XGZB 5DMKA 4AM0A 5FCSH 2WWNA 1OM3L 2B59B 1OW0A 4NGHL 3BAYA 2CO2A 2CO6B 1BD2E 3DGGA 4LP5A 1L7IL 1V8HA 2UYLB 5LG1A 2VDLL 3CN3A 1SRDA 1XGQB 3B2UD 2NY5L 3AGVA 4L3FA 1AYRA 4MZIA 5J1AB 3Q2WA 3ULUE 3RZCA 1NC2B 1A9BA 4L0PB 3JWDH 3V5DA 2YA2A 1WGOA 1NC4A 5F71A 3ARSA 5FYJE 2JE8A 1VCBC 1N6QH 4P2AA 5DURD 4XMPH 3LNHA 4X8JB 4OGXH 2PP9A 1ROCA 4LVNC 3ZHKA 4KVCL 3TJHD 3EFOA 2OZ4H 5B1JC 5EZOL 1ZTXE 1I9RL 1LK2B 4NWTL 3G6JE 3K81A 1G6RH 3W81A 3IN0A 2X1WL 3H56A 4RWYH 1N8ZA 5C0BB 3WTYA 2HPOA 2MPAH 3FQWB 1NCOA 1TG8A 1P4BH 5D1ZD 2GAZB 1CGWA 5I16B 1JZJA 1U6AL 2FO4B 1DQVA 2F5BH 2XETA 3S8WA 5ACZB 3LHAA 4FJYA 4HUCA 2HLFD 2EE6A 5JQ6L 4WFFD 3WIIL 2PO6C 1DQQB 3KYMA 3DGDA 3RFZB 3NCJH 4FULA 1L9OA 3FTXA 5CR8A 3HFML 1EJOH 2OCCB 5ISZD 1FDLL 2XWTB 1FC1A 4I4WA 1V3KA 4L9DA 3JWNE 4NM8H 2DKMA 5LBSH 1JF5A 4Y9CA 2WIMA 4PJCB 3MV8D 4NI3A 1HSAB 4M61A 4Y1TA 4K5NA 2F7PA 1HWHB 4D8PB 4HWNA 1F58H 4NKMB 4PRHD 5HHVL 3L8QA 1T6VN 2GHWB 1G7HB 1S7TB 5F89B 5FA3A 1BX2B 3SO5A 1MIEL 4PJDF 3SYPA 3FQXB 3QHTC 3SHSA 3SJVA 4N0UB 5JMOC 1DTUA 1HE7A 1HI6A 1UZ6E 3BKYH 3E0GA 5IQ9A 1BD2D 4APQD 2H0EA 4A7GA 4G7SB 4WW2F 3WS6A 2KHAA 1UXSA 3QQ3A 4IRJD 3ULUD 3LQZB 4Y9BA 4AV0A 3VFVA 5BMFH 4TUKH 2Z7UA 5LQBH 1ASQA 4QT5B 1AKJD 4GEJA 3JTTB 3TNMB 2AGJH 2CJTA 2DL9A 5FYJD 4NEHB 4JFOA 4E9QA 5C0DB 4UDTA 4NENA 4N1CA 4C4KO 4S0SD 2GIMA 2ZWYA 1RCYA 3T6QC 1CXIA 3IGFA 4LB8A 1N4XH 1WZAA 3MV9E 3OKNB 3TBYA 3MJ8B 2GTWA 4BH8A 2DOCA 2DM2A 4HXBL 2BCKB 3IFPB 4PTTB 4PJXF 5IB1B 2KDGA 5EBWA 4LBEB 2OTWA 4KITB 3N85H 3UEZA 3ARBC 3WY4A 5T3XL 3L5WB 4BZYA 3DTUB 4JM2B 4UIMA 1DVFB 5HDWA 2NR6A 3ZIMA 2FQDA 4FQJH 3U2SB 1WAAE 1AD9B 2F54B 3RWJA 3KWWB 5HHOD 1YUHA 3FU7B 1A2YB 4HJGA 4J6RL 4PP2B 4XBPB 5I1EH 4E9SA 1U41A 3CXHJ 5I76B 5LVEA 2GTZA 1L3NA 1VEMA 2KPNA 3OR7B 5DVMA 5I2IB 4HJJH 2VLRB 4KAQH 4PJAF 4FHBD 4L23A 2X4OA 2CH8A 2IALB 2WXOA 3WIAA 4X6CB 2N7AA 3HAEA 2J25A 5DS2A 3QDJE 1JWMA 1OAXH 1E43A 2ZOUA 2XDHA 3U0TB 5A6MA 4K5LA 4AJYV 4BSVA 5D1XB 5F96H 3LZPA 3KCPB 3U9UA 1SF5A 1UH3A 1JCKA 4AEIH 1A4BA 3SGDI 4EI6A 4MA3A 1YNKH 5JXEC 4PLKC 1IFHH 1Z0NA 1T2JA 2GG1A 1ED3A 2H1PH 5DJAA 3VYPA 1USQA 1NSNH 3CFKB 4MAUH 4JKWA 1ES0A 4AGLA 3QHZL 4BFIB 3T2OA 4OCXH 2ADGA 1FN4A 4YLQT 3QEUA 4B9PA 4M8RA 3VGBA 1OP3K 1F4YL 3M1BB 3QUMH 3WIFA 3HZ3A 5LNGA 3PGCA 1UKTA 2AZUA 2E5EA 4FQHA 5ADOL 3MV9D 2GITA 4BRVA 5FA4B 3I9IA 5I73B 2CUAA 1A6AB 2D7OA 4OZGA 3KVDD 4FFZA 1WK0A 4PJ5B 4Q6YA 1DO6A 1G7JB 1D6EB 3IFOB 2UZIL 3SE4A 6FABL 1B0IA 4OZ4A 1GTFA 4RAHA 1YYLL 4UIKL 5F6IC 4P2YA 3DROA 5F6HJ 5T1MA 3MRNB 1HU8A 1ONQB 4BKLA 1O7VA 2FATL 1AGDB 1XZ0A 2PW1B 3QIBC 4J3OH 1HILB 1T22B 3FUFA 3UTPE 1XD0A 1UJ3C 3OHMB 4M8QA 2W5PA 4QXWA 2DWEB 3IB4A 3V55A 3GSRA 5JPNB 5CMAA 4CKVX 3W9DB 3A6OA 4Z7WE 5DJ0B 3BYTA 3QCTL 4X7FC 3RVUC 5A2IH 3BGMA 3O6FD 4NZUH 3WFHA 1USZA 2WLLB 3MXWH 1H6UA 5J56B 1EZLA 5GSRB 3BPNB 3HZYB 1YN6A 5DFAA 4RVBA 1AZRA 4HJ1A 5BS0D 2VDKL 4XMZA 3QDJD 2APBA 4FQQA 5IOPB 1RUPH 1GY2A 1UQSA 1MKFA 1BVOA 2F08A 4GS7B 1NCWL 3D34A 4QHUB 2HJKA 4WNSA 2EIJB 1E2WA 4GB9A 1HCZA 1ADQL 1ZKAA 2HVJA 3LB6D 4JPIB 4N2IA 1SXNA 4N3UA 4ONOA 2P26A 4XCNB 1KC5L 1RP8A 1NCCH 3IXAA 4WGWB 4BWWA 3AT9A 4ZMZA 2V5TA 3CHPA 1KELL 3PWUB 3TEZA 4MB1A 5IBUB 4XVTL 5E6IC 5D71H 4GAAA 5GJSL 3D4GA 4MJJA 1CFTB 1M9WA 1NTDA 2QKIC 2VQ1A 3TA3B 4M5YH 3ULVL 1P9MC 2A73A 3E2HB 2O61B 1IBGH 1EO5A 4M8UA 3BPCA 1DEEB 1E4XH 2R15A 4OBRA 3P9WB 4PRPE 1AGCA 2B3RA 2VC2L 3QWOB 4WI5A 4Y4KD 2J2ZB 3BVVA 2WMPB 1NCJA 2WN2A 4R84A 4AT6B 3TF7C 1M7XA 2HT3C 1FYTA 4OV6F 3BN9C 4NO3A 1S4IA 5FCUH 4YDLC 3SDAB 1HXYA 2QPFA 5C0GB 3MCG1 1H9VA 3ZTEA 3IGAA 3UAJD 4CGTA 3GUFA 3UTPD 4GAFB 2DMCA 4K9EH 2MFNA 5F97E 5SWSE 1MHPH 5L8JB 2WTRA 3QRGH 1J5HA 1ID5I 4XHJC 4YS4A 5KEZA 1KN4H 3QEHA 1UTDA 3WELA 1D9KC 2X88A 3P73A 2NY2D 5DRWA 4JQIA 3QQXA 3QUXB 1CGSH 1NCBL 1QLRB 2OP4H 3TH2T 5E0QA 4MX7A 5AUMA 1QZNA 3MLYH 1FVCB 4K71C 1KMGA 2WWKO 4LCWB 5BOZG 1A7RL 2W80C 2K6WA 1S8DA 1W0YT 4RIRB 1Q72H 5K39A 2BY2A 3A0OA 3CU1A 3GMMA 4LSQH 1P1ZA 3RY6C 1XMWA 5C1MB 1GS8A 4EZMA 3IU4L 5DZLA 1I1FB 3TPKA 2ZYSA 5IUCA 5K9JL 3WMPA 5J11C 1FI8C 1ACZA 5HYSG 1ZE3H 4N0RA 4XAKE 3IMBA 3BH8A 3P4OB 1BMWA 2HB0A 1U93B 4XNYH 2XN0A 5A2FA 1MJ7L 2AVGA 4BQ8A 4CC0A 2FLRT 3KMDA 5JIIA 2H6OA 3HC0A 4MQ7A 5I75B 3HE7C 5HHXL 4UT6A 4BH7A 3Q5YA 5FOBA 1KTLA 4F2EA 1W0VA 4ODSL 4IMLB 3HI5H 3O9WB 1SOSA 2BZ7A 4HKZB 5IB5A 2HUEA 1TEYA 3KPRA 1L9PA 1XD1A 1QLEB 1KTJA 3C5ZD 4KFZC 4PRPD 5FR3A 5CLXA 1G1YA 3JQOB 3R19A 32C2A 5DGQA 7CGTA 3HMXH 3T0EB 4PJIE 4CRPA 1SHMA 3VQLA 1X5LA 3UO1L 1BEXA 1TZHB 1AXTH 2VDQH 4MA1B 4ZUWA 1G9EA 