1OK8A

Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
394
structure length
380
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dengue Virus Envelope Protein After Membrane Fusion
pubmed doi rcsb
source organism Dengue virus type 2
molecule tags Viral protein
molecule keywords MAJOR ENVELOPE PROTEIN E
total genus 68
structure length 380
sequence length 394
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ok8A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1ok8A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1ok8A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1ok8A03
5LBVA 5JHLA 3UZQB 2I69A 2JV6A 2R69A 3N42F 5LCVA 3MUUA 5IREA 1Z66A 1TG8A 4AL8C 2P5PA 3UZEC 2R29A 5LBSA 3P54A 4X42A 4AM0Q 5KVFE 3C5XA 3UAJA 1OANA 5JHMA 3UC0A 2JSFA 4UT6A 1OK8A 2V33A 5H37A 3WE1A 2H0PA 3UZVA 5B1CA 1S6NA 3J2PA 5AAMC 1RERA 4ALAC 1UZGA 3N41F 4UTBA 4UTAA 5KVGE 3J27A 3N40F 1SVBA 3G7TA 4UTCA 4BZ1A 4L5FE 4BZ2A 5IZ7A 1Z3RA 3VTTA 3UYPB 5KVEE 3N43F 2ALAA 2HG0A 3N44F 4GSXA 2GG1A 3I50E 1URZA 5KVDE 5GZOA 4UT9A 1PJWA 1OKEA 3IRCA 2JQMA 5GZNA 5AAWC 4FFZA 1ZTXE 4FG0A 4GT0A 4FFYA 3C6EA
chains in the Genus database with same CATH superfamily
4UQ2B 4C4KT 4J6RH 3P3SA 5JPMA 3AQZA 5IGXH 2GFBB 2HG5B 3D39A 2H1XA 4HIHB 4XCNA 4YK4B 2B39A 3T08A 4DO6A 4MRCA 4AGLA 4U1KA 2K4AA 2CK0H 2RACA 2VLRD 4HZ1A 3RDTC 3V0AC 3PXHA 4DPRA 3MRJA 4F15B 2JB5L 4CU6A 1VESA 5HJGA 3O0LA 4A66A 2OW7A 4K8RC 4PW4A 2C1PB 2EVHA 2ZOLA 3ZDXF 2VAJA 3PJNA 1XCTA 2CDGB 4JN2A 4DH2A 2OZ4H 5IUCA 2MKWA 2P9RA 3G08A 4S1QH 4FL4C 3K1DA 4P59H 2Y36L 2NX5B 5F7YC 3RDTA 2VXUH 4XH2B 3FO0H 3V5DB 3BWUF 4OLVH 2VKXA 3WD5H 3NIDE 3VG9C 4KNQA 1JGIA 3VXUE 1ICTA 1I1AC 1R5VA 1V3MA 2F9BT 3AXIA 4MJ5B 4RBPK 5CSZB 1KCSH 4G11A 2BNRE 4GUPB 1FIGH 3MACL 1XL6A 4ETYA 4G7YL 3TH4T 1MFDH 1WZMA 2WXNA 3BPCB 1IUZA 3L9BA 3UTSD 3G7TA 3LY6A 3F2LA 1AOHA 3C5ZA 3ROLB 4ZW7A 3FT3B 1A66A 1S9VB 1T2JA 3HCVB 3ARXA 4JFPB 4X7DC 3MRGB 4IGBC 3SY0B 4PWFA 1X4YA 4L2YA 5BJTA 4HJJL 5LXVA 1WBZA 2VDRH 2LGNA 4HIXH 3QXAA 4OF3A 3I9AA 4UF7C 2HPOA 3UYOD 4F5CE 1KMGA 1FI8C 3KPMA 1H6UA 4C4BA 4N2DA 3BH4A 3D39D 3DX8A 3B2XA 4UV7L 3HPLB 2BHUA 3QDME 3RNKB 3T8VA 2FO8A 2C4FT 4MCNA 3N43F 3O2WL 3GZKA 2EXTA 3MUY1 4NKMB 5HI5D 1A1NA 3RKDD 3V0DA 1BXUA 3MV7D 4DT2A 3VM5A 3IB4A 2XWEA 4EUPA 3OKYA 2E86A 5AFAA 4KKBD 2CO6A 3O3AA 4D0DA 4DEWA 3IJSA 1AKJB 1TNMA 2VUYA 3O3UN 3VQLA 1AS6A 4XOCA 5F88A 3WHXA 2WVSA 1FZOB 1S5HA 1I3GH 3CQQA 1GS7A 4BSWA 4IBUA 2OL3A 1H8SA 1OTSD 4Q9BA 3GSNH 3OXRA 2F19L 4I4WB 4JO4L 5FYKL 1N19A 2N3JA 3EGDB 2CUIA 1JYVA 4OZIB 3TFKC 3RL1A 3BW9B 5CSGA 2GIXA 4GBXC 1VZIA 2X41A 3H9HA 4GQPH 2GIMA 5CILL 5D6CB 2VMCA 4JEGB 2BHFA 5AVTB 1QLEL 1RVFH 4WEEA 3QI9D 5D1ZD 1YEHL 1J8HA 1RK0A 4F7PB 3U6XS 1D6EA 4LVHB 1K5NB 1L3NA 1T20A 2QV2A 4HFWA 1MDAA 3BZ4B 2NT1A 5EU3B 3P4OB 3QIBA 4IOIA 3MUGA 3QH3A 2W9DL 4AG4H 4H88L 1OAXL 4EJ1C 1UKSA 4NO2A 1CDIA 4U3CA 3NRQA 2AQQA 3OM3B 3ERXA 1FNGA 1GSMA 1NGYA 3IMTA 3X13A 4K23L 2EYRA 4PJDB 1K8IA 3PQYA 3P2TA 1ACYL 3P9LA 3T6VA 3QIBC 4IKIA 1S46A 1YEIH 4TVPD 4JHAL 4XPFL 2DLFL 3C6SA 3FUEA 4YHNB 4QLRA 1E4HA 2YUVA 5D7JC 3QG6A 5EIVA 1WJ3A 2XLLA 2Y7QB 1IU1A 4JFWA 4N2MA 2RFXB 3ARZA 4S0HA 2BWDA 4QXTB 1TU2A 1R3IH 3AGWA 3OGCB 1AQMA 1MZZA 4W9IC 1PX4A 5L88L 4OZIE 3CFDA 1T3FB 2XKUA 1HX0A 1QR1A 3L13A 2VDOL 3HR6A 4U1GC 3VI3A 2FHBA 4IRSA 5JDJA 1OAKH 1VEOA 3WNIA 4GINA 4JDTH 1AP2B 4WJKB 4TQIA 4YDKH 1COBA 1SBSH 5DHVH 1F86A 1FNHA 2R1YB 3G6JA 4E0RA 2F15A 1AFVH 3MJ8B 5C07A 5I74B 3KL0A 3C6SB 5ESAB 5CSZA 1OIOA 1USQA 1FLTX 2DWEB 4LCYA 4C54A 2WINA 4IRSC 4JREC 1QFWI 3L4TA 5AW2B 3VXPB 2KZWA 3N2JA 3KPNA 3LHPH 3RVUC 3ZLQC 3PDGA 1EZVX 2FBOJ 1MVYA 5DSCA 4HETA 2XN1A 4KTEH 4OCSH 4MCZA 2K78A 4JDVB 1HL8A 1A8JH 5HGHB 3C6LD 4L05A 4YVUA 4KKBC 1TJHH 2CCLA 2CHWA 2GY5A 3CDZA 3QAZC 4GXFA 2Q3XA 3Q5TA 3DX6B 1T1XA 1GYUA 2ZYRA 4FA6A 5AKRA 4XNBA 2ADFH 2Z35A 4NLAA 3Q0HA 1A6TA 4OF6A 1J9RA 4ZPVB 1INEL 3O2VL 3E9UA 2ARJQ 2CIIA 2RD0A 3ZZLA 5I2IB 4MDRA 4MDIA 3RFZB 2BJMH 5JMRA 4O9HH 2H5UA 5C6TL 1Z0NA 2OJEA 5DZNA 4D2NA 2WBJB 5KSBB 4BFGA 3IXAB 1T66D 1AGEA 3OBAA 2OYKA 1DVTA 5ABAA 3DX9B 1UOLA 2PETA 5D7LE 2F58H 4QT5B 4XB8A 3FXIC 3K1KC 1OSPH 1LDPL 2HVJA 2X0WA 5IQMA 3HNSL 5TDNA 1QTYT 2F7OA 4GG6A 1AKJA 2IFFH 4JK0D 2ZXBA 1DQQB 4H8WC 5C0NC 3H6JA 3MLTA 5I0YA 3THMH 5MEPA 3GSUA 2F1EA 2DLFH 2MHAB 3D50A 3QWOB 5B8CA 5B7EA 4M7LT 4HIPA 2VN3A 3GWJA 4TQPA 1QUNB 4AOFA 5A7EA 5KSAD 3OXRB 3O6ML 1J18A 1LGVA 3NGBB 4Y19D 5AENA 1CVSC 1TCRA 2DWTA 1E6OL 4PJ5D 4QTHB 1HN1A 1WA2X 3Q8CA 4O2EB 4CVXA 4EEEA 4NO0D 5FUOL 1FZMB 1URIA 2R1WA 1THCA 2BXZA 5CJXC 3HBGA 5JTWA 2A2QT 2LFEA 4UM8A 1GS8A 1BW8A 2DQIH 3TVMB 2CO4A 2VDOH 3C6LA 3HJ0A 3MFFA 2K3HA 3WKML 1FSKC 1G7JB 2EDTA 2VAAB 4KXZI 5DT1L 4MNQD 3JWDL 1MWAL 3WXWH 4PLKC 3FFDB 3WDHA 1U42A 3BQUC 3SZKC 4K5NA 2O61B 5L9DL 2QSCL 2NX5D 4GP8B 3VFUA 2K7QA 1LO4H 1KG0B 4MHHI 2ZWNA 5H94A 1A6AA 2XA3A 1V7NH 3PFQA 3F05A 2AEPH 3JUZA 1G4RA 1PEZA 3KCWA 4QTIH 3BQUA 3NA4A 4QRQA 4E9WA 1HOCB 3QNYB 4UUJB 4KZDH 4NB7A 4YC2C 2PYFB 1A02N 2GJRA 2Z92B 3PDOA 4LO9A 3BESR 5FUZL 4Y8AA 5ID1A 1LO0H 4P5TA 4XGZB 5D1XD 3PUUA 4GUQA 2VLMD 