2I69A

Crystal structure of the west nile virus envelope glycoprotein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
403
structure length
403
Chain Sequence
FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLAEVRSYCYLATVSDLSTKAACPTMGEAHNDKRADPAFVCRQGVVDRGWGNGCGLFGKGSIDTCAKFACSTKAIGRTILKENIKYEVAIFVHGPTTVESHGNYSTQVGATQAGRFSITPAAPSYTLKLGEYGEVTVDCEPRSGIDTNAYYVMTVGTKTFLVHREWFMDLNLPWSSAGSTVWRNRETLMEFEEPHATKQSVIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Polyprotein
publication title Crystal structure of west nile virus envelope glycoprotein reveals viral surface epitopes.
pubmed doi rcsb
source organism West nile virus
total genus 72
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2i69A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 2i69A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 2i69A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 2i69A03
2V33A 3C6EA 4GT0A 3N43F 3UC0A 1URZA 2R29A 3N41F 1OKEA 2HG0A 1Z3RA 3VTTA 1SVBA 5B1CA 1RERA 2R69A 3N44F 5KVEE 1S6NA 4AM0Q 1Z66A 1ZTXE 2H0PA 4ALAC 4FG0A 3C5XA 4BZ1A 3I50E 1UZGA 4FFZA 2P5PA 1PJWA 5IZ7A 5AAWC 4GSXA 2ALAA 1OANA 5KVGE 5IREA 3UZVA 4UT9A 4X42A 5JHLA 3UZQB 4FFYA 3J2PA 5LBSA 3IRCA 4UT6A 2I69A 5KVFE 3WE1A 3N42F 1OK8A 2JSFA 2JQMA 2JV6A 3N40F 4L5FE 5KVDE 3J27A 3UYPB 4AL8C 5GZNA 5LBVA 5JHMA 2GG1A 3G7TA 4BZ2A 5GZOA 3MUUA 3UAJA 4UTBA 3P54A 4UTCA 5LCVA 4UTAA 5AAMC 1TG8A 5H37A 3UZEC
chains in the Genus database with same CATH superfamily
3NH7L 4AYSA 2WW8A 2AJVH 1HYSD 4C55A 3FW6A 4D7PA 2A3TA 1PY9A 2A9CA 1MCSA 2OMXA 5DD0H 5LG6A 3QNFA 3INUH 4QRPD 4KTGA 2YZ8A 4WGWB 5FDWB 4PGZA 2ZUTA 4ZMLA 3UZVB 1O6SA 1OCZB 3T0EB 4YHML 2HA1A 3R4RA 4LCVA 4RRPM 3LH2H 1BD2B 2EIZA 1OCWH 1T83A 3FN0H 3DO3A 5I1CH 2EVJA 2PLTA 3DVGA 1OB1A 3NPSC 2P9RA 4TULH 3L16A 4KXZH 2VRAA 3MGOA 4N90D 1U8KA 4GQZA 3VSQA 1IAKA 1QO3B 1GAFH 3PE9A 4G3YH 1AC0A 2QQNH 3CLFL 4I3RL 1MUJA 4TNVK 5HGDB 4QRPA 5IFHH 1UT1A 3BFQG 4MWFA 4AEEA 3P3SA 4LSPH 2QDWA 2GIMA 4FLOA 4OIIH 2F8IA 4A7QA 4U6VL 2KLTA 1HSBA 3QEUB 2E8ZA 2QPEB 3QCUL 1G4RA 4FABL 5AYUH 2NY5H 4Z7QE 4PJAE 2BVOA 5A2KH 2QGEA 1LQBC 4KKCD 5DUMH 4EI5D 1QLRA 2BCKA 4KAQL 3ZIYA 1RHHA 2ZYRA 2AEPH 5D1XB 5C0JB 1AYRA 4Q4EA 1F6FB 4LGSB 2V6HA 1F4AA 1N3NB 3GSQA 4X5XA 4GKOA 1G7JA 1UB5A 2D9QB 2VLRE 4XOAA 5CBAB 2IPUG 5D7EA 4FF9A 5JTWA 3H0TA 4ZW6A 4S10A 1A65A 2HVBA 1HCZA 2Q6WB 1JHLL 4NUMA 2HB0A 3IMTA 5K9JL 4JGJA 2AEQL 3QJVB 2YC1B 2O5YH 3LRMA 4N8CH 3BPLC 1KB9K 1CLYL 3BUYB 2OTUB 4C56D 4J5VA 1JUFA 5GRYA 4EI5A 4YDLB 3CHQA 4FYSA 3L9EA 4XP9L 4XX1E 5HHVH 1H0DA 3P9LB 5TE4L 2DPKA 2OX5B 1R3HA 7TAAA 1NGXA 5IMKB 3ZYIA 3HAEH 4OLWL 2WQUA 1NGPL 4P2CG 3O6LL 1XZWA 1FNEB 1ZLSL 4OUUB 2AJYL 1BBDL 4LRNL 3DLQR 4EI6A 5DHYB 1YHPA 5H37H 2JLLA 4GFXA 2DM4A 3BKYL 5D1ZD 3IYLW 1EJFA 5BXFA 4IRSD 3SJVB 1RK1B 3FQXA 4ZMWA 3HE6D 1HXYA 4WHYG 1XH2A 4LPXA 4ZUWB 1TITA 2RALA 4OT1H 3FQNA 3L3OB 5L4FA 1O7SA 4GAAA 1EXHA 1EO7A 2FH8A 4C56A 4IIZA 2HWZL 1Q1JH 2R29A 3B7UX 4PJ6A 4TF4A 5LAXB 2YA0A 3BVWA 5F7KC 5I66B 4OCXL 1OSPH 1QRKA 3C2AH 4PGDB 4LHUG 1DL7L 3BLBA 4K23L 4FS0A 1JHKH 1XF3B 4QRBA 4AV0A 3T1WA 2PMZA 3ZE0B 2QVKA 2P1YA 4WJ5B 4NNXA 2CO2A 4AV4A 3ET9F 1XGUB 2BSSA 2C9VA 4NJAH 4Q56A 4WWKC 1GC1C 1A7BA 2DQDH 4YNYA 4HLZH 5D1ZA 4IRSA 5JHLL 1F4XL 3HE6A 2CLZB 3MRHB 2IAAC 3K8MA 1HCVA 1P1ZB 4QF1B 1P1VA 3OKEA 4B0MB 4HUNB 5L2JA 1AAJA 4LAQH 3UX9B 3FOLA 2Z4TA 1WAAE 3DX8A 3GM8A 3QEHA 5B4MD 3S88H 5MEQA 2GJZA 2QTVA 3U79A 3ZKXC 3VXMB 4M7LH 4UTAL 1BECA 2VSDA 1UFGA 5DZAA 4A6YB 1ML0A 2PYEE 1UQSB 2W0KA 3WSQL 3PWJA 3D09A 4DQOH 3BP4A 2XQYA 3QDHA 4TN9A 4G8GD 2ICES 2UZXB 2FL5B 3I9PA 3HS0B 3OKNA 3WLBB 2W5PA 1CFNA 1YN7A 3OAYK 2MCPH 2ZE0A 4WUKL 1A5FH 3HR5A 4XHJC 2B7DT 5GGRY 5JLZA 5SWQA 4R7NA 4PBVC 3IDNB 4W9EC 1UKTA 3CFDB 4MKMA 3TJHD 4DKTA 1QW9A 2IH9A 1NBVL 2XIBA 1T1YB 4HOZA 3VU1A 1A1MB 4G2AA 2ZKXA 1QWHA 1E27A 2FBJH 3H9SD 1V3LA 4P2RD 2WVUA 1UGNA 3B9KD 5E4AA 2ZG1A 3Q2NA 3LHAA 3GZOA 1KEGL 1U8IA 3NRQA 3E9UA 4U0RB 1KCVH 4F15C 1R1CA 5IG7B 3CLEL 4G8GA 4F37K 4PGEA 4Q9RH 4OF8A 2J6WA 1KTJA 2F58L 4JN1L 1UM4H 4JZJB 4BM7A 1QWUA 2E59A 2BMKB 4YDIL 3NK3A 4ANKA 2BOLA 1NANH 3TYGL 3U7YH 1ZT7A 3DV4B 4IRZL 3RAJH 3TCXA 3UIZA 1MFAH 3O4LB 1OE1A 1XTMA 2N01B 4XNAA 4PLJD 3PGDA 5I1GL 4P5MB 4P2RA 2IDCA 3H9SA 3LN5B 5HP5A 2PTVA 4DP9X 2XTJD 3B9KA 4HUVB 4LCIH 5AVWB 3WMSA 4OCNC 5FOJA 2HJKA 4AI7A 4M56A 3H7BA 2OMZA 4BKTC 4Z7NF 1N68A 4DP7X 2JB6A 3P4LA 2CR3A 2R7EB 2RACA 4GIPD 5E8EB 3V6FB 2Y7LA 3I6GA 5ENWB 5B39A 4L0ZA 5JPNA 4QUOA 5MEPA 2PWGA 4OCSL 1E4XL 2P5WD 3MV7E 4BFIB 2RHEA 4HOMA 4PBWD 2VLJD 4BZ1H 2CO4A 2VWEC 5E56A 4DZ8B 4HJEA 4MJIB 3ZDXE 4GEIA 4YZWA 4ALAL 2C9XA 3D18B 3BP6A 4XZ4A 4NZFA 3M6DA 1DLFL 5EZLA 1AJ7H 1CVSC 4FQQB 1NGQL 4NUGH 3UCQA 4AXWA 2W94A 2CIIA 1COBA 1YY8B 3KYMA 3LKRB 3FDWA 5L8JB 2ZPKH 3DC0A 4F2EA 2ZSVB 4XVSL 4WNQB 3LRKA 4XMWA 3V5DA 1VZGA 3GYRA 4G43B 1BX2B 3B6SA 4FLQA 3VI3B 3N55A 3EF7A 2H0EA 1NCJA 1OCRB 2P5WA 4P9HL 2Q9OA 3UAJC 3JWDC 2LAAA 1ZWIA 2V2XA 3DKHA 3MRFB 1I8LA 2ICWI 2AKRA 2VLJA 2XWTB 4YZFF 4UINH 4BHUI 4JDEA 1FF5A 1WPCA 5DF0A 2XKNA 3T0BA 4YC2B 1YVLA 2A73A 2BVYA 4WI9A 3KS0H 4XN4A 1JRHH 3DBXA 2DI8A 3MR9B 