1OK8A

Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion conformation
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
394
structure length
380
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPHGKEVKITPQSSITEAELTGYGTVTMECSPRTGLDFNEMVLLQMKDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords MAJOR ENVELOPE PROTEIN E
publication title Structure of the Dengue Virus Envelope Protein After Membrane Fusion
pubmed doi rcsb
source organism Dengue virus type 2
total genus 68
structure length 380
sequence length 394
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ok8A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1ok8A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1ok8A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1ok8A03
2GG1A 3UZEC 5JHMA 3C6EA 2R29A 5AAMC 3UZVA 5GZOA 4ALAC 4UTAA 5LBSA 1Z66A 3N44F 2ALAA 5B1CA 3UZQB 3WE1A 2JV6A 5IREA 4AM0Q 3J27A 4FFYA 3J2PA 1OKEA 1URZA 3UYPB 4X42A 4L5FE 4UTBA 3IRCA 5LCVA 3MUUA 4GT0A 5LBVA 1OANA 3UC0A 2H0PA 3I50E 5KVEE 4AL8C 4FFZA 3UAJA 3G7TA 1UZGA 3P54A 1S6NA 1TG8A 3N41F 2P5PA 3C5XA 1ZTXE 4FG0A 4BZ2A 3N40F 5KVGE 1PJWA 2I69A 2JQMA 2HG0A 5AAWC 2JSFA 5H37A 2R69A 3VTTA 5JHLA 4GSXA 4UT9A 2V33A 4UTCA 5KVDE 5KVFE 3N42F 1RERA 1Z3RA 4UT6A 3N43F 1SVBA 4BZ1A 1OK8A 5IZ7A 5GZNA
chains in the Genus database with same CATH superfamily
4ZSOA 1UD8A 2YPLE 5T3XD 5ALCL 2Q87A 3AQZA 2PXYC 1MFEH 2VUYA 3H6AA 1S9YA 4U1LB 2CM5A 4PH8A 1A7OL 3LHPH 2YOCA 1A7PL 3AADB 3KPOA 4JGMA 3L2NA 4LDLB 2ZXGA 1U8QA 2A9NH 4FQXD 5G4OA 1EJ8A 4LU5L 4MA7L 5L2KE 2AKRA 4YEFA 5DRWA 1WO2A 4J8RA 3AB0B 3HMXA 4EIUA 4HOWA 1DVFA 4KQ0A 4UT9L 1RZJC 2EYSB 4FTVA 2ZSVA 1N6QL 1ERNA 4HZAA 1TLMA 2P5WE 3QUGA 1NWOA 2V17L 4I77H 1XQ4A 3K72A 3PIQB 1ZVYA 4H20L 1MAML 1ZMYA 2WVVA 1O7VA 1E7UA 3QWNA 4MB3A 4UIKH 3DETC 1I1RA 4L8BA 1AHMA 4YDZA 2A7BA 3UGEA 4BXVA 4U1MB 3WNPA 2Y7QB 1NC4A 3K74B 2A9AA 3QUMB 4AE1A 2B9BA 2LT9A 3PV6B 4N3UA 2JKSA 4PJ7F 3ROLB 3QUML 3IB4A 2WXKA 2BVYA 2HRPL 3ZYOA 1NUGA 1PG7X 1XH3B 5KYYB 1AXTL 3GIZH 4PJAB 1KZQA 4YK4C 2X89A 3I6GB 4JY5L 2XTJB 5I1AA 2QV4A 2VSCA 4WWKD 3W1ZA 1FNEA 1G7PB 4NNYB 3ZSSA 2W9DH 4YDVA 4HSCX 3S7GA 1TKWB 2GSMB 3A4DA 1TTCA 5E6UB 1IAIL 2CKBH 3GS7A 1RKRA 2E9JA 1JDCA 3PE9A 1BF2A 5CFAA 4GG6F 1MDAA 5ANMB 4I9WE 2AJXL 1NMCC 4M43H 4XNYH 2ZX6A 1VF5C 3HNVL 3MOBH 1RHHA 4A6YB 4BQ9A 2K6YA 2AJYH 3QUXA 4QLRA 4YDIH 1ORQB 1KLUB 1TO5A 2XACC 3O45B 2KL6A 4D9QD 1T1ZB 4HUMB 1P53A 2WXMA 5C7XH 5EBMA 3U0TA 4Z3EA 4Z7UE 3FU9A 2VN3A 1OAYH 1HIML 5FKPB 3VXME 3VXSD 3EJTA 1NBZA 2A73B 1W15A 2CLRB 4KI5D 4BWUA 1U8CA 2GAZB 4W6YB 1IEAA 4Y2LA 1R0AL 4PJFE 3VVVA 2WD0A 1N70A 2ZONA 1HCYA 3F64A 5DEFB 3BIAX 2C3GA 5F3BA 4LLUB 3KPTA 4BFKA 2BY0A 1BM3L 4JFHD 4FYSA 4PWEA 2HPTA 1OF2B 5TFSL 4OLVH 3U6RA 1Q94A 5C0RL 1BZ9A 1KCBA 5EPMA 4X4XB 2R69L 1JV5A 1UB6B 2JJTC 3IKCA 3WIFB 3GMMB 4LHQB 3DSFL 5F8QC 3HBGA 3REVA 1SFDA 1HHHB 2NZ1A 4DAGL 3P02A 2BOCA 5JOPE 5IQ9B 1LO4H 3DVIA 1C16B 2ICEC 1BAFH 3HCVB 4JZJB 1UKSA 4QY8A 3BP6A 3EAKA 4JFWA 4EBQL 3S88L 1IAOB 1DBKL 1KXQE 5FO9B 1L3WA 1JPEA 1AQMA 1E9OB 1A6VL 3WCYA 2J72A 3S8FB 5IB1B 2VE6A 4RNRB 5AVXB 1URIA 4EZLA 4EO5A 2GSIA 4K73A 4NO0D 1NZRA 3AWEA 4ELMF 1DJSA 1H6EA 1XGYH 3HLKA 2FWLB 4WRLA 4M6AA 2LLGA 3FT3B 3VXOB 4FNRA 3SYCA 2YQBA 3HN5A 4G3YH 1M57B 1CICD 4P4RA 3TBWB 4WU5B 3LKSB 4YBLC 5H37G 3FRPB 2PTUA 3B2UC 5I19H 1G94A 3QCTH 4PGZA 3VFMB 4L4TB 3G04A 3CAFA 5E2UL 4JFXA 3FSAA 3P3SA 3Q0HA 2O6PA 2XLLA 3KMDA 1PKQB 1ZA6A 4Z7WA 3GJFA 1BG9A 3HZKB 3BPCA 3SE9H 4YHLL 3MV7A 5AOJA 5JIMA 2EJ1A 2OTPA 5FGCE 3AM8C 3SJVB 1VPOH 3UACA 3R06A 4JMNA 3LRSA 2VRQA 2DY2A 2EZ0C 5C0NC 2O6CA 1A3LL 4AEIL 4XVTH 1AC0A 1FVDB 2JF1A 5SWZB 3I50L 3D69B 1NCJA 2A1WL 2HUHA 1J87A 1WIUA 1KELL 3U46A 3I84A 5B1AB 3X12B 1N2RB 3DVGB 3P4NB 4U49A 2FYYA 3HG1B 3BRGC 3Q5YA 4DTGH 5I8KH 5I18L 3S4SA 1GVIA 4J3TA 1R46A 3HE7C 3PGCB 1U8NA 4JDZA 4UM9B 5AW7B 4FHKA 1ZD6A 2BVEA 1BQSA 1H3UA 3DTXA 3RPIB 2WXLA 3PGFH 3FQYA 1WBZA 4PRHD 1H3VA 3HFFA 4TSAH 2AGJH 2QPSA 1AZZC 1MH5A 2N1TE 4YUEL 1LO5B 3EO9H 4XH2A 4LSPL 1U4EA 1G9NC 1NQBA 2D03L 2VUOA 2X4SA 3PHOB 4X6CF 1WT5A 4ZO9A 3U25A 1MFCH 2KUTA 2UYLB 4MNQE 4E9YA 5MP6L 3DGDA 3S5YA 4XMKH 4FTVE 2EYRA 5F1NA 4C47A 5DUBA 1JF5A 4XN9A 2DBLH 1S7TB 3PWVA 1H5BA 2DTSA 5FYJU 5EB9A 2PP7A 4PW4A 1IE5A 4NQDA 1AGBB 1PLCA 5DD1H 1U8PB 4IGBC 1SJHB 2NY3C 5DMIH 4U1HB 4JQVC 2R4RH 4XPFL 5GJSL 3KS0H 3EJSA 3LSOA 4KDTC 4LEEA 3V4PA 5IY5B 1JZ6A 4Y16C 1AGDB 2QFPA 1FYTA 3S36H 4DP7X 4S1RL 3AG2B 3OKLA 1HCZA 4L18A 4Z8FL 3JWNH 2ETWA 3U4BL 2PCPA 2WLJA 2FEEI 3N44B 1VAHA 2QHRL 2VOTA 2HZHA 1N59B 2CDEA 3A4EA 3CV5A 4OJFH 1TYJA 2MCPH 2ZYRA 4MRCA 4BSVB 2HMIC 4OGAD 1OP4A 2PWDA 2ADJB 2IBZX 2HSIA 4RGNB 4F92B 1NLBH 1QRNE 4NAMA 3QIBA 3LS5L 4MNGA 4XPBL 4M3KB 3G6JF 4UV7L 2G3ZA 4WJKB 5I66A 1W72H 3N1MC 4A7TA 1CG9A 3L1EA 1YECL 2PR9A 3S2CA 1WBXA 4J3OD 2VZOA 3UC0H 2F54B 1FLRH 3HKFA 1QLEH 1PX4A 4KNUA 4XZ4A 1Q9KA 5J6HB 1OTUC 3MOQA 4JR9L 1J1PL 2VLRB 4UT7H 4DEUA 2OZ4L 5C0DB 4MDRA 5DZJA 3RY6A 4J3XA 4WI9A 3VG0L 1RFDH 2DBJA 3V5HA 3I9IA 4CA4A 1J05B 4JJHA 4X6FA 4MDJA 5F7AA 4NQCD 1ZLUK 4KQ3L 3O3UN 4EIGB 4EN3D 4RFNB 3ZX1A 5C0CD 