2I69A

Crystal structure of the west nile virus envelope glycoprotein
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
403
structure length
403
Chain Sequence
b'FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLAEVRSYCYLATVSDLSTKAACPTMGEAHNDKRADPAFVCRQGVVDRGWGNGCGLFGKGSIDTCAKFACSTKAIGRTILKENIKYEVAIFVHGPTTVESHGNYSTQVGATQAGRFSITPAAPSYTLKLGEYGEVTVDCEPRSGIDTNAYYVMTVGTKTFLVHREWFMDLNLPWSSAGSTVWRNRETLMEFEEPHATKQSVIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
molecule tags Viral protein
source organism West nile virus
publication title Crystal structure of west nile virus envelope glycoprotein reveals viral surface epitopes.
pubmed doi rcsb
total genus 72
structure length 403
sequence length 403
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2i69A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 2i69A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 2i69A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 2i69A03
4GT0A 1OK8A 2P5PA 1Z66A 2R69A 4UT6A 5LBVA 3WE1A 4AL8C 4BZ2A 4FG0A 5GZOA 5KVDE 3MUUA 4FFYA 4FFZA 2HG0A 3UYPB 4BZ1A 1TG8A 5AAMC 1RERA 1OKEA 2I69A 3N41F 3P54A 4ALAC 1S6NA 5H37A 3UZQB 3N44F 1PJWA 5KVFE 1Z3RA 3G7TA 5LCVA 5IZ7A 4UTAA 3N40F 2ALAA 3IRCA 2V33A 1URZA 1OANA 2H0PA 4UT9A 5JHLA 5IREA 5KVEE 4UTCA 1ZTXE 5GZNA 3I50E 1SVBA 3N42F 3VTTA 3UZEC 3C6EA 4GSXA 4L5FE 3UAJA 2R29A 4AM0Q 3C5XA 4X42A 4UTBA 5JHMA 3UZVA 2JV6A 2JQMA 5B1CA 5AAWC 2GG1A 2JSFA 3J27A 3J2PA 5KVGE 5LBSA 3UC0A 1UZGA 3N43F
chains in the Genus database with same CATH superfamily
5E1IA 2ZCKH 1NFDF 1ND0A 4OBSA 2IG2L 4P59L 3HN8A 2WXNA 4IBQA 1IC7H 1E2WA 4IRJB 3GIVA 5FW6A 1GMEA 3RX5A 5GGVY 2VQ1B 3FTGA 1NTDA 2GT9A 2C34A 3BX7C 1ETB1 5DDHA 4KVPA 3BWAA 3M07A 1OF2A 1X7SA 2G5RA 2KC0A 3M86A 4PJBE 4UZUA 3BPCB 3CU1A 1UADC 5E03A 1L0YA 2ARJA 3GM0A 2VDMH 2ZSWA 1CIUA 2J8UA 3GSVB 2BC4A 1X4YA 3PHOB 4XMTA 2XXCB 3PP4H 3QQNA 4Q9BA 2BIIA 1GGIH 5HYQA 4HOWA 3CFUA 3NIFB 2WLJA 2Z35A 2Q20A 4FG2A 3EDDA 3NIGB 5IHUL 2EJ1A 2KHAA 4JG5A 4UCFA 2EIDA 1XZWA 1MY5A 4QHUB 5GSRB 4V33A 4HIIB 4FQCH 4JLRB 1AO7E 2DTMH 1DSFH 4CVWA 4L5FL 5EU6D 4YSUA 1N18A 4RAVA 4PRIE 1Y0LA 4CMMB 1ZA3A 2JKWA 4HG4K 3BW9B 3DSFH 1U93B 3FSOA 4G7QB 4DQOL 1L5GB 3AABA 4J8RB 1AC6A 3CBRA 5ISZB 5AEAA 4M29A 3UMNA 4HWZB 4PJXB 5AOZA 4Y2NA 3L4ZA 3T6XA 2EUWA 4ELMB 5IG7A 2AEPH 2OSWA 4LOFA 4JN2B 5C0FB 4QUOA 4APQD 3H7LA 1OP9A 2CGZA 3FCTB 4X4KA 