4HIHB 5FO8B 4AEHH 3FB5A 2KZBA 2NRDA 2W8CA 1UJ3C 3ZUNC 1TPXB 3V4VL 5C8JB 1VEMA 2EDLA 5GRJH 1ZT1A 4URTB 4H8QA 4HUWB 1WE5A 3QC5X 3DX6A 1LDPH 3BKCL 1AR2A 3FU0A 2EYTA 1TJHL 3SPIA 4PUBL 3W38A 2A6KB 4OF5A 3DDFA 2VXTL 4YXKL 4ZMQA 5D6DA 1L9NA 5FYJD 1T6VN 5FKAA 1MHPL 4NQXA 1DJHA 1HHGB 3CCHB 1I75A 5FS5A 4YXHL 4B7LA 1BEYH 4WV1C 4JCLA 2NXZB 4MYPA 1M2VA 1RZ7L 1UD8A 2A9ML 3EO0A 3G6JF 3HHSB 4JO8A 1I85A 1AGEA 3T8XB 5CBEB 4UQ3B 4N25A 5L6YH 1IBBA 1RK0B 4YBLC 1M71A 1K8DA 2FJGA 1W0WB 1X7QA 4JPWH 4LIQL 1YN6A 4X80L 1QWNA 1RIUL 1WBYA 2K8QA 3KNBA 2G4GA 1JGVL 2ZWZA 4G71B 3ZQ9A 1ZY9A 3AUVA 3FT3B 3RWIA 5B1CA 2R51A 2HVJB 4F7EA 4QRRD 5LG1A 1PLBA 5FR3A 2UUDK 2CLRA 1KLGA 5IEHB 2CKBB 4XPAH 4UZUA 4Y1AB 5AWNH 4N0FA 1LTXA 4QOKB 4YHPA 5BZXA 2YWZA 3NSJA 2J20A 2YMTA 4H1LG 4L3CB 1UWEL 4RWYL 3QRLA 1F4HA 5CM1A 1XGYL 1KCSH 3DVIA 3BESR 3E6HB 4CKQA 1FBIH 3O11A 5EPMA 3H1ZA 4HS3B 4KHTH 1IQDB 2LVCA 4UOW0 5FM8A 3FQ4A 4KJYA 1OCCB 1OO2A 2JTDA 1RAMA 4YDNA 1P7KA 3BWAB 4I0PB 3Q2WA 4GY4A 2VLKD 1C5BL 3PREA 2Z34A 2X6VA 4OFDA 2NUTB 3TM6A 3IPFA 2R1YB 5T1LB 1GPOL 2FHBA 1P5UB 2XA3A 4QRRA 4OFVA 5ADOL 1YPZB 5IW1A 1LL1A 1MJ7H 2WXPA 4PJEB 5E5MA 2E74C 1FG2B 1TQBC 2WYTA 2H2SC 3L95A 1OK0A 1BVOA 3HC3L 5EEZA 4P46C 1MRFH 2HX8A 3ZLQC 5EO1B 4IJ3C 3MXVH 3WFCH 3SY6A 3KYOB 4FA6A 4Y19B 1SXZA 1HIMH 5FA4A 4DVBA 3H42L 2NXYD 3SKUD 1ZV9A 5LDSA 3QUZD 5GGQH 2OYPA 3OZLA 2JJSA 1ASOA 3JT0A 5C0EA 2VLKA 3NTCH 1XAKA 4DZBB 3UC2A 2V5YA 3PPSA 4YVUA 3NK4A 2QKIB 2R0ZH 5HJDA 4A2LA 3LZPA 1GS7A 2B2XH 12E8H 3UO1H 4P5SA 3DROA 3FQUB 3NYKA 4OZGE 4MMYB 3SD2A 4BRJA 1FYHB 4E9LA 5HVWA 5K1VA 1EFXB 1FNGB 1JPGA 1SYVA 3DK0A 4S2SA 1OAXH 2AMUA 1PPIA 3JV0A 3SDXA 1OB0A 2AJ3A 1JP5A 1RFDL 4C58B 4A66A 4F33A 3MRBA 4YHIA 5E2JA 4U6TA 3QGVA 3LVTA 3QARA 4LZKA 3QUZA 4R5TA 1NSNL 3M1BB 2A38A 4HFUL 1FNSH 4MBOA 3T08A 5C9JA 1I4FA 2VUOA 4B96A 3QULB 1AR1B 3VXPA 4PRAA 2CMRH 3BZFA 1F3RB 4WEUD 5E94B 1MWAH 3QAQA 1FO0H 2HT2D 4XP6H 3HI6L 2WWNA 4EZKA 5DVMA 2JELL 3ZW3A 4G6AD 3NJHA 1ILUA 4HIXH 4N2HA 1ZE3H 4AQ1B 3ARWA 3QYCA 3NEOA 3QG6B 2VWEE 4EDWL 4PJHE 1UG9A 1BPLB 2MOVA 3AG4B 4PP2A 2ARJA 4YAQB 1RHFA 3D8MA 1QQDB 4K94H 1MFDL 3FRPA 4DK3A 1IL1B 3VM7A 2APSA 4ZAKD 5F7FA 4KK6D 2EEAA 2APWA 5BRZB 1BDYA 1F3JA 3ILQD 2ENQA 4Y5XA 1NFAA 1KN2H 3OR6B 5FAAA 2EIBA 3TA4D 5IMOA 4E42B 3HRZB 1EO5A 2C4XA 1QACA 3UTQB 3MLWL 2AK4E 1I1AD 1DUYA 2TRYA 4IMLA 4LFHD 5BOZG 5BV7L 4JK0D 2X9WA 4JCMA 1CURA 1YMMB 4OSUL 1CQYA 2CQVA 4QHNA 1W72L 4IGBB 5ICZA 5GZNC 2PWHA 1IGYB 5K93A 4G7YL 1WS7A 4ZW7A 4WENB 2W0PA 2X0VA 5CR1A 2EUXA 5E6IC 4UOQA 3II3A 1ETZB 4ZAKA 4HPHA 1DQLH 4NAJA 5F1KC 3GO1H 2FYVA 1JF6A 1TDQA 5ESVB 3EFOA 1NWOA 2VM9A 1HEHC 3E8VA 1BLNB 3HJ0A 3M7OA 4NC0B 4WGVB 2XIIA 3SO5A 3L3HA 2P45B 4PQXA 3ZDZE 3KLHD 3GS7A 3MA9H 8CGTA 3C6LC 1WT5A 3HI1B 3MOAL 2PTTA 4ODSH 3SODB 4HZ1A 2JI1A 1I1AA 2QZQA 3B7RL 1USZA 2CUMA 4N1EA 4Z7UB 5ALCL 4IEFA 3DVNB 1SF3A 2EEXA 4TOYL 2VABB 3SE8L 4KJWC 5KJRL 1BM3L 1DZBA 1OGAB 2C8NA 2FQFA 4HK0B 4NIYE 4HXBH 5AAPA 3D9AH 3MMEB 2BY1A 3CBRA 3PL6C 1TQSA 2IFFH 1S7WA 1W9XA 4L8BA 4L4VE 5AVSB 3WLWC 3B5HA 3ZN6A 5BUAA 1CTNA 4PREB 3PWPB 4PJ9C 5LB1A 5EC1A 2YQBA 3RFZB 2DD8L 1T2QL 3EYVA 4U3SA 2Q86A 4J7RA 5A1AA 1JPFA 5TE6H 3JWOL 4HKZA 4OVVA 3V0AC 3L9RB 1UUNA 4APQC 4JMNA 3BQUC 3MCG1 5C97A 1CFTB 1VGKB 1NAML 4K9EL 4PRIE 5IV2B 1Z9LA 3AQDA 3AU0A 3WKMH 3G3LA 1VB9A 3B43A 3IJEB 4MB1A 1GIGL 3BAKA 4OGXH 5FIEA 2BXZA 3V9EA 3O4OC 2C3WA 3B1UA 3F83A 2W9EH 3G08A 2PW1B 4PJBB 1VKXB 5DJXA 5JZ7C 5D1QB 5FYKU 1BVKA 1QSFD 2G5UA 3MKKA 4JPSA 1MVUB 2ERJC 5D4IA 2AJZB 2KS0A 4G1EA 1JGUH 3K2IA 2XPGA 3G9AB 2DDQH 5I8CB 4IBUA 4E9VA 1Z7JA 1R3KB 2Q8AH 1B2YA 3CDGA 3K4ZA 4G6JH 1RJLA 4U6XB 4XE5B 3ELQA 4Z7IA 3SDCC 5K9KB 1SOQA 3V8OA 4S1RH 1SDYA 1I9IH 2I7OA 5JNYA 4H0GA 4HSQA 1A7NH 5E8PA 2CM5A 1OE3A 4A7VA 1KEMH 3QNYB 2ZUYA 3BAEH 4KKBC 4UT7L 4HGWB 4MA1B 2EO7A 3LQZA 5AOMA 1FJ1B 4WTWA 3UBXI 1E9PB 2YFOA 1K2DA 5J8OA 3FU6A 1G5GA 4ZS7H 4ZYKB 4HPYL 4AE0A 5IP4A 2ZCZA 5KG9B 4AKQA 1NIBA 2LGNA 2MCG1 1AI1H 1QSFA 3N1PC 4UF7C 4AEIL 1KSRA 1Q1PA 4GRLB 3SGDI 4PS3A 4RAVB 1AFVL 2AMGA 1LO5B 1MJUL 3CVHB 3NJKA 4JN2A 4JY6A 3FCTA 2ZXGA 3EBAA 4W9KC 4FGMA 3LQMA 4ADGA 4C47A 2P5ED 1BIIB 4K3EL 1NWPA 3V4PH 1A25A 1FC1A 1DQQA 4LHJB 4S0SD 2XG5A 3ORJA 3EYFA 4BD4A 4JO3L 1ND0B 4Z76A 4Z3EA 2GY5A 4HP5A 5EG6C 1LO3H 1NEPA 3NABH 1RP9A 2HAZA 2ZUQC 1IKNA 2Y7QB 3LB6C 4FCAA 4JQXA 1QI3A 3JV6B 4CADA 2MKLC 1ZLUH 1V54B 1HHJB 4U4IA 1P2CA 1KC5L 3IU3A 2EO1A 1ZTMA 3AACA 1WFIA 3HLAB 4WU5B 4DKEH 1W0YT 4KHXH 1V7NL 2NY4B 5C0CB 4C59B 1RZPA 3U4KA 1BMZA 1KBGH 4N20A 1PZSA 4U49A 3IFPB 3D87B 3O6KH 4FJ6A 5KWYC 4Q74A 2OTPA 4R4NC 2BNRD 2P5EA 4PI2A 1GGCH 1B0GA 1SMOA 3MBEB 5B7EA 3U2IA 3ARXA 3VWKC 4LBEB 5D96C 4EVNA 2J43A 1ZEAH 1SGKA 1HQRA 3AU1B 3CNKA 3O45B 3L7FB 4JJHA 3SPCA 4M1DL 1S9KC 4QXUL 2CCVA 4DP6X 3TN0D 3MU3A 5FCSH 3TU6A 1L9QA 3KVQA 4RGOL 1FN4B 1UURA 4NO2A 3ZKMC 3NVQA 3CPUA 1B3JA 4IU2B 5DJDA 5F9JB 1YC8A 3RNQA 2YEZA 3BXNA 4NB7A 4Z8FL 1E3FA 4FC3E 4OZFB 5HBBA 1WFMA 2B77A 4Z95H 4GKZA 1CYXA 2BNRA 2ATAA 2R69H 3BAXA 2CK0H 1R5IA 2W88A 2WZ5A 1EEZA 4BK4A 1CO1A 3GSNL 2H3NB 1QATA 4AJVA 5EU3A 2ZOWA 4IM8A 5TQ2L 1RZKH 1PNDA 4L8SA 2F5BH 2JIXB 4QRTB 