5ES4B 3CVCA 5A1AA 3P3RA 5CLZA 4P23D 2VRKA 5CCHE 5ICXA 1TCMA 2WZAA 3B83A 4U6YB 4JFYB 4GAYA 2NY5H 4N8VA 4BQCA 1DJXA 4F57H 4UM8B 2EDBA 1R9FA 4LNVA 5D7IA 2FIKB 2W38A 3PL6C 2WP3T 2X38A 1EZLA 4HIPA 4QRPB 5FA3B 1IKFH 1P5UB 4MAYA 1PAZA 3LQAC 1D5XA 3ARFB 1OF0A 2R39A 1CTNA 2UY7B 2HJLA 4IRJD 2ODHA 2QJDA 3A67L 3CZSA 4NZRL 3O6KL 1N5AB 5C0AA 4JO3L 4RMSA 2IC2A 4LSRL 3ZDWA 3DPBB 3Q06A 3QI9B 5ICYA 3TCTA 2NY2D 3WMQA 3SKOA 2X70B 2XWEA 4BELD 1DVTA 1WFUA 5IQ7L 5LGKA 3AQDA 4Y1TA 3UZVB 2VTFA 2HA1A 2X1WL 3D3VA 5AL8A 3I02A 5JW5A 3QUYB 5I23A 4XBMA 2CPUA 1GGYA 5HY9A 3QIWC 5H2BB 4GBXD 4C83A 3PAYA 3L7FB 4M00A 3HPJA 3P0YH 5CR8A 1GC1H 1UXWB 4WTZA 2PR4L 1LD9A 3CH1A 1QR1B 3QQ4A 3B3IB 4FFVC 4AC4A 1DJHA 1NH6A 1XGRB 4JX0A 3E1ZA 1H6FA 3C75A 4N85A 4K3HA 4QRRA 1REIA 1U8HB 2GK2A 2OR8A 3FQ1A 3QDJA 4NQED 4XPTL 3MGOB 2X88A 4QR7A 4OJAA 2ODIA 2XWBB 1RPKA 3VVWA 4BM7A 5J89A 3JYCA 1IT9H 3FB6B 2BHUA 5C0EB 4HBCH 4HD9A 2ZTBA 2W91A 1VFBB 4AEHL 1UUNA 5ECJE 4WTZG 4GRLB 4KKAD 1YEHH 4B41A 1EGJL 4Z7WE 3FTWA 4NO2A 3CLEH 4H5SB 3KJ6L 3Q13A 2OR9H 2V33A 3MV7E 4LPWA 3B3BA 3U7AA 2WAQA 3MX0A 2R0LH 2I7SA 3O11A 4PN6A 4LK4A 2XX0A 1T7ZA 3EDKA 1X3DA 1YNTA 1XIWC 4NUGH 4XXCC 4ZFOL 2ADFH 3JV6B 1NCWL 5E6IA 1XF1A 2PW2B 4FQXA 5MEQA 1Y7VA 1OCOB 4M48L 4TXVB 3C6LA 3IAQA 3P4LA 2KLTA 3MRCB 4FFZL 5GGUA 2R59A 4GQRA 1GZQB 6FABL 3FU7B 1LNUA 1GYWA 2OS7A 3BSHA 4PJDF 1QTYT 3D25B 5JYLA 2MHAA 3BSZH 5C09D 3THML 1CI3M 3CSGA 1NMAH 4RGMC 2UUDK 2WY3B 1JHTA 3WJJC 1SY6L 1H8LA 3WTSA 1HX0A 3KPQB 4N24A 1ZTXL 4DFHA 2GC4C 1EVUA 2Z4QA 5EDXA 4NI6A 4EOWL 4XAWH 3X14A 5IBLD 1W0WA 1AANA 2F5BH 4KDVA 1N8ZA 3JWOH 4MJ2A 4P5MB 2AF2A 4OCRL 4EI5A 5CINH 5F96L 4L4VB 2OSLA 5IOKA 4NKIH 4KI5F 3TWCL 3T0EA 3HUJB 1Y0LA 1R3JA 3DX7A 3VMOA 5JNYB 4PJXA 3F58H 1G7QB 1WCBA 3VGHA 1PLGL 4NQDE 4WWKA 1FWXA 3BYYA 4HJTA 4AVIA 1NBQA 2I9TB 3CHXA 2UX7A 3E2HC 3CN1A 1WA1X 3OWEA 2XOTA 5C2BH 1FYTE 1M7IA 2HB0A 5DU7A 4J3SA 4ATWA 4AMXA 2B08A 3T2LA 3V4VA 1ROCA 3LZRA 3WFDH 3EADA 4Z0BL 5GRVK 1KGYE 4XCNB 1JNHA 2WO2B 4HK3N 5BUPA 4G7SB 1GZPA 4L9DA 1KUMA 2ATPB 3U79A 3C9NA 4NJAL 1FVCB 1MCNA 5D5MA 5GZOD 4GLRH 1H8SA 1DLHA 3C5ZA 3TJEL 3EFOA 1MCPH 4PY7B 3ZGHA 4OJYA 5EUOB 3RNKA 4P04A 4PG9B 4KK5C 3HNTL 2A74B 1KTDB 2NLJB 4GIAA 3B7TA 2DQJH 4AJWA 5JW4M 3LPPA 3TLRA 3PLYA 5CGYC 2AXHA 5HHXH 3B2VL 3HB3D 5DO8A 1SYVB 5KSAB 4BFRA 1EEZA 3OR6B 1LK3L 2XJLA 4HKZB 3WTUA 1HNYA 2FCBA 4XNZB 3KYOA 1KIUA 5ADOL 2X2IA 2AEPL 1G9NL 4R96B 3GPEA 3MRDB 4L29A 3ZUNC 5A2CA 1KGXA 5HYSG 5JXAH 2YPKA 1CD8A 4DGVH 3IDGB 2CRYA 4HS6B 5FW7A 3ECQA 3MROB 4U2ZA 2IQ9L 1XR9A 1FO0H 1XWVA 3QHFH 4KVCH 4A6YH 1U3YA 2J73A 1KBPA 3BP4B 2DM3A 2WBJA 4WV1B 1F8TL 1EO5A 4NN6C 5D7IE 1MCKA 3AFLA 1QWUA 3BPNB 5F9WC 3C6EA 4OV6F 3ZOAA 4WCYL 4KAQL 1NBCA 5JHLH 2VR9A 4JPQA 2HWZH 3PPEA 4K7PH 4DW2L 3V8CA 3E6FA 3GKWL 3OWRA 5F7BA 1UD2A 4K94C 4Y16B 3PXJA 4L1SA 1OSEA 5C0AE 4E5XA 5CCGE 1KC5H 4PRID 1MN4A 3W0WA 1MHPL 1CZ8L 3PJLA 5DJDB 1T0MA 3ZL4L 4LRNL 3ZPDA 4FN0A 5AD0B 1KN4L 1NDMB 1UWEH 1R3IL 5E94A 3NK3A 1YJDH 5KSVA 2P5ED 1M2VB 3B4NA 3P0VH 1Z32X 3ARBD 4XXDA 3VFVB 1HESA 4P2OD 4X7EC 2B39A 3AS0A 3FUFA 3LHAA 4H0HB 3SOBH 4BH8A 1GGCH 3FU3A 4XPHL 3RGBA 3MRIB 4KH9A 2AANA 2ZUWA 1F3DH 1PX8A 3IDIA 3OMAB 3OR7B 3MLXL 3Q6FB 4FZEL 4K9EH 1I9IH 2ERJB 1IGIL 2A6DB 4GQQA 3MMEA 4OV5B 5I6XC 1OPOA 5I1HH 5KYWB 1UXSA 3FTZA 4KJPC 1P5VA 3Q48A 4ERSH 3V7AG 4CC4A 2R0WL 5IB2A 5E51A 1B0IA 3ZE1E 1OB1A 43CAB 3PQYB 3NCJL 1DSFH 2BVPB 3QDJE 4DKAA 1YNLH 2JKNA 3RVWC 4TTGA 3KS0J 1KGWA 5J13B 3VDAA 5IVXB 2ARWA 2QSQA 1Z5HA 2HJKB 4PUBH 5DUPH 3O6LL 3P77A 3WLWD 3EO1A 4BFIA 3F62A 1BLNA 3P4OB 2ZCKH 2AEWA 3PWUB 4YGVB 4DZBA 1W2KT 3T4AA 2LU7A 4PTUA 4MS8D 5T3XE 1BWMA 1OLZA 3F5WB 1EHXA 4P2RB 4Y2OB 1VCBC 3LQAL 4XP1L 3U7YH 3W3BA 1NFDA 3WNOA 5FEBA 4XOAA 2XBZA 3B5TA 2YUVA 3QEQD 3BP5A 4KRPD 3AW5A 3T08A 1G7JA 1MAKA 4E9SA 4CSTA 4PJ8D 5TQ2L 5DT1H 2ZCLL 2AJ3A 1UA6L 1M1XA 2E7LA 3RI5K 4JPVL 3WAKA 2D2CC 3OXSB 1IL1A 2OMTA 5IFJA 1X5LA 4BQ6A 5PAZA 1GIGL 5HD8C 3LY6A 2E27H 1JDDA 1IBGH 2WN2A 1N26A 5E5RB 3REWA 2ICWA 1WLGA 2CU9A 2BSTA 3L95A 4LOEA 4YR6B 2NNCA 1Q72L 1NBVL 2IDTA 1MFMA 4FI8A 5F88B 1F4HA 4LEOA 4LL4A 3FOMB 3FH8A 3GI8L 2JCCA 1S7VB 5T1JA 3DX3A 5KSBB 2OI9C 5BS0D 3X3FL 1T89A 3JWNC 5HI3C 3TJHD 1M3JA 3HFMH 3O8XB 4WENB 1BF8A 3G6AB 3VRJA 2VXSL 3LKOB 1NCDH 3NQKA 3EGDA 3GHEL 3LPFA 4IRSA 3HZYB 1ZLSL 3CMOH 4PJXE 4HMCA 3ULVD 3UJIL 3BYTA 5AW6B 3WN6A 4APXB 4ANVA 3K4AA 2DJ4A 1RUMH 3TIDA 5JHDB 4U33A 4MMZC 1RURL 3UJJL 3ZGIA 4CN1A 1RQ5A 4WIQA 5D2NA 4OI9A 2BZCA 5EA0L 1A9BB 4NNPL 3H9SA 1YQ2A 2YMOA 4O58L 4X0NA 4ZPVA 2RQEA 2DM4A 3DXAB 4P23A 3VQ2C 4G6MH 3M7FB 3DX0A 4E41B 5F7NC 5FFLA 5JW4Q 2AJVH 4MXWL 3GBNL 1CJYA 4LLWA 5D5ME 1WRFA 4NUQA 5HDQL 4L0ZA 3WIHL 3CUPB 3OGOE 5E8NA 2NY5C 4QTIL 3SDDC 2JIXA 3CXHJ 4DKDC 3QORC 2GJZA 3CPUA 3KPPB 1E9PA 1HAWA 4ZW8A 3IK2A 3EH1A 4WUUD 5CHNB 3HS8A 2X4RA 5CEZE 3MC0A 3GZKA 4ODTH 3RWCB 1ZS2A 2CA4A 1C5BL 4H2CA 1I3VA 1WYJA 1UM4L 4MHHG 4LAQH 2A99A 2YS4A 2F8VA 4ACTA 3FTSA 3VWJC 1EMTH 4Z7NE 2CQVA 1ZGLP 3ARDD 3JWDL 4UIKL 2VDKB 4OTXH 3QWOA 1QSFB 4LCIL 4NHUB 1JFQL 1F11A 3TBVB 3V7MA 1QW9A 2FGZA 5IWLC 1TYEB 1KJ2H 3LN5A 1SXCA 1NGQL 3UPRB 