3V4PH 4X7FC 1ETZB 2VTFA 1G9NC 2DWEA 1TZHB 2K78A 4XAWH 2ED6A 1B4JH 3GM8A 4Z3JA 4X5RA 1FNAA 3ULUE 1IEAA 3HRZB 1T1YB 3CV5A 4Z95L 1FV1A 4HGMA 1ETJA 4DHLA 3LKSA 4QTFA 5MI0B 3FT4B 3KYAA 2CZNA 5AAMA 4ZXBD 2KKQA 1ZA6B 3UEZA 3BN9C 4GB9A 4RWYL 3ZDWA 2BVUA 2VLKD 3DMMB 3JUYA 3G6JE 3ZDYF 3TIEA 3L8QA 4FQXD 5SWQA 4X7SL 5IF0B 3KCPB 3MZGB 3PY9A 1SM3L 1T66D 2VXVH 4UQ3B 1IGMH 2NY0B 3LOWA 3X3FL 2ITFA 2VDNL 4KUCD 1EO7A 3QQ9D 5DUPH 4GW1A 5E8NB 1EAPA 1EGJA 5E6RB 5E6IB 1S7WA 4NKDA 1B88A 5EUOE 2EDEA 3O6KH 3WY2A 4UT6A 4R7VA 1KIRA 1A65A 3SQBB 4JMXA 3ZKQD 4ZYKA 1UD4A 3FHQA 1D9KC 3IJSA 1MOEA 2AV7A 1JCKA 4PJ9B 2XRAH 5FCSH 5IB3A 3MUJA 2EECA 5CNHA 2APTA 1KLGA 3HR5B 4NZTH 2YQ3A 2CA4A 1R3JB 3HG1D 1GGBL 1SVBA 3RWJB 4G7VL 3IGKA 4QRFA 1HHKB 2ZAGA 3AY4A 4AV0A 1NBZB 5JW3L 1YEHH 2WMPB 3LEVH 1XGTB 2JLPA 2F5BH 1XF3B 3GF8A 4LCCA 4RRPA 3DI3B 4K71B 5FYKU 2WPGA 4XOAA 1MFDL 2YPLB 5TDNB 3IAGC 3SCMB 4ERSL 4HIHB 4HP5A 1GGCL 2G9KA 4NZUL 4GBXC 3SDAA 5IBLD 3X12A 2E6QA 1GR7A 1AKJB 2ZOUA 3CSYB 4JPIB 2H3XC 4HBCH 1J1XL 2ZYSA 4RGOH 5BJTB 1XF5B 5I6MA 1L5GA 1E67A 5DJ2A 1IAIM 4ZW3A 3P4NA 3RX8A 2WINA 2BLFA 4MA3B 1UM4H 3G5YA 3MBWA 1CDGA 4XNYL 4EUPA 5HHOE 1OM3H 1S7WB 4QWWD 1AKJA 3PQYD 1SHMA 2G2NA 1Y07A 5FHAH 3TEXA 3Q8EA 1TZGL 1YMMB 5HXMA 5HGDA 2EKSA 4G6AC 2LW5A 1D5BB 2AK4A 4OV6F 4BKLB 3WSQH 1RKRA 5LG6A 5LN8A 1AIFB 4U1KA 4PJAF 4C54A 2J6WA 4JFED 1MCLA 2Q3XA 3AREB 1T0OA 3JV5A 4AXWA 1AIZA 4DOHE 4PI0A 3HBPA 3FSAA 1KBVA 4M43H 1JYNA 1ZIAA 3Q3GB 4WWPA 3ARBA 5FYJL 2VRKA 5CWSA 3WD5L 3GYRA 3BAYA 4M56A 3WNLA 3P0GB 4DH2A 3E0GA 2VERA 2J5LB 1GS8A 2ZJSH 1LEGA 4HCGA 1U8NA 1WWWX 2BW4A 4OCWL 1OSZB 1WD8A 1ZV9A 3FTGB 1GA2A 4LSQL 3RVXD 2XZAH 3SE6A 2VOTA 3OAZH 5JQ6H 3MBXH 1BM7A 4M8QA 4X6DF 3MXVL 4KNUA 1CLCA 4DGUA 3UG4A 3SO3B 1GYCA 1TENA 1AXTL 1CR9L 5DMKA 3K46A 4DEUA 3TPUA 3WD5H 4U1MA 1T5XB 3VXSE 4XXDA 4FFWC 4DNLA 1RY7B 4LQFL 3QDGA 3RJDA 3ILEA 3QJXA 1KXTB 5F96H 2NSQA 3HZMB 1KTRL 4KK6C 3K71A 1FRGL 5D7HA 5ANMA 3ATEA 1FO0B 3O6FD 4WI8A 4HSAC 2Z7UA 3DXAB 1G5GA 1UB6B 4H2CA 2VN6A 4IRZH 5BZDB 2ROXA 2IQ9H 4LLUA 3Q13A 1EPFA 4B97A 1LILA 2WAQA 1EO5A 2ICEA 5FHAL 2A77H 1GVIA 2ADFH 2IFGA 5TQ0H 4YDIL 1QZNA 3NJHA 1ADWA 4DGIL 1CE6A 2DBLL 1IQDB 5DMGD 2P24B 2E5EA 2F53B 2WJ7A 5EZJB 3UC0A 5GGUA 2RALA 1SJMA 2Y36H 3Q6GL 2D31B 1V3KA 1WS8A 2CRZA 2HT3C 2UXGA 3BPCA 4IU3B 4JQXA 2AQ2A 5L88H 1A14H 4TXVB 1VERA 3W3BA 1S7XB 3ZE2F 3BZ5A 4PBXA 1AO7B 3D3VB 4NQSA 5E51A 4KKLC 2C1OB 