3TN0A 2YD7A 4PWJA 4Y5VC 2OK0H 3SPVA 3QPQD 1N5AB 3LNHA 3ZQWA 1MCJA 3E1F1 1KIQA 3IFNH 3WN5C 4MASA 1S7QB 1M9WA 5E5UB 5IT2L 2A74A 5KVEL 3MDJA 1M1SA 1M6OB 3A22A 5D7IB 1JHTB 1MW1A 3RWHA 1YEHL 3FB7B 2J7LA 1CD1A 2EDXA 2ATKA 3S36X 1PLAA 2EXTA 4ORGB 2GBUA 5CWSB 3LVEA 2PABA 4DKDC 1CF1A 3ZE1E 5IUSA 4U3HA 3T6WA 2M26A 3N42B 1TVBA 4PB0H 4LNRA 1B2WL 1T0OA 5AOJA 4X5WB 1JWSB 2I69A 3QDME 3B8YA 2JCCB 3D0VB 1M9SA 4YSAA 4D9LL 3S36L 3RDJA 5D8JL 1NCCL 3GJFB 4NRZA 4NPJA 3JWNG 1OM3H 3TCTA 4PLNC 5JOPD 3BRGC 3IN2A 3FAXA 2IANE 1YYML 2HH0H 5F70A 1YEKH 3GKZA 4PYGA 3O2WH 1GJWA 3OAWA 5I0XA 2YD5A 3TL5A 1HAUA 2XN9E 2PR4L 2XWEA 2ZOTA 2X40A 4YHYB 2CZNA 1QYGL 4U3XA 4CKVX 4ENZA 1E4KA 3T65A 3H2QA 2PO6B 2J4WH 2CRMA 3AMLA 2I24N 1FGVL 2I7SA 1A7RL 4PW3A 2E7DA 2EABA 3GRWA 2ARJQ 4GSRA 4WEMB 3SBWC 5CEXA 2BJML 2DQJL 4YIQA 5I24A 1YJDL 5GGTH 1IVTA 4AVJA 3VRIB 2RQEA 3KJ4B 5DJAA 1BVNT 2BS9A 2VLME 1IM3B 2DWXA 4OV5B 2VERA 4MD5B 4F8NA 3C6EA 5CFHA 4FQ2L 3F64A 1GGBL 3LRSB 3Q1SL 1XL6A 1HQ4B 5IJVA 2D7TL 2JK5A 3IJHB 3BUBA 1FFNA 1QLEH 3WTYA 1QSVA 4V2CB 4LCCA 2EDNA 1QLFA 4N26A 3AS2A 3F6LA 1X5LA 2QV4A 3MLRH 1EUUA 2X4SA 3BKMH 4OKVA 3L17A 2ZXDA 5D71H 3BRFA 1XV8A 4P2YA 5C3TA 2NYYC 1UVQB 1XB6A 3PV6B 1KGYE 1WZLA 1JZHA 2WLYA 4G9DA 4YHZH 4YMPA 1JDAA 5F7EH 1BQRA 3VD4A 2V9RA 3IXAB 3I6KB 3ECBB 3WDHA 4QXGL 2FJHB 4XGZB 3MLYL 2ZCLH 2ZKYA 5F1IB 4LLQB 1AS6A 1J1PL 3DXAE 5GXBB 5ID0A 3U0PB 2DBLL 3O2DH 2YPKA 1Z5HA 1LE5A 4XNXH 1CDUA 1RCYA 2YD4A 4Y9EA 5IB5B 5I0DA 4X99A 3EUUA 4YHOL 1UENA 2W0FB 2ZKHL 3QHFL 4JX0A 2BK8A 4I9WE 1I8IB 1BGXH 5GS3A 2QPSA 1IC4L 3OC8A 1NIAA 4MA7H 5DJ0A 5EOTB 1KCRL 1HZHL 1ZK5A 3S37X 5AVYB 1NAKH 5HGHB 2X4OB 4HUUA 1NTDA 4LE8A 1OZTG 1QASA 1UZ8B 4M6AA 3RWDA 4JO2H 3SDXF 1IEAA 2Y9RT 5DK2A 3WTWA 4XVTL 1KTCA 3VFMB 3MUGA 1EBAA 1MFCH 2OL3B 3KDPB 2ORBL 1MY7A 5D55A 1PF3A 4U0RC 2X38A 3ULSB 4AIEA 3DETC 1IT9H 1QTSA 2IWEA 2X0UA 3VRLF 2VDPH 1DLHB 2Q87A 5I1JH 3OGOE 2ODHA 3MV9B 1NINA 4TLSA 3RWEA 2W07A 5I0VA 1KT2A 3F6JA 3FO9A 5D70H 1P0SE 5SX4I 3WIHL 3MCYA 2WBJD 4M6OL 4X4ZA 1LP9E 4NKMA 2XQYK 3DARA 1QRND 2DWSA 3QG7H 3QS2A 1ZCRA 4IDJL 4FXKA 3FSWA 4HKXB 1AD9A 3MRIB 4PB9H 2AJSL 4PRPA 1AVAA 4AUYA 4G80A 1FZOB 4BA0A 4CSSA 2HCZX 1QR4A 3F7VA 3GLDA 2EDOA 3MRJB 5LBGA 5TF1L 3VXTB 4DWHA 2VH5H 2AC0A 4M00A 4XP5L 5GIRA 3GBNH 3IWUA 4X9BA 1FFQA 4LARL 4MBRA 4W9CC 5H4YA 1EGJH 2RCSL 4N6RB 4GG6A 3RGVD 4OF7A 4JHWL 5DD1H 1RJYA 4M8QB 2VJXA 2OPCA 3EKCA 5GJTL 4GW1B 2YK1L 5GS1C 3EDDA 4JDZA 3CDZA 1AO7D 1PW3A 2N1KA 3BIKB 4ORZC 2GSGB 2WBJA 5AL8A 3TPKA 4MVBC 5J56B 1ZHKB 1DBKL 3U4BL 1QRNA 3CK0H 2XPZA 1S7XA 2UVFA 4J3OC 1CDIA 2ED6A 3PWVA 2XVLA 3ZX1A 3QUMB 4XI5C 5DRXA 3MNWA 2YAFA 1F4WL 2NX5D 2YQ3A 4NQDB 5FHAH 1BJ1H 4H0HB 1OV8A 3QR2A 4K71B 4Y2DA 4CU6A 1JDDA 4UYQA 1BZ9B 4QHMB 4FFYL 4M5YH 3CN4A 4YEEA 3RGVA 4E9WA 4LK4A 3TBWA 3VACA 4Y8AA 1KB5A 3T4YB 3TZVB 1G6VK 1AO7A 1HOEA 5DHVH 4U1IB 5E8DL 2W65A 3UG4A 1KB9J 4QYOA 2WLZA 1DVFB 2Y69B 3ZDYE 5JIHA 1A14L 5IB3A 4W9FC 1OSYA 4FD0A 1DQML 2EVIA 3UMTA 3BGFC 4KUCD 4Z5RA 3GINA 3PHQB 3SYCA 3EOTH 1RZFH 3SPGA 3S4SB 1BWMA 1F4YL 3TT3H 5BJTA 2CHDA 2FX8L 4F80A 3CG8A 1CI5A 2NX5A 1E6OL 3HNTL 2GCYB 4NBZB 1A6ZB 2FD6H 5LXGH 5JPMA 4X9FA 3TWCL 2IPTH 1TZAA 1KJVA 1MVYA 4YH6A 3RNKA 2F54E 2GSIB 1JPEA 2H32A 3K81A 4FZEL 3PGFL 4NS0A 4YBHA 4I18B 5EB9A 1OW0A 4XVUC 4PCTA 1GSMA 3QA3B 4KK8D 2X4UB 1VZHA 4R0LB 5F3HA 1XD0A 3T2NH 2VLRD 4FNTA 3IDMB 3L3DB 3CVDA 3EYOA 2ZXQA 4YL9A 1M53A 4GW5A 4YUEH 5FGSA 5I19L 3MUUA 4QPEA 5K9QI 4OVUA 3NCWA 3Q3GA 5EBMB 3S3SA 5CP7A 2Z8VC 1SRDA 5IBTL 1K8IB 4IS6B 3FFDA 4HC1A 5F7BA 4XO9A 1PZUB 4UTAA 4PJAA 3KMDA 2WCGA 3OAZH 1KXVA 3ZYJA 3L3JA 4AVHA 5IVXA 1U3HC 4Y16C 1NDMB 3DX2A 3WDIA 5EU6B 2YPLB 4D0CB 2X4TA 2LTQC 5B22A 1NBYB 2BP0A 4Y2NA 1BQUA 4W81A 1BFTA 4MRCA 4NO0D 2VLRA 3S0PA 4LSTL 1RJCA 1U8QB 4Z7NB 3ECWA 3MLXL 1W16A 3E1ZA 5L4JA 4YBQC 2C4FT 1BG1A 3VXME 1L0PA 3CN1A 4L2YA 4K5LA 2KI6A 3MRQA 4M6MH 5I15L 4MMXB 2VC2H 4KKLC 4LPYA 4U05A 2A4EA 4KXBA 1KTLA 3PJNA 3R19A 1CICC 4I0PC 4AYFB 1XX9C 4JG5A 3GMOA 1K72A 4KKAD 4N85A 3OVUB 1TR7A 3GIVA 4BFEA 5KBPA 2X4RA 3DIVA 4XBGB 5EWIH 4GAGH 3FPXA 3WXVH 3RWFB 3O9WA 2Q76A 4JFZH 5GGSY 4Q6KA 3BZEA 4NO0A 4HHAB 2Z8SA 2KLRA 4HCRL 4M43H 1KCUL 5I0WA 3EGXB 3V2AR 5JA8B 5HHOE 2OMUB 1C12B 4PJIA 6PAZA 3G5YA 1BHGA 1DQJB 5EZJB 4OGYH 1FRGL 3NN8B 4R97C 4AK1A 1PD0A 4B41A 3QO1A 3WEBA 4E41B 3L4CA 1G9MC 2WCSA 1FDLH 1HSAA 3EYSL 3EYUH 3MRNB 1DE4B 1WFUA 3GMRA 2FEDD 2VW6A 3AY4C 1BVLA 4MZ2A 3RGHA 4DVRL 5I28A 4ADIA 5BCAA 4RGMB 4M4PA 2QKIC 5TDOA 4NPYA 3KEHA 3WIAA 1NQBA 2EXWC 5DJ2B 3HKFA 5I5IA 2PYED 2J44A 1SY6L 4PI0A 1R5VA 1NIEA 2IV8A 3CFCH 3Q0HA 2DY2A 1A22B 2HUHA 4JM4H 3ARBD 2L7UA 1OHZA 4OGAD 2JKJA 2GPZA 2MQ3A 2R15A 2K70A 2YLHA 3G6AA 4R2GB 4XHQA 3X3GL 5FW7A 1LEIB 1U8PB 3VH8B 5F6IB 4K8RH 3MKGA 5D4QA 2KBGA 1YEJH 3QDGB 1TYRA 2VDKL 4FQJL 1AR1C 1FE8L 1V5JA 4PRBB 4D0DB 3UTTB 2WZPD 4RZCA 2V2TB 1CR9H 5LCVH 3TV3L 3G6JB 5ABDE 3ZMEA 5DD3H 2GUYA 1RMFL 2PYEA 1X5IA 4G7QB 4DGVH 5HYJA 1FZMA 3D52A 4FE9A 1U0QA 3ARBA 3WD5H 5CJBA 4JG1L 3SN6N 5IBLC 1F2QA 1MQKH 4DOHB 5DMYA 1DDHB 3CFBA 1OSZA 3QAZC 3C6SA 3GMMA 5DMIL 5I8OH 1FL3A 3PJLA 4OZFG 2P24A 1BOGB 1CCZA 4X7TB 1QBML 3KR3H 