5G4MA 4GAFB 4DUVA 1BIHA 1ADQL 4FYTA 1N3NB 4K8RC 4NPJA 5D70H 3U2IA 4BZ1A 2Q10A 3BPOB 1L7TH 4Y8DC 4HUXB 3X3GH 2OCCB 1CS6A 3CZKA 4N0UA 1I8AA 2PW1B 3BKJL 5IJDC 4TRPH 2Z0UA 1RPUA 4YPGA 1HCFX 4HC1L 5GGRY 3ZR6A 2ZG2A 5B1BB 1HN1A 3BH9B 3CBKB 1D5IH 3DHPA 4N6QA 3RIFF 43C9A 5EORL 4GBXA 3VMPA 5L7XH 4GMTH 3F7QA 4GKSA 4K5PA 4PWHA 4HLEA 1AZNA 3IDYC 4LZKA 1IIIA 2HFFA 3L7EA 1UM5H 3W0WE 1SLUA 1B4LA 4ADGA 4XXWC 2IMNA 3POCA 4JPWL 2DTML 5TH2B 4HAFA 3KXFA 4DQOH 1E4JA 4UOW0 5I28A 2XXFA 4UMSA 5CMAB 1INDL 5GISL 3RWGB 3TH2T 2AI0H 2C9SA 1BQKA 3QARA 2XA8H 4TNWK 4UQ2B 4ZTEA 4JRXD 3MUUA 1LEIA 2RH0A 1S7UA 1NCHA 2IBZY 4MWFB 3HA0A 1J8HD 2EIEA 2Z8RA 4M3JA 1U9KA 1PZUB 3FFOA 4GO8A 1ZOXA 4JM0A 4H8HA 2Y5TA 3U0PB 2F7RA 5KBMA 3FQUA 1FZOB 1DE4B 1I7UA 3W11D 1XZWA 3TX4A 3ATFA 1NGPH 1SLWA 1CIUA 1PZ3A 1J5DA 5D2LE 4R4ND 5HGDA 4X6DB 5JPNA 4G7YH 3T65A 5HYJD 3FL7A 4Y5VC 3QT2A 3RAJH 3IEAA 4FXLA 2FEJA 3BIKA 5L6YH 2JXMA 2Z8WC 3NA9H 5B8CC 2B3RA 2VR4A 3NRFA 4M6OL 4XVOA 5BNXD 1KPUA 1S3KL 2KI6A 1R6VA 3SPVA 4HIHB 4OCMC 3L2MA 4IU2A 5C09A 3LPGA 2NY4C 4N4YB 1FFNB 3RRQA 4CVZA 1H0DB 1FFTB 4G8FA 4FNTA 1I1AC 2JK5A 4JN2B 5F6HI 3VFTA 3MXWL 3VMNA 4F1SA 1GMEA 1UB5B 1NFDE 4W9DC 5MI0C 1K8IB 2X3AA 4MZRA 5KSUB 5I8CA 3W38A 1PCXA 4K94L 3NZ8A 3M8OL 2YA0A 4Z95L 2D31B 3Q9PA 3US0A 1J1XH 3ET9F 4N0RA 4ZS6C 1ZVSA 5EU4B 1SVZA 2APVA 1QEWA 2E74C 2JE8A 4UILL 3BO8A 2VJ0A 5FW6A 2O30A 1P7HL 5FXCH 3QRLA 5KS9E 1RMFL 1FFPA 1XGQB 3JWOC 1ZLWH 2E0PA 3DGGA 2PXYA 3GI9H 3UYPA 1RJZA 3PREA 4PTTA 2J12B 2HTKD 1K5WA 2CDFA 3KVDD 3B8YA 2DQHL 1BX2A 5K1NA 2OJZL 4LO9A 3HG2A 5JA8B 3ZW3A 1J1OH 3IFNL 3G9VA 4LCUB 5DYFA 1IO4C 5DJ8A 4WEUD 1V05A 3NDYE 3WEXA 1AXSA 5I5JA 4F24A 3DOHA 3WJMB 2DM2A 4M5TA 1H9VA 5CJQL 3NVQA 1J48A 2JCCE 2XQYK 3BUQA 4KX7A 3NP4A 2WYTA 3WD5H 5IQOA 3L1OL 5KOVC 3F65A 3FT2B 1CO1A 2YKLL 3TEUA 1JTOA 2VW6A 2VZTA 2VDNH 3MYZA 3GSOA 3GS0A 4KRNA 3QA3A 2JI2A 4M9OA 1SUJA 3B7RL 2EQDA 2X4UB 2NY1C 4G8AC 5CWSB 5AWNL 4AIXA 1R34A 3BZDA 4ENED 1TU2A 2K4WA 3DOSA 2YD7A 4XCEA 5E70A 4IM8A 1CB4A 2FLBT 2Y25A 3C8HA 3MCKB 2VM9A 3R8QA 3P9LB 4W9JC 4YE0A 4I5BA 4KQ4L 2YXVA 3FSOA 5D2NE 3FCBA 4PS4H 3H56A 3VX0A 3H9SE 3AREC 4GB9A 5J7CC 2AS5M 1ZV9A 3OD3A 3TCLA 2IDQA 1MCLA 4JJ5B 3B2MA 1JERA 5E99H 2L7JA 3GZPA 2R56L 2WCGA 3O0LA 4DOHB 2DIJA 3SE4C 1MHHB 1MVYA 1I1YA 2X4PB 2I07A 3DV4A 4XGZA 1E65A 3V4UH 4KTDH 4YBQC 3EO9L 4N90D 4Y2DB 5IHUL 4YDKH 1M53A 4OLXL 5FFOA 1HEHC 1U3HD 1BZ7A 3RE0A 4RA0C 1Z2KA 2IWEA 1GA2A 4LSVH 2JFCA 1F2QA 5IEKA 1T7VA 1WC7A 3C60D 3HC3H 4NM4H 4JN1H 2GBUA 1AI1L 3IBOA 4YE4L 3RFZB 2KZWA 1TZGL 3FF7A 2AXGA 1F18A 3BUTA 1Q9LB 3P4MA 2DBLL 2NOYA 4TL4A 4X50A 3KWWA 5JLZA 5D71L 4J6RH 1WZ1H 4HZ1A 5KUMA 3DIFA 4L8DB 5D7SH 3WEBA 4O00A 2CXKA 3VCLA 4N9GA 5I76B 1DCEA 3CDFA 1MOEA 3ILEA 1NCTA 2CO3A 2IH1B 3LIUA 3KM1A 4Z77B 1J0YA 2OI9B 1D7BA 5CKAA 1UM6H 3QYMA 3LRHA 5D7HA 2X9YA 3U2GA 1A14L 3WEOA 5GGTH 4N0UE 4WW1B 2V2XA 2QHLA 1CR9L 3SCMC 4JO5A 4OJFL 2MCPL 2P5EA 1KB5B 3SGDH 3BW9B 4GO9A 5KTEH 3HJ0A 1KB5L 2GSGB 5GGSA 5LHDA 4V1DB 4G7RB 4P2OA 2F1AA 4M1DL 1MWAA 1ANUA 1KLFB 2G0LA 1BECA 5INDB 2QMJA 2RMNA 4FXGB 3L3OC 2IXQB 2YIHA 5T5NG 1CGSL 3TA3D 1TQWA 3HVDA 2VC2H 3I75A 2CK2A 1KT2A 1DVQA 2EEFA 4LLDB 2JJTA 4AEEA 3U2HA 1T6WA 4ODVL 4AQ1B 1BLIA 4JM2D 3BZFA 2NPLX 2P8LA 3KLLA 3KXFE 4RFEB 4Y5YA 2WXNA 5K33A 4B7LA 3HE6C 4PJFF 1AY1H 1RJLA 1T66D 3EG9B 3GSUA 3I6LD 3KPNA 3FZUD 1A4JA 2H32H 5SWSA 1J5CA 4AYDC 2NY0D 5H8DA 2ICEA 2YUWA 3VYOA 5KW9H 3C8KA 4I48B 3FRUA 5JQ6L 2ZOLA 5MHSD 4M1CC 4JVWA 4MSWB 4NN5B 1BXUA 2ZWZA 1QP1A 3KPRA 2W60B 4D9RE 3RGVB 2HT3D 3QCUH 4NZUH 2IMMA 4Y19D 3UAEA 1KCWA 3DX9A 4EPSA 4XE0A 1GW6A 1MJ7L 2YAEA 3S96A 1GOGA 1BYPA 3ULUD 4RMQA 2FZ3A 3L9RB 4HCRA 4YHPB 5CZXC 5T1KB 3DX1A 4Y5XB 4GXUM 1PDKA 4D7BA 3BDYL 4Q4IA 3CFCH 4KUCF 3HN8A 4KXZH 4P9MH 1AHWB 3T9WA 2WWMD 3CFKA 3VFUA 3SODB 1AD0A 2QGCA 2YEZB 2DN7A 4NIYE 5DLLA 1JXGA 1GJUA 4DZ8B 4AUJA 2ZWYA 3CZUB 2JB5H 4JG1L 2BSSB 4K8RL 1BEYL 4WFHE 4L5FH 3BWSA 3TVMD 2J4WH 3LNHA 5GSRA 4GQPH 3FB8B 2VXUL 1E67A 4XPGL 4I0PB 5C09E 1Z5LB 1S5IL 5GRYA 3T1FA 3M1BB 1RY7B 2APFA 5E6YA 3EFFB 5C0BB 2JCWA 5I8OH 3MLUH 4OFDA 1XGPA 2WBXA 3BN9C 3KAAA 4UTBL 5J6SA 5KYXA 1S5HB 5TQ0H 3EDFA 3IVKB 3BDBA 3E7JA 4R97B 3FJTA 1YMMD 1M2OA 3QW9A 1YC8A 5E9AA 3H9YA 4PJIA 3VAEA 4UT6A 3TO4A 2NW2B 3SDXA 4P46C 4D7PA 2XFXB 4KZDH 2F8OA 5CAYB 4EVNB 5DHDA 1U92B 4I13B 4Y9BA 3IE4A 3KVPA 1UD4A 1EJFA 1EA9C 2NSQA 2BOBA 3MR9A 3HE7A 3MLTB 4H88H 5HHPB 1YMHB 3ZKMC 3T2NL 3V6BR 5AB2A 4PVLA 5HVWA 3LDBC 4O9HH 4OIIH 1AGEB 1B9KA 4P5TD 1RIUH 2B1AH 2VN6A 3NZHL 4XVJH 4LNRA 2Q2EB 2A3TA 2DQUL 1T5WB 2DYPD 2XV3A 5IT2L 4IOFD 1V7MH 3STBA 4DO4A 4R7NB 1RK1B 1MKFA 4M61A 1MNUL 3GBLA 5IMOA 3BUYA 1YEHL 1ITCA 4PJCA 1HINH 1NEZG 4KHXL 4ZUUB 4XTRC 4E9VA 1CE1H 1G0YR 5I0VA 5I0YA 5DSCB 5I75B 1CT8B 4M8UA 2R4SH 3SO3B 4E2OA 1DANU 1JE6A 3C8DA 4PG2C 4JFFD 1FIGL 2X2JA 4FS0A 1T2QL 4LKCA 1DO6A 4IGBA 4MASA 4AIZB 5HI4D 2ITDA 4JQVA 1DQIA 4HALA 4E9RA 3Q3GA 2VSDA 2XX1A 5I1KL 1J5IA 3SY0B 3TN0A 2L7QA 1HK6A 4EF3A 3CTTA 3O4LA 1WD8A 5IF0A 2UZXB 1N0LB 2IDUA 2VLKD 2Y24A 4HUUB 2GI0A 2WXQA 1R5IB 2W94A 4XOBA 3W57A 2XZCH 3G08A 4MXQC 1OK0A 5F89B 1M6OA 1N64H 5F7EL 