4P05A 1BBDH 2YGNA 3KW7A 3RHWF 3AM8C 2AABH 3ARVA 1KGCE 2VW4A 2HRLA 5TFSL 4LL1A 5SWSD 2VR5A 2ORBH 2DWTA 1KDJA 3EG9B 3LPPA 4DHLA 3AROA 2F68X 4TF4A 1NBYB 3BKMH 3CHXA 4Y7OC 3OBAA 4MQSB 4QXGH 2P8PB 3UYRH 1ZV2A 3L9EA 4N22A 3TZVD 4MA7L 4JZJA 4PWJA 5BW7C 3MRQA 3D0AA 1J1OL 1RQ5A 3UYPA 2IXQA 1F90L 4K07A 3GM8A 4DP2X 4ILDA 2Z92B 1QUNA 2ZWSA 4WV1C 4JFQA 3DMMC 2VZUA 2XFGB 5JHDB 3GBNH 1K2DA 1RIVH 2GC4C 3EYUH 1IX2A 2W38A 3HBZA 3MRKB 4P46B 1FFPB 3ECQA 2F7OA 2UWEA 5I1HH 5E99H 2YHGA 3ES6A 2C4FU 2I27N 2H3XC 3DX6B 5HVGB 4JDZA 4XWGL 1QA9B 5LDSA 3HG2A 5CJBA 1D5XB 1YN7B 2BHYA 4XAKD 3FRUA 4KDTC 5LXGL 1SOKA 5DJ2A 1QSFE 3F58H 4P4KC 7PCYA 1JF1A 4XN1A 2YWYA 4F8TA 4WI2A 3EF7A 3MLVH 2FWOB 4PTUA 3TESA 3QPQC 1QX1A 2V7NA 4Q4EA 4S10A 4ES9A 5KSVB 5KBPA 4W9JC 6TAAA 4X6BB 4UNVA 2WXRA 4I3RH 3BUYB 4H1LA 2FDBP 4X80H 5JNYA 4YHLH 2ISDA 5DJ6A 2R0LL 3P02A 4JFFA 5I19L 3Q3GB 5GS1B 3JYCA 3ZMNA 2CR6A 4PJEF 3D08A 4JPVL 4DTGH 4DP4X 5DWUH 2BS71 2WGNB 4NBZB 1TEGA 4M7ZC 3ZTNL 3FAXA 5LGKA 2OCFD 4ZBJA 3IDNA 5CZVH 5AW1B 2DLTA 1LILA 3FUNA 2ZKYA 4OFYA 4HFUL 2YSTA 3NABH 2M2DA 1KGCD 1N2RB 4TLSA 5L4FA 2OULB 4M02A 4ZAKD 1EFXA 1ZXKA 4RFOH 5ICUA 4QKTA 1TSRA 3ZZ1A 4V2CB 3BLKA 5AB2A 3EYSH 3NIFF 4AL8H 1R17A 2BH0A 4CBPA 4PN6A 1A6ZB 1ZA3A 3DJTA 3AWFA 2F5AH 3CNKA 2VM4A 2WQXA 1SJXA 5JORA 5KBNC 1XMEB 3B3BA 4OAWA 3X3FL 1N7ML 2VXSH 1NZRA 4GFTB 1QI3A 1V3LA 4S1DD 1JV5B 3OB0H 2V2TA 3CDFA 4EAEA 2BVOA 4MS8C 2BY0A 5C7ZA 2DI8A 3SQBA 5DJCB 1ET7A 1OCZB 2VLMD 4HKBA 5D96C 3LN5A 1WBYB 5F0MB 4FZEL 5EC1B 4IBQA 4YHPA 3KPQB 2ICEA 1EHXA 5IHZB 3ZPDA 3VW3H 4KZCA 4RA3A 4F57H 5I1LA 2HJLA 5I1CH 3NACH 4GQRA 4JNXA 2WZAA 2AQSA 3I6KA 2E6QA 3TYGH 2LLNA 2KZKA 4NUJA 3AQZA 4TNWF 3GLAA 4YPJA 3VFPA 3F62A 5FHBL 3FDWA 3B2VL 5MI0C 1N6UA 4IRSA 4CC4A 3RDJA 4G6AD 1LO2H 4JFDA 4QTHB 4WHCA 4YEEA 4FZ8H 4WHDA 2FJUB 5D6DA 4HIJA 3UG4A 4OUUA 2DJUA 4R26L 2DQDL 3N43F 2OL3A 1MZZA 1N3NA 1NCTA 3ECBA 4QRAA 5C0IA 3KPSB 4NUGH 3RX8A 3GMRA 4ODBD 3LRHA 3OZ9L 4XWOC 2BJMH 5MEOB 4N2LA 2VOTA 2D3LA 3FCSA 1P7KB 3NCYP 3BZEA 4LPWA 1ZAGA 3ARFB 2ATPB 2WSKA 4Q9QL 1XGTB 1NEPA 3CFCH 4WHTA 1KBBA 2R0ZH 4HS3A 4TSCH 4FJ6A 4AM0B 2RACA 3OB8A 1KLGB 1BZ8A 4KI1A 1HHJA 1LK3H 5C7XH 3EO1A 3L7EB 1NFDA 4Y16B 3OJVC 1MPAL 4JPKH 1IGCH 4LOFA 4P23D 3ZSSA 5CCKH 3RL1B 1NFIB 1QFOA 2ZCLL 3NFNB 1WJ3A 3HBPA 3UROR 2ZXEB 1A9BB 3Q9PA 2X6VA 2OX5A 3BD4A 4H5SB 3Q43A 1T1XA 4I5BA 4LLQB 1TQCB 3BRDA 1YJDC 1PSKL 1A9VA 4YK4C 2YC1B 1CL7H 2LFEA 1AXSB 3WJMB 1OHQA 3GHBL 4UUJA 1OE2A 3N9GH 2E6JA 3JT0A 2XPZA 3IXTB 5AZ2H 2ZX5A 5KTEH 2DMBA 3CMGA 2X4PA 2F8OA 4JJOA 4A6YL 2WM0A 1N8ZB 3TTYA 2XWCA 3BT2L 4DF9A 5EIIA 1NEUA 1UYWL 2XIBA 3C6LD 3KBEA 3IGUA 5BO0D 1MNUH 3KGUA 1N64H 4IBZA 2DI7A 2K1MA 5G5DB 1ZSDA 2WCGA 4XBGB 1M2VA 1XGUA 3H42L 3CZLA 2ZT9C 1DQIA 5HJBA 1MJJB 2L7EA 2QMKA 3CVCA 4M62L 3H4HA 3CFJA 3C2SA 1DJGA 1OTTD 2A2QT 3AB0C 4P5KA 1JVKA 1TNNA 2BNQB 4FQLL 3GKWH 2VAJA 3PYCA 3WNIA 1Z0MA 1SUHA 3E6HA 2VDMH 5KS9A 1SDAB 2XTLA 5JPMB 1T2QH 2R8SL 3H6JA 4QRQB 5FK9A 4RGOL 1JK9A 2OKMA 3OX8A 4MA8L 4D0CA 5D5MF 2C3GA 3HRPA 1RJZA 2X9ZA 4XP4H 3E1ZA 3UAEA 1UWFA 3UX9B 2E4TA 4B3EA 3MJ9A 5CJXA 4O02H 1OWRM 1QRKA 3CSFA 2JKSA 4E0RB 1IE4A 2CDGB 4BXSV 3UPRB 3HPJB 2X2JA 1ZHBA 2YAFA 1D5MA 1BJ1H 5EUKB 3MRJA 1J10A 4ODWA 2R29A 1QQDB 3MLSH 4YHNB 3DK0A 4JO4L 3UG5A 2AERT 4X7TA 1AGEA 4XMXA 5I6PA 3ZE1B 3INUL 1UXSB 3QQ3B 4FNLH 5E4OA 1P6WA 3ARYA 4WGVB 3U30C 1UADC 3OC5A 3VFVB 2XWXA 4ATTA 2WVSA 2A77H 1DP0A 4MMYA 1CURA 2VRAA 2XLLA 3VWJD 1DUZA 4JB9H 2XXCB 2V3DA 3VGDA 3NCCB 2RALA 4OCLC 5I28A 2OM5A 4M4RA 4AQ8A 3O11B 1IGTB 3TBYB 5C0BE 3GZQA 3HRZB 3ZKND 1GGYA 2Q6WB 3ROLB 3GZKA 4PJ7F 4MQXC 5EO9A 2LW3A 3CQPA 3WNMA 4ERSH 3TO2A 2IAND 1IQDB 2CPCA 5F7MC 4S11A 2YPLE 4X99A 4G2AA 3PJSB 1HXMA 4XZUA 5I74C 5DFVC 4M56A 3EBIA 4DK5A 2PCPB 4DP9X 1CI5A 3MLXL 3BVXA 3FULA 5GXBB 3EHBB 4WDIA 3QUYD 5C07D 1L0PA 3K3QA 1LMIA 2VE6A 1EK3A 4O4YL 4UI2A 4YR6A 1GGCL 2XX0A 4R0LA 4HJGB 4FLQA 1E4WH 4R97B 3TXAA 1CBVH 5CEZH 2WLJA 3ELAT 4DK3A 4RGNC 2OFQA 2R23B 2GK0B 2GTZB 4NZTL 4L1SA 4N0UE 3U7WH 1U8JA 3HAEB 5TJWK 2YPVA 1WICA 1L9NA 4XBMA 3MLZH 4KVPA 1G9ML 3OC8A 5IBLC 4AGOA 4NKIL 4GFXA 3U9UB 5BV7C 2HRPH 1VAHA 5GGUB 2CJ3A 1NC2D 1X4ZA 5CIPH 4EI6B 3QDGB 5IESH 3FW6A 2EDEA 5DZ9A 2E4FA 5L0QC 5J0BA 5DJAB 5HI4C 4YC2B 5TE4L 4EN3B 3C09C 1LP9F 3V5KA 4OZIB 3EDJA 3FPXA 3VFNA 1ES0B 3BQUC 1C9SA 1IMHC 1PZSA 1FC2D 2QFPA 4MMZA 3QEUB 3C8KA 4FQCL 4OFPA 1E90A 3QFJA 1B90A 3WIFB 1GMEA 4WGKA 2W0FA 1IE5A 3KWTA 3AY4C 2E47A 5C0BD 4J8QA 1V7NH 1JDDA 1XHHA 2HT4D 3OB0K 4GUPA 4OZGB 5J7CC 1U42A 