4BD4A 4WW2C 1CDUA 1W6WA 2JIXD 4MAYD 4Y5XC 1Y18A 3Q8AA 3V5HA 2H2SC 4ZMTA 2J6EA 5DS1A 3RVTD 1JIBA 3NAAL 1KY6A 1CF1A 3EBGA 4JVPA 3AREB 3LKSB 4P5TC 4EKXA 1QR4A 5L2KB 4QRSB 1T1WA 4V1DA 4HPOH 3BAYA 1I3UA 3TTYA 5AOZA 3GD1C 1BZ9A 3PNRB 1CYWA 2X2JA 1MFCL 4ILDA 3JWNC 4P0DA 5D4JA 4N28A 5GRUL 2X3BA 3UX9B 4HKXB 3GJFA 1BM3L 4NNYA 3MKKA 4NXSA 4QI3A 1UB6B 3FO2B 5DVNA 2AXWA 4C83B 4FYRA 43C9B 4ZS7H 5AW7B 2F19H 5CAYB 5JNYB 2BCKB 2ZWSA 4HHGA 4ZUUB 1F4XL 2XPYA 3EGSB 5KVFE 3WY2A 2G30A 1ZA6B 3B2VL 4QHMB 4OH2A 4HKJB 2YD3A 3O9WD 5F89B 5C0BE 3I6LD 2BC4B 4JPIB 1GYAA 4JR9H 5EOTB 5I1AA 4ZX3A 5GIRA 5DRXA 3HG1D 4ZAKB 3VTTA 2OR9H 2QGBA 1JPTH 3I50E 3RY5A 4AK2A 3DECA 1QBMH 4K15A 1XD0A 2ENPA 5FCUH 2Q3ZA 3T4YB 1A9EA 3MJ9L 4IHOB 3OD3A 3HAEA 1ND0B 1PX3A 3ZHFA 1PEWA 4E0RB 5FKAB 3QI9B 4MGXA 4CKVX 3SQOL 4JO2L 3GSVA 3OWRA 2WNXA 5TPWH 3VD5A 4Q56A 4KQ4H 3HRZC 4UT9L 1WC7B 1VFMA 3IAPA 2KS0A 4KFMA 2ATKB 3FPYA 1ANUA 3LZFH 3GSXB 4PJFB 1BIHA 2K45A 1LE5A 2VLJA 3NCFB 3CBKB 1MLCA 2WP3T 4HF5H 3HRZA 4PB9H 5C0GB 1OOWA 3FN9A 4WWNA 3EDJA 4MWFA 2QQNL 3T2NH 1NCJA 4O2CA 3TFBA 1WDAA 3V4PH 2I9TB 3BUYA 5I6LA 1WFMA 4XOAA 4C58B 4ODWB 2RMNA 2E4FA 2OTUA 5DURD 1MRCH 2V2TB 1M3IA 1S7TB 2CO7A 5B3SB 1MZYA 3W5NA 5F3HB 1AHMA 3P73B 2VZOA 3UO1H 3I6KA 3LB6D 3NSYA 3P1VA 2KMWA 5D7LA 4YDVA 4EVNB 2BP8B 3NJVA 3L5XL 1RZ8A 4AQ8C 5I24A 3BPCA 3GTVA 5C9JB 1XCQB 1SZNA 2W65B 1GL4B 2Z91A 3S96A 2GBUA 3S5ZA 4L0ZA 3BZ4A 2YRLA 4HBCL 1WP6A 4XB7A 1XGTA 2FJGB 4XMKH 2UXFA 3B5TA 5HYJD 4MXWL 3UG3A 4GIPD 5EUOB 3CZFA 1BD2E 1NCDL 2AV1A 3MRNB 2WQVA 4LEXL 3KPLB 4Z7UF 1OQXA 5I8OL 1C9SA 3ETBF 1KGIA 3O45A 3SPHA 4TL5A 3A67H 2YD5A 3AT0A 2WC7A 1ORQA 4M56A 4OZHE 1IZKA 1Z3RA 1N8OE 1SOQA 2FECI 4MYPA 5BOZG 4S0TD 5IB4B 4OFYD 1N5YL 2V2TA 1IJ9A 3N40P 4YEFA 2PP7A 2WJ7A 1MW3A 3DOSA 3AABA 2WXIA 3D18A 4KXZH 1XF5A 3ULUE 1F3RB 2QLYA 4XO8A 4Z78A 1LL1A 1W72H 2XTJC 2ZAGA 3QDJA 4CMHB 4L3EE 3DX1A 3KBFA 4HEPG 1S7QB 4QY8B 2B9AA 2B1OA 5E9NA 2OP4H 5JUEL 1PYWA 4BBWA 5T1KB 2VUKA 4JFEE 2WUCL 1MAKA 3FUMA 2QELA 4XVUC 5B7FA 2BWIA 2HAZA 3SB3A 1JE6A 1O6VA 5DI8A 2DWDA 1F2XK 4FLOA 4NYLA 5E2VL 5KN5A 3D69A 1J0KA 1TZIA 1WC7A 2YPLE 1XF3B 4N5ED 4QRUA 2WBJD 4MRBA 1JDDA 2OSLA 2C1OA 3AG3B 3GXNA 3DC0A 1W2KT 3G6JB 4YHKL 5DZOA 5SWSB 2VLJB 1OAQH 3TIDA 4FEMA 1L9SA 4AM0B 2YEZA 5ECJE 4OI9A 3K91A 4L0YA 2CU9A 3OAYH 2EE6A 5PAZA 2J8HA 1Z9PA 5I1KH 4EI5A 1DO6A 3EDEA 1BPLB 2YN5A 4NQCD 1CO1A 5CF3A 2EIKB 2M2DA 4K94L 5HYJA 4PJIE 3WAJA 5F0LB 1XQ4A 1FHNA 7FABH 5TE6H 4YXKL 4MA1B 2A6DA 4E42A 2Q10A 2QADB 1KXHA 4NX0A 3MN8A 4FXGB 2JCCA 5D2NB 4AQEB 1A9VA 2CG9X 4E68A 4K7FA 3F7VB 2FX8L 3ZDZB 3NBNA 1IAOA 4ABVA 2FJHA 1A4AA 4NQEB 1NZRA 4NQDB 5T8IA 5JHMA 2IG2L 4J2XA 1NICA 2AJZA 5CGYC 1X5YA 1WVZA 1A5FL 3BT0A 4OF8A 2GSMB 5A2BA 4JL2A 2ZX8A 4KNSA 3RL2B 3BZEB 3WL9A 3UYPB 4YSPA 3U4BL 4PRPB 1ZLWH 4PGEA 2ZXDA 3II2A 1KC5L 3KH4A 2HRLA 4M29A 4XMXA 3C9NA 5GSVB 3FYIB 5DD6A 3EH4B 1EXUB 4KZDL 4JUTA 3MV11 3RNQA 3W39B 1NBZA 3R0MA 4RGMB 4NCC1 4BFOA 5D70L 5MERB 3T09A 4AEHH 2V6HA 4LSRH 4DVBA 3SE4C 1MCOH 1BV8A 3C2SA 1DBKH 3CXHK 3EJZD 4GYBA 2IDTA 2IGFH 2X4OA 5FM8A 5A16A 2YD1A 5DRWA 4NQXB 1RIVH 3SD2A 2R1YA 3L17A 2H6PA 4EI5D 1DBML 3L3DB 1UWYA 3SJVD 3PGFH 4YDLB 4Z3IA 3PCYA 1UXWB 3K5RA 3DPBB 1QHQA 3II3A 2VISA 4X99A 4Z5RA 3SE4A 3CZJA 3ISYA 3QJQB 5DQJB 5AVQB 1NC2B 4G1MA 3VDAA 1Q9LA 1BAGA 1ITBB 1DQDH 4HC1A 4M3JA 1OT1A 4PREB 1SDDA 4LSUL 5CMAA 4NNXB 1MRDH 2YD0A 4MJIB 4OF7A 2YLHA 4BELD 4FFWD 5DD6B 4HAFA 4OIIH 4P59L 2XRAL 1GY2A 2YEZB 1L9NA 1KGYE 3ARFD 1KG0A 5J3HD 3L6FA 1YYCA 4I1RA 4U1HB 4NUJA 3QIWD 1BF2A 3EBAA 3OJDA 5CR1A 1A3ZA 4M6ML 4P9HL 2A73A 4OSUH 5FB8B 3F58L 5IJKC 3REVB 4G9FE 4AH2B 2BX5A 2GEQA 3MRQA 2G2RB 2G60L 3P3UA 2GHZA 4LPWA 4Y2NA 3CSFA 3V0EA 5AD0B 7FABL 1WD9A 2YUZA 3V5KA 1IBGL 4XNYL 1TQVA 3ULSA 4FTDA 2YQGA 1KBGH 5IJKA 3MV9B 4JFHE 1AZRA 4B95C 3B4NA 5J6HB 3G5WA 2PW1A 1UCBL 5E6YA 3B2DC 4JLRB 4LOUC 5CJOH 3L48A 4MJ6A 5DRNB 2VM3A 2BNRA 5FKPB 3AWGA 4LPVA 4HUVB 5B4MD 3RA7H 2W0PA 4OLVL 3ASNB 1N4XH 4A7TA 5J56B 2VGLM 2UV3A 4NP4H 4H2AA 4GG6E 1DE4A 5LUMA 1TZGH 3QEQD 3IFNL 5I1LB 1LO3L 1MJJA 2NNAB 3D52A 3QUYC 3RNQB 3WO3B 1LHZA 2BNQD 4NUQA 1FO0H 3L95B 2Z35B 3QULA 2CMRH 4LK4A 4M7KL 4Q4EA 3UFIA 4FN0A 3ZIMA 2NY7H 1W8EA 5J6HA 3HIZA 3GB7B 4K94C 3SE3C 4GW4B 1ACCA 1JHTB 5D5MF 4XMZA 5E0FA 2EIZB 1OW0A 4LKCB 4ABWA 4IU2B 3T8XB 5K69A 3NCXA 3NQIA 3RDTD 5HYQB 3T3PB 3OMNB 5ADOH 4TQEH 3UBXB 4FS0A 3TWCL 4OAWA 4JY6B 5EA0L 1E2WA 4NQDA 5AOKA 4AYMC 1G7IA 4PGBA 5ESVA 3CHOA 2XA8L 3KWUA 5AOLA 3N1FC 2C3XA 3QJZA 3H9ZA 5B4MC 2WNWA 4LF3B 1A6VL 1RIHH 4R7NB 5DUMH 3A67L 3V4PA 3W56A 4F8PA 1Q1PA 4PJ9D 1QBLH 3QAQA 4YHZL 4XPBL 3RJDA 4FQCL 1A7NH 3QZNA 1J88A 4N1HB 1SYSB 4P57A 4GO8A 4PQXA 2MPVA 1CT8B 4KRPB 3QJOA 4MA3B 1A1OB 1A6ZB 3BAIA 5FYJH 4BHUA 2Z0BA 3MR9A 5J5EA 5ETUA 5CBEA 3REWB 1MI5B 1N12A 5EZLA 4R9HA 3WHE0 1G87A 4GKSA 5D4HA 1KIUB 2NY5H 1O6SB 2X4PB 1C8PA 1R1CA 2A6JB 1FC2D 1QP1A 1DVUA 3MODH 4J3XA 1A7RL 3NJXA 3F7QA 3LNEA 1SPDA 2JXMA 3QIWC 4MMXC 1BZ7A 4P46D 1C12A 4EO5A 3GMLB 2YUXA 1XH1A 2IWEA 3BKML 1B3IA 4B9CA 4ELMB 3NIGB 1NC4D 4CC4C 2CE6A 4QLWA 4UWQB 2KUTA 3CFJA 4J3TA 4ONFL 