3UTOA 5BVJA 4DUXA 2WO3B 3BPLC 3I9PA 3QNFA 5CP3H 3VXTB 1ZEAH 5I71B 5EUKB 1S8DA 2B14A 1UADC 2EDLA 2IJ0C 3ARDA 3Q1SH 3WUWB 5B21A 1EXGA 32C2B 4LRIA 3RWIB 5ACZA 4JO8A 3FQWB 1PZDA 4MB4A 3MNWB 1MCWW 3WN5C 1ZT7A 3R0NA 4PJHA 4XHQA 3ZKSD 1FNAA 2DL9A 3OKNB 2P3YA 1OIOA 1E4XH 4W9EC 4XCCH 4NJ9H 5E2JA 5FV2A 5IGXH 3GRWL 4FJ6A 1CXLA 3C08L 4A2EA 2WYZA 4M62H 4YAQB 4P4KC 5AVUB 4P07A 1LQSR 1AKJB 5INCB 1GYAA 5D1ZC 2AK4A 1CK0L 4NUJB 1T3FA 3HMWL 2G4GA 4HT1H 1TQBC 1AOHA 2EO1A 1ORSA 3O2DL 2XDHA 4JO2L 5FV1L 3F58L 2ZWNA 4QHPA 5H4YA 3O0RH 2VLJD 5T1MA 3DK2A 2FB4H 4KJQD 4BIKA 1GTNA 4ODBD 5F0MB 1MLBA 4TOYH 2IQAA 1IV8A 5HPOA 2YPVH 5D8JH 3CZEA 4P3DA 1T03L 1XCQB 4W68A 2V8MA 5K9KA 4WHCA 3AG1B 1UOVA 3RKPA 4IQHA 2Q7YA 2W95A 1P0SE 3QG6A 1TSRA 1XZ0A 2VWEE 4LARH 1R3KB 2VDKH 3BAKA 3PL6A 3CN3A 2ZP8A 3ILDA 2JKTM 4MQ7B 4RMWA 2P5EE 5F7UA 4GP5B 5CEXA 4N0CD 3RYMA 4OZGA 1IC5H 1GHFH 1WBYA 1T0OA 2GG1A 1U95B 1A7RL 1J8HA 1T5XA 3S34H 3SGJC 5E4EB 3VD2A 5ICZB 5DFVD 3VFPA 4QAMB 2OFQA 1MIEL 3HN3A 4HS8L 3F00A 4HKJA 3ZT6A 2CA3A 1BD2B 4GRWH 4IBTA 4JEGB 2DQJL 3B9KD 1UXMA 4UNUA 3CCHB 2OCFD 3W39B 1UURA 1OAZL 3D09A 3ZKXB 1FRGL 4KRLB 7PCYA 1IU1A 5SWSE 5LGJB 4EXPX 4OZIB 3QYNA 2B15A 3J2PA 4ZI8A 1OKEA 2M2DA 1BVNP 4NKOB 2N1KA 3BUIA 4HAKA 2O5YL 3VE0B 3EDJA 3MV8A 2XKNB 2K7PA 1AD9B 4FFTA 4TULL 3N1FC 5FF6A 4TSBH 4DP1X 1SJXA 1NTDA 1EAJA 4HV8B 2VZVA 1DJYA 2F53B 3BQUD 4OF6A 3IPBA 1E0OB 2F7PA 2FX8L 4XWOC 5AZEL 3EH3B 2HRGA 3LQZA 5LAPA 1ID5I 2XUWA 4AGOA 1URLA 1NGZB 4X7TB 4ADJA 3FT4B 3O6FD 4AK1A 5HDLA 1J5HA 4X8JA 4XPAH 1FVEA 1RZFH 3IRPX 3QEQE 4KMQA 5JO5B 1GAFH 3KHQA 3MRRB 1Q1JL 4PV9A 3V95A 4E42A 1DUZA 4Q9RL 4ONGL 5C9JB 2JJSC 2H1PL 3A3YB 4N1HB 4BWWA 1T04A 2H7WA 2IDFA 2H5UA 5D6DC 2IGTA 1P7QD 1P6WA 3B1UA 3EFDH 4DN4L 3OF6A 4UQDA 3AMKA 4JFZH 3DURB 4FQCH 3ABLB 3TV8A 3S35X 3UBXG 3WKPA 1GH7A 4Q9QH 3OKKA 4LCWD 4YBHA 4K71C 2QGDA 1FFRA 1J0HA 5I6NA 1JK8B 5F93C 1XIWA 1EJOH 4DCQB 5AB1A 2ARJA 1D5ZA 1A3ZA 5FWRA 1NPJA 2DEWX 2DWEB 1C08B 2XN9D 4BHUA 3KPLA 4JKLA 4JO1L 3ZDYF 4HJ0C 1A25A 4UU9B 3SPHA 2BSRA 3SDXE 3NJKA 1PYWB 4R8WH 3A21A 1S9VA 2J8HA 3NTCH 2CMRH 4OD2A 1YY8B 2WQAA 2YZ8A 2OMXA 4N2KA 4PJ7B 4XCYB 4A55A 2V7HA 4H8PA 1RP9A 2FX7H 5CSZA 5DK0B 3TYGH 3OQRA 3WJJA 3MREB 5DQJB 1YY9D 4L2LA 3DA0A 5J57B 4MA1C 2V5SA 1AACA 3TFKC 4ENZA 5B3SB 5FLUA 2FSEB 3L8QA 3L3GA 5DUPL 3TCXA 3N3EA 1LO2H 2OK0H 4NKDB 3MZGB 3ML9A 4U1KA 5GQBA 2AEQH 1ADQA 2NY6C 3HG3A 1CLYL 2VL5B 2VN4A 3CLFL 3UZQB 3VFGL 3RY4A 4ZMAT 5AG9A 4LSTL 4PJCE 1IILE 4QAWA 1DP0A 3V0FA 3SKNA 1LE5A 1S9XA 4XX1G 4Z18A 5H94B 2WLLA 1P9MC 3NT0A 3F7VB 4GH7B 3K4DA 4XRCA 3OGCA 1KEMH 3KCPA 4GG6B 2IPUK 3GXMA 3G5VA 4LCCA 1SJEA 3MRQA 2BY3A 3O9WA 1NC2B 5IUCA 2ZZUT 2XWRA 3K3QA 3G5ZB 2A38A 1NANI 3VQ1C 4L3ED 1BV8A 1KLGB 3C12A 5DK2A 2I7OA 2IH3A 4OCXH 3D7PA 3OX8B 4X5QA 1C12A 2PYEB 3TEXA 4HEMA 3MRHA 3QBTB 2WW8A 5A2LH 3WFCH 3K2UL 5DA4A 5DUJA 4FNLL 5EF0A 2CKBA 3V0WL 2PUQT 3TIEA 4ZMNA 1CLVA 5DMGD 4JFVA 2G5RA 1X9LA 5K59E 4OUUB 4TM9A 3QULB 4X6BB 4O4YL 1L6PA 5DHYA 3ZL1A 3QEGH 4XP9H 5L0QB 4YX2L 4ODWA 4XNXH 4PJHE 2Z31B 4GMSL 3ARGC 4U2YA 1IAII 2CLZB 4JDTL 4FLSA 4FTDA 4OBRA 3RDTC 3SGEH 4I4WA 1OAUL 1RJCA 5D7JB 4EDWH 2TRYA 1WGVA 3OLGA 4MVBD 1ZTMA 2ICWI 3S6CA 3VSVA 2AK4E 1OAKL 3HI1A 2XTJD 3QIUC 2C26A 4NO5B 5E1IA 4Q9BA 1TZIA 5DS8A 1NAKL 2G75B 3KM2A 4P2YA 4MNHB 4FFYL 1F6AA 2X09A 2CO6B 4KV5E 1L9OA 3D0VB 3EHBB 2IOOA 3CLWA 3EBHA 3L6FA 3QG7L 3BCFA 2C4FT 5BMFL 3WTWA 1MFDL 1XCTA 2J21A 4PM1A 2Y1ZA 3WS3A 3MLRL 5J1TC 3SDCC 4TMPA 1PKOA 1A6ZA 1H15B 2HXAA 1JWMB 3LNEA 1TVHB 2DQIL 2NZ9C 2VXQL 5C2UB 2EXTA 1UH3A 2AXWA 1VDGA 4ELMB 2XKUA 1BPLB 5FYKL 1CGTA 3BN3B 4N5ED 5GJTL 5I73C 3S5LG 2Z0BA 2ZXCA 4OZGE 4BWTA 3I2CL 2C1OB 1QLRA 2HKFL 4PBWD 4Z5RA 1J8HE 3QPKA 2CE6A 4BGLA 5FM5O 5C0JA 4IKIA 2XETA 3QEHA 2WJ7A 4HJGB 4KPHH 1I7ZB 3MJ8B 4X9FA 4XN5A 2K70A 4HIQA 2B2XL 1RZ7H 5EEXA 4X6EA 5D7IF 2E8ZA 1JPFB 1BW8A 5EC1A 3KYMA 1ZWIA 5HHNB 5IBTH 3X1GA 4EQ2A 1SXZA 5FUOH 5HTSA 4JHAH 5C3IA 1ILSA 4MHHI 4ODTL 1QFUL 3BKMH 1CIDA 3MNZA 4HBQA 4KY1H 4ZXBB 2QQNH 1AYOA 4HUCA 3QZMA 3T0WA 4LPTA 1JZ2A 2UWEA 4KK6C 1KDJA 4JHUA 4OGYL 4YFEA 4LQ1A 1E2WA 2DPKA 3MV8E 1E28A 2EECA 4KK8C 5EU3B 4AH2A 1JJUA 5LBVA 2OW6A 4MJIA 4UAOB 5E00A 5HGBA 3K81A 3OV6A 3SB3A 3UYRL 1DUYA 1KPRA 4I3RH 2LW5A 3UIYA 3TVMA 2PO6C 1CFNA 3EKCA 2NYKA 2YZ1A 4BXSV 4WLCA 3QWRD 4Z7OB 5IKCA 5FOBB 1TENA 3KBPA 4TSCH 1JGEA 3PWLB 4TKWA 3WFHA 3P54A 4H44C 4HJJL 3OKDB 1QUNA 5I0DA 4GFTB 2Z93B 1B3JA 3G6DL 3TL5A 4OJCA 3RL2B 3D33A 2F61A 1T4KB 5EIIB 1AJ7H 4MX7B 1RU9L 3I74A 3CVIL 4RX4D 1MREL 1KENL 2UZIH 2EKSB 1AVAA 5EOQH 3MHZA 5IB5A 4X6CB 5CBEB 1TUPA 4PRAB 2V2WA 5AZ2L 4N26A 4O02H 4JCLA 5LCVH 1T1WA 2DKUA 2X2YA 1LMIA 1F00I 3IJHA 3RWDA 4YC2C 2NZIA 1TOXA 1I9RH 3QP3A 5AKSA 1U2YA 2HT4D 1FGNL 4WNJA 3O2WH 4L4TD 5IW1A 3WSQH 2EO7A 2J1KA 5L2JA 1JOIA 4ZUTB 3DMMC 3K6OA 5BVPL 2DYPA 3VI3A 3MFFA 1KCRL 4N0FA 4XVSL 3IJEB 1M05B 2X2UA 3T1WA 1DBMH 1DBAL 4IRZL 1RXLA 3RJOA 4ZNEA 4HUNB 1RK7A 4O2EA 3EGXA 5LDSA 3SJVD 5BV7H 4MCZB 1IQWH 4QLWA 4HUWB 2H8PB 1QTSA 2QSVA 3MXVL 5IB3B 2EYTA 1THAA 2EIMB 3LAFA 1EBPA 5IMMA 2VM4A 2BNUA 1TQTA 3FO9B 4LLQA 4M6NH 4XBGB 5F9JA 4Y4KB 5B3JE 