3C60A 1M05B 2QZQA 3O6MH 3PFQA 5FOJA 2HZHA 4HWEH 4ZS7H 4QHMA 5B8CA 4XN2A 3KWUA 4GI6A 2PWGA 4G59C 5DLLA 5JXAH 4NQXA 3DROB 2PKDA 5HGHB 2C34A 1GPOL 1DFBL 2BP0B 4XOEA 2WZPA 3K6NA 2AAAA 4WF7A 1KCRL 2WCSA 1E27B 3AS0A 1U8IA 1JNHA 4JPWL 4BQBA 2NOYA 1BQLL 4LLUB 3PHQB 2VLRE 3BAJA 4KFMA 1FZKA 4PI2A 2IGFH 4S2SA 4AYFA 5B7FA 1M53A 4IIQA 3PL6A 1ZWIB 3QP3A 3OKOB 2CPUA 1Z9LA 1QPXA 4RX4D 3RE0A 3QARA 3W39B 4BZ2L 3CZNA 2QTEA 3T04D 4G7QB 4CVWA 1IC5H 4AV4A 4M00A 3FO2A 3WNPA 5ID0A 2QT6A 3BKJL 4FFZL 4QMEA 1FGVL 4YHIB 4JE4B 2M83A 4JFYB 1RIHL 5DEGA 2E27H 4Y4FB 2ENQA 1ZVHA 3AUWB 3GMNA 3LRMA 4LEXL 1FH5H 2Y3AA 3IMWA 4XI5C 4AQAA 5CU5A 4IDJH 4DGIL 1Q1JH 5GGQL 4G8GB 4HETA 3L4TA 1N67A 1KJVA 3W0WA 4JFVA 3SPVA 1TCRB 1SM3L 2W8CA 3T8MA 3GSNH 3AS3A 4JL1A 1DO5A 4YXHH 2K9UA 1ZT1A 5BCAA 5IQ7L 4MWFA 1J9RA 3G6AB 2A38A 3RDTB 1KT2A 3M45A 4IU3B 3SSGA 1MY7A 4R5TA 3BPCB 4UQ2B 4XXDB 5IBTL 2VL4A 4W9KC 3RB5A 4JM2D 2D2CC 4U1IB 1RZIA 4UANA 1CBJA 2P49B 1DVFD 3CVHB 4PLNC 5JQIB 1SVCP 4N8UA 4MDIB 2X10A 4OD2B 5D4HA 3T6VA 3N44B 4BFOA 2FHBA 2CKNA 2C3HA 2F54D 5CR1A 4HUVA 1HCYA 2PETA 2PUQT 3HE6B 4G3YL 4F20A 1HXYB 1PPIA 1DBJL 5C0EA 3G6DH 2FX9L 1QI5A 1N0LB 1RZFL 3VD9A 1FHGA 1YNTA 1Q0YH 3ETSA 4HZAA 1MRCL 1JMXA 2VLRD 4NOBA 3GZPA 3QEHB 4J39A 4AVHA 2I5YL 4GAYB 2B7DT 4QLRA 1I7TA 5LGHL 3WIHA 3ZE2B 3GTVA 3RBSA 1MFDH 1ZD6A 2OSLB 5D1XD 5CD5C 5KSAD 2DQHH 4QIRA 4M6OH 4LIQL 1A3RH 2VM9A 2YAPA 3P1VA 3LXUX 3U4KA 2MPVA 4KROB 1IGJA 2J7LA 4OF0A 1YA5A 3OJ2C 4M7KL 4K5OA 2G5BA 2EDFA 3NOIA 2OYPA 2XFXB 4A2EA 4JFEB 1KACB 2Z6FA 3LMJH 4ZXBB 4JO2L 2NYZA 1I9IL 1VFOA 2OMUA 2F18A 2YLHA 4HKJA 4KK5D 5FYKL 3WI9A 4LSVH 2Y6SC 1PNCA 1MFNA 4S1QL 5DJDB 5INDA 1L0XA 4OZHB 5IJCC 1T20A 1FNGA 4G80B 3ESMA 2DYPA 1J87A 3SQOL 1V05A 3PWVA 4JE0A 1I3GH 1A1MA 4YSSA 1CE1L 4AIEA 2VXTH 3HHRB 1OW0C 3NJJA 3E9UA 2Q3XA 3JTSB 4BQ9A 1LWHA 3EYVA 1T21A 2VH5H 3SYOA 2OSXA 1A6UL 2PTTB 3BEVB 4BH7B 4DKFL 1J05B 4TPRL 4PJ5D 4QTIH 1S9XA 4GAJH 4BCYA 4BSWB 2AP2A 4BUQA 4JQIL 3RZCC 1DL7H 4OZFH 4EI5B 3DRTA 3MRCB 5D72L 1ND0A 3BSHA 1OCRB 1YEHL 5D7JA 2KI6A 1KYFA 1INDH 1BEYH 3WY2A 32C2B 2HFGH 3BSGA 1WFIA 4G8FB 4JY6A 4UYQA 1SVBA 5C9KA 2WNXA 2F1BA 3DVNB 1FNEA 4L3EA 1HYSD 2A6DA 4YJZL 1SN2A 2C3XA 3CGTA 1FIGL 4RFNC 3WL9A 4M29A 1H6EA 2P9RA 4XTRD 1PZCA 2IF7A 3M46A 3CX2A 2P44B 3NH7L 1IC7L 2F6AA 5AQ0A 3MI6A 1CC3A 4YSPA 4J5VA 4UQDA 4F8PA 4H88L 2WZ0A 4B97A 2VZ1A 4UBDD 2IO5A 1AY1L 5B1CA 1BVNT 3IFLL 1R3LA 2K3HA 3MRQB 5EZLA 2NTFA 3VXOA 3UYPB 1WFJA 4BCZA 1Y1DA 1RUAL 4UQ9A 5KYUA 1SY6A 3EJPA 1NWPA 1K2DB 1JWSB 2BIQA 3WFCH 2ZOTA 4RAVA 3KH3A 3P9MB 1CD0A 4FG6C 5EZOH 4NWTH 5FKAB 4QF1B 1A47A 1BZOA 1TZIB 3ES6B 2YAEA 3GLDA 5AOMA 3HOGA 3MX0A 4Y9GA 1OCWL 3BFWA 3N40F 2I69A 1DVUA 3CZJA 1T04A 4R4FL 4OFKA 3V10A 3QXAA 1IGYA 1I8MB 1F4XL 3PHOA 3TA3D 5CINH 4IOIA 4IKIA 1V54B 5JQ6H 4ONFL 3WIIH 1FE8L 5CILL 1DQJA 2V7NB 3HVDA 4I48B 4C8XA 5IF0A 4QHKJ 3HFMH 4NO0A 5GJTL 3WS6C 5JNYB 1CR9L 3RKPA 4A66A 3QW9A 2L7JA 1FDLH 1XVSA 4TQEL 5DJ6B 2MCG1 4AK2A 2CAKA 3T0EE 4PV1C 4NSKA 1UKQA 2DIJA 2WBJB 2Y5QA 5L7XH 3SDAD 4ZFOA 4JJ5A 1NGWB 3EYFA 4GI9A 2J6EH 4DP1X 5TF1L 1QFUH 5HHVH 5AAMA 2NUTA 2QDVA 4X8CA 5TDOB 4PGCA 4FXKA 2ZUSA 3V0HA 1GYAA 4C4UA 3KXFA 1NDGA 3PDDA 1F2XK 4PJIF 4XPFH 1JZFA 4ZX5A 2X5PA 1ICTA 1WCQA 3DURA 2DKSA 1AS7A 2ESVB 3QUXD 2PYEB 1X5FA 1AAJA 1KGXA 4L5FE 1KLUB 5D7HA 1NGQL 2GBAA 3GSXB 2NQDA 4LRIA 5CGTA 3EXJA 3QRBA 3Q1SH 3FFCB 5JHDE 5DZNA 4UQAA 2NR6C 2EIDA 3MRGB 1BDYA 1HESA 4NN5B 4K5PA 4KJQC 1SUJA 5E51A 2BVOB 4AYEC 5CD3B 5T5FL 2Z91A 2P8LB 4PUBH 4R7LA 1L6XA 3LN5B 1BXAA 3L7FB 4YHPB 3MLUL 2ICEB 2P80A 4HXBH 1HT6A 5DJYA 3BXNA 2Q87A 2HJLB 3VI4A 4KXCA 1M7IB 5D6CB 5E2TL 3QZWB 3N41F 4OLYL 1X7TA 5T3XH 3AGWA 2AJ3B 2VLJE 1EERB 3AQDA 1E28A 2FSEB 1F6FB 2ZG1A 3GGWA 3QUZB 3BUIA 3SDCC 3FT3A 4IRSB 3JUZA 2O5XL 1FO0A 2JCCB 4KC3B 4I88A 5AW5B 3B9EA 3QEQA 4J6RH 3T0ED 4DVBA 1BVKB 5DUJA 1PKQB 3RQ3A 3RVTC 1RZGA 2ZWLT 3GJFH 3BT0A 3ECBB 4DEPC 1S46A 3KJ4B 4RMUA 2NXYB 4LLVA 1PG7W 1SJMA 1WZMA 3O3EB 1IKFL 3PUUA 1VZHA 2XWBB 4CMHC 3LSOA 3APCA 3OAZH 3GSQA 4J4PD 3BZEB 3TL5A 1EHLH 4UF7C 2EACA 1B6DA 4TVPH 4W9HC 4F27A 2FH6A 4AH2A 4U1LA 2X6MA 5CJQL 3MJ7A 2H0JA 4AKPA 4NQVA 1LO0H 4XPAH 1QBML 1PEZA 3GINA 2PWEA 5JHDD 3HA0A 4Z7VA 4H8UA 3DXAB 4P46D 1F97A 4QUOA 1GTNA 4G70B 1PL3A 2X0WA 4M1DH 3S8FB 4N6RA 1F4YH 1OAUL 2VWEC 1F1AA 1CDCA 2WJ7A 2WY3B 1HIMH 2X2IA 4LE8A 5E6UB 3VRLE 5ADOH 1ETJA 1OK0A 3ZHDA 1NPNA 2CGYA 2XRAL 4WJG3 3L3OA 2VERA 4O58L 2VR9A 4UUJB 3CHRA 4KHXL 1QLFB 3WEOA 5ESQA 3ARRA 5HVHC 4Q9CA 3LH8A 1BQSA 5I6LA 