2B2XH 1PZSA 2ZUSA 4KGLA 4BZ2L 1RD6A 1QVOB 1MUJA 4OZGE 1JXJA 4I77L 1EAPA 1SJMA 1W91A 2XZAH 3P9WB 1WLGA 4LOUD 5BXFA 1TZGL 3VA2C 4N0CC 4HAGA 3ARYA 5SWSD 1MLBB 3NP3A 4PP2B 1ORQB 2A74C 4IDLA 1L9OA 2JNZA 1T1ZA 4C56A 3UXFA 1NMCB 5DA0B 1OTSC 4MB5A 3RVVC 5E51A 5DD5L 4FOMA 3QI9A 4YHIB 1MH5B 2BIHA 1HHKA 4A7SA 4Z77A 3T3PF 4C47A 4ATWA 2WWMC 4KOBA 1OLLA 3QUYD 1F18A 4E2OA 2GBTA 2IVFC 1BREA 2UZXA 2WVVA 2XN9B 2IPTH 4B53A 4QYOB 4TRPH 1ACYH 4G6FB 5LBVA 1HI6A 2CLZB 4JM2A 5BRZD 5HGBA 3G6DL 1AE6H 5EDXA 3KPSE 2X4RB 3D0AA 2E7MA 4IKJA 2QPEB 2DQ6A 2I60L 5AL0A 4LQ1A 4AIEA 2V2XA 3FCSA 5F21B 4P2OC 1YO4A 3RILA 1TOXA 5FKPA 4LRNH 3PPEA 4K5OA 1XXDC 4PR5B 4PW9A 3EFOB 1MAML 5DJ2A 2E9WA 5GISL 4P4KC 4L4TB 2N56A 3F65A 1PKQA 2GTZA 1MHCA 4C56B 3H9SB 4HUMB 2EDRA 5TE6L 3HC4L 2HT4C 4WHYH 4PV8A 4JFDD 4P2OA 1VFBB 1BQUA 4JRYB 3OKDB 3FJTA 2EVFA 2NUPB 2BZCA 3C6EA 3VFPA 2G0KA 3QO1A 3GMOA 1NCOA 2YXVA 1EGJA 3UGUA 3PWVA 3NPSB 4OY9A 2VUOA 3WTXA 1OAYH 3LKQA 4ZFZB 5SWQA 2APSA 2FYYB 2PPDA 2V17L 3ZRSA 4KMTL 1OZUA 2DQDH 1AQHA 3EGXA 2C26A 1R9FA 3OKKA 4XBGB 2WTRA 2LU7A 3ESNA 4AYEC 4DOHB 3K6SB 4IRZA 4LCUA 1HYSC 4FQPA 3MLWH 5J6SA 1HSAA 3VTMA 3MX0B 1DLFH 4HAKA 4DN4L 1A1MA 1DQMH 1YUHA 3X11B 4OV6F 1CI3M 4JMXA 4OUUB 1UM4L 4FFZA 3S8WA 2AERT 1NPUA 3VD0A 4L29A 4E5XB 3WNOA 4R26H 4DN3H 2DB8A 3W38A 1ZHBA 3BQUB 2KHAA 2HYMA 5FFGA 4PRHB 3TCLA 1P7KB 3PHSA 4PMFA 2GPZA 5C0DA 5A6IA 2ZXGA 3AITA 2BWQA 2PYFA 3BE1H 5JLZA 3OZKA 5FGBC 5EORH 3WTWA 1W0YT 4YHMH 3CFEA 4KDWA 5BUGA 4X0NA 5L9DH 4XBPA 4Y16C 1PD1A 4OJDH 4NJ9L 2FJFB 5D8JH 1L5GB 3S37L 3UMNA 4P57B 1KGUA 5ICXB 4FYSA 4Q97A 3SGKA 1NFDE 2CBQA 4G9DA 5I18L 1KXTA 1JD9A 2Z7UA 1MH5A 5FGBA 5A6LA 1EDHA 1X5LA 2AEPL 2AEWA 3PQYE 3WS6A 5FGSA 1F56A 4UILL 3WLBB 1XCTB 5KSUA 3QEGH 1UADC 3PP4H 2WQUA 2VDLB 5ESVB 3PPSA 1DN2A 1ZWIA 2VWEE 3KLQA 4YNYB 5A7BA 1SBBA 1YYMH 2LVCA 5DRZA 4WEBL 3WIIH 1HESA 3GS7A 1M7DA 4PI2A 4ZW6A 3FCSB 5SX4H 1WG3A 1JWSB 2IMNA 1AY1L 3IDMB 5GRWA 4HJGB 2CCVA 3J7HA 1AGDA 1JF6A 4LVNC 5IV2B 5EOCH 3T0BA 3TT3H 3DHPA 2LVEA 4M5YL 4U1MB 5CJ8A 2VDKH 2OMTB 4OLYL 1LO4L 2HRPL 4TOYL 3FB7B 2ODIA 1JGDB 2UUDH 4X6FB 3ALWA 3ZMEA 3JTSA 2AP2A 4UIMA 3KW8A 2XETA 1YJDC 3NTCH 1HQ4B 2IPKB 5B1AB 5BQDA 4NO0A 3SGEH 1YMME 2CJUL 1AP2A 1JGVH 4L4VD 4F8TA 1KYFA 2EIEA 2Q6WA 3FCBA 2LU4A 3I9PA 3ZDZF 1IAII 1GZPB 2PCPA 3I75B 5HHPB 2I25N 2CHZA 5GSRB 4YBQD 2N0MA 2CO1A 3H9SE 2R9HD 3MTRA 5BW7A 4XRCB 5DJYB 2HUHA 3TNNB 4B27A 5IV2A 3F83A 3RIFK 1I8MA 4EUPH 2IEPA 2DQEH 3B9AA 2FH6A 3FO9A 3OX8B 3KHOA 4P4KB 5HDLA 5GQBA 5JIHA 1R4XA 4Q0XL 4DK5A 1ZJBA 2RIKA 4NAMA 4OV5A 4Y4FC 2JJWA 1NGZA 5GJSH 3PWPE 1C5CH 3L3IA 5L88H 3EBIA 1FLRH 4KK5C 4TS6A 1OCRB 1Q72H 5D72H 5HHMB 3CMOL 5TH2A 2AHIA 2NY2D 4LU5L 4LDOB 1IQWH 1DJZA 4QRTA 1IC5L 3SSGA 2WOYA 3LN5B 4Y4FA 4PGCB 5K59F 5D1XA 5JPNB 1UD4A 4I0KA 4Z7OF 3BVXA 4OGAC 2LR4A 2YPLA 4FNRA 3D18B 5FM4A 5C0JB 2BMKB 4XVUD 2PW2A 3M8OH 1MIEL 1KJ2L 2XN9A 1PF3A 4KTGA 3KCPB 3VH8A 1L6XA 3D2UA 1MW1A 4IHOA 1V7ML 3CHQA 4FXTA 1OTTD 2YUWA 4QRPE 3NCYS 4P2QD 4KTEL 1KUMA 4ONFH 4WUUB 3MRNA 4UQCA 4IIZA 3ARGA 1BJMA 4ZW8A 1T6BX 2BSDA 2HTKD 4NZTH 1QHOA 4OZGB 4AMXA 2YGPA 4EIGB 4Y9CA 3QQDA 2WVUA 2LAAA 2QQLL 3GHBH 4G6AC 2VXQA 3ZOAA 1FYTA 4P2CG 2RCSL 2EE2A 3SKMA 1I8IA 1OAKL 3HBPA 3B6SA 2BW5A 2ED6A 3H55A 3VXME 1CGYA 1CFMA 2FEJA 2WB1A 4XOBA 3SYQA 4MXWH 1YEWA 5I75B 4DF9A 1ZDSA 1OAZL 3TBVA 2NY4C 2Y1VA 4NERA 3CFKB 4MD0A 3RUGA 2OTUB 3ZY7A 3U7YL 3P0YL 4Y5YC 2XUWA 1A6WH 2D4DA 4B5ZA 4BCYA 1FN4B 2WLNA 1MFEH 4H1LA 4LLAA 3VXSA 1D7FA 1KN4L 2X2YA 1IC1A 4EIZC 5KYUB 4N25A 1MEXH 2P80D 3MRRB 3BIAX 5CWSB 4WGWB 3NZ8B 5DFAA 1K4CB 1HDMB 3GTTA 4PV9B 4AENB 1BMZA 3QQ3B 1UH4A 3FS9A 1OAUH 4RFNC 4KNUA 2EDQA 2FTAA 1YCSA 1DCEA 4LB8A 4NO5B 5BVPH 5F3BA 2G0LA 1I9RL 5A43C 3V79C 3DSNA 3SOBH 1HOCA 4UUJA 2GHWB 5EPMA 3MLTB 2QQNH 3MRKB 3T2NL 3W9EA 2DY2A 4NPKA 1S4IA 1IKOP 3E8VA 4QXTA 3EHBB 5ELIA 1JZ8A 1BVKA 4XN9A 3LD8C 3QQ4B 4HS8H 5E2UL 2A9DA 4FG2A 1EHNA 4G8EB 4YE4H 1NCWH 1R19A 4Y1TA 4OCYH 3KLKA 3WGVB 4G71B 1EK3A 3BAXA 3DIFA 5CKAA 1LWRA 4E41B 1F4WH 3STZA 5TE7H 1IAIH 2VLJE 1KENL 3NIFB 2IAMD 5DR5L 1N26A 4JG1L 1WV7T 4NI6A 1ZMYA 2IADB 5AYUL 5K93A 3ZTEA 3T0EA 1FH5L 4M00A 4MA8L 1DBAH 1KYUA 2VC2L 2Y5EA 4RAVB 4AY0A 5TQ2L 3UCRA 5JR1H 5KW9H 2APBA 5I1DA 5JPNC 4QHUA 2AXFB 2B4CH 3O6FC 3QEHA 4KVCH 4PN6A 4EXKA 5HY9B 3IK2A 5DD0L 3MLZH 1LO2L 1O7VA 1H15A 4MASA 4N90D 4KX7A 3D69B 3T0EC 1NSNH 4FXKB 2XQYK 5GS1B 3IBEA 1N8ZB 4BHUI 3DX0A 5KYWA 4L3EB 4HCRH 3WGUB 3VMNA 2DS4A 3O6FA 4OCLC 4NZTL 1FNSL 3ZK0A 2P80A 4W70A 5C0DB 5I1LA 2R4SH 1I8IB 1G1KA 1BJ1J 3MO1A 5DEJA 3T3MF 5AOMA 2CGYA 3SBRA 3UTTB 4A1RA 1TQCB 3WV0A 2YZ1A 2KQMA 2QVIA 1NFKA 4L3AA 5ADPH 5ISZB 3OAUL 3OMIB 3VVVA 2A6JA 5CZXC 4WQOA 5A16B 3Q3GA 4UYPA 5AW6B 2VXVL 3X12B 3E6HB 3VCLB 2XZZA 3UAAA 3RBSA 3NK4A 5DEFA 5HSFA 2X2UA 5I74C 5DUBA 2CWRA 1G0YR 3VGFA 4X5WB 2E27H 1B2WL 3MCKA 1KYAA 1U8JB 2DH3A 4ONOA 4QRRE 4ZUSB 3CXFA 1XCXA 3DUUA 3VH8B 1JF5A 3ZKXB 3FHAA 1FL6B 4PJ9B 3VW3H 2W95A 2GBVA 1T7YA 1FGNH 2O5ZL 4N26A 5DJAB 3T0ED 1EAQA 1P7BA 1YQVL 1N0LA 4CN6A 5DFVC 2R59A 5MENA 1KNOA 2EXWD 3BPLC 1C5BH 4XXWA 4JDEB 3VGGA 4YHPA 3BD4A 2LTQB 