5SWZD 2ITFA 3ECVA 4YSQA 1KCVH 2HN7B 5F7DB 4UINL 1HOCB 3L5HA 4NI3A 3V6FB 2AZAA 4YHYC 2H3NB 4KKCD 1NOAA 1SN0A 2WC7A 3FKUS 2CBQA 3MRKA 4Q97A 3RTQB 3GBML 3G6JB 5ID1B 3HG1D 4A2HA 3CFTA 4UQIM 1ECZA 1OGSA 3NJIA 3OMZA 1S7RB 1HKLH 4ORGB 1GYVA 3NCFB 2IAMB 2FECI 3L08A 5FIEA 3TXAA 2CPCA 2COQA 4POYA 4BE6A 3SDAB 1VEMA 4UM9D 1D7CA 4S2SB 5IJVB 4YNYB 3PP4L 1IFGA 4CMMB 3ZE2F 1MI5A 2WQWA 4AM0Q 3L3HB 5A6MA 3GMLB 2MPAL 2O72A 3GDCA 4WTXA 1TJIL 4WI2A 2ZP9A 1URZA 1P4IL 1Y18B 1M71A 1ZRUA 3D0AA 1WWCA 2Z92A 5D1QB 2E9WA 4UOZA 2Q8AL 1KCUL 4NHCH 3GHBL 5ESVB 1OANA 3UC0A 1ZLDA 2A6IA 2D0FA 2B59A 5I1JH 4R90H 1EH9A 4JRYB 4HEME 2CGRL 4LP4A 2F5AL 5AUMB 2IALA 2WZ6A 3JWNG 3RU8L 1YSOA 3NIGE 1AE6L 1E6JH 2AAAA 4ICXA 3DECA 3K71B 5JMRA 2CH8A 4XNQA 2ADGB 3TBYA 3BEWB 1HXMB 4HMEA 3CFEB 1ZXKA 4PJXF 2V5RA 4LGSB 3B9VA 4DVRH 3O3AA 3JYBA 4FQPA 4Q6IC 4DKEL 1MCSA 4M7KH 3PUCA 1FC1A 3JVGC 4OD1L 2ED6A 3OB0H 1KCSL 1NGWB 5DJZA 3SDDA 3VXRA 5DRXA 2QQKH 1CL7L 1UOKA 3PXLA 3QORA 2DI9A 2MQCA 4MJ5A 1EHLL 3LKQA 4YSOA 1HH9B 4OZFB 3KNBB 4F7CA 3GLAA 3TF4A 1F97A 2QPUA 4RGND 5KN5A 1X4XA 2JSFA 3KYKL 1ODAA 5DDHA 3L81A 4LFHG 5ILTL 2WN3A 3D18A 1A6TA 2GJ6B 2VH5L 4TVSa 1E5AA 2F54D 3ASWA 4LVNC 1NCCL 1FZJA 4H13C 3U7WH 2B0SH 1M7DB 3SIKA 1PL3A 2VDOB 4MD5A 3S3DB 5IWLA 1P69B 1FIEA 3FBKA 3RGHA 2VLRD 4JGJA 2E6QA 4K3EH 4A7UA 5T3ZL 3C87A 3HC0B 3B9KA 2CCLA 1KXTA 1C8QA 4ODHL 1OE2A 1KYDA 1TYRA 2X3BA 5DGRA 1HQ4B 3I6LE 5BO1H 1V27A 4OFYD 1IM9A 4LKXB 1R4XA 3H9HA 2DD8L 1C7SA 4PCTA 5BRZA 2OSYA 5AW2B 3ZMEA 1WLHA 2FHCA 4MMYB 1WHPA 3F3HA 4XC1L 3V4UL 4BFJA 5I30L 3MLYL 3NQIA 4YFDB 3VSTA 2EEXA 4DGIL 3UZEC 4N8CL 3FO1B 3WFBL 3BQUA 4F58L 3DTDA 4X7DC 2YKKA 4XXWA 5DD0H 4QRPD 5I1GH 2QKSA 1USZA 4HS3A 1AGFA 3EJZD 3ARFD 3EO0A 4I2XA 4KKLD 4Z7VA 1OTTD 4GSUA 3TV3H 2X0UA 5GIRB 2DMGA 4LLMB 4AGLA 1M9SA 1G6VK 1TZHB 1WZ1L 1OSPL 2UWEE 3ZE0E 1ET8A 3ZZ1A 2NY7H 3QJFA 4WFED 1CF8H 2HT2D 3QI9D 1MPAL 5DJAB 3T5WA 3MQIA 1IKOP 2VMCA 2F0CA 3PFUA 4QD2E 5KAQG 1I8MA 3NPSC 3B56A 4MJIE 4RBPH 1QLFB 5B4MC 4X80H 5GGRB 4X83A 5B3NA 5DRZB 1WFIA 1OLLA 5DZLA 3NCYS 4MGXA 1K2DA 4Z78B 3N04A 4JFOA 4PJDB 1HNGA 3QUYD 5J3HC 5BZDA 2WXHA 4TVPL 5IW3A 1JG9A 3HAEG 4W9FC 3C5JB 2NR6C 2NDFA 4Z7QB 4Y5VA 1T1YA 4HWUA 4G8GA 4FP8L 1VACA 1FV1A 2CBOA 2QKIA 4ZMXA 1A3QA 3MU3A 3RL1B 5B8CA 1NCBL 1I8IA 3IXTA 3MGTA 2OTUB 5JDSA 2X1QA 2CRZA 1MVFA 4HISA 1S9KC 3LRMA 3MKKA 1AOZA 2PLTA 1PEZA 2I9LB 1QPKA 1L0YA 3HRPA 1RI8A 3BSZA 4WO4C 5I6PA 4ZOCA 5AVSB 3O3DB 3PGDB 1I1AA 4QXTB 5B7MA 2MQGA 3QJHB 2NW3A 5L88H 4GQ9L 2C8NA 1UZ6F 2MOGA 5E8PA 3A24A 4PJ5A 4QT5A 3MBWB 3V0AC 4GRLD 1Z7JA 3ZYJA 5EO1A 3VI3E 3VFRB 1TEGA 4JO4L 4S0HA 4GKNA 1ASQA 3AAZA 1WSST 2LE9A 4ZNEE 3R8BB 1KJ3L 3DOIA 3V6OA 2YD5A 2WSDA 4AJ0A 2XYBA 3U9PH 3VD1A 2I5YH 4WWOA 4U1LA 5BUAA 4LDCA 3IMVA 2VXTH 3ECUA 2B77A 3UC2A 1PZ5B 3AY4C 1OAXH 4J7RA 4P2CG 5SX5K 5DUMH 2RQ8A 5HYEA 3GO1H 2FL5B 5FOJA 5KVEL 4PJAF 1MHCB 3BHBA 1HHJB 2MQ0A 4X5WB 2N59A 2YBRA 3GF8A 4JCMA 3S2AA 3VD5A 2DWYA 4LHUB 1OOWA 4H40A 4I87A 2ORBH 1OTSD 4WI0A 4BFBD 3LNIA 3WOVA 2PO6B 2JB5L 2JWYA 1BYNA 2J6WA 4GOSA 1I1FB 3PIQA 4ZUSB 1OM3H 3ARXA 5I1EH 1OGAA 3MOAH 3JWNE 4MZ3A 1EDHA 3Q5TA 1MI5E 1B0GB 2PTTB 9CGTA 4QHNB 1FPTH 3IGAA 1MFNA 5ACMA 4Z3JA 2NQDA 1A5FH 4J27A 2YN3A 3MLUL 2EIBA 2LU5A 4I85A 3ARTA 4AUYA 1SJMA 1TJGH 3GJEA 4RWYH 3S0PA 4WK4B 1L7IL 2JCCF 2H9GB 4GS7C 4FXKC 2YRBA 3D4CA 5CKGA 4UQAA 3EOBB 3PY9A 5GRXG 3EZ8A 5ABAA 4R0LC 5FYLH 5KYYA 4KZDL 3KWXA 3BRDA 2FDBP 3BZEA 3HZMA 3I6GA 1DFBL 1KTLA 2GIMA 2OMUB 1G7PA 2GTZA 2AXJA 4NNYA 2CO1A 3VQMA 3U0WH 3LIZH 2X6AA 5DMJB 3SE4A 4N2GA 2EADA 4JFTA 3PS6A 4H2AA 1TKWA 1EDYA 5BQ7B 4YLBA 1KIRB 4ZAKB 1G1KA 4HKXB 5A2KH 4PWIA 5J6GA 1QTPA 2NXZB 4IKKA 3VGAB 3MUGB 3QSKB 2J1ZA 3AQXA 4PGBB 2EZ0D 3QAZC 4JHVA 5C0ND 1FO0A 1AQDB 1HHIA 5C0FB 4MXVF 5JOFB 1L5GA 1P84J 2R2BA 3MRGA 5D1XB 3EBAA 1ORQA 1KLUA 5IJKA 1T0PB 2H47C 4NKQB 2KZKA 1PG7W 4U1NA 4WKZB 2D3VA 4FFWC 1IAIM 2CLVB 1OVZA 3CDYA 3MYJA 3QHZH 5DC0A 5HYFA 5JHLA 2VIRB 3DUSB 1A02N 1U33A 3D85B 5FKPA 4WGKA 5KZCD 1I82A 2D73A 2X3CA 4GP4B 5E5MA 4AW7A 2CLRA 4NDMA 3SYAA 1IM3B 1G43A 3E9UA 4PRHB 4XVUC 1Q0EA 3AS1A 3SHSA 4JRLA 2HKHL 1U58A 2VUKA 3FCTB 1IFRA 5KSAD 1IEBB 1L9NA 2AMUA 5DEFA 5MERA 4HCFA 1K3IA 4ETYA 4LLUA 4PHZA 1A1MB 4RMRA 2EC9U 2E3VA 5M94B 3SCMA 4YHOL 2IANA 3FFDB 1TJHH 1V10A 2EH7L 4J2QA 4R2GC 4JFSA 2ADIA 4J3UA 5BRZE 4NC1E 1ZT4A 3K2KA 3ETTA 4X4XA 5I9QC 4R7DA 3CN2A 1E4WL 4IIQB 2BIMA 5DD5L 4WY7H 4FQ1H 4CMHC 1MAJA 4X99B 5EBLA 2VT0A 2QSTA 3NK4A 3OMNB 4FDWA 1JI2A 1HHHA 4NJ9L 5EO9B 2J55A 4OKVB 2AQ2A 3ISRA 2QVIA 3NIDE 4JZJA 1W8EA 3HHRB 1MG3C 2CM6A 3PWNB 4I2XE 4K15A 3UMNA 2W65B 2J6EH 4Z7VE 4MQTB 3QO0A 4Y16D 5FO9A 2CGYA 4UZUA 2CR0A 4PWJA 3WGVB 3QUHA 3B5GA 4DN3H 2XJKA 3VWKB 1UJ3B 3ZHDA 3FO2B 1ZSDB 4WEBH 1VA9A 4FG6C 4ELKA 3ZJAA 1ONQB 3FT3A 3KJ4B 3VXOA 1MLCB 2DLFL 2ZXDA 3IU4H 4HUKB 4JDEB 4MB1A 1HILA 2EXYD 3MRBB 4QO1B 2VDPH 3GSNB 4WU5A 3LKSA 3TBWA 3EJPA 5L8LB 2FIRT 3GSNL 1DBBH 1Q0YH 1U3ZA 1Y6MR 1NDGA 4L4TA 1VKXB 1R5VA 2FH6A 1UGNA 1X7QA 4HIXH 4G8GE 5GS0C 2EC9T 1KBBA 4CKVX 1ZPLA 1V7NH 3WO4B 1PKQA 3QZNA 3FONA 1ZHBA 2XI9A 2X7LB 4MJ6A 3BLBA 4OQTL 4NQCB 5L9DL 5AOKA 3VXNB 