4DP0X 1KCWA 2X4RA 6FABH 4DCQA 2XVLA 4W6YB 2X4PB 4F5CE 4NLHA 3H9HA 2JF1A 4DVRH 4MYWB 4PU2A 5IW1B 4DP8X 2XIIA 3QAZB 5IOKA 5DRNA 2FATH 4NJAL 3ZRSA 3K6SB 5DHEA 1XGUB 2I25N 4MSWA 4X6FB 2JQZA 3TX4A 4JQXC 1O7DE 3KPSE 4EIUA 1FFNA 3CFJB 3QCTH 4WI7A 4ACTA 4H8WL 3MCLL 3GNML 3UBXG 3P3SA 4JY5L 5KS9B 3E6HB 5DEZA 5GZND 4PHXA 4XX1G 5FB8A 3UZQA 1I1AD 1J0HA 2J1ZA 1JK9B 1I85A 2NSMA 2VDKH 2R69L 4L8BB 1CIDA 4JCMA 4LEEA 4ODTL 1PCSA 2ZSVB 3OX8B 4YZFF 4D0CB 4HGWB 3AUVA 4KQ0A 2GPZA 2VDRL 3QWRD 4WJ5B 4Z7UF 1F0LA 2VDNL 3GJEA 2PTUA 4AQ1A 2WUCL 5MENE 5D1QA 2VDLB 2PTVA 1NCWH 3LEVH 1KBGL 1D5MB 1HHGB 2H9GA 3MRJB 3MGOB 1PU0A 3HS8A 3VO0A 1S5IH 3OKYA 3HG1E 4HZLA 4Y9EA 1KC5H 3BLPX 5C92A 1PX3A 3O8XC 2KL6A 2ZOWA 3UTQA 4YE4L 1HDMA 4NHCL 2A6IB 1HWWA 1OE3A 5EUOF 5GJSH 4N8VG 1YJDH 2F8IA 4XN8A 5F1SA 1KY6A 5FV1L 4FCAA 4TM9A 3DJRA 3ZE0E 4ABVA 3FQRA 4D9RE 4K4KA 4K23L 4M4RB 4WK4B 3CXDL 4RISH 1GJWA 4I9WD 5FX3A 1EJ8A 3VI3B 3V6FB 2AQQA 2K7QA 1K5WA 5EO9B 2YZ8A 2ZUQC 1CLZL 3TFKD 3FU9A 3MJ9L 1F1GA 4WWID 1JXDA 2V37A 1OARL 4XPBL 4Y8DC 3TNNA 5GGVL 3V8OA 3GUTB 1VDGA 1WH0A 4PBVC 1IJ9A 3NAAH 1HXMB 1ZLEA 5D93B 3DHPA 5AAPA 4LEOA 1BZ7A 3EO9H 4YAQA 2BNQE 3ZL2A 3FT2B 4R96B 3RIKA 4WDIB 4J2XA 3KPSD 4UV4H 4V33A 1OP9A 2DW5A 4NOFA 2N3JA 1SN0A 3QGVA 4EVNB 1FAIL 1OGAB 1RIUL 2FECI 2VE6B 3H3PH 3MV01 1AZCA 3HS0A 2XPGA 2EKSA 3PWPA 4HZ1A 4YZWA 3L9YA 2SEBA 5C0CE 3ZKQD 3FUHA 2DJSA 1P69B 4PS3A 2XA8L 3ARFD 1UACH 3OPZL 3APMA 3OTTA 3L2NA 3I6GA 1WA0X 2NMSA 1ZT4B 4MJIB 5IB4A 2CE6A 4Y16D 2BSRB 2FYVA 3RVVD 1SFHA 4D9QE 4MTMA 2QDWA 1W9XA 3U1SL 2HA1A 4HUNB 2WXIA 5D2NB 2NY0B 3IU4H 3DX3A 1TJGL 3ZE1E 3VQ1C 2WYZA 3FB5B 4U3XA 1KCUL 5CUSL 5GRJH 5EWIL 3JWOL 5DO2C 3S96B 5A2LH 1DQML 3KYOA 5C8JA 1KXQA 1KIUA 1IM3A 5SWQB 4J7RA 4LVHB 3BSZA 4PR5A 3N1PC 4HG4K 2ZXWB 1CYWA 1FGNL 4WWKC 2DWXA 1B4JH 5HJGA 5C6TL 5I0YA 1SN5A 1S7XA 2E9IA 2W9DH 4LDCA 1XB8A 3WN5B 1W15A 2LHAA 3IMSA 3MTRA 5HHXH 3K5RA 3U4BL 4MMZB 3FT9A 4XO4A 3C8KB 5I66A 4KRNA 1YY9D 4D9RD 4JZJC 2W0FB 2ICWJ 1NANI 4U1KB 3UBXI 4WTQA 3HPLB 3KPNB 3ME0A 4HMEA 1LM8V 3RGVA 3IS0X 5DDHB 4CL7A 5F7FA 5HY9A 1VFMA 4N9GA 2ZX6A 3BQVA 1Q9WA 1KGWA 2HTKC 1OOWA 4FLOA 3UO1H 3TEXA 1ZV9A 1K4DB 5E8NA 1MFBL 3A67H 5B8CB 3K0YA 3QNFA 2QVTA 4FNRA 2VGLM 4AVIA 2WQAA 4G1MA 4PG9A 2IH1A 3KBFA 5TFSH 2BNQD 2WZ6A 1A9EA 1I1YA 1N0XL 4XNUL 1E6JH 2ED8A 4JHZA 3LKQA 3QORA 3BZDA 5E8PB 1QPKA 3SDXB 4AEHL 1DSYA 2DM7A 5C0CD 1RHHA 5I26A 3TIDA 1FFTB 3RIFK 3DO7A 4YXKL 2QV4A 1JNHB 4ETYA 4TUOB 4J1UB 5F0PB 3R4DA 4HCGA 1SEBA 1J1OH 3CZSA 1BQKA 1F90H 1NDMA 3B2MA 4AYFB 1UWEL 2XY1A 4PJGF 1IRAY 2J8OA 3GMLA 3JUYA 1KZYA 3PGFL 3QFGA 4CVZA 3CLFH 3FYIB 3PL6B 4K8RD 4XPHL 3R7RA 4IM8A 5PCYA 4D9QD 1MWAH 2EDQA 2DLFH 3NTCL 2J5WA 2FUTA 3DHJA 2E3VA 2NY4B 2HFFA 3A4AA 3QDGE 3MYJA 3KNBA 1U3HA 3ZU8A 3ARQA 3HCVA 3GJFK 4B53A 5BV7H 4Y4HA 2GABA 5ID0B 1RSFA 4ZFZB 2YAHA 4NQDE 2Y0SA 4OZIE 5KUKA 5LXGH 2BC4A 4PJHF 2G75A 4AQAB 2DBJA 3FRPB 4GP8B 3B9KB 4Z1PA 4V1DB 5AENA 2GIXA 1FF5A 4G8EA 1X9RA 3OAZK 2OQJA 4LDLB 1KJVB 4NKOA 2HKFH 2D7NA 2WO2B 3DYPA 3K72B 4EJ1C 3SKJH 3CDZA 5EBMA 5BXFA 1ZT1B 4HEMA 4MWFB 2R0LH 1VGEL 1MAML 1EDQA 5DEFB 5I19H 1YCSA 3V0FA 2OR7A 4K7FA 1KT2B 3LKRB 1L9SA 4LAQL 1ZJAA 4NIKB 4Z7OE 5A16B 3NVQA 4JPVH 2BSED 3ETBF 1A7PL 5GHWL 1QWUA 2YBRA 4M3JA 4EKXA 3EHBD 2O6CA 2OMBA 4MLIA 1KFGA 4HJSA 4RCAA 1EMTH 3VFSA 2PPEA 4ZMPA 1Y0LA 3WTVA 4MZ2A 4P2RA 2KKQA 2F7QA 4AV5A 5BVJB 5C0EB 4Q52A 3FCTA 3PWJB 5IVXE 3T9WA 1DFXA 1P4IH 3DBXA 2W95A 3MXVL 2X2YA 5DQJA 2NQCA 2I9TB 1HL4A 1I7UB 1N7MH 3KPLA 3TVMB 3X3FH 2VM3A 1Q1PA 4LLDB 4IRSC 4ZUUB 1I7TB 4CC4C 5BQ7B 4B0MM 4IQHA 2P47B 2XKUA 4KXBA 1FG2B 2C26A 5DD3L 1GW0A 4RAUA 1A6TA 4GBXB 3H9SA 1ACCA 4FZEH 4YSRA 5C9JB 5HYJB 3QDGD 3FAWA 3O41B 2R4RH 3WO4C 2CCLA 4GRMA 2P45B 1TTRA 4JRXA 1E8XA 2DWSA 5E7BA 3ZR6A 4JHAH 1RJYB 4EN3D 1ZT7B 1E2VA 4G8GE 1MSPA 1U8OB 1GGBL 2OMUB 1R3HA 3IMTA 4HIEA 2W59A 4HKJB 2AEQL 3LPFA 2X0UA 3CDYA 3AT0A 4F3FA 3HN8A 1TZOA 3PAUA 5INDB 4D7BA 4ELMB 2DYPB 3D30A 4WUUB 3LN9A 4QWWC 1T66C 3B8SA 3D0VA 3FT1A 3CSPA 3B2VH 4IKNA 2AQRA 1OAZL 4Q74A 4BK8A 1DQTA 1OB1A 3EYVB 4EXPX 4XE5B 4X4YA 4R26H 4LU5H 1UENA 1ZVSB 2DQDH 2VC2B 2Y1ZA 5T3ZH 3RGHA 5C0RL 2A3TA 2CBTA 4H8WC 5LCVL 3T3MB 1PFCA 5LN8A 3NPSC 2J1YA 2JI2A 1ND0B 1IV8A 2FH8A 3BZ4A 3OZ9H 4GOSA 5D7JB 5GRVK 3OKMA 3U46A 5J12C 4HD9A 2XV3A 4PD4K 1U8MA 2EILB 3LQMA 4TV3A 1A22B 4Q9QH 1MF2L 5JO5B 4AENA 3GZOA 1K3IA 4ZQKA 1AZUA 2Y7LA 5ALCL 4MFHA 1XTLA 2RR3A 1IAKB 1XSKA 2GYSA 5IHUL 1T80A 4RMSA 1HKLL 2YD0A 4H0LC 1LDSA 3BIBX 3ZE2E 2PW2A 5L6YH 4M48L 4XXWC 