2VR4A 3CVIH 4O02B 4URKA 3MUHL 1SXAA 2V5MA 2AQ2A 2NY0C 4MB5A 3V52L 4YDMA 1RZ8A 2Z91A 5JW4N 3MCKA 2WZPA 3NH7H 1PZ2A 3F7YA 5ID1B 3UGEA 1R24A 2FX9L 3WTUA 1LK2A 5CZRA 2QDVA 2I85A 2Y23A 1AQDB 2OL3H 4NO3A 1TIUA 5K69A 4E0RB 2DQCL 3TEZA 4YHMH 2WCPA 5INCB 2GTWA 1BQ5A 5JORA 3SE6A 5DEFA 1U8OA 4YDVB 1JPSL 2D9CA 3B9AA 3MV7D 4QCIB 2YD3A 5C0GB 3LIZH 4PU2A 1A6TA 1TNNA 1PZBA 2D31B 5DTFB 4YLQT 1FG9C 3BWUC 3OKKB 1AXSA 4LSVL 3CU1A 2XKSA 4I3RH 3CLFH 2NY6C 1ILSA 1U8LB 4ZTOL 1I1YB 1V3JA 2XA8H 1FIEA 4K7PY 3QQ3A 4KQ0A 1EEQA 2EYSA 1KFAL 2DM7A 2HZHA 4QRAA 1Y18B 2F7PA 4U6VH 4H5SA 4FULA 2W59A 3L1OL 3V4LA 3P0VL 4ZS6D 3TBVB 3RFZC 3QCUH 1O6SB 1PFOA 3MV7A 1NLBL 4G70B 2GKIA 5C0NC 2EIZB 1DVZA 4KAQH 2A0LC 4Y1SA 3DVGB 3I02A 4ZTEA 2C9SA 2Z92B 3MGOB 5AB1A 4PV8A 2AK1H 1U8KB 1AP2A 1QNZL 4Y1AE 5A6IA 1JZ6A 1ZTXH 2GYSA 1JHLH 5HI5C 4L3FA 1JXJA 5K9JH 3CZEA 1MUJB 2AEQH 4QRPB 4MWFB 1FNHA 4PTUA 5FA3A 5J11B 1TEYA 4RMTA 2DH2A 4WWNA 1CLYH 5DYFA 1KN4L 2ATPA 4XMPL 5D72L 1HSBB 1VLXA 1AZUA 2YQ2A 3VSTA 3AGWA 2NUPA 5I6PA 4AQOA 4N1HB 4XP9H 3AQYA 5ANME 5TE4H 2BVOB 4NKIL 1GGTA 1HAWA 1KTBA 3N41F 3KXFB 4OF0A 1CBVL 3FU3A 2BCKB 4OLWH 2WVVA 1NGPH 3QWRD 1HS6A 3O6LH 1ZLSH 4R5XA 4CMHC 1RHHB 2AJYH 1BBDH 1FHNA 4LRNH 3SDAD 3HN8A 5HI4D 1HCFX 2IOMA 1M7DA 2K9UA 3BKYH 3FUNA 4X5XB 3GSQB 35C8L 1G7JB 1XMEB 2R23A 4FQXC 4KO7A 3RY5A 3MOBL 4WGKA 5A2AA 4WWKD 1U3NA 1WZ1L 4MS8C 3UYOD 3SKNA 1JAEA 2HWZH 1V55B 3F58H 3MJ8B 1G7MA 3IXTB 1PJ9A 4ENED 4OCXH 1HOCA 4PD4J 1XFPA 1DL7H 2GC4C 4K23H 1MKFA 2AEOA 5DJ8B 5JOEA 2W91A 1L3NA 3FH5A 4EI5B 1IGCL 3LKQA 2DIAA 3QWRA 1YO4A 4NN7C 1H0DB 2ARWA 4JO1L 3RE0A 5B3SB 3SDAA 1IAIM 1R3HB 4DN3L 5BOJA 5F71A 3NSYA 1M4KA 5CGYC 3O0RL 3CFJB 2BH0A 5JHLH 2PXYC 1F4XH 1AOHA 4EI6B 4LSDA 1GOGA 3GKWL 3R8QA 5CAYB 4LCYA 3WMPA 5HHXH 3QHZL 5BXFB 4WWKA 1AIFA 3FQXB 3R06A 3IGAB 4PW4A 1HE8A 1PIGA 1QAWA 4XHJD 4LGPB 4DFHA 3HZ3A 3HPLA 4OLYL 3NRFA 4UTAH 1E7UA 4C56B 4GG6F 3LY6A 2FNBA 5B1JA 4WK2B 1KYAA 5I5RA 4LO9A 4R26L 3V4UL 5CEZL 4OD3L 1X9RA 1YRKA 3WSQH 2YAEA 2F8XC 2WXOA 4EF3A 1PNCA 2NYKA 3SGEI 1FGNL 2IWGA 2QGCA 3TURA 1NCNA 2V0AA 3GRGA 3NZ8A 4NBXB 3ULUL 5C0BE 3MJ9L 3CFKA 4NNXB 5DUJA 3BDBA 3IGKA 1RVFL 4WUKH 2BSSB 1J05A 4P3CL 1P7QD 3O2VL 1NCWL 4JO4L 5D1ZB 4YNYB 2IH8A 4S11A 4ZDHA 1HEJC 4DH2A 4ZMAT 5J4MA 1MQ8A 4R3SA 1KJ2L 1NBVH 1W72A 3OKEB 1U6AL 2ETWA 4P3WA 3GTVA 3GXDA 3R1GH 3CZKA 3FOLB 2NY2C 1OLLA 2XC8A 3DX8B 1AD0A 3QEHB 4UCFA 3M1CA 1BQLL 5HHNB 3WJMA 5MEQB 4NQQA 4AQAA 2K7QA 1JTTA 4U1SA 1ZA6A 3CSYA 1KEGH 4JDVB 4WFFE 2ODIA 2LU5A 4LXFA 2CD0A 2K4AA 1JVKA 4MGXA 4ZG1A 5HJ3A 3CLEH 1HFUA 1MFBL 2D3NA 1CDGA 3PWJB 4K4KA 5FPIA 4XPGL 3BN9C 3BP4B 2BO0A 2F58H 1A6UL 4JRYD 4LEXH 4JN1H 5DVKA 1P7QA 4NWUL 2VR5A 4YDIH 1NEZA 2XDHA 1V3KA 1CFNB 1YN7B 2HTLC 2Y24A 3TYGH 2O6EA 2B1HL 4IRZH 3HR5B 1MEXL 2Y6SD 1Q0XL 5SWQB 4R7NB 4ZRGA 4MNGB 4BSVB 5I1GH 2UXVA 4OZGA 3HZKB 1JGLL 3Q2VA 3RB5A 4J4PC 3MLVL 1BXAA 1G0DA 4YFEA 1E27B 4LRIA 3QJSB 2MH4A 3IU4L 3C60B 1ZLWH 4HUCA 4KGLA 4UQDA 1B4LA 2E9IA 1U8IB 3OB0H 2IO5A 2BW4A 3OKOA 4JRYA 3VSUA 1A4BA 4KUCF 1CLVA 1JTOA 4G8GB 1NAMA 1E4XH 4PGEB 3GGWB 1GXEA 4BA8A 5JXAL 2AK4D 3S4SG 2ITFA 2AGJL 5IROC 3TIEA 3OAZK 2PCXA 4XNZC 1KIPA 4ALAH 2ICWA 1G6RL 4ATWA 4N0UA 4BHUA 4R9HA 3UAJD 1PCSA 4PIRF 4AK2A 1DLFH 3PF2A 1ZT7B 43C9A 4EZMA 4Z7QF 4J3BA 4Q9QL 4MJ2A 4QRUA 1CC3A 4PJHA 4PJAF 1IKFL 2DM3A 1NGQH 4A63A 4AUJA 3RDTC 1S3KL 5IVXF 3H9SB 4ZMNA 5FFGA 3B9KB 5EULV 2W80C 5BS0B 2FEJA 3DDGA 3GXFA 3MLSL 4OJFL 5FYLE 2OMZB 3HHRB 4IBYA 1MCDA 4UZSA 5BVJA 3BSZA 3KJ4C 4RFEA 1VEPA 2JB6B 4P9HH 1H3PL 1WC7A 4CC0A 2AK4A 4JREB 4D0BA 5B39B 3QXDB 4UWQB 3I6GB 5JPNB 1DSWA 5MEPB 1I8KA 1XL4A 4QXTA 4LLWA 1JGEA 2VDQB 4PIBA 5L9DL 3TF7C 3UAJA 5EOCL 2A6JA 2F7OA 2OTWB 3CN0A 1AKPA 4GMTL 5DHDA 2IPKA 5AOIA 5KYUA 3BP6B 3V4VH 4TQPA 2BHYA 1U8CA 4C54A 1IM9D 2BSBA 3KM1A 3V0DA 4X6BA 4L4VD 3RVTD 3VD1A 5A6LA 2XTJB 4LU5H 5K33A 4JPQA 4KO5A 1NZRA 4AXWB 1UJ3A 1SPDA 1OSEA 3D3VA 2CIIB 3KYMB 4XMLL 3UC0A 3EOBB 1TJHH 1H5BC 4ZPVA 4PUBH 3BHBA 3V5DB 3BPNC 2NZIA 2VXTH 1DEEA 3JTTA 4MCNA 1MCBA 1V7MH 4YXKH 1V05A 1NCAL 4PRID 5J1AA 1X5FA 3E0GA 2P5WB 1MHPH 1ZWIB 2V2XB 2H6PA 2VLJB 4YXHH 4DN4L 2VISA 4JDEB 4X8CA 1JZ4A 1RZ7H 2A9MH 2A73B 2I25N 4DP8X 3DPBA 5KSUA 1IM9A 4X8XA 5DQJA 2ROYA 1NUDA 3FB5B 4L4VA 3ZKSD 5HJGA 4P99A 4HIJA 5CD5D 4LIQH 3B9DA 3II2A 4WV1A 3UGUA 3E2HC 4XP1L 3I50E 1RIUH 2B3IA 4L29A 5E9NA 5DI8A 5FOBA 2OZ4A 5GSRA 4RETB 3N85H 1IFGA 1ZT1B 3PRZA 5E99L 1HKLL 2W1NA 1NOAA 4YPGA 3DX6B 1XR9A 1YG9A 2CO6A 3I9GL 2EYTB 2ICEC 1EQWA 5DS1A 3V0VB 2JE8A 4PRIA 1SMAA 2AXFA 2DKMA 1HH9A 4AG4L 1E90A 3B2UD 4AM0A 5I71B 4ELME 1UWEH 4RWYH 2ZG3A 3NIFB 1XGYH 2HLFC 1Q90A 5FKAB 4JW3A 5AEAA 5EMYA 4NQXB 4XMXA 5LKNA 5JHAA 3ABGA 2H2SD 4PMEA 4HJGA 3P0YL 4Z77A 4P46D 4JQIL 1M2VB 3EO0B 1NOFA 3IPBA 4J39A 1AGEB 3H9YA 3UPAA 1UH4A 1JBJA 3U6RB 1M71B 4YGVB 1BFOA 1C5BH 1IEBB 3HVDA 2W92A 2FJGB 1FH5L 1PMYA 4I1PA 1YN6B 4O9HL 3KNBB 3DOIA 1WBYB 5ADOH 1GPOH 2EDTA 2AQPA 1ZSDA 3TPUA 4F7EB 5C3LD 3VH8G 2DLEA 2CLRB 1KLGB 2Y36H 4GLRI 4D7BA 4HU8A 2V9TA 5KYWA 4N0FB 2R2HA 3VGBA 3N1FC 1CFVL 4EQ2A 3HN5A 1J9RA 4HULB 3KS0J 4DPRA 5KBNC 3MNMA 3TBCA 2YAOA 3ZO9A 2G9HB 4P46A 1YMHA 3AFLA 