4NUGL 3ZR6A 3L08A 3QXAA 1QG3A 2XNAB 2XU9A 5D1QA 2X6UA 2GUOB 3E8UL 4MS8C 3VWKA 5DUMH 5JHDE 3ABLB 2FBOJ 1EHNA 3SKOB 1IZKA 5AKRA 2C5DC 3EOTL 1XIWA 1XCQA 1WS7A 2P8MA 2F54A 1X6NA 4EIUA 5E7FA 3T1FA 3UC0L 5I66A 1M1XB 2P5EE 5IW6A 4AMKL 1RZ7H 4JQIL 5JXAH 3IPEA 5DA4A 5CKAA 3RFRA 2HFEB 2J88H 3T8VA 5BOPA 2BCKB 1SQ2N 1TTAA 2GY7B 1DVFC 3MMEA 3PDOA 3QPXL 1JXFA 1QLEB 1S7VB 4JFOA 1N3NA 1DQJA 3C8DA 5E2VL 3SKNB 3S97C 1CZ8L 2Q2LA 3FB8B 4DKTA 1EZLA 1TFHA 1BX2A 1UHVA 3H9SD 3HLAA 3MUGB 5CZXD 3TWCL 3V4VH 2J88L 4DP0X 4L1SA 4O2EB 4XNBA 3ULVE 1U2HA 1OE2A 1AD0B 1LD9B 1RZ7L 5D72L 3SE4A 2ZCLL 4HIXH 1Z9MA 4L48A 1FNHA 1NFIA 5HYSB 5H8DA 2Y2TA 4V2CB 1AJ7L 2CLVA 4HJJH 4KROB 4P06A 5TJWK 4PGEA 5GGTH 5LDSA 4ANKA 2W92A 4RWYH 3F5WB 4B9CA 1RZJH 2NY7H 4KY1L 3LHAA 3ATDA 3AADB 1F41A 5C9JA 3GXFA 5MEPA 3ZU8A 2E0PA 5ITFA 1Z0NA 4EIBA 1AZZC 2DLIA 5IEHA 1L9TA 2V7NB 3FB6A 4IGBD 3MGTB 2RCSH 4C47A 5MERA 2ESVE 4WUUA 4G1MB 4UBDD 4RMSA 3GMLA 1QI4A 3D0LB 4F8LA 1TXKA 4K7FB 2BVOA 3EGSA 3L2MA 3UTZB 1RUQH 3IT8D 5BXFA 4TQIA 2RB8A 1M53A 1G87A 1I85C 4PB0H 3LKQB 3L1FA 4PR5B 4ZUVA 3KYNB 2VLJA 4OZFG 4ZOEA 4CC1A 2NXYC 1I1RA 1RVFL 1C1EL 1NC4D 2VQTA 4DPRA 3ZDZF 4IYKA 2CALA 1J12A 1FL5B 1C16B 4FNUA 5B38G 1A6UH 2WK2A 3ZDXB 1JPST 2YPKB 4FP8L 2J6EA 5BVPL 2F54D 1KIUA 5EOQL 5F1NB 1QNZH 3B2PA 3C5ZB 5LWYL 4KOCA 4WJ5A 2ZUVA 2Y5TB 4FTVE 3ALPA 5BNXD 3BIKA 4E0RB 1XGPB 4AE1A 1FL5A 5BV7C 1FI8C 3SPHA 4PLNC 1Z5LB 4IDLA 5IMKA 3QC5X 2DI7A 3BP7A 2VYRE 1HHHA 1ZWIB 1JPSL 2N56A 1AG0A 2YLHA 4JHWL 2QSQA 4H4NA 3K0YA 4NQDD 1C5BH 1T4WA 2OSXA 4O51B 4S0HA 5K9JL 3APMA 3SGDI 1WLHA 1OK8A 4J3WA 1E30A 2ZX8A 4ABWA 4BFGA 1Z9LA 5EHFA 4ZFGH 3DJZA 3FO2A 3MGTA 4XPHL 5MERB 1A8ZA 3CXHJ 4HJGA 2OR9H 1CDIA 2VLKA 4PBDA 5B7EA 4KI5C 5DD6B 4JDZA 4LGPB 1R24A 4Z7VB 1KDIA 2F1EA 1H3VA 1MUJB 5JOPD 2GK2A 3MNZB 3QRBA 3VYNA 5GRUH 3HUJF 3TYFA 3D30A 3BYTA 5HYSA 3BKCH 4HFWA 3QJRB 5E8OA 4BFEA 3TLRA 4Y19E 3UYOD 4HIPA 2JB6A 2UZPA 4Y16D 5F93C 3TVMA 2O5ZL 4TQHA 3QR0A 3Q8BA 4ODWB 4OD3L 4TQ8A 4N2AA 1G7IA 1MI5E 3TA3C 2OP4H 3FO9B 3FH7A 3S8FB 1UYWL 4GO6B 2CLZA 3WXWH 4D0DB 1HL9A 5DLLA 3WXVL 3AQZA 2ZXGA 2CKBA 3FCSA 5EU7E 2YUVA 3S3DB 3ARDB 4FDWA 5HHME 4MB3A 2VB5A 3ULVF 1WV7T 3FBQA 1SYVB 3LS4H 1CD1B 3HNVL 1EHXA 4ZMWA 1IQWL 3X1EA 2HMID 4U0QB 5H35B 4NRZB 1WIPA 1RSYA 2IMNA 4JO4H 3GO1L 4UDTA 3U83A 2P43B 5E8EA 3FQTB 4JKPH 3QSKB 4N1CA 4NO5B 4DUXA 3R7QA 5IVZB 5KUKA 5DTFB 3TS8A 5CN2A 4KI5E 4KFZC 1VGKA 