5JPMB 4U1HA 2YWYA 4FXLA 3N44B 3N41F 1KB5H 3OMZA 4DGIL 1A5FH 4XCNB 4HUWA 1FFNA 1VFUA 5F9AC 2NY3B 2Z31B 2ZKXA 4XXWC 2R0LH 1WGVA 4W9JC 4X5XB 3MOAH 5JYMA 2J72A 3D3VD 4NRYA 5BNXD 5GRUH 1UD3A 4IOFD 4XN8A 3QZWA 5CGTA 4NO0B 1PL3A 2WVVB 3DRQB 3G5YA 1MWAA 5LQBL 1MIML 2HH0L 3ARBD 3TO4D 5JHBA 4LMQI 1H3PL 4N2OA 4TNWF 3GSNB 4B9ZA 1CB4A 3T65B 2NR6A 4GLRI 4F3FB 3HB3C 4XPTH 2EADA 2WXGA 2H1LM 3C5JA 4L1HA 4TVPH 5DHVA 3CH8A 1LLAA 3FU7A 5C0AE 3V55A 2HP4A 4PRPE 3GMPB 3WDIA 3QPQD 4C4UA 2FHCA 5ICZB 4YLQT 4YO0A 5D7EA 2ZZUT 1FQ9C 1IM3A 4GBXA 4Y1AD 3VM7A 4M4RA 3E1ZA 4XX1G 2J1WA 1DVZA 3HVDA 4Q7DA 3UJJH 4G9FA 3HZKB 4XB3A 2W0KA 2AQ2A 1A14L 5DJDA 1YLBB 3QNZB 3GEWB 4GAFB 4WI4A 4LCWE 2Z8RA 1ZA6A 1NAMB 4NENA 1AXIB 1TUPA 4GW4A 1KIRA 4WO0A 5TJWK 3RZCC 3TPUB 1QO3B 4FG0A 2CQVA 3BP5A 1AIFA 3AREA 2LQRA 3UADA 2Z93B 1R5IB 2NY4B 2W8CA 3BVTA 1KIPB 5IW1B 3MBEC 4P99A 3V52H 3Q2WA 3W37A 1QW9A 4IRJB 2DIJA 4BQ8A 4Y5YB 4A2HA 5K9JH 1FDLL 1S7WA 2H32B 2RQ8A 4HS6A 5D4IA 3ZRCC 2FUTA 3HG3A 3U1SL 5A2CA 5L2KE 3GGWA 2VMDA 1OXYA 3CXDL 5EFIA 2KI6A 3GMLA 3ILQD 1OF0A 4R5TA 1RLBA 3CZSA 3MBEA 5D7KE 3WS3A 2BSEA 5FYLE 4AX3A 3RWEA 5KWYC 1EO5A 1F6FB 1F5WA 2EDJA 4XBPB 4LLQB 4I4WA 3DIVA 2DQJL 1M6UA 2YK1H 3EJRA 4KWUA 4WVRA 3HPJA 5DVPA 2ZG1A 2ZUUA 3MNVA 4JO4H 4AZUA 2HFGL 2WIIA 1AHWB 2R1XA 2VW7A 2WQ8A 3CBJB 4FKKA 1E5BA 3K4DA 2EEBA 4YZFF 4K5LA 1OK8A 2NSMA 4JZOA 5HDBF 3BYYA 2QL1A 2N1TE 4TNWK 3ARSA 3QHZL 2ZOOA 3ZZ1A 4D94A 4ZMLA 2ZKHH 2HKHL 4GAYB 1FO0L 2CGRL 3TU6A 4A7GA 1F90L 2W38A 2WTRB 2L4OA 5I19H 3TOPA 3BRFA 2EYTB 1SLUA 2KPNA 2EVGA 4YWGL 3IVKA 2HT3C 3NPZB 3HZVB 4GXUN 3PHQB 3FL7A 4IOFC 3E80A 2F54D 2BP0A 4UT6A 4YDKL 1X5HA 2FLMA 2H3NA 1EQWA 5H37G 1INDH 1EFXA 3LHAA 4IQHA 3U30C 1TIUA 5BUAA 1IKNC 2O6EA 1DFXA 1LNUA 4UQ2A 5FO9B 2N7SA 4FHBD 4N2BA 4KY1H 5GRVL 4PWEA 1YHPA 3HZKA 3ARPA 2CMRL 3O45B 2DIAA 1EZVY 1I3VA 3LZNA 2ZCLL 4L4TA 4WSKA 3WBDA 2Q3AA 4R8WH 1KXVA 2JB6A 3WENA 2PYED 3AB0C 3EJUA 1IKNA 5EF0A 1IKFL 4O02H 4I5BB 3UTOA 4BZ2H 1JZIA 5I5MA 4R0LA 3US1A 2Y07L 5D2NA 4NAQA 3H3PL 3OLIA 2QDWA 3MRHB 1S3KL 1IZJA 4P05A 2JKJA 1M7UA 4DKDC 1QKZL 1W80A 4GPVA 5EIIG 1NMCC 4QYOA 4QNPE 4ODVH 2ZKYA 2ICES 3DVGB 4IBSA 3OLEA 5DD0H 1E6JL 3KWXA 1XMEB 2ALAA 1PLAA 1KTJA 2D3LA 2ZG3A 5F1IB 1T6WA 3K6DA 4FMVA 4RISL 1OB1A 3X3GH 2EDHA 2Y3NA 5J1TC 1XMWA 3K6SA 1P6WA 4JG5A 3I02B 2VABB 2WXHA 3S35X 1BOYA 4HV8B 4IIQA 3S3DB 3RWFA 3RX7A 1GA2A 1FBIH 1L9RA 4Q52A 3ZTDC 1XZ0A 1NCWL 3K2IA 3PNWB 2OMXA 1RKRA 2KZKA 4HX1B 3NZUA 3SPVA 1RZIA 3B9EA 5DQDH 3U0PB 2YS4A 3MLRL 3VQ2C 3CMGA 1J11A 1T1XB 1KENH 5E4AA 3BUQA 4KH9A 2ATPA 3CVHB 1FFOB 4JFXB 2AKRA 3U79A 5KVEH 3OF6D 3FQNB 2M1KA 2YA2A 2YGQA 4PRIE 4G8EA 4Z7WE 2FATL 1OT2A 1NBYB 3GZPA 2O1AA 5AW4B 3L7FB 4BH7A 4OZFB 1R5WB 4D0BA 4OM1H 5D2LF 1AANA 4F8NA 1FFTB 1SXNA 2NY6D 3JWOC 5B1CA 3RQ3A 1MAJA 3HKFA 2Q7YA 1PDKB 1SDDB 4PYGA 5T3ZH 1PZ5A 4YIQA 4XMLH 3DX7B 3CLWA 3V8OA 4ZJ9A 4XXCC 3KLAA 4JANB 2XTLA 1BXAA 5DVKA 5F1NA 5FYKD 1AE6L 3WS3B 4CVZB 1OP9A 4O2FB 1IC0A 1X7QB 4PGEB 1WK0A 3U2IA 1BEXA 3MV9E 3HTLX 4O9HL 4B5EA 4MAUL 5HHQA 3ULUL 3RDTB 2OTWB 3QO0A 2DD8L 5LWYL 4JRYA 5EZIH 2J56A 4KKCD 2X9XA 3PAYA 2AK1H 1XIWD 5G55A 4NO3A 3GSRA 4N2CA 1IGCH 4JKMA 3PV6A 3VTAA 1FVEB 1VPOH 2J5LC 5KJ7E 3D3VB 3KMDA 1IC7H 3TJHC 1UB5B 2Z4TA 4XZ4A 5EULV 1FYHB 4IK7A 4QPEA 3VXRB 4B6ZA 3B2UC 2R27A 3OKMB 3NSCA 1LO3H 3CHPA 3WSQH 4IMKC 2FO4A 3DVNB 5D7JB 1A4KB 5FIEA 1KB5A 3QE5A 3TBBA 2X70B 2PUQT 3LIZA 2SODB 2XWJB 4KK6D 1A0QH 3US9A 2H3XC 5IEHA 4BJLA 3TO2A 2BNUB 5GGQL 1PQZB 4NQTA 3MBWB 3CX5K 4YPGA 3LNGA 2ETWA 4NUGL 3LNFA 2DQIL 2MQ0A 3E2HC 2GCYA 3MUHL 2EXYD 1E7VA 3T2QA 5IBLD 5E8EB 3VG0L 3U2SB 4ALAL 3NIFF 4WEUD 4TSCL 4DP7X 4F7TB 3VE0A 5BO0D 1D5BA 1FNEA 4RRPA 1U33A 2XIIA 3KBHE 2HFTA 1DSFL 4ZUVB 2MQGA 1UWXH 1U8LB 5GGUB 5IJBC 4Y19A 4LSPH 3QFJA 4A37A 2D8KA 3VXRA 3IVKB 4LQFL 1JYXA 3ZDYE 4N2HA 1RIHL 3SJVB 1WO2A 4JY6A 2WTOA 2BP0B 2HX9A 3K46A 2ZXAA 3NP4A 3PWLA 2DQMA 4QRPD 3ZE1F 3ZKNC 1QNZL 4FMFA 5IT2H 3U4EA 2XG5B 3D4CA 3QCVH 4OUOA 1YN6A 4PUBL 4P2AA 3CFQA 4KC3B 3VE0B 3VWKD 1N6UA 5IGXL 1X4XA 5EC1A 4F8OA 2HFFB 2C3VA 4PD4J 5GZOA 2RGSA 1CVRA 3MV7B 4IOIB 4HJUA 4P9ML 4W9GC 4JKWA 3RIKA 3KD4A 2LU5A 4X98B 2HTLD 3MNZA 4GKSB 4H8WL 4A7UA 3FN0L 3IE4A 4FLQA 1YPZA 4PJIB 4M9OA 4FFZH 1V55B 2JTDA 3SDAB 1NPJA 3I85A 1G7QA 1JGEB 3V9CA 1KFGA 1U91B 5C7XL 4TTGA 5FYJD 2BNRB 1CTNA 2HJLB 1G6RA 4NCDA 4HK3J 4QXVA 5K39B 3FU5A 3FQ2A 1UCTA 1ZE3C 1L6PA 2BVUA 2ODHA 1EJOL 4YAQA 2J20A 1YECL 4M6NH 2FIRT 4U1NA 3FF8A 4X8CA 3KDMA 1ONQA 5IVXA 4NWUH 5DHYA 1EXHA 2Y25A 3R4RA 4FG6D 2YEVB 1A3LH 2OR9L 3NJJA 1KLFB 3NFPA 4OU3A 4X5LA 5GS0L 2ZOLB 1EVUA 3MVSA 2WGNB 3Q1EA 1ASQA 1MQKL 3INOA 3NA9H 4Z3FA 2V2WA 3TN0A 1J0YA 2QMJA 3D7PA 1PZUB 4FQHB 4HG4K 2F8IA 1D5BB 1FNEB 2P47B 1NL0H 2XXFA 3QUML 4UQBA 1HHHA 1AJ7H 2CGRH 2ESVA 3BSZA 3QXDB 4U4BA 4X2UA 1BMWA 1PX8A 3AQDA 3CZUB 2WPGA 3BSZH 4CUCA 3QH3B 1JS4A 3HFFA 5AVZB 3DUSB 3OKNA 4FQLH 3LZFL 3LTVA 3O9WA 3B83A 2NXZB 3PU7A 4XCFH 3T0EB 2O5YH 3WN5B 1U8JA 1J87A 3Q9PA 1MFAL 2H8PB 3MAWA 5T1LD 2OP4L 5HVGB 4X80H 5JYLA 1BQHG 2D7TH 4EN3C 4ZX4A 1UOVA 4WU7B 4YBLC 2AS5M 1PCXA 3IMUA 5EBMA 5DYOA 