1KGCD 5DZVA 5KEZA 4PFEA 4HU8A 1PJ9A 4YFLI 1WVZA 3AMLA 3I3BA 4NO3B 4JGUA 5BV7C 3PAZA 2XIBA 1B90A 2F15A 4HPYH 5TGBB 4HXAH 5HHQB 2OMYB 3FU6A 2BERA 4X8XA 1FG9C 2APSA 3QJOA 5J11C 1R75A 5EIQA 3EYQC 4YSSA 2JLPA 3HEIB 1JI1A 3T09A 2O6DA 4BRJA 1X44A 4QUOA 4LVHC 2SEBB 1N2RA 3P4NA 1FFOB 1PG7H 3WS6C 2YD4A 1HSAA 1JZGA 3QUZB 4FKKA 4U7SA 1KTKE 1G0DA 4WI6A 4UIMA 3VXUB 4D9LH 1RULH 4WJ5B 1HZHH 1TZAA 2PPCA 1QHOA 2AVGA 2ZF9A 4NENB 4UYQA 3V6OE 3RPIA 3HI5L 1CCZA 5SWQB 2Y3AA 3GT6A 3VGDA 3QFJA 1JK9B 5LGHH 3VRIB 3CFBB 4YWGH 1QO3B 5B1JC 1E7VA 1SXBA 5CSGA 1XBDA 2AJSH 5HHMB 4IBSA 1NOLA 2PPDA 5IESH 5KG9B 1JXKA 1LILA 2CJSA 2LTQB 5B1KA 2Y5EA 1SF3A 3QB7C 4F8LA 5JIKA 5HGHB 1VFOA 3UAJD 3CC1A 4U0RB 3GXNA 4IHOB 2WTRB 5GRWA 1BBDH 3RA7H 2KQMA 3BDXA 3JXAA 1S7TA 4G5ZH 3MDJA 1OGAE 4NFBA 3OHXB 5SX4I 4TQEL 3UBXI 4KTEL 2R8SL 1QFOA 3ES6A 1U8PA 4G6JL 4U1HA 2EUZA 1Q9OB 3RIFK 4PG2A 1NCIA 5JORA 1R17A 4Y7OC 4B50A 4W93A 5CJXC 3K6IA 1QATA 1OZTG 4Y4HC 4ZUWA 5TE7H 3WFEL 1YEIH 4I18C 2ZYSA 1V54B 2GBVA 2OMZB 1KBGH 4LLYB 3OKEB 5EWIL 3CWGA 1CVRA 5DJ0B 2Q86B 4GW5B 4HIEB 2W07A 5I1CH 3QQ9C 3H53A 1BJMA 4BSVA 1UEMA 2Q0ZX 3O8XD 4M7LH 3OAWA 2F74B 1BQUA 1T20B 3RVTD 3OZ9L 5EFIB 2XTJE 5A6IA 3CMGA 4W4OC 3H4FA 1N5YL 4ZTOL 4N5UA 1RUAH 5DVPA 4BHUI 5JHDD 1JZEA 1TETH 1G7HA 5F7KC 3WN5A 4GAAA 4PY8J 4AJVA 4M93B 2VLRA 4X9BA 2MTAA 2G60H 2OK0L 1KJ2A 4GUPA 1GGBL 5ANME 1QBLL 2X05A 1OB0A 1Z9NA 1YUHB 3HBZA 3DX6B 1EAQA 3DX8A 4PS8A 1M7UA 3FHQA 2O6FA 1X5IA 1SQMA 4FLRA 3H0TA 4OD3L 4E41D 3IWVA 1ZV2A 4U6YA 1R24A 1CU4H 1KEML 4JFYA 4AOFA 3VRLE 1QHPA 2LR4A 4U1IB 5TE6L 4PJEA 2Y5QA 4JFUA 5ENWB 2C5DC 4OZFH 1XSKA 4OFKA 1FNSL 5A2IH 1S3RA 3GSXA 9PCYA 4BK8A 5CJOH 2VDMH 2UY6A 3VFWA 1FCCA 4R4FL 1DQDH 5AEAA 4KROC 1H3TA 2FIKA 4QRPA 2HX8A 3FAWA 1JHKL 1W9XA 3P2BA 2NUTA 2X4OA 1NM4A 2UY7A 4K3GA 4Z1PA 4K0OA 4PGDA 3P40A 2VDOH 4D8PA 1DQMH 4AGQA 3L3KA 4XP4H 1P2CB 1N5AA 1QSFD 4WWNA 4JLRB 2LFEA 4AL8H 4AMKH 4TUJB 3BVDB 3DPBA 4JCWA 4ODXA 1XF3A 5FCSH 1I75A 3SGJA 5T5NF 4ODUA 4OLWL 2Y22A 3T2OA 1J9QA 3U1SH 3DI2B 1TIUA 3UTZB 1SBSL 2GABA 4IRZA 1JF1B 4R0LB 1A7NL 1YCSA 1YG9A 1U3NA 4HHGA 3UZVA 1NCAL 5FX3A 1SEQL 2EVJA 3L4YA 3NFSL 5LQBH 3DTUB 4JDVB 4NWUH 2UZYB 4HWZB 4LASH 3QZWB 4ONFL 1LHZA 3MBEB 4HJ1A 2IFGA 2X5PA 3L7FA 3CIQA 5IG7B 3A0OA 7CGTA 5BZWB 4C56B 1A1OB 3NRQA 5IHLB 3TJPA 5LWYH 3ISWA 3LKRA 3T77A 1XGRA 2LV4A 4XX5A 1IAMA 2CUMA 3WNKA 1Q90A 2V3FA 1LVEA 5IFHH 1U8HA 5F8RC 3RKDD 4FL4C 2BJML 1V3LA 3E9TA 5LJYH 1OD9A 3QNZA 1TVBB 1KFAL 5J12C 3RWJA 5C0IB 3U4EB 2VQ4A 5I16B 4LOVA 2VO5A 4LEBA 4PRPD 2NNFA 2BHYA 4K2UH 2X4QB 5IJCC 4XN2A 4V11A 5C0EA 3QJTB 2AK1L 4ZFGH 3ALXA 4L4TE 1RLBA 1DQVA 4U1JB 1YPZF 1PKQE 1A9EB 3ZKQD 1NFIA 1QSEB 5IQLA 2JJSA 4H5SA 1TG8A 2R1XB 5BZZA 2LW3A 2GBTA 5EHFA 3ZTNL 3N40F 2NTFA 4CN6A 1U8MB 1B0RB 2YPLB 3ECBB 2VMDA 1MUJB 3L5WB 4UANA 4GYBA 1MIMH 1TQUA 1EEQA 2N01B 3FUEA 2MPVA 5IBTL 3ZXAC 3JV6A 3HUJF 1OM9A 2WLZA 3NEOA 2PW2A 5I9QB 1LP9F 1YEKH 4YH6A 3LH9A 5EO0B 1BVZA 1TQCC 4KHTH 3UG5A 1GZQA 1MRCH 2XZAH 3FU7A 3TM6A 2BXZA 5FS5A 2WXIA 3QUXC 3GMNA 3ULSA 5T1DH 1GRWA 3CZFB 3N0PB 2J8UF 4X5LA 5J9PB 2ZWLT 1MJUL 2DQTL 3RVXC 5JHAA 1WJ3A 5ISZA 1RZGB 5AYUL 1G5AA 2DQDL 2QR0A 1AIZA 1TJXA 1IVLA 4XBEL 2G30A 3ABMB 4IHBA 2D7MA 3GMRA 2OMVA 3UCRA 4YDMA 4AVJA 3SBQA 5B38B 4EI0A 5GGVH 1WFNA 4K55A 4HFUH 1MW2A 5HDOA 2EABA 1T4WA 4PJIF 3OQ3B 1AJ7L 1K4CB 3SDXF 2AC0A 4WUKL 4L4VA 3UGXA 4HF5L 1JVOA 4YHZL 1HWGB 3OVUB 3TURA 1XF5A 5T5FL 1CGVA 1T6BX 3L54A 3UP6A 5DMKB 3FMGL 4A04A 5EZPA 2YEVB 3BFWA 3N5AA 2CG9X 2DRUA 1V3JA 5A2BA 5IHBA 2Y7SA 3W82A 1RZKH 5JNYA 1U91B 3WFZA 1Z66A 4LLVB 2N7BA 3NAAL 4TV3A 1Z5YD 2I9TA 4UMGA 5JPMC 3G5YB 3STLB 4Z3HA 5GS0L 3F7PC 1BOYA 5KVDH 3EH4B 3VNZA 5L8KB 2Z1KA 4P3CH 3IJSB 4DP6X 5KJRH 5KVFH 4K7FA 2WZPD 1N4XH 4UB0L 1KZYA 1NSNL 4CC1A 5B39B 4PJCF 2EVFA 12E8H 3C09C 4AG4L 2A77L 5BV7L 3OSKA 3OAYK 1ACYH 2ATPA 2VABB 5HI5C 1OPGH 3V52L 2DQ6A 5SX5H 1IJ9A 3MA9L 1FVCA 2CO7B 4PR5A 4Y4FB 4PVNA 2ZE0A 4J39A 1J9RA 3QXDB 3RP1A 4IJ3B 3KD4A 1NFAA 4LSSH 5EUOA 3QXWA 1T21A 3NP3A 2AQRA 1A6WL 4YHML 3GXFA 3UTQB 4UQCA 5FC9A 4O2CA 1HYSC 2VDLH 2WQ8A 4PRDB 2VLRE 5FM4A 5JTWA 4NAQA 4LOFA 4TYUA 1K8DA 3VXMB 3ZHKA 1QSZA 4QXGH 2MFNA 5DHXB 4I1PA 2IH8A 3QDHA 4LHJB 1ACCA 1LE9B 3MA7A 3Q44A 1FGVH 2R29L 2NSMA 1PNCA 4PJFB 5GGTA 5FYKU 1EX0A 2ZOKA 3QIUA 3GZQA 5IOPA 4LEXL 5CJBA 3EJYD 4A67A 3MRDA 5ITFA 4Y2DD 2WLHA 3MLZH 3TU6A 4ETQA 1Q8MA 4PJEE 2ZUSA 3MAWA 3WDHA 4FQJH 2Y06H 4HPOH 3GIVB 5DRNA 2R1YA 5DD6B 4MQXC 2V7NB 3BP4A 3SDCA 3LNDA 3QWQB 3WKQA 2WVTA 5B22A 4R90L 4QRPE 4KXBA 2OP4H 1YEFL 4W9IC 1N19A 3VG9C 3BGAA 2PPAA 4J1UA 4ANUA 2YMXL 4NQSA 5I74B 1BQHG 1MCJA 4G6AC 4IK7A 2H32A 4ZTPH 4YIQB 1ET7A 1WICA 2FO8A 3GXPA 3GQFA 4FI6A 3ZT5A 4DVRL 4MYPA 4WFEE 4TLKA 4EUPG 3N43F 3STZB 4ZW3A 4GW1A 1PSKL 1FC2D 2CBPA 4OW6A 1KBKA 2R7EA 4WHTB 2DDQH 2OTWB 1JGLL 1EZSA 4XO9A 5C07B 1ZS8B 4R3SB 4NUPA 5KWYC 1WT5C 4WFGE 3WKML 4YFLF 3KW7A 4DPBX 2WJ5A 5ESQB 4OCWL 3ZYZA 2CUHA 1QBAA 1M2VA 2DQMA 3VFVA 3UBGA 4G42A 4YDJA 1MCFA 4NBXB 4V1DD 2G4EA 4KNSA 1H9DA 4XP5L 3TT3H 4Q58C 4OZGF 4RSVA 3SKUD 1JYNA 1USQA 5EEWA 2PMZA 5GRZA 5FA4B 4QNPF 4WWPA 3OR7A 1JWUB 2NCEA 3EYFB 