1R3HB 1ZT7A 2QR0B 1CUOA 3CVCA 3GXNA 2CCLA 4L29B 4Z7WA 1V05A 4A7GF 4QRSB 1OLLA 2AAVA 5B38B 5DRXB 3KLDA 1MRDL 4U7SA 4RFNB 3RWFB 4KKRA 3FT1A 1TNMA 4Z3FA 4KDWA 2H6OA 1AZVA 3H6JA 3VXNA 5KBLA 5F7KC 1CE6B 2BDNH 2FJHB 3N41F 4AM0B 3RGVC 2WXKA 4PB9L 3VRLE 4GXUN 2FLRT 2XWBB 5E1AB 1LTXA 5KSBB 4BRVA 1SJEB 2DYSB 1MFEH 1INQA 1NBYB 3CWGA 4P5MB 5DHVH 1JPTH 43C9A 2CH8A 2DAVA 3GRWL 4H0IA 1AGDA 2YZ8A 5C86A 5F71A 2V3DA 1I4FB 1MEXH 3OGCB 3NCXA 4WIQA 2R4SH 4Q4EA 5C09B 4QKXB 5MENA 1A3LL 1SY6H 4HT1H 3MBEC 4OFYA 3T71A 5E4EB 4ICWA 1JL8A 3ULVD 1C12A 4E41E 5K1VA 3OSKA 4AZ8A 1XR9B 4IRSA 4KU1A 5FX3A 4P46B 4IOFD 1MCIA 3WSQL 1OAJA 4H40A 3TV3L 4E42A 1JV5A 5DMIL 5IEKA 3QRFM 4CAGA 1F4HA 1IFGA 5GGVL 5CO1A 4LBEA 1DQIA 1NKRA 4BFKA 1FGNL 5CILH 4K3HA 1FE8H 1U8OB 1F1AA 3HG5A 2HTLC 4FNSA 4O02L 3ZKND 5HYIA 4JVUA 1W0VA 1DVXA 3IVKA 4BEIA 2H41A 3ILQC 1P84K 5KSAB 4IHOA 1IEHA 4HUXB 1J1XH 3EH5B 3T2OA 2ZWSA 2WNGA 2EE0A 3H2PA 4ZMVA 4TSAH 3TOPA 5T3ZE 3KEDA 5JA8B 2GSGB 3KXFB 3RU8H 3BP5A 5EEUA 4Q6IC 2VR4A 1D6EB 3UJIL 2ZXCA 4F7CA 5C0EB 4P5KA 2CO4A 4ZXBA 3IFPB 4R4BA 4NOBA 4B3EA 4HSQA 1CXIA 4B7IA 3QYCA 2HPOA 5KW9H 3GK8H 4RISH 2R29H 1QD0A 3QO0B 3S88L 1BMGA 3KYMA 3F64A 4LKXB 2OFQA 5DZVA 3VMPA 1PCSA 2M8XA 2YA2A 5CSBA 5FDWB 3P3TA 5DJ2B 3BD3A 4I13B 1AGFB 4GMTH 4J3VA 3V0VA 4OT1H 5GS0D 4G5ZL 4FULA 3ARFD 3ZYZA 1RURH 3P4MB 3MLZL 1ASOA 3SDCB 1JNHA 5T1DH 3ECBA 4IEFA 2CNZA 2HVKA 3OF6D 1XAUA 1IVTA 1M3JA 2VN4A 3FQRA 4FEIA 2OMUB 1ZT4A 4PP1D 2X9WA 2HLAB 3L3OC 4A37A 2P5WE 4UQ2A 3UADA 2VDNH 4W70A 4D9RD 4MMYB 4P23C 3MJ7A 4G8FB 4F8OA 1IEBA 2F1BA 4WFGE 3TEZA 2EUZA 2BNRA 1OGAE 4JHVA 5EZIH 3S4SA 4NJ9L 4ZNEE 1RU9L 1AHKA 2D7OA 2XA8L 1GRWA 4KRPD 4KY2A 2FX9L 4I85A 3L81A 5I1IL 4N6QA 2F61A 2OQJA 3FO9A 1S46A 2ZXAA 5J12B 3HC0B 4R5VA 3H55A 3HI6H 3UPAA 1TJXA 4TQPA 3ZYJA 1PX8A 4U2ZA 5PCYA 4E68A 5KJRH 3PHSA 1SVCP 4PUBL 5DYFA 1U8LB 2XBDA 3MLVH 4UAOC 2YWYA 2HA1A 4Z8FH 3WTWA 2M2DA 3FHEA 3NG5A 5ETUB 1GOHA 1BBDH 4ZOBA 4YLQT 4AQ8A 1GIGH 4YSEA 1IJ9A 4MA7H 4TL5A 1RJYB 5EOCL 4KX8A 5J06A 1RZGA 1W8NA 4TMPA 1HL8A 3UP6A 4PW3A 4Q6IB 1ZLEA 1LP9B 1U8CA 4KHXL 2WXLA 2RAMA 4QT5B 2QVKA 3HLKA 1DVFD 4DQOH 2WN3A 1ZEAH 3DSFL 1JK9B 1PS3A 3WAKA 2F08A 2KDYA 4FXKB 2GTQA 2Y5TA 3C5ZC 1DJXA 4Z8FL 4WEUD 4AYID 5BUGA 4WTZA 1MWAH 3A4EA 3ZTNL 1G9EA 2WWKT 4JPKL 5LN4A 2QADB 2JK5B 1U42A 1WFNA 5DHXB 1JTTA 4LCUA 4PJDE 5AOKA 2Y5QA 3UAAA 1ACYL 1KFGA 4XRCB 3S98A 1I1AA 1BXAA 3HCVA 1GGIL 3D9AL 