1HAWA 5E03A 2X4SB 1BZ9A 5HGDB 2YGQA 5JZ7D 5KZCB 2H32B 2FUQA 1JZ4A 5F9OL 2V7HA 4ZOBA 2VZTA 3IU3A 4CN1A 1IKOP 2CA3A 1V7ML 5EZLB 1T83A 3T0BA 5IM7A 4F1ZA 2C1OA 1AIZA 4JFEE 3NZSA 4HYTB 3IT8D 5IMLB 3A6BL 3DJSA 1PSKH 5KYUB 1J8HB 4Y4FD 2GJ6B 3I50L 4POUB 2ITCA 3L6FB 1IJNA 4LLWA 3ARGA 4NC0B 4P3DA 1X7QB 5IP4A 3GHBH 4KX8A 4OZHE 4G8GD 3L5XH 1JGUL 2YZ1A 3IAGC 1UJTA 5CF3A 1FL3A 4L2LA 4R6UA 4KH9A 5LNDA 4A6YH 3MX0B 4ZJ9A 4ZNCD 2JKNA 2A9DA 1SXBA 2WBKA 4CN4A 1UYWH 3AREA 3WGVB 4CNIA 2RGSA 1EUTA 4LHUG 1B4LA 3F64A 2YQ2A 1IGYB 3RDTD 3H9YA 1VESA 4F37K 1P7QB 4UNTA 2YK1L 1FLTX 3TN0D 3GHEL 1GC1L 1P5VA 4KMTL 2NUPA 4POZC 3FTWA 5I15L 2XWZA 2Y36L 3L45A 2V17H 4GO6B 3UP1A 3JBG7 3RWEB 4Z77B 3PQYA 4NO0B 4FAAB 2B1AH 3D3VE 4FQLH 4FKKA 4TLUA 5LO7A 1CK0L 2MCPH 4B9YA 4XRCA 1I4FB 1WC7B 4R2GC 3Q6FB 2I9LB 2R8SH 2OMXB 4RGOH 5AZUA 3HE6D 2QSTA 4NS0A 3B5GA 4MA8H 1YEEL 1A5FL 4ZFOB 4JJ5B 4CADB 3A5VA 1WSST 4M1GL 3T4YB 3VE0B 5B3NA 4G9DA 1Z5LA 2F19L 2NUTB 3IGLA 2Q2EB 2A6KB 4OI8A 3FN0L 1ZHKB 4PGCB 2RQ8A 3ESPA 5CEZE 1VIWA 1NDGB 1LXMA 3Q6GL 4D2NA 1XH2A 3DURB 1MVFA 3UCQA 4KNUA 1FWXA 5EPMB 4OF8A 4JO4H 1HL5A 2ICCA 1JIBA 1GZHA 4KV5E 1B9KA 1P0SE 1ZHNA 2FT8A 3INUH 1A1NA 1NPJA 1YHPA 3APNA 3NDZE 2N01B 4KROD 2V4LA 3FCUB 4L48A 2ZAGA 4MNGA 3BWZA 5B39A 3P4LA 3QR0A 3WUWG 2J71A 2E56A 3EJJX 1YPZF 3P9LA 5H94A 1OLZA 4JFED 2H3NA 3V4VB 4ZXBD 4P49A 2WIIB 2YXFA 3GMQB 4GI8A 1JYWA 3O2WL 4HW6A 5E1AA 4R0LC 3BWAB 2AXGB 1E8YA 2YPKB 2BSBA 4KRLB 3SPCA 3IJSA 1GZPB 4YQXH 5BOPA 4HBQA 3VFRB 2QHLA 1EXUB 3U6XS 4R4ND 4PREA 4TQHA 5AVVB 3UAAA 5I8KL 3HG4A 3L48A 4HC1A 4R9HA 4WCYL 4UAOB 2CMRH 5JYMA 3PGDB 3TF4A 1E28B 4DUVA 4OTXL 4ZW6A 1B2WL 1V55B 3II2A 3MLXH 2FEDC 4KGLA 4EI5D 3HZKA 4N2KA 2ZE0A 3HUJF 4UWQB 2BHFA 1BWWA 4YVUA 4HIHA 1GGCH 1REIA 2AEPH 1UM6H 3G9VA 3IAPA 3AXHA 3WN6A 1OAQH 5TGBA 8FABB 2FBOJ 1Z9OA 4ALAL 3H1ZA 5E4IA 1M57B 4KQ4L 1WZ1H 2WW8A 1F6AA 2ZOOA 1QHPA 1EBAA 4P5MB 4BDVA 4MMZC 4IIZA 2BW5A 2Z35A 4NDMB 3CDGA 3FTYA 4F93B 3PXJA 4I77H 1DVQA 2FTAA 2P1YA 4NZTH 3RUGA 2EXSA 2W0LA 4LLVB 3T6ZA 4WTZG 3VFTB 4P2OA 4HK0B 2ESVE 4NQCE 4NFBA 5DTFB 1JNLL 2PYEE 3LSOB 4XVUC 3PWNB 1WBZA 2A4EA 5GISL 2HMID 4NKIH 4HU8A 3C60C 4OKVA 4PEEA 3FFCE 4FE9A 3BVTA 4U1LB 2E46A 3MJ7B 1AGBB 2F53E 1EGJA 2L7QA 2QLVB 3HMWH 1FZOA 4AMWA 3ASOB 3TBTB 5TE4H 4MJ2A 3AACA 5FGBC 4KK8C 2ZCKH 3HKFA 2IH3A 4U1MB 4CVUA 3QH3B 4FQCH 1MLCB 4AW4A 1FO0L 2OMWB 3WUWA 2NY1B 2F9BT 4NT6A 4XVSL 1XXFC 3VYNA 1CD9B 1P1VA 1TQSA 3FH7A 4Y2DA 3T1FA 4F2ME 1X5GA 3LKPA 2CO3A 3ARDB 2Y6TE 4KI5F 3KGTA 1E3FA 4ZDHA 1X9QA 2EDMA 4PGBA 2YN5A 1U8LA 2AEWA 5FEBA 2XG4B 3VXRA 5ESQB 3D69A 4IIQC 4Y2LA 1P5UA 2C7FA 1G4RA 4N1HB 5KYXA 3HAEH 1KB9J 3EYQC 1PZ5B 4P06A 5DS8B 4YSUA 3SDYL 4F7EA 3H9HB 4K3EH 1FVDB 2AJSH 4G42A 4KBPA 2JCCE 2JIXB 1JZHA 1GPOH 4MBOA 1DFBH 2I32A 3QNXA 3TO4B 1PKQE 2WBJD 3R8QA 1KCRH 4PJFE 5CJ5A 1MI5A 1UGKA 2AV1A 2WXHA 2Y22A 2WWOA 4JPWH 3G08B 1FFNB 1BQLH 1ZJBA 1B0GB 2YSSB 5MEQB 2YGVA 3GXIA 4UMGA 1S9VB 2OMNA 5FB8B 5KOMC 4PV9A 4NP4H 4ANVA 5HHPB 2ESVD 2YMTA 4NQCD 4AJWA 2XZCH 2PYED 4BZ2H 2QQLL 4HMDA 5KSBB 3CH8A 4J3OF 1I8LA 2EYTA 4A2DA 3P0YL 3IDUA 3D25A 4WTZA 2YIHA 3X3GL 1JTPA 3GJEB 4YSQA 3BKJH 4FFZH 4OLXH 2X3BA 1RIHH 3FFCD 4Z9KB 5A43C 3F5WA 2FT6A 3MLTA 2BDNL 2F53D 3ILPA 1MCPL 3R18A 4MNQA 3T0WA 2H9GB 4NO5B 4DGIH 3VFGL 2RFXA 3DXAE 1TFPA 5BRPA 1QBBA 4Q56A 3BIAX 4N8CL 4QOKB 5I17B 1YEWA 3DARA 1J7VR 3WAKA 1SM3H 1VKXB 3ALWA 4O2CB 5F1NB 3N91A 3FQYA 4A7TA 5GS0H 5IQ7H 1CGVA 2HUHA 5IMKB 3FF8A 3D2UD 3GXDA 1DQLL 5CCHE 2EH8L 3FU3A 1XB3A 3D4CA 3VRLF 5IBTH 3WY3A 3RPBA 3WE6B 5DVOA 3QUZD 5GZOD 2UUDH 3VXME 4EDWL 5FO7A 3IJ8A 2CSPA 1JFHA 1NICA 1RHFA 3TNNB 1HZLA 5SV4A 1AFVL 3D52A 3QDME 2FX9H 2QADB 4PW3A 4LEOB 1T4WA 5EU4A 5I5RA 1PAZA 4XN9A 1H19A 1R3KA 3K2UL 4PV8A 3QI9A 3SY0A 3FTGB 4PGEB 3HI6L 4U1HB 2NXYD 3SCMB 2K3TA 1NCHA 3KWVA 2I5YH 2XPGB 3VXSE 2FECL 3PWPB 2SEBB 5BZDA 2BNUB 1WAPA 4XP9L 4DZ8A 3MNDA 1U8KA 1JDCA 4R7NA 3SOTA 4QEGA 4XCFL 3EOBB 4G43B 3MVSA 4UZGA 4LIQH 4YHZH 3WDJA 2DQJL 4QXTA 4GP5B 5FPIA 1M7DA 2Y1VA 1BM3L 4M7KH 3ATDA 1DQDL 4LLAA 1M4KA 1IEAB 1PMYA 4XNDA 3AMKA 4JO2H 1I9IH 4OSUL 3F12B 4IBUA 2F15A 5FYKH 3WG7B 1JI2A 3DXAD 4UINL 2Y25A 2FLMA 2H47C 5C0AB 3KYOB 5IMOA 5KWYC 3SQOH 1KIUB 4Z0BL 1AIFA 1XH3B 3SDDB 1CE1H 4NYLB 5FWQA 4J8RB 1RZJL 4MD4B 5HD8C 4HPYH 3W11D 3GI8L 5E00B 1J5IA 3LJ3A 4L29A 4DKFH 4LCYA 3MCKB 4WJKB 2X4NB 3EBGA 3BOVA 4XNMA 1FFRA 1L9TA 4LDEB 4JQIH 5HHQA 1H15B 2WVVB 1NMBH 1AGFA 3BAXA 4AG4H 3HJEA 3PP4L 3ULSA 4F9LA 5D72H 5E6ID 3J7HA 4X7SL 1N9PA 1YEHH 2N59A 3ME0B 