1MCWM 3H42H 3HS8A 4ZX5A 1JF1A 5KBDA 3O11B 1JK8B 5EPMB 2O4EA 5AVVB 4BKLA 4HIIB 2XV2A 2VXQL 2QQKH 3W5NA 2IVFC 3H9HA 4FKHA 1P7KB 2ZCKH 2EXSA 4ZUVA 3QJUB 4PJFA 1F6LL 5I6LA 3QFJD 3AB0C 1UXSA 1E2ZA 5IW1B 2V17H 3RILA 32C2A 4K71C 5DLML 3SKMA 1ZT4A 1NFIA 2FX7L 1MCNA 1BXVA 3L95B 5HVGB 1T03L 2NY5C 4A2FA 4PM1A 1N0XL 1ZAGA 3UMNA 4OZHA 3BVNA 1NDGA 3K3QA 3QZWA 1NC2D 5I9QB 2J57A 4DVBB 3L3IA 2FO1A 3GD1C 3ES6A 4M5SA 5I8KL 2IGFL 1WISA 1LVEA 4KXZI 1FAIL 3HI6H 5FM5O 2CR0A 3VFWB 3WFDL 1EFQA 2JELH 2VLKB 5C0EB 1SJMA 5I2IB 3QFJA 4KMLB 5F1SA 4JPVL 3TV8A 4ZSOE 3MLUH 2AQ1A 3DUUA 4EDWH 2EEDA 2VDLB 3RPKA 3A23A 1VFMA 1MFDH 3DROB 3ZDXF 1WWWX 3NEXA 4ECNA 1UFUA 1TTUA 4H8VA 1JPGB 1SYVB 4KQ3L 4S2SB 5GZND 3SDXB 2AJ3B 3ZO0A 4W4NA 3DGDA 3PGCA 2EXYC 5E6ID 2VRQA 1NC2A 3PWUA 3MRBB 3MLWH 2NXYB 2X2HA 3AXHA 4UT6H 5ICYA 1RPUA 3DOSA 2I32A 2UY6B 3CSPA 4IQHA 5CMAB 1I4FB 5EZPA 5BV7H 5C9JB 3VXPB 3KJ6L 3BZFB 3OF6D 4HIPA 4OSUH 1W72H 4XNUL 2OQJA 4WU7A 4M7KL 3ML9A 4OZ4A 4G7YH 2MFNA 4QHUA 1GHFL 5FO2A 5IR1A 3K8LA 4KJWD 4TSCH 3UAEA 5CR8A 3QDMD 4PP2B 2ARJB 4JRWA 2CA4A 4K5PA 4XMPH 3RX5A 5GZNA 4RQQA 3FRPB 1GZHA 3CFIC 5EF1A 3PL6D 3CUPA 2QSCL 5E6IA 5LNEA 3GS0A 3WLWD 3PU7A 1F3JB 1FIGL 3MOAH 2FUQA 3FK3A 2VXSL 3T3PB 4PJ9D 5IMOB 4KRMB 5FXCH 1ZVSA 2XN9D 3CIAA 3DJZA 1S78C 1JGDA 4PJXE 4OZIE 4TOYH 2IMMA 3SE8H 4APQD 5AAWA 1BFVL 3OF6A 1BM3H 5KJRH 1DUYB 1E5AA 4NYLA 3VFNA 1R6VA 3DIDA 3HC0A 1H3VA 2K45A 4XCYA 4L1BA 4MMXC 3ABLB 3GPEA 5J6GA 4TSBL 4X83A 4QHNB 1TETL 3GSXA 2DMBA 3ARFD 15C8H 2P28B 3VFTA 3OQRA 3QDMA 4JY5L 4G6FD 2G3NA 3QFDB 5ILTL 2AXJA 2E7HA 2DD8H 2O6PA 3Q44A 2Y22A 3PL6A 2VLMD 4ZAKB 4DNLA 3TO2A 1WF5A 1BXUA 3JWOH 3EFOB 3VMPA 2CHWA 5CCKL 4Z0XB 4PJ9A 5D7JB 2XBZA 4K9EH 1NAMH 2XN9A 4KY1L 1KULA 4BYHA 1UB6A 2Z8WC 2PTTB 2I9LB 2LAGB 4PJGE 4RNRB 1I1AB 2L3BA 1S5HA 4YO0A 4MCZA 5FYJU 1GIGH 2OLDA 1HXMA 3BO8B 4IEFB 5LXVA 2N59A 4FNLL 2NW3A 4F7PA 4NAMA 2I5YL 3UBXA 1A2YB 1CFQA 4HKJA 2E9JA 2F53E 2V4LA 1MJJA 2Q1EA 3ARFA 5EIIA 2Z65C 1D6VL 3ZL2A 2CDFA 4TNEA 4RGMC 1N18A 4L8BB 2VDRB 3FCSA 1IO4C 1N6QL 1AACA 4PRNA 1YY9D 5EC1B 4PVMA 3EYVB 4U3SB 2YSSA 2FT7A 1YYLL 1JPFB 4HKZB 1J8KA 3VFVA 2JQAA 3SZ6A 1BBJA 1G1YA 4UT7H 1M7IA 3BP5A 2EC9T 1B9ZA 2IDTA 3BEWA 4H2CA 4Z3HA 5GQBA 1WRFA 3EBHA 1T66C 5C2UB 2E6JA 3NSFA 2RIKA 4FHBD 4HPYH 4LVEA 1MY5A 3MJGX 4I9WD 2OI9B 1YUHA 3WIFA 4AEIH 4K55A 1A7OL 2VKXA 2Y5QA 4DUVA 3LB6D 1AFVH 3SE4C 1MJUH 2Q7YA 2PCFA 5H2BA 4M8UA 5DJXB 3AXLA 1X5XA 3AWEA 3L9YA 3BW9B 1JIBA 4K5MA 3FL7A 4G5AA 5KVDE 3A0OA 2ZKWA 1AANA 4G1EB 3NIGF 2XPGB 4K7PH 5A2FA 1D9KB 4K3EH 4MZ3A 4EIZC 1EANA 1J0KA 2XXMB 1L5GB 4NZRL 1QX1A 3FTGB 4JO3H 1JZDC 5K1NA 1OE2A 1H19A 4H4NA 3GSUA 4R4ND 1I1RA 5E8PB 4BE6A 3QIUC 5EEYA 2JJTC 1QR1A 2HT3C 3CTTA 3EFFB 3K2UL 4UTCA 5HHXL 3LQZB 5CD3A 3ZHDA 2NQ3A 5JDSB 4PYHA 1I53A 1K2DB 1KC5H 1QPPA 3IK2A 4OZGF 5IQ7L 4JFFE 2GJPA 1NUNB 3OB0K 1V7NH 2WSKA 5J89A 1ZJBA 1MDTA 1NANI 2V2WA 3UBHA 1Q9KB 2WYZA 3ZKMD 4P8QA 3HCVA 1AGDA 2DIJA 3F2LA 4JN2B 3GMLB 3FCTB 4B6ZA 2VE6B 4BQ8A 3NBNA 4CDHA 2XQYG 4A04A 2OFQA 4FLHA 4LVOC 3BKJL 2FSEB 3DRQB 3AWFA 1N64H 1WBXA 4WSKA 3WHE0 5DS8A 4M1DH 2XG5B 4HMDA 3EYFB 4AM0Q 3NFPA 4QXUH 2WWKT 3DJ9A 3SKJL 4Z76B 1FVCB 3IDXL 4NQEE 4RGOH 1NJ9A 4H8PA 5GZOC 4RAUA 3RJOA 4PJHF 3VM5A 5KS9E 3P3RA 4CADB 1LP9A 3U9WA 1TYEB 5A2JH 4Z8FH 1BMGA 5F44A 4AGQA 4Y4KD 3F3HA 1SDDB 4RWHA 3RURA 1FP5A 4QHPA 3UPRA 1OGPA 3LNDA 1MRDL 1RJZA 3QIBD 1F1DA 1FC2D 2R1XA 5DJZA 4G83A 4N6QA 4O58L 3CD4A 2FHCA 2XIDA 4MDRA 3INOA 1YNKL 2X2IA 1GZPB 2K6ZA 3LV3B 2WKGA 5C86A 2P5EB 1MELA 3GSNH 3IB4A 1B0GB 2E5EA 3ASOB 4A67A 4XCFL 5TQ2H 3FSAA 3MRLA 1P4LA 4FQIL 2QQQA 3IE9A 4GIOA 3CZUB 2AV1A 1HQRB 4L8DA 1HK6A 4P5KA 4NHCL 1JZ2A 3VG9C 2X1QA 7PCYA 1PG7W 2ZWLT 2CK2A 1P4BL 1PS3A 1EHXA 3W0WE 4NO2B 4Y5VA 4Z23A 5KVEH 5IT2H 4Y4KA 1CDYA 1WYJA 2JSFA 5KBMA 3SDYL 5HXMA 1A3QA 5DJDB 2YHGA 1NGYA 3RNQB 2YEZB 1H15A 3FN0L 3BXNB 3NGBB 3QIBA 5SV4A 2QPDB 3HMWL 2DM2A 4WI0B 1DBML 5JIQA 3J27A 1QUNA 5AYTA 1XR8A 1CJYA 1OPOA 3APCA 4AOFA 4L4TE 1B2WH 1EEZB 5B39G 2F54D 2XWCA 3DWTA 3TESA 2DMKA 2KZWA 4N86A 5E4EC 1XTLA 5EU3B 2BFVL 3IN0A 3LTVA 4D9LH 3KYKL 4L8SB 3S36H 4KPHH 4UTBA 1U2YA 3P2BA 4LSPL 4HCRA 1AZZC 1YYMH 3AWGA 2J8OA 1WA1X 3WN6A 3D34A 4OB5L 5J1TC 4JEGB 4LLVA 3R0NA 4PCYA 2PR4H 5AYUL 2WUCL 4WAFA 4ZNCD 3DUHA 2A74B 3X3FL 3ZDWA 5DUML 1DCEA 3SKOB 3FONB 2BIPA 3ATFA 3L3GA 5C70A 3MXWL 4AGNA 1SLVA 4HYTB 3RWHB 1A7RH 3RPBA 4CGTA 1ESOA 2ATKB 4EXKA 3QWOA 3ZHNA 1D5IL 3MV8E 2F54A 4KJPD 2BJMH 2DQJH 1YJDH 4S0TD 2HPTA 5BZZA 5T3ZL 1TVBB 2DN7A 4LNRB 2QR0B 2NYYD 2D03L 4BIKA 2IMNA 3ZT6A 3AZUA 4UQBA 4XODA 1XF4A 1FHGA 1MREL 4B60A 3E7JA 5BQDA 3NCYP 3NP3A 4FQ2H 1GGBH 3Q1SH 3VFUB 2D7TH 2OYMA 4NRZB 1KBVA 3O3BB 5AW6B 4ELKA 4MA3A 2UWEE 3H3PL 5A6MA 2J25A 2R2BB 1H3TA 4OQTA 5I0ZA 2RMNA 5EF2A 2GJ6E 3SE9L 1ZRUA 3HFML 3NT0A 4UU9A 1KCBA 2WLLA 4O51A 3DHPA 3F01A 1Q9OA 3T65B 2GEQA 2R27A 2YBRA 5F7HA 2I9TA 4MJ6A 5DMJB 3EZJB 1AQ8A 5H94A 1FWXA 3Q5YA 3AABA 5JIIA 4OCWL 4UM9D 1XGTA 5C0AD 3F7RA 3KPNA 4C8XA 2CGYA 4QXGH 2VMDA 3I9IA 5I5JA 4HX1A 3MLYH 1PBYA 2WBKA 4NDMB 4WWPA 5IHUL 4KDTA 1J1PH 5CHNA 3I6SA 3CE1A 5HHOD 2ICCA 2PP8A 1Q1JL 3L54A 5IJVB 2KLSA 2VYRE 4KMTL 