1OTTD 5BMFL 5EUOB 3OV6A 1YPZA 3LNEA 3O8XD 1NAKH 4JRLA 1T0PB 3ARPA 4OLYH 5EBLB 1U3HC 5AAWC 3VD7A 3NABH 1HNYA 4JRXE 4QJ5B 2VR7A 4OCLC 5E4EC 5ISZA 1CDBA 3LZFH 1THAA 1SMAA 1UM5L 4HALA 2LTQB 3ZT6A 4TVUA 5D7LD 5C2BH 1QVOA 4K94C 5J11C 1P69B 3RGHA 3WXVH 3J07A 4OCSH 2DQGH 2VXQH 1M57B 3BFOA 2HUEA 2IDSA 3HBGA 1CK0H 3KLAB 1MN4A 4JZNB 5KVFE 3U2HA 4BUHA 4R90H 1FH5L 1UENA 2J72A 3MREB 3SOTA 2BSRA 2AANA 1CLYH 1BVLA 1J0YA 4N8PA 3NA4A 2H2SD 4TLSA 2R7EA 3KBEA 4KKBD 1A21A 2YMXH 2CO6B 4NQEB 3VFNB 1OOAA 4K7FA 5ALBL 2W07B 3HI1A 1J7VR 1A4KA 1HKFA 3RNQB 3GT6A 4JFZH 4WGVB 5EEXA 3D2UA 4PRHD 5IBUB 1UA6L 2J73A 5F7EH 3U0PB 3CFMA 2YR3A 2AJUL 3D3VA 4NQSB 1FVDA 1ZRUA 3MV7B 1L9NA 4ENEC 3QHZL 1A7NH 4PCYA 3H8NA 2O30A 3QUMH 3UROR 1AR1C 3DUHA 1ZAGA 1I8AA 2VXUH 4KKPA 2OTUA 2FIRT 3UTPE 3W5MA 1KACB 1FNLA 1HI6B 2Q6WA 4C56E 3D4CA 1ZSDA 1KN2H 1BWWA 2AP2A 4YJZL 1M1XA 4KHTL 4DVBB 1M6OA 4TUJB 1JDDA 1QBAA 4N4YB 2IAAC 4K7PX 5DUBB 3AY2A 3BE1H 2OMUA 2HJLB 3DARA 5C9JB 4PREA 4CW1B 2E27L 1DHKA 3QNXB 4UYPA 2GEQA 3P3YA 4NT6A 3OKYA 4X9BA 4EJ1C 3QO0A 5DC2A 5GZND 5IESL 1UXWA 4U6TA 4B9FA 4JRYE 1OWRM 4QOKA 4U4BA 3HIZA 4HU8A 2LV4A 3M46A 4PJ9D 2CNYA 3FT2B 2Y3NA 1VESA 4ODXB 4JFDB 4HZLB 1LDSA 4GIPD 2A1WL 5F88B 5DEJA 1R19A 3RZCD 3VB8A 1F2XK 2BIMA 5L7XH 1SHSA 5EBMB 1FZJB 4UB0L 3HR6A 1BYOA 4APQC 2Y9RT 2F58H 5G2NA 1WDAA 1MFEL 4XVTH 3TVMD 2DQCH 3Q1EA 5EPMB 4Z77A 4UTBA 3D18B 2NPLX 1BVNT 2DQDH 2X5PA 3ARSA 4K3JH 3WIHH 1VDGA 3O3EB 3A6CL 4HHWA 3KPQB 3S7GA 1IIIA 1PL3A 1YDPA 2FJSA 3VXMA 2PYED 3LZOA 3QRGH 4M62H 3FQRB 1AMXA 1WT5A 4G59C 1XF2B 4J6IA 4OZGF 4XOEA 4ZFZA 3WLBB 2BVEA 5C1MB 4XNAA 1KYUA 3C75A 1F8TH 4L0PB 1Q8MA 3KH3A 3RVUD 2XZCH 1OE3A 2CCWA 4MCZB 5IB4B 5LNDA 3VXRD 1S3KH 2B1AL 2FQFA 1I1FA 2EZ0D 2CLRA 2FD6L 1A6AB 4M7LT 5AD0B 1DSWA 3GZKA 4A63A 5I75B 2VDRL 2YXVA 3D34A 4MJ4A 4J3OC 4MQTB 4Y4KC 3OR7B 5SWZA 3ZOAA 1QWHA 1NLBH 1HEJC 35C8L 3PNWA 4M1CD 2APVA 2X0WA 2WSPA 1FO0A 4YHKH 1UZ8B 5EOTB 3X1FA 1JYVA 1UUNA 2KLTA 4BJLA 3KW8A 1XGZA 4MBRA 1QFWI 4HG4J 2BVTA 1H0DB 3CH1A 3JTSB 3LEXB 1E4XL 4YSOA 5BO1L 5EZOL 2XVLA 3L4TA 4Z7OF 2XWRA 5AW5B 3MUHL 2ICEB 4HMEA 3Q5TA 4HULB 5TE4L 2K4WA 2B20A 1A3RL 1R3IL 1LO0H 3O2WH 1ONQA 3WFBL 4JQIH 1E40A 5IOKA 5EU4B 1X5MA 5DRXA 3HZYB 2JJSA 3ZR5A 3F7PC 2LR4A 3G04A 3R0MA 2ZWLT 5I26A 1HSBA 1DVUA 2F1AA 1KCUL 4X6BA 5AW7B 7FABL 1V7MH 3PAZA 2I69A 2X1XR 5C0BD 2XN9B 3L1OH 3BN3B 1CL7H 3NZSA 1UCBL 1Z9NA 4ELME 4LSSL 4LKXA 