1MJJB 3L9BA 3LEXA 4QRSB 4NRXA 2A6DA 3AT8A 1IGFH 3ATBA 3GNMH 1ZGLA 1J10A 3GS4A 1YQVL 4XBPB 5EOCH 3MCLH 5IM7B 1UT9A 5D7KD 3RHWF 5TDPB 2UVEA 4LFHD 4U1SB 4NYLA 43CAA 3PQYA 3N85H 1UZ8B 4HA1A 4UBDD 2BVPA 3NFPA 4W4NA 3GRBA 2D7OA 2VLLA 4RZKA 1E5YA 3ETBF 3P9MB 3FTYA 4XAKD 4MDIB 5IVXA 3AG3B 2HJKA 3R1GH 3CGTA 4PP1D 3WNNA 2P46B 2ENPA 4Y9EA 3RGVD 4PAZA 1DBJL 4APQB 2EDTA 2EIJB 2FH8A 3T6XA 3QIBC 2V2TB 3P4OA 1CQKA 3PWUA 2C7UB 4OCLC 4CSPA 3RVVC 1YEEL 4ATTA 4F27A 1D6VH 2WTOA 3LEYH 5T1KD 5KJ7E 1EVTC 3F5WA 4QPEA 5C9KA 2OJ1A 3SQOL 4P2RA 5BOZG 3O3EB 1A6UL 3RZCC 1K4DA 4ZSOB 1UFUA 4XMPL 2OV0A 3LH2H 3BIBX 3RI5F 1JSYA 3NABL 3HS0C 1AR2A 3DJSA 1D5BA 1S9YB 2NNXA 1H3PH 1XSIA 2J88H 3JVFC 1N7MH 4ZMYA 3IFOA 3T3PF 3UDWA 1KG0B 1NOFA 5HBBA 4H0GA 3B1TA 4PJBA 3FQRA 3DC0A 1JRHL 2RFXA 1KBWA 4OLUH 4U1GB 1Z9SB 3OXSA 2KS0A 2VRAA 1SHMA 2ZCHL 2AKRB 4NM8L 4I0PD 5DRWB 3VYPA 4BQ8A 3UTSA 5IIEB 3U9UB 5JXEC 5JIPA 4FHJA 4GRMB 4YDLB 4J8RB 5A16A 5ISZE 1WZMA 1DVFB 3BE1L 3DRQA 4I9XA 3HMXL 1XB6A 4FTVB 2ZSVB 1J86A 5C0BD 3AXLA 2YRLA 4YR6A 3K72B 3CDGB 1DO5A 3CXFA 2WVVB 2KLSA 2OSWA 2F1EA 4IBYA 1F4YL 4MAYC 5F88A 3FDWA 3VFSA 4MA8L 2ZYIA 2AEOA 4G82A 5KSBA 4J6IA 1P4BH 1AR1C 4WGVB 3TZVC 4L4VE 4Q14A 1NC4B 1BIIA 3DARA 5C8JA 3O8XA 3FO0H 3D2TA 3G6AA 3D12B 2O5XH 4RISH 3M1CA 2BY2A 1L9PA 4ZDHA 1AQKH 3HZYA 3Q43A 2IG2L 3UJTL 2WTPA 3D06A 4PJ9B 3BGFB 4HLZH 1WS8A 4TQPA 4G8EA 3KE0A 3E8UL 4DGYH 3IAGC 3BH4A 2APXA 5ESAB 5JW4N 1AIFA 4UV4L 1JNNH 1FNEB 4RGOL 1QWNA 5JUEH 4MCMA 3KZ8A 2X0VA 3TPKA 1PU0A 4YDVB 1WDAA 4NLAA 3C6SB 2WKGA 3NACH 3RG1C 1LTXA 3DXAA 2I5YL 2YOAA 5MEOA 1RD6A 4X4ME 3DO7A 4A2LA 2YWZA 3VFOA 1RHHB 3CUPA 1AS8A 3FQ4A 3GO1L 3QDGA 4NZDA 4Q6IA 4ADIA 3DJTA 5EUOE 5K9OB 3JVGA 2Y4SA 1XB3A 4XHJD 1KF9B 2VKWA 1C5CH 4AVKA 4NOFA 3R7QA 1EFXA 1J0KA 5EBMB 3U0TB 2AITA 1I1CA 1JZIA 4QMEA 2DQFB 5HPMA 1NBZB 5FHAL 2YPVA 3NIGF 4HYTB 2EVIA 5I17B 5CD5C 2YAHA 3C5XA 4OCYH 4KKZA 1OZUA 1U8CB 5TK2A 3H2QA 1IEAB 3FQNA 2VISA 3BMVA 2VM3A 3GSRB 1KTBA 1MXGA 2Q7AA 2YD0A 4DNLA 4KVNL 3TBVA 5F3BB 1DYZA 4PGCB 1UWXH 2Q8BL 3OXRB 4NWTH 5BOJA 4IIZA 3RWEA 1CBVL 1FH5L 1N3NA 2CJUL 3BGMA 1QBML 3A6BL 3U6RB 1FL3B 4LSQH 1BZ9B 5LXGL 5LNGA 2P24A 3OPZL 1TJGL 2MIZA 4HUXA 4I3SH 5E03A 5EPMB 3RUGA 3V55A 4FQXC 3C6LC 1AKJD 4Y1AA 4O2FB 4QJ5B 3ZZLA 3ESMA 1BJ8A 2AABL 4UTCA 1DQLL 4W9CC 5DC4B 1KWGA 3VH8A 5EBWB 4M5YH 4XN4A 2DWDA 2TRHA 6PCYA 1GGIH 2BOCB 1FSKC 3KW8A 5D7LA 4FF9A 1S7WB 4BZ2H 1XEUA 3DUUB 4CSZA 2C9XA 3GJFK 3NSJA 2FGWH 2VDRB 3O6ML 5CMAA 2VE6B 3EF7A 3RWGA 1ZHNA 3KWTA 2NX5A 1CQYA 1PLBA 3L13A 2EIDA 4RZCB 5G55A 3DYMA 3VH8G 4NXSA 3IGKA 2FBJL 4UQEA 3KBEA 1IBZA 2NY1D 5AAMC 4MWFA 4ZD3H 1K6QH 4OZ4B 4LCYA 4NIKB 3VW3L 1XH1A 1YDPA 4IDJH 1IBHA 3LRLA 4P4RB 1XV8A 1MFAH 2V3EA 3ARED 1Z6JT 4WWKC 1BD2D 1KGCE 4U3SA 5EMYA 3ARYA 1IGML 3B6SB 1ZVHA 3ZDYB 1ZA6B 3QDMA 5F7MC 4ANKA 4L5FE 4W1TA 3GK8H 4X6DA 3PQYE 4S1DD 3GLEA 1P1ZA 1Z3GH 4R9HA 2EDHA 1JHLH 1QWHA 2GK0A 2EDXA 4YBQD 3R06B 4JFQB 5IVXE 2NR6A 2WVSA 4OLZL 3D4YA 4KU1A 4M4RA 2Q76A 2F53D 2BCKA 4DWHA 1ZDSA 1OCWH 5GS1C 3QPQD 3U46B 4M7JL 1FFNA 3NDZE 5D93B 5I8EA 3IS1X 3II2A 2OYPA 1JXJA 1ZLVK 2D9QB 4P2RE 3V79C 5F9OH 1E2ZA 3LZFH 3PDGA 2EDMA 5BRPA 4PBDA 1Q9WB 1LXMA 4FG0A 4ZQTA 1K8IA 3PHQB 1JZJA 3LB6D 3INUL 5GS2H 5KSUA 1QD0A 4JDZB 1U8NB 3NJMA 1NAMH 2E75C 4FQIL 2ZPKH 2J1YA 5JZ7D 3IMRA 1TXKA 3EH5B 3L5IA 4LVEA 1CBJA 4WI7A 4PJBE 1SMDA 2JB6A 2K0RA 3OM3B 2GEQA 1XGQA 1QYGH 2X4SB 4FMKA 1VADB 2JKRM 3VU1A 3UTSE 1Q0XL 2BW4A 2H6UA 1DZBA 1JYVA 1A4BA 1V55B 2EYRB 1WUNT 3DHJA 1JGUL 1RZKC 3PWVB 4LCUA 1H5BB 2VITA 3GKZA 3N42F 1IGCH 1U4FA 4R84A 2QTVA 4U7KA 5FUZH 4NQDB 4OF3A 5KBDA 4HQQL 3H4HA 1V7NL 5E08L 2WLIB 4FNSA 4S1SL 5KSBE 3LSOB 2WPGA 3IDXH 3V4PB 5A3ID 1G1CA 2ZXAA 3V4PL 3FK3A 2AZUA 1O5DT 3KR3H 3OKLB 4KK9D 1HDMA 1YHPA 2QMKA 4Z0XB 3QJVB 1MRDH 25C8L 4LL1A 1WV7T 3FCSA 2N3JA 3ZVVA 1DL7L 3SYOA 3BSGA 4X5XB 4MNGB 3ZDXE 3BAYA 4IS6B 2EE9A 1TEFA 1CICC 2ZKHH 5DJ6A 5I66B 3LD8B 1CG9B 1IZJA 2B1HL 3H7BA 4B9FA 4ZS7L 1KIQA 1WBXB 4Q6KA 2EKJA 3MO1A 4FXKA 2NYYD 4F91B 4JJ5A 5H35A 3DPDA 2R0KL 4OT1H 3H54A 4GO6B 1Q9KB 3X1NA 2C34A 2I60H 4PB9H 4A37A 2VZUA 4M8VA 5AFAA 3IRCA 3TTSA 1P6AB 3DXAE 4LDOB 4OCSL 5FYLD 1MHHA 3DI3B 1OARL 1NC2D 1OSZA 3EYUH 3ME0A 4X6FB 2MCG1 3MJWA 4MDJB 3V5HB 1E6OH 3T2PA 4XMLH 4XWGL 3S37L 2ZKWA 4G11A 3QDGE 1IGTA 3S3PA 3FT9A 5F1IA 3GSWB 5ICXB 2PYED 4GAYB 1RIVH 5EOCJ 4OLYL 1D2PA 4Q4EA 4A2GA 4ZX5A 5TPWL 3RFZA 2KQNA 1IC1A 2AQQA 1L6ZA 1BFVL 1JWSA 2IPTH 4AXWA 2YK1H 4YHNB 1UEYA 1ZHKA 4FLQA 5D7IB 4YVUA 5CCKH 5FO8B 2P28B 2OMWA 2WWOA 5I76A 2BVQB 1QSFE 1D5XB 3E38A 1GOFA 2IH1A 2Z31D 1T1XA 4RLDA 1BZDA 5EZOL 1LWRA 15C8H 1KJVB 4PGEA 4PLKD 3RIAF 3RUGE 5DLML 2W0FA 5D7JD 3PUUA 3BESR 1W0VB 3T0AA 3OAYH 4HUVA 4Y1AE 2Q9OA 1G6RH 3SKOB 1MF2H 3BW9A 2E7LC 3GXIA 3UX9B 3OG6B 2EH8L 2GSGA 4GRWE 2WSKA 5HXMA 3TH4T 1ND0A 4V1DA 5FM8A 4BFFA 2FE0A 2XFGB 1KLFA 3TO2B 5INDA 3WBDA 5D7LE 3EHBD 3M45A 5IFAH 1E27B 3D3VB 4B9IA 1QA9B 4FXGA 2IXQA 3RNQA 2DV6A 2YRPA 2YO3A 4AYMC 3P30L 4TNGA 1U36A 4LLDA 4N28A 3S3BB 3CFQA 3ARWA 4Q0XL 4RSYA 4AQ1A 1JPSL 2MCAA 4C83B 4RQQB 1EANA 5DQ9A 4LQFH 2K45A 5FHBL 3BZ4A 4OLEA 2WXPA 4F7EB 2NX5E 