2JK5B 2BPBA 4YHOH 1FYTE 2B3RA 1FFNB 4R8WL 9PCYA 2ZKHH 3QHFH 4LCCB 4PJFF 1DFBL 1QLFB 2D3VA 4W70A 2Y2TA 3IJSA 4OJAA 1IC4H 1QEWA 3SCMB 2C4FU 5F0JB 4DOHE 4OKVB 1HZHH 4IRSC 3HE6C 1EVUA 3CVBA 1M2OA 3D4YA 1G7LA 3PAVA 4UM9A 5C0AA 3NJLA 1EK3A 3RIFF 3RWJB 4G9DB 1A6AA 4XVTH 1T20A 1ZE3C 4P4KD 2E6QA 4OR1A 4KJQC 1NIDA 1R5WB 4FRWA 1YAIA 4B27A 2P44B 2R2CA 2VUKA 4ODXB 2XETA 1R3LA 2ORBH 3T0AA 2GK2A 1T0PB 1KLFA 3HZVA 2D4FA 2BVQA 4ODUA 5HHOA 4F8TA 5FGCE 4ILDA 3HS9A 4QHKJ 1KBWA 3ARYA 5I1IL 4NQSA 5ID0B 5DVNA 1IV8A 3VQ2C 4M7LL 2YPKB 4YHNA 1LE5B 4WW2A 2N7BA 2DAVA 2DQEL 2EH7L 3ATEA 4X99B 3JVFC 5DVLA 1MLBA 4IOIA 4RMBA 2COVD 2F7RA 2ZD0A 3WIHH 4DPAX 4Q2ZB 3N41B 2KHAA 4M6OH 4YSDA 3P4OA 5CSBA 4IDJH 5DJ0B 1ZGLM 4FNPA 3K1KC 3K91A 3RZCC 2AJSH 4P4KA 4HUUB 1TZIA 2WVTA 2BP5M 3RWDB 1A5FL 3ZRSA 2GJRA 4MVBD 3DK2A 3BAJA 5KVMC 1IEAB 4FEMA 1JI2A 1CFSA 5BMFL 4QTHA 1XIWB 1T22A 3MX0A 1UGKA 5D7LD 3MUGB 4JFWA 4J3OD 4XP5H 3T2PA 1ZHBA 4Z7OF 1BV8A 1EO8L 4PGBB 2P8LA 1ZV2A 1FL5A 4LARH 1SFHA 1MFUA 2BOCA 2RCSH 2PKDA 4OD1L 4JHWH 2A6DA 5I16A 1SN5A 2YFNA 5GJTH 3VFGL 3X11A 2YK1H 1LGVA 4R4BA 3DMMB 2G2NA 1ZLVH 4B97A 4EI0A 4Y4HC 2W07B 1DBKH 4GSXA 1MXGA 1KPUA 2NW2A 4JPKL 3U4BH 3FO9B 1JNHA 1MW2A 1SBSL 2UY7B 5GS1A 3KPRD 5TH2A 1ERNA 2VL5A 4NKMB 5E5RB 4NKOA 1X5HA 1W2KT 2JF1A 4FXKB 1AD9B 5D2NA 1EHLL 4JQVC 4Y1TA 1R3JA 1F4WH 3LKOA 4PJDB 5D7LA 4G80B 3EBIA 5J1SC 2H5UA 3VU2A 3F7VB 1I8AA 1M3IA 1TZGL 4FFYH 2UVEA 3ATAA 4H0IA 1U21A 3PDDA 3QYNA 5GIRB 4EKXA 3UOAB 2ZAIA 3KWTA 3WTVA 3OHXB 5E8NA 1M42A 2EIKB 2IALB 4NNPH 4XPTL 1VCBC 5D1ZC 4GG6B 5E8DH 1B9KA 2EIMB 4K07A 2QPFA 2XZCL 1RJYB 5T1KD 3ZE1F 4HPOL 1HE7A 3ZU8A 1A14H 5FF6A 1GR7A 3FTYA 2ZX9A 1DQMH 3CDZB 1TU2B 2DWTA 3P77B 4N2EA 3UG5A 4ZFFB 3HZYA 3KPRA 2XRAL 4G7SB 2WBJB 2XBTA 2QHLA 5I75B 3BQVA 3HTLX 4XVUD 2BRQA 1F4YH 2BC4A 1IC5H 1S7XB 4N9OB 2FX8H 3FRPG 3MUZ1 2HSIA 3FT1A 1E6OH 3HNTH 4H20L 1R0AL 4YLBA 4Y7OC 1ONQA 2VDMB 3PWVB 3TWCH 1VHPA 5DRXB 3MNWB 2N0KA 5C08A 2APTA 4ZFQA 2GUOA 3KWVA 2YA2A 4J12A 1WUNT 2YOCA 1OOWA 1SEBA 4FZEH 2EADA 2ADFL 3PGFH 3NCFB 3TBTA 2EC8A 4W9HC 1ZIAA 2EIJB 3N04A 1CFBA 1H6FA 3PUUA 4ZQKA 3HLKA 5T1KA 4LPCA 2ZPKL 1KB5B 1GSKA 3GSRB 4H88L 1UYWL 1MVFA 1AO7B 3K4AA 3ULUD 2W65B 2WNWA 3AREC 1U3HD 4QYOB 5CKGA 1KELL 4Y16D 5L7XL 3OAUH 4I9XA 3NFNA 2LFGA 5E2WL 2CG9X 5I19H 1I3VA 4HIEA 3S2AA 1JTPA 3E6FA 4BH8A 3D0LA 4Z5RB 1JXGA 3KPSE 4PJ8C 4GYBA 3FT4A 3HMXA 4KRPC 4YBQD 5IBTH 1CGSL 5BJTB 3QORC 5AW4B 3BI9X 1AXIB 1QFUL 4JUSA 4TVPL 4NN6C 5L4MA 4AEHL 2OSYA 1QFHA 2BP8A 4P4RA 4F2ME 1QD0A 4IBSA 5JPMB 5E51A 5G2NA 3QK0A 3P2DA 1CICD 5AYQA 3WAJA 1KJVB 1QBBA 3PV7A 4NIKB 3ZTDC 2V7HA 2H32B 1C8QA 3DX0A 1RK7A 2EEFA 1CU4L 1IIKA 2M1KA 1VACA 4WHCA 4LSTH 1ACXA 5GS0L 5JYMA 1U3HA 3MLXH 4M7ZC 2HLEB 4Y16A 4XZUA 3L5WB 5F3HB 2FJUB 4C56E 4OI8A 4W6XB 1T7WA 5E9AA 4BFGA 1GJIA 2AAAA 3LKSA 4Q7DA 5I15H 2JKRM 4R7VA 3EYOB 1ETJA 3UYPA 4GW5B 3WEAA 1KJ2A 4ZJ9A 2BVTA 5CJOL 2ZIDA 4JM2D 1BA9A 2JQZA 6TAAA 1D2PA 1Z3GL 4X6EA 5E2UL 1ZVYA 2ENSA 3FFDB 1S4IA 4Z7QB 1CICA 4UQ2A 5ANMA 3DTUB 4PJAB 5HHPA 3ECVA 3S3PA 1FVEA 1HYRC 4QGYA 4EEEA 1KMGA 2NLJB 1HEZA 2HRHA 2YOAA 4A7TA 2EXWD 3Q8FA 1KCUH 3W2DL 4MCMA 2X4TB 2R2EA 4GRWF 3FQWA 3CC1A 2VLRB 3A6OA 3FOMA 1FRGH 5IFAL 3STLA 7PAZA 1HWGB 4O5LL 1HL4A 2J12B 3EYSH 4Y8DC 4JM2A 3MRQB 3OHMB 4NRXB 2DWEA 4XB3A 4DVRH 1KTLB 1ZLDA 5IW3A 1CXLA 4N24A 3GMOB 2LVEA 3FCUB 1ES0A 2J1XA 4KVCL 1Q38A 1MNNA 3GIVB 1SY6H 2X4RB 1A02N 4AIZA 1IBYA 1XSKA 4OGQC 4NCC1 1KGIA 1SN0A 1LP9F 1RZKC 1WTGT 2Q76B 2C1OA 3BZEB 4NO0B 4PRHD 4I5BB 2LQRA 4YE4L 3BD4A 3ULVL 2EILB 1HTYA 3MFGB 5KSBE 2VB5A 5IBLD 5BO1L 4EUPB 3D06A 3G5YB 4UM8A 5TDPA 2VDKH 4FQJH 5FB8A 1FE8H 4BCXA 3QO1B 1JG9A 4MX7A 2VNCA 1X3DA 1HSAB 2Y7SA 4G8GE 3L2LA 1BVLB 2NY0D 1EAOA 1RMFH 2QVFB 3HJEA 2JJVA 3IF1A 4PS8A 5EZOH 3RYMA 3X13B 4NPYB 3MBWA 4ZO7A 5GGQL 2NTFA 2O5XL 3RTQC 1Y7VA 3F84A 3QS3A 5ISZD 1JZ5A 1AIZA 2Y7OA 2V5RA 1TQVA 3PXLA 1EZLA 4KBPA 4PRHA 1SUJA 5DMIH 4BSWA 3WNKA 5CIPH 2Z8RA 4OFKA 2XV3A 1SJEB 1QBMH 4P2RE 2HJFA 4A39A 3WE6B 2XWJA 3L08A 5J3HC 3V52H 4HEPA 3N06B 1D6EA 3T0XA 2ROXA 1KYFA 1K5NA 3QUZC 1FA4A 2WSDA 2MTAA 3F12B 2VDNB 3LEVL 1KY6A 2F5AL 4FYTA 1QA9A 2BSED 3AUWB 4RZCB 1Z0NA 3TFKC 5SX4H 5DWPA 2HKFL 2YD9A 4FQCL 1U8NA 1YDPB 4LKCA 4WHTA 5CJQL 3D2UD 2DQCH 4HF5L 2Q5BA 1OP9A 2CWRA 4PY7A 3BOVA 4GG8A 2PYEB 1JD7A 5ISZA 1FZMB 2GHWB 2NY6D 2WJ7A 1MFEL 1MRCL 1CDHA 2EDJA 3ARBB 3JVGC 3QI9B 3EFDL 1RY7B 4EO5A 4M1CD 3ZZLA 4MQSB 3WY1A 3QC6X 2KDGA 4NUPA 3MRKB 5FGBA 1OSZB 4NXSA 4A6YL 2J6EL 3GMMB 1FL3B 1EHNA 1S7VB 1XD1A 1SOXA 2YEVB 3FSVA 4Y5XC 4K94L 5K59F 1GYAA 5ETUA 1QBAA 3ZGHA 4GXFA 4FFWC 5C0ND 4LSVH 3FB6A 1UXMA 2Z91B 2F68X 3EH4B 1RV6X 3MCKB 4ZTOH 5F6HJ 2A0LD 2HT2C 3F7YB 1LWRA 4ZXBD 1RLWA 4FQLL 1R24B 3ZMNA 3LKPB 3D2UA 1IGIL 1LK2B 3S3BB 1KFAH 3UTZA 3QNXA 1EPFA 3MLTA 4A1RA 2WO2B 1EEUA 2ZYIA 1JCKA 3L1OH 5DJYA 1WCBA 3P0VH 3V0WL 5I1DA 3D69A 1AS8A 2E76C 3TJEL 3P9MA 3TTSA 4B9FA 4LP8A 2DJUA 3FNKA 2GTWB 3AQXA 2VT0A 4FTVE 5HI5D 5JORB 4KU1A 2AFNA 3TEYA 3ILQC 1D2OA 3CFQA 1U8OB 3CXDL 2X89D 4FCHA 2P8PA 4MNHB 1D7BA 1WT5C 4LLYA 5A3IC 2AP2A 1JDCA 2SEBA 1KUMA 4JQIA 4X4MA 5DR5L 1VFOA 2P47B 2MCMA 4ZXBA 1QNZH 