2JTYA 3KL3A 2XZQL 1S5HB 3FRPB 1E5UI 1U8MA 4RWHA 4DGWC 2XFXB 5C0IA 2APFA 2CBTA 2X6AA 2ZAHA 5C0EB 1AG6A 1T4KB 1PAZA 3UP6A 4L4JA 1KEGL 3L54A 1PZCA 1U95A 1JXKA 3FCGA 4JQVA 4JVWA 4RRPG 4UBDD 1A25A 2VR8A 1AMXA 1TYRA 3P0GB 1E3XA 1FCGA 1KFAH 3MZGB 4M8QA 3DUSA 3QO1B 4GAJL 3SKJH 3VU1A 3M8OL 3V0IA 2CDGA 3VWJC 3IJYB 3LN4A 4KRPC 3RWIA 3AZUA 3B56A 4DPCX 1JZGA 3MRIB 2ZKMX 3BUDA 4I89A 4OLWL 5EU7E 4HLEA 3FFCB 4U05A 4XCYA 2X6UA 2AK4A 1ROCA 1JRHL 1RPKA 3CDGB 1CGVA 3FAXA 1G6RB 1M2VB 3EFOA 4R96B 2I69A 1D2PA 3WL9B 2JK5B 4N6RA 3KW7A 1TTUA 1P53A 3H8NA 1PZ5B 5AZ2H 1A47A 3MMEB 3VD2A 4JM2B 1SVCP 5ID0B 2R0ZL 1ZLDA 4DPAX 4KBPA 4DP6X 3HNVL 1H8NA 1YEEH 3IJEA 5FW8A 4DESA 1QX1A 2GJ6E 4LDCA 1CU4H 1BVNT 4BGDA 1NFIA 5HHXH 3RVWC 5CN3A 3AGVA 2W59A 2AF2A 4ANWA 1RUML 4LCIL 4DUXA 1KT2A 1QLEB 2BXYA 3H4FA 1S9KC 4L9DA 3VRJB 4EAEA 4S10A 3QUXA 3X12A 1AZNA 4WNJA 4Z7VF 5E2VH 4Y8DC 2J6WA 4AJVA 4A6YL 1OE3A 3K6IA 3RTQC 1EMTH 2V9UA 1J5OL 3QNFA 4F33A 1YC7A 1YYML 1U21A 2O4EA 3E7JA 4ZMOA 4X98A 4I2XE 5BPPA 4PRID 3QUXC 2O6FA 3HFML 2C1OB 1PG7L 4JM2F 5T3ZL 4L0PB 1ID5I 1E30A 1OGAA 5LHDA 4Q2ZB 4S2SB 4W9KC 5C86A 2HXAA 2ICEB 1QHPA 3EGXB 1RJYB 3DV4B 3GIZH 3TT3L 1NEPA 5SV3A 1ERNA 5DLMH 1J0HA 3KPNB 1QUNA 1SOSA 5F1KC 1B0GA 5JHDA 5E03A 1ED3A 1I3RA 5GGQH 4MAZA 3EF4A 2VTFA 5I1EH 3AUWB 2R2EA 1MG3C 3D33A 4GAGH 2JCCB 3CPLA 3TWYA 1FZMA 4L3CA 1IGJB 1SDAB 4XNZC 4Z78B 4OVUA 3NIFE 1JXGA 4HUXB 1WCQA 1BD2A 2A4CA 4UIMB 4UZUA 3F04A 1K5NA 4ZDHB 3MGAA 2J8UB 3EFDL 1C5BL 4UM9B 4UOW1 4X4MA 5DHXB 2EH8H 3WU1A 1GCYA 2GK0B 3S98A 4HG4J 2R69L 1KSRA 2G3MA 4LKXB 1FG2B 2G60H 4M43L 4WTZG 3KPPA 3O41A 3VMOA 1IQDA 2OXHA 3VWJB 3FT0A 1FPTH 1JPFA 2YC1A 2Z7WA 3MLUL 3JTTB 4NHCL 4EF3A 3AM8A 1ETJA 3PGCB 4YSQA 5C9JA 2IAMC 5DMIH 1I1AA 1T7XA 2J55A 3N44F 4GSXA 4JGUA 4AITA 2W9LA 4YOKA 1PGRB 3PWNA 4W9LC 1IQWL 2WXMA 1UZ6E 1L0PA 1EPFA 3L1OH 4HSCX 3PAVA 1ZS8B 4UOZA 1VFOA 3MUUA 1OCCB 2ORBL 2F54E 3IDMA 4PVNA 3NG5A 4XN2A 5G4MA 2P45B 1YZZA 4G5AA 1A7PH 1CXIA 4IRSD 1WZLA 2X88A 2YHGA 5SX5H 3F12A 4TKWA 1RURH 2CLRB 4M6OH 5EBLB 5FYKE 4CC0A 5FA4B 2DQCH 1H8OA 4F7PA 1WZ1H 3E9TA 3AU1A 5ITBH 5C0RL 3Q06A 1J86A 2BP3A 3WKQA 1U2YA 4OZHF 2XYBA 4XMWA 1KTDA 1CCZA 2E56A 2DWEA 4QYAA 3BEVB 3NCCB 3HCVA 5I6PA 3SDXB 4RGNC 2A0LD 4ES8A 4WUUA 1JI2A 4KHXL 4WWKC 1WSST 4ZO6A 1JFQL 1XWVA 3GKWL 4DEPB 2WANA 5I9QB 2ROYA 1JMXA 2B8OT 3TT1H 4FYTA 4B60A 1BFOB 2QBWA 4AGNA 1A1OA 2W1NA 1J48A 4GRMA 1ZEAL 3BKCL 5KBPA 5KSBE 3KLHD 4K3DH 4RZKA 4B41A 1GOFA 1JTPA 2K8MA 3IWUA 4KKQA 3S36H 3C6LB 3AU1B 4LARH 4J39A 1E2VA 3RIFF 2DOCA 1YEFL 4K7PY 4UTAA 2HZHA 4MQSB 2Z93A 1C1EL 3EYQD 2DF3A 3WFEL 4K8RD 2PCXA 3BD5A 2IANE 3KYOA 4WK4B 2OMNA 3HLAA 2GSIA 1S9WB 3WY3A 4KKNA 3DVGA 2J6EL 2NTFB 1S9VA 1WD8A 1GS6X 4X8GA 4Y1AE 1RU9H 2H2PC 2N0KA 4F7CA 4PJ5A 1XR9B 5DDHB 5IW3A 4HUVA 3L1EA 1BQHB 5F6IC 2AXHA 3KVPA 4YBHA 2VMEA 3QORB 1NPNA 5HXMA 1I1YA 1TZAA 4NZRH 1IM3D 4GBXD 4UDUA 1XIWB 25C8H 3QQ4A 4M5ZH 1AJ7L 1FRGH 4OZFG 2PYEE 2XTJE 4G9FD 4RLDA 3I50H 3QJTB 1OB0A 1TTAA 5CZRA 4HWEL 2BC4A 4JPIA 1NCCH 4HZAA 5FYLH 5GJTL 4YLBA 3UZVB 3GI9L 3EO0B 3ML9A 3KYOB 3V52L 4GEJA 1C5DA 1NANI 3K8MA 3V95A 1DDHA 4I3RH 3QHFH 4JLRA 4FFTA 1K3ZA 2BOBB 2DH2A 1X5FA 4JM2C 4KPHH 4NN6C 1SEQL 1RIUL 2FGZA 2WXOA 2OS7A 3FBKA 3RE0A 2AJUL 1HH9A 4KVPA 5I66B 2QVMA 3L3OA 1JVKA 4MBOA 3VXSB 5KG9A 3MQIA 4WO4D 2Y22A 4P2QB 4LMQE 3S3JA 5IM7B 4LPTA 1ED3B 3M17B 4KVNL 2ZE0A 3LEVL 3ECBA 4FFVC 4HFUH 4FG4A 4G6ML 4PV8B 2FEDD 1YNTB 3GXTA 3LRKA 4ES9A 1GGTA 1RK1B 3FO1A 4HS3A 4HIIA 1NGWA 3FC8A 1IE4A 5EF2A 1O6SA 2BIPA 2X4PA 3L6FB 2PO6B 3X14A 1NBVL 4WV1A 3MLSL 3NSXA 3D5OF 5DK0A 4JPVL 2HN7A 5D1ZA 4QTHA 2BJML 5L6YL 3ZTNL 2JFCA 4MLIA 5B38A 2P7TB 5I1GH 4Z8FH 4U1GB 5DHDA 2YBRA 3BC9A 4WV1C 3ZE0B 2JELH 3H7LA 4LFHD 1FGNL 1B4TA 2YMXH 1BOGA 3MX0A 4CADB 5DMJB 1T0MA 3BWSA 4PV9A 2CR0A 5KOMC 2BHYA 3T2PA 4GKNB 1CIUA 5L2KD 1QYGL 2J1YA 4OZHA 2ZUTA 5EZOL 2BW4A 4M03A 4OLXH 4U7MA 4LHUB 2KLSA 2P26A 5CJ5A 5CN1A 1BM7A 4O58H 4QF1B 4AJWA 5KYYA 2F54A 4MDJB 3BVUA 3KYNB 1X7SA 3WNPA 4PP1C 2VLKA 2QGEA 2X7LA 4JHWH 4H0HB 5C09A 1I1CA 1YQ2A 3IDJA 1GZHC 1B4LA 1A7QH 3V4PL 1IGIL 3LZQA 4XNQA 3OKEB 2YD2A 3R06A 5F9JA 5HI3D 1L9TA 4LLYA 2OTPA 1EO8L 5I71C 2D2CC 3BLBA 4XVTH 4RGOH 3F7VA 3WS6C 4CSZA 2BCMA 1C7SA 3QJRB 3O2DA 1RK0B 4XBMA 1GZHA 3S4SB 1URLA 1MJ8H 4HPYH 1DEEA 4X6EB 5CJXA 5D96C 4Q6IB 3SYOA 4PTTB 1I9IL 1R33A 4LCYB 3R0NA 1BLNB 1T80A 1WEJL 1G9NL 4KV5F 5HTSA 2MHAA 1X9RA 3CN2A 4YFEA 1WTLA 4U1SB 1IB5A 5C0EA 5J13B 2H9GB 3QQ3A 3R1GL 3WE1A 5C07E 2KPWA 2D73A 1KBVA 1OK0A 3O4LE 4AXWA 4R2GD 4LP8A 2MNJB 2UZIH 2MOGA 4J8RB 1JXFA 1QLRA 2P1YA 1NUDA 2M26A 3BSHA 3D51A 1AD9B 5FWRA 4PLJD 3D3VE 1D5ZB 4EI5B 2HWZH 2OMBA 1N2RA 1UD8A 2XIDA 1B0GB 3MRBB 5E6IB 3UBHA 3W9DA 1QFWM 1LMKA 2P5WD 1NWOA 2HTLC 3JZYA 4PB0H 5CGMA 4MFHA 2YFNA 3RFZA 4MB3A 4ZO8A 5D8JL 2VDLH 1P4LA 3GBLA 3F62A 4ELKB 3NAAH 3L4CA 3L5IA 3IYLW 5C09D 1I9JL 2XY1A 2DQUH 1TFPA 2F5AH 2CRZA 2G9HA 1NH6A 2R2HB 2Y5QA 1XGYL 1YY9C 5T1DL 2WQXA 3G9AB 4YXHH 4I0CC 3BPNB 3FB8A 2W0FB 4Y9FA 5BV7C 1MFCH 1J0ZA 2DMBA 4ZMYA 1WA0X 4P9HC 2QVFB 5TPWL 3WXVH 4DEPC 1MRFL 4PY7A 3GMMA 3ZE2F 5AZEL 1RZFH 3DSFL 