3QQ4B 4CADB 3QNYB 4K3DL 5IROA 2YMTA 4BDVA 4L0YA 3BKCH 3ARVA 1RUQH 2UZPA 2WIIA 3IN2A 2QPDB 4AQOA 2BCMA 4QRRB 3BVUA 5FKAA 3RGVA 3LV3B 3QDJB 4NCC1 4OGAC 1HHGA 3MACH 4B5ZA 3ULVH 2HVJA 1ZCRA 4IBQA 3WXVH 5KAQF 2WBKA 3K0WA 2ZUXA 4J3OC 1QFWH 4HHAA 3BH8B 4Q2ZA 3NIDF 2ZJSL 3QDME 4N1EA 2Q5BA 4NO2B 5CS7A 1FZMA 5D1ZI 4XCFH 1AHWA 2H1LM 4X6DE 4WTQA 4O02A 4ZXBD 1QNZH 4Z7VF 2YEZA 1TZ8A 5LCVA 5T3XL 4POUB 2XWJA 2Z4TA 1FORL 3MX0B 4IU3A 1DVUA 4PQXA 1ZJBA 1ZANH 3A22A 4D94A 3SE8H 3BVNA 1R19A 2NNRA 2XVGA 2LOEA 2WUBH 4EN3C 2YA2A 5J0BA 1DLFL 2BSSA 1JAEA 4P23C 5E6IB 1R5WA 2JKIS 5MEQB 4O5LH 3FPXA 3C6LB 3FB8A 3IXAA 3NJVA 4FQ2L 3VGFA 1UCBL 5LBSH 2HPOA 2K7QA 1JPTH 3PWJB 4JY6A 3GGWB 4XNDA 3KHOA 3LEVL 1U8OB 2MHAB 5FYJH 2CXGA 4J4PD 2KKQA 3NEXA 3BAXA 3VUAA 5CGBA 3QUKA 1IGYA 2JI1A 2PWFA 1JHTB 4XN1A 3IVKA 3QS2A 3H85A 3ZE2B 5GZND 5EC2B 4PYHA 2HFEA 3D08A 2VLMD 3WS6A 4JKPL 2CUAA 4IRJC 3EYVA 1BMGA 2Y6TE 4EVNA 4YHKL 3PCYA 2Z4QB 1U92A 2W9EH 1KGUA 1R3HB 1BQ5A 5HHPA 3BP7A 1KJMB 3QDAA 3AY2A 4L8SC 4K3JH 3X14B 1YMHA 1A0QH 3ZY7A 5C6TL 4JKNA 4EI5B 1NIBA 1YEJL 1K5NA 4DO5A 3X2QB 2OSLB 5IHZA 2XTLA 2GTWA 3T0EB 1Y0LB 2HFGL 2IGFL 1T22A 3GD1C 5D72H 3H6JA 5F71A 3P9WB 4PJXB 1WCBB 1F42A 1ZT1A 3D51A 4L4JA 4QGTA 4ZYKB 3IRZA 1IFHH 3JUZA 4QRFA 4KRMB 5HGAA 1O9ZA 1JL8A 1Y1DA 2AXFA 4GBXC 4KXDA 5F9DC 5AALA 4WNSA 4ZUUA 1FCGA 1M7IB 4AMWA 2A5UA 1RK0A 2BDNH 4JFEA 2AJUL 4Y4KD 3P11H 3QGVA 4XB8A 4TUOB 1CDUA 3V4VL 4O51A 2WO4A 2LU3A 1HH6A 1QKZH 3W2DL 1JNHB 4YSUA 4M5ZL 3RTQD 1GZPB 4RAHA 5CJXA 3KVQA 4Y4HA 4K23H 1DJIA 3T04D 1P4UA 1WUZA 5D55A 1GL4B 2IAMD 5D5MB 3IMTA 4QDGA 2XZAL 1DLHB 3C5ZB 3RB5A 3EFOB 4HUUA 3SDAD 4U7MA 5HYSB 4QTHA 3QQ3A 4OM0H 3RNKB 1E42A 3T3PB 4BCXA 3AWFA 4EMZA 3NBNA 3CVHB 3FHEA 2ESVA 3VXTA 1DR9A 3HNSL 1O9VA 4OSUH 3QZBA 5I6MA 1FNLA 3WUWA 1CLOH 1RHFA 2VQUA 5CEZL 3RWIA 4ZZKA 2N7SA 3FQWA 2Y1YA 4W4OA 5D1QD 1EEZB 5F9AC 1LO0H 3OKNA 5JPNC 3KYOB 1KIUB 5GRUL 1RUKH 1Q38A 2VQTA 3OMIB 4HFUL 1CL7I 4JRYD 1UFGA 5FCUH 2VB5A 1YEGH 3L4ZA 4L29B 1D9KB 4YAQA 3R7RA 2RAMA 1QZ1A 2FD6H 2YPKB 1UATA 2FAUA 4LIQH 4P5KA 4NUJA 4YMPA 1NM9A 1XR9B 1UD5A 4YXKL 1I7RB 1TCRA 3AU1A 2WBJB 2BLFA 5E2WH 2BZDA 1IKNC 1PFCA 2KDGA 4OZIF 1NCGA 4AQEA 4RFOH 2XY1A 2BSEA 5JQIB 2P52A 1EWHA 3BLPX 4A66A 3E6FB 2NCMA 1XB8A 5DCCA 3T3MF 4MLIA 1DN0B 3QK0A 4X5PA 5F3HB 3OJDA 5FAAA 4H1LH 2NUPA 4N25A 2OULB 3HC4L 3EGSA 3W0WB 3S48A 3CZGA 4I8DA 5IBLC 1SMOA 1T0MB 3CSTA 3KBHE 3JT0A 2VXVH 2GJ6D 2QSCH 4V1DE 5E94B 2WQUA 1OO2A 1G5GA 1LDPH 4PWKA 1TT6A 5KSVB 1A6AA 1HL4A 2DQEL 3DRTA 4MCYA 4XXDB 4JPKL 4YZFF 5FFGA 3I9GH 5FUCE 1RL1A 1MFBH 1K9TA 4JY4B 3HW7A 1U3JA 3B2XA 5FO2A 2VDLL 4FQQA 5IQMA 3CCHA 1SVBA 3MBXL 2DMBA 3IDIB 4WFFD 1KV3A 2VR3A 2BIPA 2ZAHA 4MNQA 5C0GA 1A4KA 1SNRA 4MD0B 5BW7A 5MEPA 2ZSWA 1QEXA 1GYCA 2GJRA 4L3EB 1WFOA 3SKMB 1UXSB 3ZU8A 1YRKA 3I3EA 4EE2A 1WCQA 5H37H 5IB2B 4BKTC 1OB1B 1CD1A 2WWKT 1BQLH 4ALAC 3MUY1 4XMTA 2C3VA 2VDRH 1IZKA 3BWZA 4HV8A 2VDQL 2QADB 2A9CA 2F53A 4JHWL 2BIOA 2F19L 3VACA 4PVMA 5GZOC 2WNGA 1U30A 4XN8A 3EO1B 2LLNA 1MCOH 4BFIB 1NGZA 3MLSL 2QVKA 1BLNB 1NWPA 4YLQT 4DZBB 2OP4L 3T4AB 3BC9A 1JXDA 1S2EA 3SGDI 2DYSB 4M8RA 5A43C 1S9WB 3HB3C 4NC0B 4FD0A 3V0HA 1PMYA 2AV1B 4M8QB 1NFDB 2FQDA 3ARGD 3OKOB 5KYUB 1R1CA 2YD3A 3BP5B 1QRNA 3LS4L 3RDTD 4E9XA 1JYWA 3ILQD 4ANXA 4C59B 4JQXC 3NIFE 1G7JB 4NP4H 5CU9A 5EN2B 2YSSA 2ZX9A 5C08A 5KANG 1FZKB 1G9MC 4TNVF 2W5PA 2MMXA 4ORZC 4TQ8A 1G84A 2BS71 5SV4A 3HR5A 1IL1B 5IFJB 2CHNA 1OW0C 2K8QA 1OXYA 4DCQA 3REWB 2FNBA 5BJTA 4EXKA 2ICWB 3ZIYA 1PF3A 7FABL 4YL9A 4CKQA 2BSTB 3LXUX 1BBJA 4WGWB 2F58H 3ZRCC 2A4ZA 3QJZA 4JVUA 1ZV5A 1W0YT 4JFDA 4PHXA 4WU7B 2A9ML 3EOAB 2OXGB 4LEOB 4XCYA 3Q8FA 5TE4H 5ETUB 1UACH 2JCCB 3IF1B 3L4TA 4HK0A 5DK0A 3MREA 2VN7A 4N2FA 3V2AR 1OGTA 3D30A 4CUCA 1N0XL 4GAGL 4KXZI 4W9LC 3IFLH 2VWEC 3LPWA 1B9ZA 3SZ6A 4UQ3B 3VRJB 5DJ2A 3Q01A 1BXVA 3EGDB 4IRSB 1ET5A 1DVSA 1BEXA 2AAVA 2CK0L 3K6NA 1U8LA 3AS2A 3WNMA 2CHWA 5CILH 3ARBC 1SFHA 3GDBA 4P2OC 1KEGL 4KKQA 2VMJA 1Z3RA 2ZOUA 4OM1L 1ZLVH 3RWHB 4FHBD 2YGVA 5H94A 2QL1A 3BKYL 5D2NB 4JFEE 4YQXH 4D3CL 2HLFD 2YAPA 5KVGH 4OGXL 5GGQL 4AT6A 3A6CL 1MSPA 1GY1A 4Y5YC 2MKLC 4OR1A 4KK8D 2NSXA 1T2JA 4X7SH 5JHMA 4LHUD 1H3PL 5JPMA 2C9UA 4LF3A 5L2KD 1KLGA 1N7ML 3R4RA 4HULB 1GPOL 1QVOA 3HTLX 3LIZA 5GRJH 2PO6D 2PYEA 4LLWB 4L0PB 3Q6GH 5E8NB 2JIXB 4UYPA 4TTDD 3WLWC 2GJZB 4XMXA 5CO1A 5JR1H 1BGXL 4WW2C 2R2EA 2XKSA 2ESVE 3ULUH 4OUUA 3UEZA 2GPZA 1G87A 1OV8A 4X6BA 1W6WA 4JANA 1XO8A 2X4RB 1FE8H 4MS8C 1I85A 2MCMA 2Q3AA 3B43A 4UDUA 2NYZA 1F4XL 5DWUL 4WQOA 4B9GA 2Z31A 3K4ZA 3NN8A 1VSCA 3MLWL 2WBWB 2RACA 3QWOB 4EZJA 4HXBH 1F11B 4HCGA 2B4CH 2DKMA 4ILDA 4DGWC 1SM3L 2EDRA 4N2AA 3LN5B 5D7JA 3U30C 4FABH 4Z3FA 3MJ9H 2G9KA 4PJ8C 4U3CA 4NQQA 1UD3A 4UTAH 2VNCA 2BXYA 4NO5A 5F0JB 3UMTA 4RISL 1S4IA 4BZ1L 2C3HA 2M26A 4OGZA 4W6WB 2XVKA 3MV9A 3SPIA 1LM8V 2WGNB 3EUUA 2VMEA 4PYGA 2ICCA 1RPQA 1BFOB 1CLCA 3L2LA 2HH0H 2V9RA 4ZAKD 2WUCH 5TF1L 2NQ3A 1AO7B 3F83A 43C9B 1WAAF 1P4LA 1H15A 2NXZD 3H1ZA 3H8NA 1HWHB 3AXIA 1GJIA 1TVHA 3MNDA 3LKNA 4GSRA 3OTTA 3NGBC 2HFFB 3WJLA 3HHSA 1BVNT 5D1XD 5FDWB 2IBGA 3RBGA 5ALBH 3KXFB 3TO4C 4Z7OF 4QHUB