1MZYA 2MNWA 1ZKAA 5IW3A 1I8KB 4CVZA 3WN6A 4ZS6C 1FBIH 3MLWL 4LEOB 4U1LB 4XNQB 4XMKH 5IKCB 4LCVA 3B1UA 4WY7H 3QORA 5I1EL 3LXAA 4NAMA 4XWGL 2MTAA 1GC1C 3V0DA 2G0LA 1T83A 1V3MA 4FQIL 4R26H 5DA0B 1KIQA 2J3SA 5KS9F 2MKLC 1CGVA 3NQIA 3L1GA 2JB5H 3NJFA 4DGIH 4YHZL 4BXSV 5DZJA 2E4FA 1G7IB 2X2HA 1T2QL 3P4NB 4MASA 1NGXA 3D18A 4G7SB 5HPMB 3DOIA 2AXFB 5C08B 1OT4A 2HFGH 2Y1AA 3BP4A 5C71A 3OHXC 1BG9A 1RUAH 2BS8A 4D0DA 4W6XB 2BFVL 5FS5A 2Q76B 4MJ5B 3GJEB 4NKIH 1SDDB 3HG3A 3S2CA 3TT1H 4NO5A 2FD6H 2DQJL 3D85B 2AV7B 3MSPA 1XDTT 5E9AA 3RJOA 5IQ9B 3N1FC 3WL9A 3SGEH 5L8KB 3EGDA 4N2GA 3ZQWA 3RIFK 4D8OA 5H35A 4X0KB 5EOQH 3EYVB 3BHBB 5JW5A 4CBZA 3T0ED 3BSHA 1T4KA 1WE5A 4LLQA 1R3HA 4G8GD 4JE4B 5E95B 5LAPA 1E9QA 4B9PA 3MODH 4KI1A 3DWTA 3O45B 2CDFA 1D7CA 2OMYA 1P7QA 3CZFB 1OTSD 1UH2A 3MRBA 5FO7A 5AENA 4DZ8A 4ZYKB 3BKML 1BF8A 2FECI 4N2OA 4OCWH 3WIAA 2OJ1A 1N10A 4N8VB 4X8GA 1EBPA 2AXJA 1YC8A 1KPRA 2XWEA 5C0CA 3A5VA 1H6TA 1ZCRA 4U1SB 4UT6L 2BH0A 2YD8A 3FUKA 4Q56A 1UUSA 3BMVA 4F1SA 5E5UB 1LWJA 4QCIA 1RIUH 4RFEA 4MNQA 2RCSL 3AU0A 3WKML 1WRFA 4QHMB 4UT9A 3N40P 3UCRA 3KWWB 5HHPB 1QR1A 3PAVA 1R1CA 4TQEL 4P57B 2GCYA 4P5TB 4TRPH 4ZMAT 2BVQB 3RDTA 4HKBA 1DVSA 2HX7A 4BWWA 2GAZB 2VM4A 4YE4H 4XH2B 5DEFB 4J5VA 2O26U 4QRPB 3QUZD 1TEFA 2D3LA 4G8EA 2DI9A 4R7DB 4MA1B 3BE1L 3N0PB 3QDJE 1Q9OA 2HT3D 4ZTOL 2AI0L 5IIEA 5M95B 4WF7A 4M3KB 5MP6H 4O00A 3T5WA 1PCXA 5K9OB 2IWEA 1VACA 2PW2A 5K5YA 4FXKC 4NM4H 3VNYA 3BGMB 4MD0A 1PLAA 4OGYH 3LNGA 1BGXL 4RX4A 1XVSA 3IETB 2UUDH 4QHUA 4Y2OA 5C0FA 5D1XA 2G5BB 4JFDE 3CVHA 1NOLA 3N41B 4KKCC 4XOBA 2MOQA 3VQ1C 3S37H 2QMJA 1DBML 1NGYB 2WIIA 4P46C 5GSVA 1CS6A 2WWNA 4PLKC 2IOMA 3ZO9A 1SN5A 2ADGB 2WV3A 1IAOA 4QXUL 1YEDA 3P2DA 3RHWK 1MLCA 2LTQC 3S37L 2V8LA 4OZIB 3PFUA 2VR5A 5FDYA 1LD9A 1NAMH 1NCDL 2MNUA 1C7TA 2WTRA 4H20H 2JCCA 1RFDH 4D0BA 1EDQA 4NZDA 1TKWB 5DO2D 2KUTA 1MHPH 4WO4A 3ARBC 4GT0A 2DKMA 3JSSA 1BFOA 4NFCA 1ZA3B 3SKUD 1ZS2A 1CFTB 2GKIA 3E2HC 4GFXA 2O5YL 4HJGB 2DM3A 2DQCL 1LQBC 5EV7A 4U6VH 4MZIA 4XC3H 5ESQA 3E6FA 4WUUB 5AYUL 3F2LA 3FN9A 1LWRA 1I9EA 4P99A 3TNNB 3L7FB 2XZZA 2V2TA 2A6KA 3OBAA 1ZHKA 3S96A 4XCEA 2B14A 4JFXA 4JM2A 3TN0B 1NCBH 3PAYA 5J57B 1URIA 1J05B 2DQMA 3KHOA 2H2SC 2CGRH 4F2MA 5CAYB 1PYWB 5F89A 1QSEB 1IILE 3G6JF 2NNRA 4KRNA 2GC7C 1N8ZA 2ZP0T 2VDNB 2YFNA 5FKAB 3FUHA 3AAZA 5F1NA 2HWZH 3LXCA 4JFSA 1SOSA 2VZOA 3FB7B 4M7JL 3SB3A 5JIHA 3NCMA 5JHLL 4EDWH 2ZUTA 1JGLH 