4RVBA 3H42H 4X4ZA 3PV7A 2GI7A 1EHXA 2XKNB 4NFBA 2PR4L 1F8TL 4JDEA 4G42B 5DD3L 5FF6B 5E24E 4ZMVA 1YY8A 2F53D 2D7OA 4R4BA 4LSSL 5AL8A 2YD8A 4OLUH 4N87A 1V3KA 4JY5H 2GC7C 2R8SH 3S88L 4OD3H 5IW6A 1GYWA 1D2OA 3B7YA 4MNGE 5DZVA 4G7YH 3QHZH 3KE0A 3VACA 5FX3A 4G59C 3T77B 3WFCL 1G7MB 3VXOB 1JPTL 3EO1B 1RHFA 1CI5A 5DGQA 1ZLUK 4MQ7A 5CLTA 1U2CA 5DK0B 1E4WL 4HS6B 5B38G 5IQLA 3VCLA 4P3CH 2CO7B 3WELA 2EZ0C 3HC3L 1D5IL 1C08A 1J7VR 4ZW5A 4RDBA 3QJHB 5G5DA 3Q8EA 2RB8A 1B4JH 5DQ9B 1AH1A 4KHXH 3BT2L 1DL7L 4ZXBB 3DLQR 5FF6A 4KKCC 5C7ZA 4GW5A 4W1TA 4EUPB 4P06A 1ZK5A 1V7MH 1G9ML 2Y3AA 3VGAB 3NEOA 2JMRA 2Y6SC 3FN0H 3IJSB 4QOKB 4BRVA 3O4OB 3SPCA 3U4BH 4AT6A 4NQCA 1ZEAH 3BKCH 1PNCA 3VH8G 4LHUA 3EJSA 3H54A 3WEXA 4YHPB 4AYSA 4CN1A 1KWGA 3CTTA 3IMBA 1XTLA 4FD0A 5EN2B 2FJFA 1HINH 3BEWA 4M7ZC 4ZI8A 2WSKA 1MCDA 2ENSA 2N7BA 3HJEA 1I3GL 1HHIB 5FKAA 2YGNA 4AKQA 2Y36H 1CMOA 4Y89A 4K7PX 2ZCZA 1RZGA 4FQXA 3MRLA 2FX9L 5L4IA 4AV4A 4CADA 1JNNL 3INUH 2JJUA 1IVLA 3UTQB 3SQBB 1KJ2H 1SEQH 2WLZA 4TLTA 3TJEL 3AY4C 5TE4H 1VADA 4GG6B 1OP5K 2EEFA 3MYJA 3ZMNA 4W9HC 1UGNA 4JO3H 3ESMA 2H2SD 4GS7C 3QEUB 1OP5H 1MRCL 1SDYA 4LT7A 3TPKA 3RGHA 3AJ7A 5I0ZA 2NY5C 2EDBA 1ADWA 4AQ1C 2WOBA 2X1OA 5IVZB 1VHPA 3M1OA 2OYPA 5D55A 2GSIB 1YVLA 2Y6SD 3AY4A 2HRHA 4I18A 4JPWH 3KYAA 4MSWA 5E2WH 5FGCE 9CGTA 2WYZA 2VDRL 2EDKA 1CD0A 2AVGA 5DGRA 3ZN6A 2NTFA 4N68A 4HKJA 1HHIA 4Z3HA 1KLFA 3BCFA 4GJTB 2O6DA 2WO4A 4YH6A 2MH4A 3L8QA 3RTQB 4UI2A 2GSGB 2WUBL 1IGML 4U3SA 4HWZB 5L4JA 4FFYL 4XP4H 2VR7A 3QXWA 1O7DC 1TEFA 3DMMB 5HYSA 5CUSH 1WTGT 4CMMA 3FOLB 1Y18B 2PO6D 3AS3A 3V5HB 5HGAA 5IP4A 3JUYA 1H3UA 1HILA 4LFHG 1HNYA 3ARGB 3WOVA 2E59A 4U7SA 5AOJA 1BOGB 3RHWK 3H0TB 1E5AA 4ZXBA 3FTYA 5HHOA 3TESA 2XPGB 1FC1A 4WI6A 4WI3A 1UACL 3D08A 3K72A 5EZOH 1A6UL 4FQXD 4KK8D 3SKJL 1FVCB 1MJ7H 3DJ9A 5TDNB 4ANVA 3MJ8A 5C07B 3VUAA 1BFOA 1AAJA 4F7KA 2J1ZA 1JNLH 3IJEB 4MCMA 4UV4L 1J1OH 2TAAA 3MRDA 2ED9A 2IOIA 1Z9NA 5EF3A 1BIIB 1HOEA 5I1KL 1QG3A 2LW5A 5FV2A 3JSSA 4R4NC 1JV2A 2CKBA 2JI2A 4QMEA 1E5CA 3D85A 4D0BB 1RZIB 1JK9A 3EO9H 4M7KH 4EI5C 3CZGA 2JKLA 2XJLA 4NKIL 5EB9A 5J11B 2ESVD 3ZO9A 5HVWA 3N0AA 4XMLL 2ZD0A 4DUVA 4YDZA 4N0UA 4NKOA 3ZL2A 1BZOA 1OGAE 4OTXH 3VD7A 1KCVL 4KZ0A 5AUMB 2GTQA 4KXDA 1WEJH 4YDJA 1OB1B 2XACC 3G6AB 2FAUA 4AMKL 5TE4L 2VIRB 4JFDE 2PCPB 4JPKL 1KIQA 1WLHA 4N5EC 2D03H 4APXA 5EOQH 1OWWA 4JFDB 4KO7A 4RX4A 6PAZA 4N8VG 5I16A 1IL1A 3PGCA 2ITCA 1GSKA 3FO9B 3HZMA 5DJCB 5SV4A 4ODBD 1JYNA 3GC3A 3Q8BA 4M7ZB 1R3IL 4U1JA 1I31A 1W72B 3MBWA 5HHOD 3S3PA 5I8CB 3L95A 4MQXC 4YSSA 3ULUC 4WUKL 3UYRH 3UO8B 3GLEA 1UWXK 2UWEE 3M88A 4MQ7B 3F84A 2C7FA 2RH0A 4G7VH 3OR7B 2BVOB 5D71L 2ZXWB 3AC0A 4H44C 1XGUA 1RIVL 1AACA 1JZ3A 3APCA 3K5SA 2VE6B 1WUZA 4XNYH 3HG0A 2KZ1B 2UUDK 4LEOB 2BINA 1Q94B 1F3DH 4OZ4A 4HC1L 5C0JA 4HIJB 3MRMA 5JIPA 5JIIA 1WA1X 3O3EA 5CCKL 3CDFA 2IDFA 1DQDL 1MWOA 2BP8A 3ATEA 2A77L 5KVGH 3EYFA 3UMTA 3M7OA 1ZAGA 1BFVH 1QVOA 2Z8VC 3DYOA 5HVFB 5E70A 4A2EA 5SWSE 1UD6A 5I8EB 4QGTA 3ROOB 4BFBD 2JKIS 3EH3B 1U8CA 3H3KA 2BSBA 1JPSL 1P84J 2ROXA 3ECVA 3EDDA 4XP9L 5D1ZI 4M1CC 4OLUL 3VXSE 5GXBB 1A6TB 5KANG 1X7QA 2VDRB 3BP6A 4RIRB 3IMWA 5TGBB 1KCKA 1QSFA 3ZKMD 4AV5A 5BQ7A 3GS4A 3O4OC 4M1GH 5E08H 3HA0A 3A5VA 3BDXA 3GIVB 5BV7L 2LW3A 1L9QA 4KROC 2V5SA 3MGTA 1QSVA 5TD4A 1XXFC 1I9JH 3HZYA 1WQVT 2ZXQA 1MHPH 1PZ3A 4IYKA 5IUSA 5KJRH 3AREC 4P5TB 4J3OH 5AKSA 3LXAA 4FNPA 2VQ4A 4FJ6A 5GGSY 4TVPE 1KTDB 1XGTB 3EG9B 1OT4A 1EJ6A 1QZ1A 3TV3H 1FF5A 1R5WA 2AQNA 2Y7MA 4WW2F 3NMEA 2D7MA 2MPAL 3GLZA 3GSNL 4ORZC 5F1OB 2R69A 2AJYL 1A3LL 2NYKA 1EEYB 3MCLL 2F8VA 3N5AA 3C2AH 3H0TA 2R69H 4U1IA 4AMKH 1JZ4A 4KOCA 35C8L 5LXGL 1FV1A 2DM4A 1CF8L 2XWJA 1Z6JT 2ENYA 3O6FB 4JZJA 2NLJA 1MQKH 3NA9L 4OIAA 4XI5C 1HSBA 5GS1C 4ECNA 3SO3B 2VXTL 3L4ZA 2E9BA 4DIXA 4L4VB 4MNHB 5E4EB 4AVJA 3FMGH 3AROA 5I9QC 4KAQH 3DBXB 4U49A 2Y7QA 1JZ6A 1JCKA 4ZUWB 1AXTL 1JZDC 3QNZA 4R90L 5CLZA 1HZHL 3FTSA 3V0VA 3LKRB 2YKLL 1KCUL 4HIQA 3QUYA 1F0LA 2VOTA 1WHOA 1Y1UA 4PW3A 4WNSA 4E41E 4BFIB 1TDQA 4EPSA 3JWDH 1QSFD 2V3FA 3STZB 2WZ0A 4OZ4B 4XP5L 4JM2D 5BRZA 1NGYB 3X13B 4KMTH 2EO9A 5INDB 3ARBC 4FQ2H 3TO4C 5MHSE 4RAVA 1MJUL 1QBAA 3GRWA 1QBBA 4IK6A 1MCHA 3HBZA 3Q2NA 3GRWH 4AGMA 4F20A 2VZVA 2WMPB 3KPSD 4QOKE 4DP2X 5DFWH 2K1MA 3RX5A 4HJ0D 2NY2B 3FQXA 2P49B 4F58L 3ARBA 4RQQB 3TO4A 4BSWB 1JCVA 3FBQA 3FUKA 2C7UB 4YDIL 5B8CB 2G3NA 1BWMA 2X70A 4FQCH 4Z3JA 2D0GA 3QDMD 1UA6L 1YEKL 3GM0A 2VSDA 1A4BA 1L7TH 4CKQA 2E74C 5JOPE 3ATFA 5ABDE 3F6IA 5D6CA 1K5WA 2WLKA 1KXVC 4A7VA 4M1GL 2PNDA 3GUTA 4LLWB 3UEQA 1NBZB 1IGMH 3MI6A 1GIGL 2XQBL 1OAJA 2QVTA 4R0LC 3T2OA 3WIFB 5KSVB 4N2FA 4MNQB 2ITDB 5DJ8B 5EBWA 4U3SB 1UENA 4B3EA 3X17A 2WWMD 3DRQA 4JFHD 3NZ8A 3LN4B 3JXAA 4P5RA 5HDBB 4MNGB 3B8YA 3NTCL 3KPMB 1OGAB 2Q9OA 5GS3A 1L0XA 4FNTA 1DVXA 5IKCA 5BOJA 3BN3B 5HDWA 4APXB 3R18A 2C34A 1DJIA 3CPUA 4V1DE 4NKMA 2E8ZA 5IM7A 1NCCL 4GW1A 2ITEA 3QISA 4LSTL 1T4KA 2BNRD 3WIIL 2I24N 1QSZA 5IHUH 4MJIA 1BEYH 5L8JB 2I07B 3ULVC 5JO5B 4ZFQA 4XN1A 1E3ZA 1KEMH 1AHWA 2R1XB 4LP4A 3SKMB 1N64H 4W6XB 4XXDA 1IILE 4JFZL 1BIIA 3GBNH 1MI5A 4JO5A 3CVHL 2NYZA 3WIFA 