4LASH 2CK0L 3RGVB 3BH9A 3UZVA 2YRZA 3VXMD 3B8YA 4HUXA 3VWKB 4CVXA 1S7UA 4I0KA 3QJTB 1WPCA 2Z65C 3VFWA 1Z6JT 5E8NB 3F6LA 3LVEA 1T03L 2GSIA 4WI3A 3QDMD 1GAFL 2DQFA 2PCFA 4Q6IA 1A9EB 4PG2A 2XN9B 1IC7H 4PS4L 1UWGL 2HT3D 4XP6L 4TKWA 4XCEB 3BSZL 1CVRA 4H88H 2MNWA 3VXSD 2YAOA 3NSXA 2IQAB 1AY1H 4W6XB 1X5MA 4WO4A 1C5CL 3PIQA 4U1JA 4MJIE 3DX2A 3H4FA 4HF5L 4MRBA 3GSOA 4XAWL 4UT6H 1BQ5A 4YBQD 3ILDA 3F7VA 5DRXA 3ESNA 2QQKL 5D2NE 3GMLB 1SBSH 5AKVA 4CVZB 5DUPH 2ZXQA 2DQUH 3PDGA 2FYYB 4PJ9B 1E4XI 1AG6A 1WFUA 2VSCA 5CN1A 3HBGA 3HFFA 3MRMB 5SX4I 1U3HB 4WFGE 2Q5BA 3HCVB 2WB1A 4ZFFA 1LNUA 3SZ6A 2N4IA 4X6DE 3VFOA 3TT1L 4CU6A 5ISZA 3ZYIA 3TV3H 2YEQA 1KF9B 4FNQA 4UQEA 4W9GC 4FXKC 2G75B 4R4FH 5FF6B 3MV8A 3M1CA 2J44A 3B7RL 4G8EB 2V3EA 4PJDB 2OQJB 5I8CB 3K6IA 3OZLA 1L9MA 4ONFH 4PRHA 4U2YA 1XGRA 5CILH 5ALBL 5D7IF 1UVQA 4AUYA 4KJWD 3W1ZA 3LCYA 4Z8FL 4HS6A 3C08L 5EBMB 1EQWA 2R1XB 5GJTH 5IG7A 3LZFL 4TQEH 2CLVA 3UJIL 5G4MA 3KAAA 4FMVA 3KBHE 4LARL 3GIVB 5D1ZI 1BD2A 3PNWA 4P9HL 2GK2A 4APQA 1BZQK 1GGTA 1AD0A 1BIHA 4U3SA 4IRJA 3FO1B 3WO3B 4HIXL 3GSWA 4FGMA 3F7PC 1AKJA 2GY5A 4H2AA 3SDXE 3JTBA 1OGAD 2JH2A 1R3IL 2IBZX 2KZWA 3MRIA 3O2DA 1BMGA 1TEFA 3X1GA 2ODIA 1QBLL 4GUOA 1Y0LB 3ZT7A 4OLVL 1JPFB 1Y07A 1NGQH 3LZNA 4HX1B 3L3HA 4KK6C 1H3GA 3DBXB 4PB9L 3G6JA 1IGIL 1QP1A 4W4OA 4MJID 3WFDL 2EH7L 3N5AA 4PP1D 2E7MA 2OYKA 2BNRB 2V5RA 1M1XB 5DJXA 1QSEB 4NXSA 3GXNA 3KDMA 3KHOA 4H1LH 1G9NL 1Z5HA 5T5FH 2HVBA 1D5BA 4YDVA 5F1IB 2PXYB 3CC5A 4RAUB 4LPVA 1RUKL 4ISVA 2HFEB 2ZCHL 4WFGD 1XF4A 1X44A 2X4TB 4D0BA 4Y7MA 4V1DE 3SEPA 5HHOA 3QR1A 2FO8A 1LEGB 4UT9A 5E2TH 1WP6A 4HIEB 4PJAB 2EYSB 4LSPL 4EE2A 1NUGA 1OCOB 2AJZA 2XJLA 4F3FB 1TQBB 3GKZA 3ABMB 1IGML 3LKOA 3JYBA 1YEJL 2GTQA 2HKAA 4HXAL 1J18A 5IFHH 1CGTA 3ZVVA 2R1YA 1E6OH 4OY9A 4N90E 2BPBA 4OJCA 3WKML 3VMPA 1OB1B 2GBVA 4DKEH 2XNAB 1WIUA 1F3RB 4X4YB 5DVKA 1YY8A 2DLIA 1QSZA 2VJ0A 4MB3A 4QI3A 1II4E 1C5DA 1S7SA 4QHPA 5HTSA 4Z7OF 3BZ4B 3S36L 4OLUH 1OAKL 3OKMB 3U46B 4ZX3A 1XH1A 5AYQA 4MXVF 2NW3A 2CU9A 2V5SA 1CDHA 3KGRA 43CAA 5CFAA 3L3OC 3G3LA 4AENB 5LXVA 5GRWA 4FQXB 5I18L 4S1RL 3ZLQC 2Z4QA 4ZQKB 5F70A 1WT5C 4ESKA 2IWGA 3CFEA 5CJQH 2G5RA 5E8OB 2EDNA 4KO7A 1KJMA 3MV9A 2UUDK 5EDSA 1QBMH 1OPOA 3K6FA 2PW2B 1C16A 1CDJA 4H8QA 3UTSB 2EKJA 5IVXF 5IY5B 4PJBE 1X9LA 3V4PB 2NY4D 3IDGA 3IU3B 4X0KA 2K6YA 1K8DB 4NQUA 2X2UA 4XO8A 4UM9D 1OAUH 1KFAH 5TK2A 4DUXA 1IBZA 3HNSH 2DD8L 3MO1B 4GIPD 3P4MB 3ZTJG 1ZHLA 2OL3H 1U2CA 1KCLA 2YD9A 3ARGB 4FQIL 1WAAA 4KHTL 3B9KD 4O58H 1NGPH 4QXUL 4V1DD 3BD3A 3PDOA 4ELME 1I85C 4WUUE 1ZV5A 1FL3B 3RA7L 1J5CA 1WZKA 1OP5K 2MHAA 3JV6A 3KYAA 4TSBL 3M17A 1M6UA 4NPKA 5EFIA 3O6FA 3ULVE 2D7TL 3MOAH 3BP6B 4TUUA 4AQ1C 1ZS8A 3ETBJ 1U3JA 5D1QC 5BS0A 2R4SH 1XB6A 4ODUA 4NJAH 3QDJA 4TNFA 4N90D 3GB7A 2VN4A 4XMLL 1VHPA 3MUZ1 3CSGA 3X1BA 3FQTA 2HPTA 3K2IA 3ELQA 2WWKT 3MRPA 3UBHA 2J5LB 4H8WH 3K0WA 3F3HA 3GNMH 4N6QA 4I1NB 3O4OC 2K8QA 2GI7A 3NDYE 3V0JA 3OWRA 4XRCB 4NJ9L 2GEQA 1B0WA 4Y5YB 1QFWH 3RRQA 4GKZB 5E5MA 1QO3A 1MVUA 1JD7A 4KUCF 2VDRH 5CJ8A 1A4CA 1Z5LB 2HRHA 4KKPA 4KXDA 1L3WA 4CDGC 4MMXA 5CSBA 2WUCH 1JN6A 4Z0XA 4YGVA 1MWOA 4LSTL 2V5MA 3CE1A 3DUUA 3TVMD 3BCFA 3SKOA 3PE9A 1H8OA 3OM3B 4GXFA 2ATKA 1KJ2L 3NPZB 2YUWA 3F05A 1A0QH 1NMCB 2DIEA 4A37A 4GBXD 4N68A 1J0IA 2W88A 3BGAA 5HYJD 4Y4KA 1J8HE 4YE4H 3IDXL 2GJ6E 3IETB 3LRSA 4MNGB 4O51B 5GS2D 1FZJA 6CGTA 4YSCA 2JJTA 4W9IC 5H94B 4PLJD 3M8OL 2EIZA 5KVEH 5FUZH 5DXWA 1TTAA 2K78A 3HS0C 3R1GL 3MNWA 3S88L 2AJVH 1FG9C 3NJHA 4FHJA 4WEEA 4E41E 3UAJA 2ZP8A 4XVOA 4K23H 1G0XA 1OGTA 3CXDH 4RRPA 2DQEL 2CLRB 4JDEB 4WUUD 5B38G 1XIWB 4Z7WA 4HJ0C 4PIRF 5KVFH 2V9UA 4PREB 2H5UA 2CKBA 2YMXL 3ULVD 1BOGB 5FYLL 2A83A 1CLZH 1JG9A 3MJ9H 3CSBA 1OARH 4FQ2L 4GRWB 1MQKL 3UTTB 3GC3A 1R5WA 3CVDA 1BQUA 2VLLA 4LLMA 1IC4L 4QRRB 2R29H 3KS0H 4WKZA 3HZKB 4TNEA 4ZI8A 4P0DA 3V5HA 1FAIH 5CSZA 1UASA 3B2DC 3D50A 5DVPA 4ZODA 3CSTA 4HIHB 1OWWA 2IADB 4F33A 3A21A 4XMKL 2WAQA 3HG3A 2C9SA 2XA8H 4IRZA 3HI1A 3OPZH 4HP5A 1LYQA 1OZTG 2BOCA 4BDVB 3JWDL 5A1AA 5DD1L 2Q86A 2XT1B 1QR4A 1KPUA 3OV6A 3RUGB 1JF6A 2PP8A 2GSGB 2O4EA 3PWLA 2VN7A 2WB7A 3U1SH 3EJYD 2H6UA 2J8UE 1PDKA 2DPKA 2FE0A 4IJ3B 3RWHA 1RZPA 1TJGH 3ZQ9A 1KWKA 5EU3A 1KCUH 1OSYA 2XTJB 4O5LH 5CUSH 5DMIL 4QXVA 5EWIH 2E7LC 1NEZA 1DQMH 4KKBD 5DLML 3OHXB 5ECJE 1Y18A 4PRPA 3C5ZA 1FGNH 2WLNA 5C6TH 1P4BL 4MJ4A 1J8HD 2GJ6D 4MNHA 1HINL 2W60A 4UDUA 3F84A 4KV5F 43C9A 1JZ6A 4JZOA 4NUQA 3QORC 3IDYC 3FU8A 1ZLUH 3T0VA 3U4BH 3CHSA 2CO7B 2LFGA 3MRBB 4HOMA 2KH2B 3SGKA 3M86A 