3V5HA 1AXSB 3NPSB 1S8DB 4X4XA 2Q7AA 4ODSL 4N1CA 3OR7A 1BYPA 1T89C 3O3DA 3NA9L 3QQ3B 3V0FA 5E9DA 2WO4A 3BC9A 4WUUE 4ZI8A 2EYSB 4U33A 5J9PA 2MHAA 2VZUA 5D72H 4TLUA 4FJYA 3QE5A 4FQXD 1NCBL 5ESAB 3CLWA 4XOEA 3KHQA 1Z5LA 4ZPTA 2X89A 3MV7B 3TBSA 2G4EA 4Z6AT 4MS8D 5AUMA 5FFLA 1XSIA 2P49B 1CBVH 1JPST 3ZDXB 5LGJA 2QZ5A 1U9KA 3D51A 3KLAA 5HY9A 3TX4A 3ESOA 3MROA 3I02B 4W68A 4N0YL 3S35L 35C8H 2DLHA 4TLKA 4XVJL 2H3XC 4PV8B 2VXQA 5IIEA 3VXSD 3FUKA 1WD8A 3KYNA 2EDDA 3K2KA 1EHAA 5EH1A 5F9WC 3MOBH 2VW4A 3QWNA 1WZ1H 5CGYD 2VLLB 5DURD 5EO9A 4OGXL 4N2OA 4I0CC 4NUJA 3KCWA 4N5ED 3V7AG 4FQXA 5FA3B 3TFBA 1BVNP 2IWFA 2F74A 4Y2LA 3LCYA 4QO1A 1GY1A 4YHKL 3H6AA 2XFGB 4MHHI 2JKTM 2I07A 5FCUH 1N2RB 1YEWA 3SGKA 4WW2F 1IGCH 1XCXA 2NUPB 1ROWA 3BPLB 4JO1H 5CCHE 1XZ0A 3X1FA 2OXHB 3BCFA 3U1QA 4DN3H 4G6JL 2D7QA 1T0NA 2TSBA 2WVVB 3O0RH 3DO4A 3SPJA 2QFPA 3IAPA 3UDWA 1CT8B 3V9CA 4QRRE 3VXRE 3FB8B 5I18L 3DJRA 3KD4A 1TEGA 2YPVA 2GHZA 2YAMA 3GKWH 4QRQA 4RDQF 3VXSA 4CNIB 4FADA 1UCTA 4N8VB 2L04A 4LPTA 2R23B 4G11A 4RSYA 5T5FA 2AQNA 3KPOA 5AQ0A 1BZDA 2DQIL 3MRPA 2CRYA 5F89B 3FMGL 5HGGS 4OLYH 5CO1A 3SKNB 1F58L 2J1YA 5E0FA 3N9GH 1G7MB 4HBCL 4NI3A 2FO4A 4R26H 3V4UH 4ELMA 5CEZH 1G87A 3GMNB 4IOSD 4XMVA 1HOCB 1L7IH 2BCMA 5ICXB 3AROA 4HUXA 1FGNH 1ETA1 4AVIA 4I88A 4N0CD 3U36A 3LKQB 3C09C 3WI9A 1THAA 4HJUA 3IS1X 3MJ9H 1IC7L 4H26B 1T0MA 1RVFH 1IKNC 2H1XA 3B2PA 4JKPH 4LEBA 4P3CH 3RX7A 3O2VH 3SDAB 1A64A 1NCWH 4JO4H 5T1MA 4BSJA 1GJUA 2J5WA 2I60L 3BN9D 3NABL 4L23A 5IGXL 1KJ2H 1W80A 3SO3C 4J3OF 4W9IC 2NY1D 2R0KL 3IRZA 4M3HA 4WWKB 1AIFB 4M7JL 3R06B 4ONOA 2HTLD 1BQLH 5F21B 1F1GA 3X1NA 1XGRA 1OTSC 4N2GA 1FFOB 2Q3ZA 3DV6A 3HPLB 3FUMA 4IOSA 3VRLE 4EN2A 2VJ0A 3UL4A 3ZYOA 1MFBH 4J4PD 1EZSA 2WQSA 4NWTL 2QADC 3QCTL 1O0VA 5IZ7A 4XPGH 3ZKXB 2IBBA 1CYGA 4HJJL 2CKBL 4N0RA 2UYLA 1YEDB 4NWUH 3NZ8B 4F57L 2X5PA 3D12B 3APMA 2AQRA 4Y2OA 1O7VA 3OZKA 2B1HH 4HXAL 1MEXH 3NESA 4F8LA 2BNQE 1N10A 3S96B 4ZDHB 3X14A 1HCYA 1JGLH 4AKPA 5F96L 3T0DA 3KLKA 5IROD 3MLVH 2VXUL 3O3UN 2OCCB 2AW2A 1U58A 4WEBL 1AD0B 2W60B 3IU4H 2WBXA 1RIVL 1BZQK 3DOHA 4AQAB 4JFXA 1L7TL 1ZA6B 4U1SB 5F72S 3RDTD 1GOHA 4K0OA 5K9OA 3A3YB 5HJ3B 1JD9A 4H25A 4EUPH 1G84A 3TN0C 4PR5A 5JXAH 2BSCA 1KOAA 1OTTC 2EYRA 1UOLA 2L7EA 4OLXL 4F15B 1J7VR 1P7QB 3CX2A 1G6RH 3SPHA 4IBWA 3UFIA 1UC6A 4Q9QH 2QFRA 2NNAA 5IROA 1IKFH 5FYKL 1RD6A 4XOCA 1S3KH 2EDMA 1TZ8A 3BFOA 4OZGB 1HNYA 1QW8A 3Q8EA 3VW3L 4GSDL 1PSKL 5CZXC 5DCCA 3HG3A 2PR9A 3MVSA 3FQYA 3Q01A 3RDTA 4OJFH 3REVB 2J71A 1D5MA 1WAPA 1ET5A 1TEFA 1XGQA 4LMQE 5CEYA 1X9UA 3ULUF 3S5YA 1J5CA 3I3EA 1H3PH 3DRTA 5DT1L 4P3DA 5TF0A 2BLFA 3ZT7A 3PP3H 3QUXD 4MDJB 1HHHA 4B9YA 2HRLA 4WJKB 3WFHA 1S9YA 2V7NA 3K8KA 1BEXA 5L9DH 3U2HA 4YSUA 2X7LA 5EOCH 2NNFA 3FTWA 2ENJA 1BPVA 4GMTH 4W9GC 1KIPB 1KIRA 4N0UB 1DYZA 3L81A 3O8XC 43C9B 5I0YA 4PJHB 4AT6A 1FVDA 2WXQA 3GDCA 4BV1A 3IDJA 2QMJA 4MDIA 4DAGL 4DERA 3VD9A 1C5CL 2JLPA 4DTGL 3WOVA 1D7FA 2YGOA 4NN5B 3KH4A 3X12B 2OSXA 1HILA 3QUXA 5LBSL 5BVJB 1NCAH 5C1MB 1N9PA 2ZCHL 2UZYA 4X6FA 1H5BA 1WC7B 4OZIA 2AK4B 4D0BB 3QB7C 5KANG 2ZXAA 1KPVA 1KG0A 3U30B 3Q9QA 2BY3A 4JM2F 3VFOB 1IGTA 3VRJA 1I8KB 3U1SL 4QXTB 4LLWB 1RL1A 5TGBA 3TCLB 3VD0A 3S3DB 2F53D 1AKJA 2IPKB 5KYUB 3L4ZA 1CXFA 1TZHA 4XP1H 4KZDL 5I30L 3FYEB 3PNWA 3MNVA 4H40A 5E99H 4Y4FD 1HKLH 1UJ3B 2IWKA 1FAKT 3WGVB 4QRSA 1JK9A 2WZAA 3T8VA 1U93A 5T33L 3LS5L 3I9GH 4NZTL 4NZ8A 4F9LC 5CZKA 3ZDZB 1R75A 4UIMA 5IHBA 5JMOC 4TUKL 3BHBB 4PJGA 3PG2A 4ANVA 1QSFE 1XSJA 3JTTB 5KVGL 5KSAA 1WFNA 1I3GL 5J1AB 2ICEA 2B1OA 2H6PB 4QXVA 1C16B 4UAHA 2VISB 2X6UA 3P0YH 3VGHA 2F53A 4OKDA 4K5NA 4U1MB 3T6VA 1KDIA 3GHEL 3DPBB 5C6TL 2A6IA 1IM9B 5DQJB 5AKRA 2FZ3B 3MLZL 4F2FA 5KSUB 1E5CA 2WN3A 3O2DL 4L4VB 1J48A 4HIJB 4Y4FA 1DJYA 1FH5H 4WV1B 4ZUTB 4CBPA 4O9HH 2WWMD 4X0KB 4XNQB 3T77B 4L29B 1NCUA 5DI8B 5FOBB 4LDLB 5GSRB 4RFNC 4AQEA 5J57B 5JW5A 3EW3B 4YBLB 5HHMD 2DJ4A 3EOAA 4YPGB 3APNA 1TSRA 1XR9B 4EN3D 2CO6B 3C5ZC 3MRRA 3ZBMA 4PRIB 4AYEC 2HFGL 1HH9B 1N4XL 1CXKA 4WCYL 4HU2A 5A16A 2XWDA 2CJ3A 4XPFL 2X12A 4E9TA 4UOW1 4JFFD 3FRUB 2EC9U 1LLAA 4J6IA 5JW4Q 2R8SL 4HJGB 4HWEL 3WO3B 4AW4A 4UUJA 4QHLB 2MQ0A 5JHDE 3STZA 4ANUA 4UBDC 2VXQH 2IV9A 1ADQL 2W95A 3QP3A 4AEFA 5E8OB 5GRZA 3LNGA 3WTSA 4FJZA 1J0YA 1TTBA 4IHBA 2VMEA 5HGBA 3T1FA 1YYCA 2YGPA 2GTZA 4EN3A 2BIOA 3W82A 2G60L 5GRVL 1DP0A 2FUTA 1PQZA 1J5HA 5DLMH 3TPUB 3OXRB 1UA3A 2FX7H 4LB8A 1T03H 3CDYA 3OMAB 1FSKC 3E38A 3SQOH 3D50A 4PWEA 1N0XH 1KYOK 2VW7A 5KYWB 3S8GB 4NKDA 2BNRE 4JFFA 1TQBB 3MGTA 4PJ5A 5SX5H 4P46B 1YMHB 5IREA 1B4RA 1JF1B 5B1KA 4IJ3B 3BWUF 1O5PA 4JFHE 2IGFH 4PLKD 4BKLB 5I8KH 1FAIH 2EXYD 3WFDH 2FE0A 3EHBD 4DCQA 4JPVH 3F7KA 2XUWA 4I0KA 4ZUVB 3FBQA 3R0MA 4BZ2L 3CVHL 4NQCE 5TDNA 2PCPA 2HKHL 4RMUA 1JV5A 1SHSA 4Y88A 1PZDA 1YCSA 1UWXH 2VSCA 2PN5A 2MOGA 3PXHA 3ROOA 1DANT 2YKKA 4KQ3H 4W9DC 2NSXA 4Y2DC 3GT6A 1INQB 3L1FA 4PTTA 1ZT4B 1XEUA 1MCLA 4AQZA 3DHUA 5KS9A 3RGVC 3W0WD 4HVBA 1CVRA 4FL4C 1LO4L 2WQXA 1E40A 2Y06L 3CH8A 3C08L 5C09D 1AE6L 1NDGB 3BVNB 1T5XA 4M5YL 2Y07L 2WTRA 4TV3A 3ES6B 1QHOA 1PYWA 4TNWK 5I1EL 3HAEA 4M7KH 1GHFH 3BPOC 4L4TD 2FWSA 4X6DA 3U9UA 3UZQA 5H37A 2BWIA 5C07D 