1CXKA 1H3GA 4OLWH 3LQAH 1SY6A 3MRBA 1GGCH 2OMVB 3N43B 1R3JA 2CZNA 2OCCB 3DVIA 2X4OB 1C16B 2BNQA 3IDXL 5TDPB 4CMHC 3OG4B 1JRHH 3H3BC 5BVJA 2DLGA 3MRFB 1P1ZB 4NZ8A 2WIIB 3ZTJH 4ZUTA 4Q6IC 1CDYA 3HZYB 5DS8B 2CUAA 2WSPA 4N6RB 5EEXA 3P30L 2VC2B 3HHMA 4HLZG 4XE0A 1PLGH 3HNVH 2JCWA 3E6FB 4KJQC 4XN5A 5HYSB 3WAKA 3NFSL 1AZUA 1FZKA 2QEJA 3FFCA 4KY1L 1J1PH 4Q6IA 5TFSL 5BRPA 2TSBA 4MZIA 1RP9A 1RU9L 3P02A 3SKNB 3V4PB 2V37A 4HF5L 3QRBA 1HK6A 1UXSB 4XWOD 2ZUWA 4AV0A 1ONQB 4HV8A 4IIQB 4B9PA 1JZJA 3L45A 1UWEL 2J71A 1YYLH 5LKNA 5KVEE 1OWRM 3BE1L 5HGHA 2DMCA 3I50L 5B3NA 2PTVA 1ZK9A 1Q9OA 3GLDA 1M2OA 2MTPA 1MCIA 4QGYA 3RWCA 5KSVA 3VD4A 4ODVL 4H0IA 2ENQA 5HD8C 3S37H 3PWPA 2AMUA 2BNQE 3MLRH 4JJ5B 2D3NA 4PRBB 3ZDXB 4BA0A 4K2UL 1M1SA 2JSFA 4IRJC 2DQHL 1X5AA 3GJEA 3EH1A 1KGJA 1FHGA 1HNFA 4NGHL 4R0LB 4JX0A 4RMUA 3ZPDA 3ARWA 4R4FH 2TRYA 2PYEA 3TBCA 2IDUA 4KJQD 3KYKH 4NM8L 4MMZB 4PD4K 5CEXB 4LCWD 4ZO7A 1P69B 4HKBB 4NFDA 3TTSA 1VF5C 1KN4H 5EUKA 1AZVA 2DI9A 2HVJB 4KI5F 4Y2DB 5DMGD 4A39A 3PHOA 4G8FA 4R5VA 2FX8H 4G80B 1ETZA 4CA4A 3PABA 2YPVL 1WUNT 4NPYB 4QHNA 4TUJB 2GQHA 3WFDH 2CPCA 3QUZB 4H8QA 3SOBL 1DVFA 3CSBA 4K3EL 4Z7VA 1S7QA 1CLVA 1CE1H 1O75A 2YPLD 3BN9C 5A1AA 2G2NA 4RMBA 4QKTA 1ZIAA 1L9MA 2IJ0C 2F6AA 2H45A 4QXWA 4JFED 4OKVA 1M7IA 3TA3B 4APQC 2FEDC 2OQJA 1BAWA 1H6TA 2R4RH 3RDJA 4PBWD 4X8XA 2OZ4A 4TLUA 1UATA 4FQQA 3SGKC 3H1ZA 2CNYA 2YO3A 5BS0A 1MCLA 2E7DA 3HI1B 4Y4KC 3FT3A 1TZOA 3SCMC 1JHLH 3PWNB 4AGOA 1XH0A 3EKCA 1IM3B 4GBXB 4LSPL 4APQA 3B2MA 4AVKA 3LMJH 4H25B 2NY3D 2Z31D 4JKLA 1FH2A 3HRPA 4RZCA 2BVQA 3VFVA 1UT9A 3DXAD 3CFCH 2JI1A 3FPXA 3VD9A 1HL4A 3D4GA 4KKRA 4FZ8L 3U6XA 2HFFA 3OGCA 4NLHA 2DM3A 4NSKA 1LQBC 4XP1L 5GIRB 5DUPH 2Z92A 1XBDA 5E1HB 3RWCB 1ACZA 1TENA 2BVEA 2OMWA 4HZLA 4OGAD 4ZDHA 4CSSA 3QJFA 1U58B 3BN9D 5DD1L 4IOSA 4BZ2A 4NM4H 1U36A 1L7IH 1VGKA 1N59B 3VG0H 2IBZX 5DJ6A 4BXSV 3PXJA 5K59E 4B50A 4RMTA 1FIGL 1AO7A 1F6AA 2IG2H 3FCTA 1QEXA 3MACH 4JPQA 4DAGH 5C92A 5T3XH 4N2KA 3L3GA 1EX0A 1X5MA 4XBGA 1EZSA 4JRYE 2JIXB 2X9WA 4MAYB 4QHLB 2HKAA 3HE6B 3WIHA 3TEZA 1DJWA 2I5YL 5TF1H 1B0WA 1IM9A 1RMFH 4L3EA 2LAGB 5HYIA 5HD8D 5H35A 4LEXH 2HTKC 3ABZA 2DQEL 3SDYH 5I8OH 4XC3L 4JFEA 5JDSA 4S1SL 1E8ZA 2AEQL 3BHBB 3ETBJ 4NBXB 2ZOUA 4H8UA 4WW1A 4X6CE 1N0LB 1O7SA 1T22B 1N5YH 5BW7C 5D4QA 2ADYA 3KPSB 2JJSC 1L7TL 4XNZB 1N18A 4ZRGA 1KDIA 2H0FA 3G5XB 2H0EA 4LEEA 2EDNA 3DOHA 3F64A 3FU3A 2NY4D 3UO1L 1U8LA 2IGLA 5GGUA 1M6OB 4Z95L 3WFEH 3QAZB 1AYRA 4NQED 3DIFB 3MRPB 4DK6A 4LSSH 1DBBH 2Y2WA 3FSVA 2QVKA 2VISB 3CLFH 4Z5RB 3ECUA 4IKLA 3O9WB 2NPLX 1MJUH 4Z7AA 2EEAA 4GP4B 4LAQH 1D5MA 1VADB 4IBZA 1HAUA 3DUHA 4YN3A 1HQRB 4PFEA 4Y4HC 3RVWD 4Y7MA 1WH0A 3QWRD 4XCCH 4XHJD 4PAZA 3VI3F 5BMFL 5IHBA 4JGJA 2EXSA 4GRWB 4UQ9A 4F7CB 4H26A 1KIQB 1WE5A 7TAAA 1LD9A 3UCQA 1A4KA 3HC3H 1F4HA 5DF0A 2OMZB 4MXQC 5ALCH 1MUJB 3OSVA 2A73B 4R5XA 5AW0B 3NSJA 4TVPL 5GSVA 1SEBA 1VENA 3Q05A 1PLCA 1SJHA 4K71C 3CH1A 2EABA 1HH6B 2VDNL 4N1EA 4L3ED 4MZ3A 1FP5A 3GSOB 4G6KL 4PJGB 4KHTH 3HW7A 2QHRH 3DX6A 5I0WA 3LV3B 1AD0B 3LRSB 4JANA 5F1NB 4ZTOL 1EZLA 5KEZA 1TMQA 2FE0A 5IB2A 2IMMA 5E8PA 3UC2A 2J1XA 3QJFB 2V7HB 1JV5A 2H1PL 4KKLD 3S2CA 5I1JH 1NGQL 4DZ8A 3DO7A 1U91A 2AJSH 2KH2B 5DUBB 2DYPB 3KZ8A 4BXVA 3MZTA 1BAFL 1ZANL 2C5DC 3HZ3A 3MRMB 3VFSA 2I32A 3MNZB 4YAQB 5LQBH 4OUUA 3BVVA 4M8UA 3FZUC 5I26A 5I30H 5JHAA 2YMTA 1OF2A 4EI6A 5HYJE 3S96B 1I7ZB 1FVCA 4XOEA 1SHWA 2WUBH 3NSFA 1IGFL 1FFPB 3ETSA 5ID0A 1OAZH 1R34A 4ZT1A 3KWVA 2OM5A 1JNNH 3VXMD 5E8NA 4I0PB 2CM5A 3BH9A 5EFIB 1ITCA 5FLUA 3UROR 3ZIYA 4F2EA 4F93B 3O0RL 4XNUH 1ZHLA 4L23A 3UL4A 2Q8AL 1NMAH 4ADGA 1UM6L 3RY4A 3UOAB 4QHKJ 3DYMA 3JVGA 4OGQC 1QSED 2WLMA 5J9PA 2VDQL 2XNAB 3LH9A 3C9NB 4YUEH 3EYVA 1PS3A 4PS8A 4HJTA 4JFFB 2FQFA 4BSVA 5IEKA 4XXDB 2BY1A 3IT8D 2J8UE 2XYCA 3CK0L 4R84A 1FN4A 2ZXEB 3EOTL 4H8VA 2MCPL 1CXHA 1RUKH 4PTUA 4V11A 3RTQA 4CGUB 5D1QA 4DUWA 2FZ3B 4ZFZA 5BS0E 1RJCA 4OLXL 3KWWB 2X5PA 5KW9L 2NR6D 1I7TB 4L8BB 4U6XB 4DO5A 2F53B 3MBXL 2IANA 2RAMA 4NO2B 4OFPA 1V05A 1W0VA 5IMMB 2LTQC 5JPMC 2DLIA 1A7QL 4LLQA 5IIEB 3QQDB 4Z7QE 2C9VA 5CD5D 5HHNB 3EFFB 4JCLA 1QLFB 1O5PA 4WFED 5F9OL 3FB7A 4MS8D 4MXVE 5KANI 4PB0L 3QQXA 3BAKA 2KERA 1FG9C 5AAMA 3ZJAA 3KHQA 5A2FA 4GRLC 4PJ8C 1AOZA 1T7VA 3TBTA 1M7XA 4HUXA 3PWJB 3HG1E 5A2IH 4K2UH 3HE7C 2JQAA 4WK0B 3TF4A 1TU2B 3V6ZB 2FIKB 3N50A 3A6CH 1MQ8A 4TPRH 1ND0A 3TZVD 3GIVA 4PRIB 3MV7A 4U3XA 2ZCLH 3NN8A 5C8JB 3ZE1E 1V54B 3AACA 5ERWA 1NGQH 4GRLA 5AVXB 3QQ9D 3QZWG 4PPTA 3ARVA 3H42L 2FO4B 3DVNA 4LLMB 1YMMD 1CXFA 4KX9A 4TUUA 2NMSA 2XN2A 2NZIA 4L8DB 4F91B 3G6JF 1AXSA 2UY6B 4G43A 1ZSHA 4UTAH 1U8KA 1EFXB 5AYTA 5EC2A 5CEYA 1N0XL 3QA3B 5HDRA 4XP6L 4PYHA 2I60H 3ALPA 1J1OL 4IJTA 3F7PC 4EDXB 4QF1A 3BI9X 1KN2L 3VRIB 2H47C 1KXQA 2VZ3A 2ZCHL 3CC5A 3WDJA 4EN2A 3L08A 1QW8A 1DJYA 4Z76A 3IFLL 3K2UH 1BA9A 4NS0A 1SM3H 1KPRB 1J8HD 3L2LA 3MROB 1E2ZA 2BIMA 2TSAA 1QACA 3PE9A 2EDFA 2VLME 3B9DA 4DJMA 1LE9A 1XF1A 3L5JA 1G7MA 5SWZE 4KGJA 1AD9A 2LLNA 5ACZB 1XV8A 3MCKB 5KS9F 1T89C 5LG1A 1MWAH 3WXWL 4D8PB 1ET7A 3MGOB 4CU7A 2GAZB 3S3BB 1KCVH 4AC4A 3KG5A 2ZWYA 3RWJB 2Y6TE 3BRGC 