4PG9B 2H6UA 2GBAA 1JN6B 4BA0A 5DVMA 4WO4B 1EAOA 1IC5H 5FUOL 4TSBH 4QHPA 3FQNB 4JL1A 3US1A 4FMVA 4KK8C 4Z23A 1CT8A 5EZPA 5EOCH 4YLBA 5C6WH 3F6JA 4NQED 4LMQE 1XCXA 5SX5K 4D9LL 4QD2E 5JW4R 3PWPD 1H6UA 4PGDB 3T08A 4OFKA 4MQ7B 1LO3L 3N2JA 3PRZA 3EAKA 4ADJA 1NSNH 4Q0XH 2QHLA 3DHUA 4P49A 3V6OE 1I3VA 3PV7A 4GKOA 4XX1G 5IHLB 5CEZH 4AQEA 3G6DH 1OCRB 4HXAH 2BRRL 4MAYB 3CSTA 3EO0A 4JJHA 4WUKL 1EX0A 4IGBB 2HG0A 4HOZA 2VQUA 3VGEA 3IDMA 2X38A 2WYIA 2J1YA 3FT9A 1YJDL 2R2HB 3KXFE 1IQDA 1IM9D 4XNYH 2ICCA 3IGAB 3OB0K 5BUPA 5A3IC 1Q9OB 1QSZA 2X3AA 3MA7A 2P48B 5J1SC 1OL0A 4GG8A 5ACLA 3OMIB 4NQCD 5BCAA 1IX2A 1UH3A 4W1TA 1FL3A 1W72A 2MH4A 3UBFA 3NIFE 1LWHA 3I9AA 2E9IA 2J43A 2UV3A 2GAZA 4JFYA 1DBJH 4K8RL 5KJ4A 4H8WC 2Z4QB 1HAWA 5HHPA 2EZ0C 4LSSH 5D5MA 4N85A 1LP9F 4JFVA 3PP3H 2Q86A 3MROA 4FNLH 3WS3B 1EQWA 2HJFA 1U91A 3WTYA 1WWBX 3BMWA 2WZ0A 2Q2EB 1K5NA 2QTVA 2F6AA 4F27A 3N42F 4A66A 3S8GB 3CPLB 2VITB 4HK0A 1A1NB 3GBML 2XYBA 1RUKH 3AREA 5IMMA 2HTKC 5TGBB 2FO1A 2FWLB 3PFQA 4JCMA 4CILA 4RMTA 5FYLD 4YVNA 1ED3A 5FOBA 4N2DA 2HKAA 4FXGA 3QDGB 1NKOA 4BINA 5FUOH 4P9MH 2GHWB 3LNIA 3O6KL 1H6FA 3BGAA 4M02A 5I1CL 1QRNE 4QRPA 5JOFB 2X4PB 2CR6A 5IQ7H 5JIIA 5DMKB 5JHLA 3T65A 1LNUA 5D8JL 1U3JA 3C5SA 4NQUA 4LHQB 3V4PA 4U1JA 5IFHL 2YLKA 2FYYA 5DJZB 3S5LB 1BJMA 3TO2B 1U21A 4JRYD 4IKNA 4Z7UE 3ZGHA 1XGTA 5LUMA 5DQ9A 3Q2LA 3MX0A 1MREH 4FLSA 4I18A 2C4FT 4QPEA 5JOPE 4ZTPH 4JN1H 3EGXA 4XXCA 4PRDA 3PJNA 4R9HA 2X6BA 3F01A 1D5RA 3H9YA 1MLCB 1AVAA 3FYEB 2Y72A 5EORL 1BFVL 4G3YH 5E8PA 1KPRB 2GQHA 3PP3K 4JFHE 5TFSL 5DURD 2CKBL 5EN3A 3VWJA 3ZSTA 4GG6F 4X5WA 1YQVH 4EE2A 4AYEC 4RSVA 1HNGA 4GIAA 1BQLH 2OMYB 2Y6SC 3CZFA 3CZGA 4JGNA 25C8H 3RIAF 3RTQC 3UPRB 3D2TA 1J8HB 4X8CA 5HVHB 1NDGB 5BZWB 5AAWA 4Y4HC 5D7EA 1V7NH 2PYEE 4LL9A 4LRNH 1O7DE 1TYEB 5DYOA 4JRYA 1ZE3H 4YEFA 1T21A 1QW8A 1N2RA 4LASL 4LSDA 1L0PA 1IO4C 3FB5B 3MBED 4L8CA 3IWUA 3FSWA 3PAUA 3ULVC 1YCSA 2XG5A 3X2QB 4X6DB 1NCDH 1DJIA 1ZA6A 2X89A 3HAEG 3FF7A 3Q5YA 1A9EB 4LSVH 4MCYA 4UDUA 3GPEA 5JIDA 4C4KT 3MLRH 1BQSA 3MXWH 5FYJE 3PIQA 4JJOA 5TQ2L 3EO1B 5DD5H 4GKLA 1OAQL 5KG9B 2XCMC 3BCFA 3BUDA 1T1XB 3A67H 4XMPL 4EN2A 4M00A 3GLZA 1DJZA 2VNCA 5LGHH 1KCVH 1E4HA 2UWEA 2EH7H 3A0OA 1DZBA 4Y16C 4H0GA 1MZZA 3LPFA 5EMYA 4Z78B 1XD1A 4EZJA 1SHWA 2BNQD 3MJ9A 3KR3H 1A47A 2DY2A 4K7PY 5IB3B 2IH8A 3VFRA 3FFCE 3UZVA 3IU4H 3B2XA 3FU7B 3TWYA 1RPKA 5CEZE 5F7UA 2A4CA 1IU1A 4JHAH 1MNNA 