1QI4A 2QSQA 2JXMB 3K7UA 2BSDA 5DZ9A 3TNMA 3US9A 5JPMC 1VADB 1E4WL 5CP3H 2QSCH 3BT2L 3EJRA 5DA0B 5I17A 2BNUA 3W0WA 3GNMH 4HWUA 1FIGH 4JGUA 3CJJA 2VXSH 2VAAA 4HS6A 2FD6L 4U1NA 1OKEA 3SOTA 4KVPA 5C09A 4LEOB 1NC2B 5HPMA 2G0LA 3ALPA 2YGNA 1BFVH 1WG3A 3DOSB 5J06A 1P69B 4WEEA 4GP5B 2GBTA 3SBPA 5JOFA 4G7VL 1R4XA 1J8RA 4TSBH 4L4TA 1TETH 3MV8D 4CBZA 2Y2WA 5C07A 1WA2X 4JY5H 4WU7B 4HJIA 5IR1B 4OZ4B 4OIFA 3LJ3A 4FKEA 3MJ6A 3HR6A 4LVNC 2UXFA 2PPAA 4NT6A 2RAMA 1PFCA 4GI9A 1TCMA 1KXVC 1U91A 2J55A 3EJQA 3O6ML 2N7SA 1XO8A 4EQ3A 5CCKH 1YQVL 1OEZW 4OAWB 4ZUSA 3ME0A 3CUPB 4LLMA 5HPOA 5E6IB 4KY1H 2H26A 3HUJE 1BM7A 2GJ6D 3PDOB 1U8JA 3AITA 5KBLA 2LW3A 1ZVSB 2HJLA 4X5PA 1KJ3L 3QUHA 4GBXD 3TBYA 3FF8A 4FNLH 1JGDB 2KPWA 3ZK0A 1T80A 3EH2A 3C6LB 4YFLI 5E08L 2I5YH 3BLPX 2JJWA 3JSSA 4FYQA 3VFNB 1ZDQA 3MV8A 4XCYB 1T66D 3ZE1B 3NCJL 1D6VH 3ZY7A 2RFXA 3MA7A 4ELMF 2F1BA 4APXB 4K3HA 4OM1H 5E6YA 2VJ8A 5IESL 3GIZL 3QDMB 1N6QH 5LDUA 1ZVNA 2E9WA 4R90L 5IOPA 4WDIB 3PL6B 5AKSA 1I9JL 1YYLH 3FO1A 5KTEL 1G7QA 1QNIA 3TO2B 2UWEA 3ARDC 2IANB 3O9WC 3RP1A 4BK8A 1A3RL 2GJ6A 2WMPA 4PJ9B 3TLRA 5EWIL 2AS5M 1FYTD 2XN9B 4N8VG 4GBXA 4L9LC 2X6AA 3HBZA 2KH2B 1MDAA 4APQB 1S5HB 4YO0B 4MCZB 3CBJB 3BQUB 1HXMB 1A7OH 2F1EA 4PGCA 4TQHA 5IMLA 4YVNA 1SF5A 2OCFD 4F7PB 2FIRT 3UBXB 2HT3D 4C4BA 1CFQB 4HKJB 1NFKA 5MHSD 1MJJB 1DUZA 4I4WA 5EIIB 5EHFA 4AV5A 1DSYA 3ISYA 3O4OB 4ZODA 4G6FB 2CDFB 4MAYC 2Z7ZA 1UXWA 4O2CB 1CDBA 2ZT9C 3PABA 5E4OA 5C0FA 3FCSB 3KZ8A 1G94A 4ZK8A 1P7HL 1KB3A 2XV6B 4NZRH 4PRNB 2ERJB 5EBWA 4HGMA 5IF0A 2YSSB 5IB2B 1FYTA 4BQCA 2WVSA 3VFVB 1BBJB 1BCIA 2HG0A 3K1DA 4IJTA 1WWBX 1M7IB 1X5MA 4ICXA 3BP5B 1EZVY 1OAKL 3BEWB 1NC4D 3CZJA 3RVWC 5DFVD 3SDCB 2CUIA 4PRPE 2MJWA 3GEWB 2X2JA 5DSCA 5IQ7H 1ZHLA 4JM4L 5CSGA 1G9NL 1B0WA 2JJTA 4ALAC 1PD6A 5D2LE 1YUHB 3WIFB 1JWMA 3FO0L 3NG5A 3DBSA 1PKOA 2FEDC 4BZ1A 2PCFB 4ACTA 3AXLB 3D48R 2WUBL 1N8ZA 1YEJL 4JUTA 3WEXA 1NCDH 3V9FA 4C57C 1MAMH 4ANXA 2B14A 4AZ8A 4L2LA 3BKJH 4ISVA 4N2IA 3QRFM 1SVZA 3DXAB 3QIWC 1S46A 4G7RB 3SY0A 3B7YA 3VGAC 4WHYH 1QRNE 4BGLA 4JJ5B 3SKJH 3GSUB 1NC4A 3IDXH 1KACB 1AGCA 2EINB 2CO7B 2ICWJ 2ZUUA 2AABL 2PPCA 4GLRH 1QR1B 1FH2A 1RSFA 4OY9A 2G2RA 1E4XI 1MHEA 5AL0A 2ZWSA 4U1JA 5MI0C 1NIFA 4XO4A 5CD3B 3K46A 1PZ5B 2VN5A 4G8EA 1OVZA 2ZUQB 4KNUA 1MIEH 4DKAA 1MRDH 2EDEA 1RXLA 4GRWB 4DW2L 3QXWA 4Y5YA 3BE1H 4KC3B 3LXBA 2V2WB 4O58H 4GW4A 1OZUA 5AZ2L 1YNKH 3HCVB 1AGDB 3BAYA 1LMKA 3T2OA 2YD2A 5K39A 1AO7E 1PDKA 4X8JA 3ENEA 2IADB 4XCFH 4FQIH 3CN3A 1N6UA 5CSZB 1MCKA 2WNXA 3R7QA 1RZJC 1AZVA 4OLZL 2YXFA 4BUHA 4RSVA 1OALA 1I7RA 4NHCH 2K4WA 5DS8B 2OL3L 2BIIA 4NO5A 4FG6D 2AAVA 2OXGA 5JIDA 3ATDA 3VWKB 1TFPA 1P4BH 5D96B 5KVFL 4NENA 2BIHA 3LZQA 1NJ9B 2NX5E 3EJTA 3SDYH 1ORQA 3HBPA 4I2XE 4RAUB 3IJ9A 1LP9B 4DKFH 4EIBA 3EJUA 3NDZE 5TTRA 3HMWH 2XOTA 4U2YA 1DBMH 3UPRB 3LIZL 2GY7B 1GL4B 3MRMA 2GK0A 3I6LE 2R1XB 1QO3A 4PHXA 5EUOE 2YUXA 4QLRA 2XFXB 1TQCC 2XN0A 3V6ZA 4PJXF 4OZIF 1U3JA 2ZUVA 3HE7C 2BFVH 5I6KA 2XA8L 1P4LB 3KYKH 4NJ9L 2F1AA 3ERXA 2AV1B 4L8DB 3SQBB 3UERA 5J13C 1MAKA 1Z3RA 2VR6A 4P5KB 4OB5H 3DI3B 3N44F 3IVKA 4Z3IA 1UWGL 4RMVA 1SHXA 2WUCH 1I8MA 3OL2A 3E3QC 4Y5VB 5AVQB 2E27L 5KVDL 2FR4A 5D4JA 2G3XA 5EA0L 3X3FH 1G5AA 3P2TA 4HLJA 1IE4A 3LKNA 1NGYB 3KPSD 3MRCB 5IVXE 1H15B 2ZX5A 3MXWH 1IX2A 3WN5B 3PP4H 5CBAA 1T4KA 1D5IH 1CS6A 1QUNB 1XR8B 3BCDA 3ARVA 4P23D 1KF9B 4PJGF 3LD8C 5T3ZH 1KIUA 2AK1L 4ZS6C 1CBJA 5GHWL 2YC1A 3K6SB 3QUML 2D03H 1HWWA 1N26A 2GW5A 1ZTXL 2A4ZA 1MREH 3VXOA 3GTTA 1V3MA 3I75A 1EJ8A 3MJWA 3EG9A 5BW7C 4HHGA 3M45A 3H3PH 3ZDYB 5KEZA 2F61A 4PJ7E 2MNUA 3KE0A 4QR7A 3SE9H 4AENA 2H4EA 3G5VA 4LLVB 4GRMA 2O30A 3KPSA 2KMWA 3HFMH 4KGJA 5E2VL 1PIFA 4F7TA 2WBWB 1ACYL 1H8NA 1YC7A 4AZUA 4AMKL 3BMVA 5I1KL 2AEIT 2NQCA 3CZFA 3L3GB 2DIBA 4F2MA 4DETA 3B2VL 4P23A 2EZ0C 1BZEA 1HESA 4QRFA 4OCWH 4ZUWA 1KPRB 2FJSA 4KTDL 3QWOB 5M94B 2F54B 2HYMA 3L3OA 3AM8C 3QR0A 4PJIE 5I73C 2CBTA 2WINA 4AYMC 5J0BA 5IHUH 3HG1E 5LAXA 3F05A 1UUSA 4N5UA 2JI2A 2GG1A 2CDEA 1NOLA 4KJQD 5F7UA 3F58L 2EE6A 3T4AC 4F58L 4KMTH 2BY0A 4WNSA 4ELKB 4LBAA 4JFPB 4MA3B 4KZEL 4R8WH 2PNDA 1J8HE 3SDAC 4W1TA 5E6ZA 3WFBH 1DFBH 5HI4C 2J1WA 2AQTA 4BFNA 1LEKA 4UU9B 4KXAA 4LLDB 3WAKA 1NPJA 1UZ6F 1H8OA 2P42B 2WLLB 4O51B 4ZOAA 2VMCA 2HFTA 1Q9OB 1UM6L 4JY4A 2YBRB 3CV5A 1ECZA 3BISA 2APFA 2N0MA 4MJ6B 2I9TB 1BXXA 5H94B 5SX5K 2X87A 3QUYC 4WHDA 1XGTB 1Q72H 4DO5A 1MWAA 3KPNB 4ENEC 1VPOL 1FO0A 1N12A 4JS7A 5AOKA 2ZUSA 4HX1B 2KUTA 2KYIA 3IEAA 5B1JC 2CGZA 3RZCD 4HJSA 2FB4L 1SVBA 4M8VA 4A6YA 3WU1A 5E1QA 5I1IH 1UQSA 3VXUD 1PLGL 4H8WL 4NXKA 2DQEH 1TVDA 2EH7H 3FF7A 1E5UI 1G9HA 5HYJE 2WAHA 2XLLA 5LAPA 3WLBA 1H9DA 3TC9A 1YNTB 2FSDA 4E9RA 3Q2LA 4U6HB 3IJSB 3P3UA 1QEWB 4TUJB 1XGZA 5BV7C 1CGUA 2XZAL 5JDJA 4M02A 1FNFA 2DEWX 1Y6KR 1X5AA 3MYJB 1G7LB 1EERB 3KCPA 4Y4HD 4UM9B 1JYWA 5EEXA 3VD5A 1A6AB 2CBQA 5KS9F 1T20B 5BMFH 1DBBL 1RUPL 3RZCA 3L5XL 1EO8H 1P6AB 2WXNA 5E1HB 1KLFB 1WIUA 2BVQB 4OD1H 3VXUA 3R1GL 4HEME 4XP4L 5HHOB 5KSBA 1RULL 3RU8L 2Y3AA 1NKGA 2OYLA 3VFGH 1DQTA 3CIQA 4LCWE 5IVZB 4MJ4A 1TJXA 2H6UA 1WZAA 4WW2B 2DF3A 4JPKH 1X4YA 1SBSH 4X6DF 1MLBB 4IOIB 1ADWA 3ABMB 4WWID 4A37A 4LEXL