3PQYD 2YRBA 3RFRA 2MCG1 1CFQA 1KTRL 1PZBA 2ICEC 2FATH 1K6QL 3U7WH 4J3OC 1WIOA 2AQRA 4MB4A 1UD5A 2G2PA 4DZBB 4HMCA 1T89A 1KIPA 1G7HB 5KBKA 1NMBL 4ZTEA 4ODHL 4YFDB 1UURA 3UBXA 5KYWB 2Q2EB 4XMTA 3WNMA 4PJCE 1G7PB 1MVUB 1QRNB 1S7UA 3WFCH 1E9PB 2OMXB 1FFNB 5LCVA 1ASOA 5FEBA 2ICEA 1A7NL 2NR6C 1EJ8A 4PJGA 4P2OB 4AC2A 3LH2H 4KTYA 1MIMH 2HH0H 5IR1A 4DGUA 5JORA 4MWFB 43C9A 5IK3B 4IBTA 2AABL 2YD4A 3S35H 2DLHA 2DLEA 5E8DH 2IH1A 2XNAA 2DJMA 3MV8E 4IBYA 4M62H 4Z7OE 1JGUL 3CLFL 4LKCA 1J8KA 4O4YH 5MEQA 4YS4A 3TJPA 1TTRA 4OCXH 4JRWA 3WIHL 4M1DH 3MREB 2HVKB 5IB3B 3O3BB 1A2YA 4LLDB 4MJJA 3KBPA 5AW1B 3EOBA 1ZDQA 4MQXD 4PJ8D 1VGKB 3ROLA 1FDLH 1FZJA 4YQXH 3EF7A 5IROA 2BOCB 3VI3E 3L3DA 2Y23A 4HEME 4X7CC 3NOIA 1VACB 4AVIA 2E6JA 4J12A 5E2TL 3VAEA 2KT6A 2E8YA 2YFOA 4DEUA 3TV3L 3QGVA 5A2LH 3GXDA 2Y1ZA 4ZFGL 2QKIA 2FEEL 3OC8A 4UNUA 3WUZA 5HPMB 1N7MH 4M5YH 3SE8L 2QHLA 1ES0B 2FX9H 2FQGA 5E00B 2A5UA 3MRCB 4A55A 1GW0A 3GSOA 2Q8BH 4LNRB 5CJBA 3Q1SL 1MHPL 2HKFH 4LL4A 2A6KB 3QZPA 4NRYB 2HVKA 3QJXA 4CBZA 2QKIC 3CFKA 4DWHA 5EDSA 4BFEA 3JVFC 2CJUH 2A4ZA 4M1CD 4DGVL 1SMOA 5AB2A 4FQIL 1KF9B 3LKNB 3IDNB 2IPTL 4YSUA 1SVZA 3Q43A 1EANA 1YEFH 1BF8A 5FFLA 3U9UB 2NY1C 4ZD3H 4TSBL 5C0IB 2IH3B 4UNVA 4KK9D 3CN4A 2EQDA 1OGTA 5IG7B 2WYIA 2Y24A 4EN3B 5GISH 3JV4A 4KI5D 2W9EH 2V3EA 5C0AB 5HHVH 3X3FH 3O8XB 4PGJA 3PABB 4ENZA 3HC4H 2AV1B 1ZT1B 1FL3B 2BS8A 5TK2A 3WEBA 4F7TA 1R3JB 3B7TA 3MJ9H 1A9BB 2F74A 2A83A 5DJ0B 5DVLA 1CJYA 2MCPH 3CK0H 4JO2H 3MXWH 4LSTH 3VXQA 4HD5A 1OQOA 4AUJA 2PXYB 1KLUA 2V17H 2C1PA 1MW0A 3FB5A 5EBLA 4Z77B 4ZNCD 4ZO9A 3VI3B 2AITA 1PTZA 3TBWA 4WCYL 3DPDA 1JGLH 4HYTB 1MJ7L 4QRUB 4PH8A 1ZA3B 5LNDA 4KKAC 4K7PH 5AB1A 4OCXL 1HXYA 2Q76B 3CZEA 3MMEA 4W9DC 5FM5O 4QHUB 1XEDA 1UB5A 5D2LE 2V4LA 2EIZA 2P43B 2FB4H 1HILB 1NBQA 5D7HA 2VLKE 3RGVA 3TCTA 3MUZ1 3L3OB 4HUKB 3NRFA 3UZQB 2FT7A 25C8L 2C9QA 1PKQB 4PBDA 3G04A 1SHXA 1QOKA 3MOBL 2GY7B 1DO5A 3PL6D 3MBED 4F27A 1NOFA 4P5TD 1CGUA 1WISA 1QYGH 2FSDA 5D7JD 5ICZA 1ES0A 3T3ME 4FXGA 4KXAA 4Z3EA 3CU1A 3BLPX 3NIDF 2IBBA 3NFSH 1AS8A 2ZSWB 3LEVH 4FNLL 3ZX1A 1ZS8A 1DQIA 3G5ZA 3W9EB 1BEYL 2JCCF 4X9IA 1ZLUH 3VNYA 2EC8A 3AXHA 3F85A 4J2QA 1J9QA 3TXAA 3D2UB 4ICXA 3H2QA 2V0AA 3QDGD 5F7UA 1JRHI 4EBQH 3DARA 1P7QD 5EOQL 4ACTA 3FOMA 4MCYA 1BQSA 1XAKA 2APXA 3A3YB 2VZ1A 4AUUA 4FQIH 1KZQA 3FUDA 2WXRA 1BLNA 5IMLB 5T1KD 4PJAB 5DZ9A 1VSCA 1HHGB 4V2BA 1IL1B 4YR6B 5E5RB 1S78C 1HKFA 5DJXA 5HHMD 2WN2A 4WO4C 5IVNA 2YAOA 3FK3A 5DK3A 3GHBL 1VB9A 1ZTXE 2OPCA 1B0RB 3G6AA 4HLJA 4Z7UA 4DP1X 1H3WM 3QG6B 3CVHH 4X4XB 2FCBA 3L3IB 1EFXD 1NLBH 2P5EB 4JFXA 3LAFA 3UBGA 2YR3A 3V0VB 3ZTNH 1MHEA 1QSFB 3B7UX 3D39E 1U3ZA 1XF4B 4MCZB 3D0VA 2MEJB 4I9WE 4WO4A 3RGVD 1CK0H 2MOQA 5FHAL 1RP8A 3TPUA 1JK9B 4L4TD 2Y7OA 4XXCA 3FSOA 2G2RA 4OQTH 2ZF8A 5BRQA 4ALAH 5KZCD 1XDTT 5KSUB 5FPIA 3KPRE 2QADD 2CDEA 2NY1B 2RQEA 2ZUXA 1CLYL 5IBTH 4PWHA 4B9FA 3FO0L 3OAZK 3AG1B 1X7TA 1INEH 2JI3A 4O58L 1F6AB 2IWKA 5F1IA 3C5XA 3FONA 1MFAH 5E1IA 3ZE1B 3ZDYF 5JIKA 4EZJA 3WSQL 5DHVB 2V8LA 5IQNA 4LE8A 1T5WB 5G4OA 5CMAB 1A0QL 3EH5B 3KJ4C 1IGIH 1X9LA 3FMGL 3OLDA 3TASA 1CLZH 3A4FA 5KVDL 2DDQH 4Y7OC 3TCLB 2V9TA 1IGCL 2VSCA 2VL5A 1TTCA 4IMKA 2R0ZH 3ASWA 1BQ5A 1JHLL 2MQ3A 1WWAX 3LQAC 4NZDA 5E8DL 3KLSA 1QFHA 3L5WB 1GMEA 3AU0A 3RVXC 4PVLA 1CU4L 3BP6B 4RIRA 5TGBA 1X44A 5IB5B 3MRIA 5EC1B 1MFDL 2NX5A 1SUHA 3ZYOA 4W81A 3SQRA 5GZND 1P5UC 4L1SA 3NCBB 1M05A 2V8MA 4XO5A 5IKCB 1PBYA 5LXGH 2P48B 4R96A 4ZX5A 3GSQB 3WLBA 4QAWA 2E27L 3U0TA 2GB2A 3QP3A 5J1AB 3ILPA 4PRAA 4JBSA 4XHJC 3VXMB 1M42A 1SXSA 3DTDA 2ATKA 2WGXA 3Q6FA 4Q0XH 2VQ1A 1IARB 1P1VA 1DSWA 1VZGA 5E9AA 3WJJA 1JZ7A 4PJDF 4P4RA 4WFHD 2VWEC 4A7GF 3B5GA 3HRZB 4ESKA 3FRPA 3MYZA 5E1AA 5C2BL 3I6GB 4OFYA 3U2GA 5K1VA 3RIAK 3QC5X 4CJ0A 3LZRA 4OSUL 3ULUF 4WUUE 6FABH 1LP9A 4N2EA 4PLOB 3DURB 3FU0A 4R7LA 3V0HA 5JXEA 5BZXA 2W80C 4X5PA 5EU6E 1KJ3L 1N10A 2FEEI 4HKZA 2CHXA 3SE6A 4QRQB 4HWBL 4L37B 4JY5L 3QIWB 4MMYA 3RZCB 2EIJB 2VN4A 1DVYA 2VDKB 3MRHA 3BZFA 4L3CB 3RVXD 1CICB 3BIKB 3L81A 2ADGA 3P4MA 1NKGA 1BZ8A 3K74B 3MV9A 2E6PA 2V5YA 4Q6YA 12E8H 4AQ8A 3JZ7A 1CR9L 1U8HB 1FVEA 5I2IA 1QFWL 4XH2A 4XNDA 4JVUA 2O26U 4XNMB 1CWVA 1I7TA 1AVAA 4OGYL 3BMVA 4UTBL 3LOWA 4K73A 4JG0L 5CILH 3LMJL 1Q9KA 4P9MH 3INUL 1N8ZA 2WXLA 3MPCA 4AQ1A 2FSEB 2ZJSH 3HI6H 1GZQB 2NQDA 3X1EA 3ZQXA 1IT9H 3UIZA 4FQ1H 4JHAH 4XPFH 32C2B 3VFGL 4DGIH 4G7RB 1LEIB 2IPUG 2EAEA 3SY0A 4NT6B 3VFWA 3B2UD 1G9NC 1CGSH 3KEDA 1AI1L 1VDGA 4NIYE 1SLXA 1P4BL 1TLKA 3NABL 5EN3A 5GS2H 5IHHA 4NWUL 4U2ZA 1Y6MR 1T0NB 4JZOB 1HL5A 3KGSA 1QPXA 5K39A 3FT2A 1H9DA 5JXED 2EO1A 1KIUA 1PSKL 2Q7AA 3JWOL 3U46A 2CK2A 4AUYA 2XPGA 1NSNL 4ZXBC 5A40E 4PJEE 1KTKE 1D9KB 1QABA 2L7QA 4NN6B 4BV1A 3ULUD 3SDDC 5F3BB 1A7RH 4R7NA 3QFJE 3BEVA 3AT9A 1M2VA 4LAQL 3VRLE 3ABLB 1WWBX 3JQOB 2AJSL 3A24A 3IRZA 4WSGA 2DQFA 2MMXA 3GSWB 4AVHA 1HCVA 5CIPA 3N91A 1EFQA 1C7TA 1NDTA 1UH2A 3OLGA 1CE6A 1UACH 3NCJH 4U1KB 1P6AB 3T3MB 4EN3A 5FV1L 3U9PL 4JPWL 1BD2D 2R29A 3PIQB 4PJBE 5CBAB 1JNLL 3S3CB 1U93A 2NUTA 3VWKA 3ZKND 2MJWA 4WDIB 3WN6A 1PLGL 4R7XA 2FR4A 2ZKWA 4PV1C 1T04B 3SKOB 4NQEA 1RUPL 4ZNE