4PH8A 3OG6B 3MCYA 5SWSA 4HU2A 4OH2A 5FM8A 2CLZA 4NM8L 4ZDHB 4L37B 5ESVB 1U8LB 2B5IB 3NN8A 2YN3A 3H9ZA 3G5XB 1P7QD 1GOHA 4L1BA 4N2AA 5IROC 3C6SA 2V9QA 1P5UB 3TZVA 1AP2A 1G1OA 4JY4A 1MFBH 4YHOH 3RGBA 5C3IA 4UILH 4KO9A 4F8QA 1VEOA 5DEJA 3NZUA 4NO0D 5CZKA 4G42B 1FCGA 4Y4HC 1SJVA 3MJGX 2FWSA 4F7KA 5C86A 2B1HL 1N0XH 4XNUH 3RX7A 4P5TB 3WEMA 4DSYA 3QNXB 5FO9A 1J8SA 4ELKB 1KTKE 1RLWA 3IBOA 2DICA 1PVHA 3WXWL 4M1CC 4YXKH 4KRPC 2NY6B 4A39A 1DANT 1W0WA 1R0AL 2B39A 5BMFL 5LQBL 2ICES 1S7RB 2AGJL 1CDIA 4N5UA 4QDGA 2CBMA 4IU2A 4JN2A 4OFQA 4N0FA 3UL4A 1NAMA 3T8VA 5C3LD 3NTCH 2D3NA 1IZJA 3DOHA 1ZGLA 1Q9LA 3B6SB 1RK1B 4PJEB 3R06B 2YRLA 1OTUD 2CNYA 5LGYA 5DYOA 1AC6A 1CFSA 4PM1A 4PY7A 1OKEA 3QE5A 5LB1A 2A6JB 3LD8C 3NQKA 3MJ6A 2J72A 2NX5E 2RFXB 4ZPTA 4JG5A 5IBLD 4PJIA 2WQ8A 3IDIA 2CGZA 5DI8A 2VZOA 2IG2L 4I1RA 4NRZA 4ZO8A 4BINA 5DC0A 1T5XB 1OVZA 5IJKA 1UB6A 3WNLA 1ZA6A 3ZL1A 3CCHA 2C5DC 3NIFB 4MS6A 4Y5VB 5HI4D 1VGEH 5EEWA 4ZAKA 2CO1A 2FJFB 2O72A 4RGMC 4LAQH 1SQMA 3G5ZA 2A9CA 5AYUH 4F7CA 1WUNT 2ZPKL 5B1KA 3C5SB 5I1EL 2JKRM 1A7PH 1VFBA 3ILQD 5E94A 1TTCA 1FBIL 3GLEA 1TO5A 4HMCA 4PVNA 4YDIH 3CFDB 1UG9A 3GEFA 4G82A 4P48A 4QCIB 3WY1A 3CZFB 2X7LB 3ZTCC 4M6MH 3ZHLA 2AANA 3UFIA 4B95C 1H0DA 4AEIL 3OLDA 1URLA 1XGZA 4LCCA 3QZNA 5J6HA 1AYOA 5EU4B 1QAWA 1IFHL 1R3KB 3MXVH 4PV8B 5EU6B 1WTLA 3C5JA 1O9WA 4GYBA 2H1PL 5DHVA 3LDBC 1NSNL 1M71B 4MAUL 4J3UA 1RD6A 3ET9F 4R7NB 2HG5A 2VAAB 2VDNB 4I1PA 4EQ3A 4M5TA 5DD3H 3QUML 3QK0A 1S6NA 2AJUL 3L3IA 1F4AA 2AQTA 4IEFA 1YG9A 3RWGB 3UOAB 2AMUA 3VDBA 4GG6F 4OUOA 4U3CA 4GP4B 1NM4A 4WU5B 4PVLA 4QOKE 1GGBH 3ZGHA 5I71B 5DFTA 4AYMC 3DYMA 1QG3A 4ZSOB 1QSVA 1E8ZA 4Y19B 4BE6A 1KXHA 2XU9A 2NY1D 4EUPG 3QG7H 4R90L 2CG9X 1J0ZA 3HG0A 3DTXA 4HHAA 4N3TA 1AIFB 2FBRA 3ARDD 2ZCZA 4M5SA 4R7VA 4AYBA 1XR8B 1OAZH 1XX9C 1S5HB 3VFMA 4G7VL 1CLVA 3ASWA 1O6TA 2ZWNA 3J8F7 3F7QA 3LPWA 4XNMB 1INQA 1U91A 4WNQA 2DLEA 3C8DA 4X0NA 4OZFG 3WIHH 2ZF9A 5D4JA 1J0KA 1UUSA 4NZUL 1TJIH 3RZWA 1T83C 4P23A 2JIXD 1UB5A 1OY3B 3UZVB 3U0WL 3TP4A 3S36X 4HUXB 3TO4D 2UXGA 4QD2E 4CVXB 1MOEA 3DK2A 4XOAA 2R2HB 5EIQA 3ZKXB 1HJBC 3E6FA 4LKCA 2ZX8A 2FR4A 1JFQL 4FFVC 2FHFA 1J5OH 2HT2D 3VFWB 2IV9A 2JSFA 5ERWA 3CWGA 5ALCH 2DTML 3BVUA 2YXMA 4AGPA 5KG9B 3BE1L 1HKLH 2Z8SA 4LFHG 4MAZA 3A4EA 2VZVA 2NW2B 4KY2A 2R2EA 1N26A 2JFCA 3BVWA 4R7XA 4U1SA 2AXWA 3AREC 1BG1A 1EA9C 2R2CA 2BVPA 3OWEA 4XNXL 3W3BA 4WO4B 1BXUA 1GY1A 5BRQA 3FB7A 3PIQB 3BPOC 2ICWB 3CH1B 4OI9A 1V7MH 3TEYA 5GGRA 3GSOB 3ZKMC 2ARJB 5FKPB 5D71L 3A6BH 3F7VB 3C6LA 2BIHA 1WCBB 3I50H 1AI1L 3NEOA 1N59A 1EAPB 5HGAB 5F88A 4X6EA 1DANU 1XF2A 5CKGA 1IBGL 4OI7A 5C0AE 4QOKD 4BFKA 1RPUA 1JGUH 1MHHB 2HH0H 2XA3A 3FUDA 1E4XL 3Q2VA 4FD0A 4L2YA 3VTTA 4ZFFB 4ELDA 4C83A 2AHIA 1AZZC 1DBML 4L9LB 2HX7A 2X9WA 3VFOB 4ZO6A 1IC1A 5D5MB 1QKZH 3T6XA 2CBQA 4IW4C 4ZUVA 2RD0A 3K7UA 3L9RA 4OD3H 2EO9A 5FM5M 3RTQB 5KYWA 4XVJL 1XGRB 5I15H 1UXWA 1GZHC 2P5PA 4P99A 3VNYA 2CQVA 3OMAB 4HS6B 1PJ9A 1S3KH 3QRGL 5F93C 1KIQA 2H26A 3JT2A 4NC1E 1H3XA 1VLXA 2RTTA 1BD2B 2X9XA 3PNWB 4JMXA 1CGSL 4PRAA 5IJVA 1DDHA 1JXKA 1RUMH 1YEEH 1AD0B 1SY6H 3QUKB 2OP4L 1XGYL 1P2CB 4DGWC 4M1GH 3DYOA 1UT1A 2F19H 3BWSA 3F01A 5LDUA 3GSWB 4JFZH 3FN0H 4B9KC 2XN9E 4YO0A 1T5WB 3MFGB 1NFKA 1Q72L 4HUMB 3SCMD 3VWJA 4AYGA 3MRIB 3HJ0A 3BUTA 3POHA 5ANME 3L3KA 3RVXC 3DA0A 2X09A 1ZLWH 3WNJA 3MRDB 1U95B 3TCLA 4DESA 4P2CG 3MR9A 2Q3ZA 2QGEA 1JHTB 3FU6A 3L3HB 3NCYS 3OGCA 4GQQA 3S7GA 3G6JB 4WK2B 4AIZA 4FQ1L 4WW1A 2UZXA 5G2NA 4F80A 4HPOL 4DK6A 1KB5A 3PJNA 3V6BR 5CGYD 2IANA 4HA1A 2VLKE 5C6WH 2WP3T 3MPCA 3ILEA 4OCSL 4XN4A 4YDVB 1LMKA 3QJUB 2HN7A 4WWOA 1NOAA 5EO0B 5C0AD 4ISVB 1UGNA 2MOVA 3QUYA 3VX1A 3EO0A 2R2BB 4GJTB 3RNQA 3P54A 5KSUA 4G5AA 3SDDD 2V9RA 5IHHA 2AZAA 2X05A 2OV0A 4KKAD 4PJDE 5JMRA 4P2OC 3SGEH 5K59F 1UA7A 2XYBA 4WCYH 4MCYA 2EDRA 1Q9OA 2AJZB 3MRRB 2VDQL 4X6DF 5BVPL 4XGZA 3O2DL 2YOAA 4M6NL 4OTXH 2P24B 3RURA 4UTAA 4XXCA 4EIBA 2O5ZL 2B59A 3PLYA 1WRFA 3OMZA 1CCZA 5J4MA 2EDDA 4O2FB 2ORBL 4NB7A 2CO6A 2UYLA 1RMFH 4RFEB 4OBSA 1XGQA 3VWKD 4PWKA 4QXGL 3UYRL 4TXVB 3CHQA 4HH8A 1YY8B 1NC2A 4BJLA 2LVCA 1ZIBA 2ZNXA 3GMOB 4KQ4H 3BZ5A 5CHNB 3RIFF 5AW2B 5EBLB 5KVDL 3WLWC 2G2RB 2H7WA 4Y2DC 3KCWA 1TKWB 5AAWA 2XN9D 2MWCA 4X8JA 1A4KA 3GBNL 2X87A 4NUPA 4PJXE 2CRYA 1F1DA 3T4AC 4AXWB 1V5JA 2C9VA 5DZJA 43CAB 4FL4B 3EJRA 3NFSL 4FXGB 3II3A 1K72A 2O5YL 2NZ1A 1NFAA 4GSQA 1YEDB 4GKSA 1DJYA 3FQWA 5C0BA 1XBRA 5I16A 1EFQA 2NZ9D 2VDOL 2FO4A 1UD6A 4Z78B 2EIKB 1SNRA 3SKMB 5K33A 3D39E 4RMVA 5ACZA 1JMZA 1IARB 1VZIA 4PJ9D 2VLKD 3TEUA 2E6PA 3IDGB 1TYRA 4JFWA 3O3BB 1DQQA 2YPLA 3NZ8A 4CW1B 1FO0H 2HCZX 4IJTA 3CMOL 3BI9X 4XVSH 4X80L 1G7PA 2F7RA 4YHYB 4YHLL 5HGBB 4Z7NF 1ZHLB 3DI2B 5TDNB 2IAAC 5GGTA 2BINA 3FT4B 1R3JB 3WFEL 4DTGL 1HSAA 2YMOA 2VWEE 4D8PA 4NKMA 5D7LE 3Q2CA 2MHAB 3BP4B 5F89A 1G7HA 1S7TA 3SDYH 5CZVL 3V9FA 1I8LC 1BX2A 5EFIB 1ZDSA 2A1WL 3FQXA 4PJ8B 1RAMA 1NUDA 4N0UA 1ZS8B 2MKWA 4V2BA 4JRWA 3MACH 4RFOL 3QDJB 4RX4A 4EMZA 3II1A 4KI5C 4N2CA 2DH2A 1LQBC 2YD4A 2LE9A 3KLDA 1GL4B 4ZFGH 4Z3HA 5JHLA 3SO3B 4CC1A 2B3IA 3QNYB 2F5AL 1UOLA 1X5YA 3LQZA 4X6CF 3MRPB 3SDCD 2Q1EA 1R19A 4QGYA 3JTTA 2VXSL 3TNMA 5FDWA 1D7BA 5C0DA 1FFQA 1NLBL 4X5LA 4QYAA 2XV6B 1EVUA 1UD8A 3C75A 3LRKA 4JO1L 1RV6X 4RZCB 3IDJB 3TJEH 1E4KA 3P0YH 3OKNA 2JCWA 1GCFA 3GLZA 1BLNB 1JN6B 2BCKA 4YGVB 2X70B 3FHEA 3IFPA 4PTTA 5IB1A 4LBEA 3VW3L 4F57L 2EYRB 3KM1A 3G04A 2BNRD 4NFDA 3UTSE 2X6CA 5I1CL 1MCPH 3RTLA 1QSED 5DD6B 4U4IA 3STLB 2R83A 3V6ZB 2OYLA 3MBWB 3CV5A 4N8CH 2K6ZA 3D39D 3TYGL 2DI9A 1YNLL 2PXYD 4PCSA 3VU1A 4JM2A 2DQ6A 1DVFA 4Y4KB 3CBKB 4ODVL 1XO8A 3LRSB 3U2SA 5FYKE 1FZJB 3J27A 1MIML 2DLHA 2VXUL 3OVUB 2VNCA 1AD9A 3QI9C 4A67A 1W72B 4PJBF 2EIZB 3KWWA 4N0CD 1QVOB 2XVGA 3X1NA 2PCXA 3QZPA 3BESR 4XBPA 4YFLF 2DQCL 2EH8H 1FLRL 2X53A 3WE1A 3D09A 5E0FA 2CRMA 2DWYA 2YRBA 4NUGL 5CAYB 5D9SA 4FA8A 2QSCH 3QAQA 2VLRA 2BJML 2BIIA 2EAEA 3CVIL 3C2AH 5F9JB 2XCMC 2QEJA 4LPTA 5CEXA 4HLJA 3U0TA 2Z7ZA 1U2YA 5D1XA 3TWYA 5KSAA 4QRUB 3KCPA 1AFVH 2IBGA 3WYRA 1R5WB 1N5YL 5EZJB 1AS8A 4FNSA 2VLLB 5C7XL 1LK3L 2BP5M 3K2UH 3GSVB 3V6OE 2BVUA 5HYEA 3V5HB 1UWXH 1IGCL 4WI6A 5CSZB 3IMUA 5CCKL 3CFKA 4FCHA 5IBUG 4BFIA 5GQBA 3M1OA 1MHCB 1YLBB 3HI1B 3C6EA 4XCFH 3N50A 4S1SL 1ROWA 4FQXD 2A5UA 3FUKA 3M1BA 3SE8L 2P7TB 2DQJH 1SYSB 5D55A 3VX0A 4X9GA 2BIPA 1BM3H 1MAKA 2QJDA 1DQDH 1PBYA 3PWLB 5AFAA 4F9LC 3Q05A 4G6JL 1PDKB 1I3UA 3ARTA 1RVFH 3UABA 2K0RA 3UTSD 1RH8A 5AZ2L 2CKBL 1G7JA 3B2UC 3EGDB 1D6EA 3IFOA 4UINH 3D0LB 3QJHB 1I53A 3D1MC 3GPSA 3KPRE 5AZEL 2NDFA 2GCYA 4MNHB 1D5RA 2W60B 5FYKD 1SHXA 4Q6IC 4BELD 1HQ4B 1AGDA 2PW1A 2DWDA 3LH2H 4PG2C 3GI8H 4HV8A 4JZOB 1HILA 1T22A 3VM5A 1ZLWK 1MY5A 2DWEA 3ISWA 4F37F 3TJHC 4HUKB 1RXLA 4ZYKA 5JPNA 3I9GL 2GJZB 4CJ1A 1ZK9A 3F65A 5DJ0A 4XBEL 4E9TA 4C47A 1XBDA 5SWSB 2WLLA 4IHBA 1NUNB 1NANH 2VDML 2XXMB 5EO1A 2LU7A 3DLQR 5LNEA 1T2QL 3HZYA 2NXZB 2KLSA 2ZOLB 1O6SB 5D1ZC 3NN8B 1PD6A 3I75B 4M3HA 3WENA 4HAFA 5L9DL 3HZVA 5IOPA 1WA2X 3EXLA 3TZVB 2EECA 1AP2B 4JQVA 2NNFA 1TENA 1T03H 2AQ1A 3WXVL 3WD5L 4Z3TA 4W9ZA 1QWHA 4XE0A 1KCVL 1Z9SA 3IJHA 4HSQA 1FNAA 4OFIA 4M93B 4YFLI 4BM7A 3H54A 4PS4H 4KZEH 1UWGH 4B5EA 1ILUA 1AOHA 4PRBA 3BSZH 4JPIA 3QYMA 1T89C 2ZSWB 3MLSL 4X4XB 3I2CH 3B9VA 1C5CH 4KVNH 4XCNA 1C8QA 3IE4A 2EE9A 4Y1AB 4HF5H 2QR0B 2AS5M 4XAWH 3BGFC 2VDPB 1TPXB 2A77L 3JZ7A 2Z31B 4J3VA 3RWFA 4I0PB 1CFTA 4N2HA 2SODB 3TA3A 5I9QB 1ASOA 1CTNA 4NCC2 4WVRA 1NAMB 2E9GA 4R7DB 2IGLA 2B20A 4APQC 4MKTA 1Q9LB 2J2ZA 4IRJC 1U8CA 3TT1H 5HDBF 5HYQB 1TZGL 3Q8FA 3B5TA 4KPHH 4OM1L 2PP7A 4YPGB 3ZIYA 4ERSL 2EDBA 1QTYT 4NN7B 4ZPTB 3SDAA 5C0GA 1RPKA 1I82A 2Q7YB 4PJIB 3FK3A 4NRZB 2DYRB 2HXAA 2EXWD 3JV4B 3C08H 1UB6B 3PV6B 1XIWD 4WWKD 4WSKA 4XZ4A 5CLYA 3OKKB 4GMTH 3UJIH 2D73A 1O5PA 4W4OC 4LARH 3WTXA 3PUCA 1CBVL 3FBKA 4L4TB 1DJWA 2CDFA 4IBWA 1QLRA 3UTTD 3B7TA 5MERA 3NSYA 1IIKA 1VFBB 4BHUA 3V0WH 1EH9A 5F7AA 5HP5A 4QRRD 5DJZB 4XP1H 3K74B 4RIRA 1A14H 1EEUA 3PNRB 3U7WL 3BUBA 1GYWA 4ZMVA 4FG0A 1R3IH 3P2BA 4PRNB 1XF5B 3MLZL 1QBLH 3BLBA 3LNGA 1I1FA 5JW5A 2DY2A 5E9DE 4OLVH 3C9NB 3JWNC 5LJYH 2HRPL 2HTKD 3PXLA 2Q7NA 4NBXB 3KG5A 1YQVL 4CUCA 1DBAH 2XYCA 4PB9H 2AQ3A 4F92B 4QY8B 3P4OA 3WFDH 1U93A 5IR1B 2EH7H 3W82A 3VAEA 5SWZE 3E1F1 5E70A 2WZ5A 1AR1B 2I26N 5JOFA 2F0CA 3I6LE 1QSFB 3NJFA 1KGYE 2FQFA 1JTOA 2ED6A 4F9PA 2XTJD 4IMLA 4PJEE 1J0JA 1E40A 1RUKH 4ETQA 4FKHA 5L4JA 1R24A 4HKZA 2ZCHH 4IEFB 1FUNA 1AHWA 3D85D 4G6KL 1V7NL 4BHUI 1TIUA 1BVNP 3E3QC 2G0LA 1C5BL 3T0EA 1KBVA 1D6VH 1BQHB 1TZHA 1R5VB 2VN5A 4ZS7L 2W65B 2JLPA 1KCKA 1YEJH 5DQ9B 4HXAH 3IJEB 1CDBA 3NIFE 4WHYH 2N7SA 5K9OB 2HLAB 3EG9A 4FP8H 4CSSA 2EXYD 4ENZA 1ZEAL 4C56E 4O2EB 2A74B 2P8PA 5IGXH 1TR7A 4LOUD 1IU1A 4GRLB 4U33A 2EUZA 1CLOH 5E2VL 1IBBA 2CZNA 1JRHI 2IGFL 2KQNA 2APVA 2VISA 4I18A 1K6QL 3ESVF 3EGSB 2AQNA 3LH9A 3NEEA 1YMMB 5JHDA 4NZRH 4P5TD 1PD1A 5LWYH 1D7CA 5CWSB 3REWA 3MRKA 5E7FA 4P46A 2ILLA 3E6FB 1FFPA 3M07A 5IUSA 2FR4B 3DHUA 5I18H 1IC5L 5EU6E 2NY6D 5E9DD 2KYIA 5ERWB 1OF2B 2H1XA 3DX6A 1D5XA 1YN7A 1FH5L 2ITFA 3O6FC 4L0ZA 4IDJL 1WBXB 1ZOXA 1JAEA 3QJZA 1S78D