5D1ZC 3JZYA 3ZZ1A 1G1OA 4M93B 5I6KA 4P59H 3SBRA 4ZMTA 2C9UA 2QSCH 4F37F 1J9TA 3L4XA 4QKTA 1EEZB 1M3IA 1VLXA 3F7VB 3JWOL 5J3HD 3TV3H 2BRRH 3H9ZA 2Y7SA 3U4EA 2EE3A 3AMLA 4YHYB 5J4MA 1JPEA 2WOYA 5C92A 3INUH 5BVJB 2K6YA 2DICA 3WKMH 4YSPA 3ZDYE 4BA8A 5C70A 4FI6A 4H8PA 1W0YT 3OX8B 4W9ZA 1X5YA 3U9PH 1HINH 5KSAD 3CDCA 3HMXL 3QJUB 3THMH 12E8L 2DQTH 4ES9A 5CCJA 3D0VA 2W9LA 4N0CC 3BSGA 5HPMA 1OAXH 4ZW8A 1HL5A 2EIKB 5D9SA 5HJBA 4UTBL 1KIRB 1NDTA 4NYLA 3A24A 1ZTXL 2NW3A 5SWZB 5C2BL 5CGBA 5DMJB 4I0PC 5JR1H 2ZNWA 1OZTG 4OD1L 1UWGL 2ZICA 2XKNA 1J0IA 2F7QA 4ZUWA 2WNKA 1U8QA 5GIRB 4G6FB 1E6OL 4JCWA 4JO1H 4TVPL 3SSGA 5M94B 2X9YA 3NZHL 3D9AH 1WFOA 1YA5A 1PG7H 2KZ1B 4Z7OB 1AANA 1HQ4B 2NY6D 3VI3F 4MS6A 1NIEA 3QXVA 4ORGA 4JFXB 4JM2B 3TN0A 3K4AA 1MAKA 2HKHH 3UABA 5TPWH 4HQQL 3PWJB 3HPLA 3IKCA 3L6FB 3G08A 4GAGL 3BPNB 4WU5B 5DS8A 3QIUC 3ZMRA 5BS0E 4XP1L 2GJ6B 3QS2A 2ZIDA 1UKTA 2G4GA 4XCNB 4TVPH 1JSYA 3IMSA 3G5VA 4X6CA 3RBGA 2AS5M 2AMUA 5AL8A 5C3LD 5E8DL 4P4RA 4RDQF 1A64A 2B7DT 1CFTA 4U6YB 4OCNC 3EYQD 1W16A 5ABAA 1N26A 1TLMA 2FGWL 2FAUA 3EJZD 3UDWC 4ANVA 4N8CL 1X5GA 2VDQH 1LNUB 4GO9A 2QKIC 4KVNL 4DVRL 1IGCH 4L8BB 3HG0A 1BEXA 4IMLB 1MJ8L 3MJ9L 5IG7B 1DR9A 2CK0L 2R1XB 3U46A 2ZAIA 2L7UA 4I8DA 4LO9A 4WY7L 5IY5B 2W1NA 5L2JA 2IGLA 2ODHA 4QNPE 2ZNXA 4ZSOA 3T4AC 4IQHA 2P7TB 4OZIA 3W38A 4UTAH 5CLWA 1TTUA 2Y22A 3H85A 3AXHA 3IS0X 1E3FA 2P5EB 3KNBA 3V6FA 4NQEA 3VFNA 1E8ZA 5HYJA 2DEXX 1XGUB 2F9BT 4IRZA 3US0A 3P11H 3GMNA 2NY7L 1KEGH 3WTVA 5I74C 3FN3A 4M1DL 3BWSA 3UTQB 1GY2A 1G7MA 1IC4H 3VRJA 4BYHA 1HXKA 3NSYA 1BG1A 1KCLA 3WDJA 1TETL 2IV9A 4YO0B 2AITA 2BHZA 4PWFA 1A7PL 1M2VB 1R3KA 4KXBA 1R0AH 4MTMA 1RI8A 4JHAL 2E7MA 4OW6A 4PAZA 5AVSB 2F8IA 5IV2B 2DF3A 4E9XA 2DTSA 3LQAC 5GGSY 5TF1L 4FKHA 3DVFA 3CHPA 3LRKA 1XR8B 2GJZA 1ZT1B 5FGCB 2TRHA 4QYOA 3OQ3B 3CX5J 5DD1L 5J6HB 3K6IA 5D1QD 1C5BL 3BVDB 4X9HA 4KK9C 1FVCA 1DL7L 4UM9B 4L4VE 4HPYH 3WEMA 3TFKC 2EH7L 1KFAH 1JDAA 1TJHL 2OMWA 5IB1B 1FP5A 4O4YL 1TKWA 4Y9CA 4IDJH 4XI5D 4QRAA 3QBTB 3UAEA 1PKOA 2B3IA 2WWMD 4C8XA 3HUJB 3HMXA 3H56A 3FF8A 1YEDB 1AO7D 3IFNH 4L3EA 5HJGA 4HJTA 3DX6B 3JV6A 3AROA 2OMTA 5A2CA 4ADIA 3IETA 5LVEA 4WO4D 2DQDL 3A22A 1SXSA 2R0KL 5ICUA 3UZVB 4LASH 5D4QA 3UTOA 1JZFA 4FCAA 4FL4B 4DGVH 4FNRA 3IDIB 1A6ZB 3M17B 4M61A 2XN1A 1FE8L 4JG1L 4GH7B 4E5XA 2JTDA 1P5VB 3MYJB 1XB8A 2A77L 2OYKA 4R2GB 1KXVC 2J6EH 2QPUA 5EN2B 5CD5D 1SXNA 5E6SB 3WG7B 2ZWYA 3FN0L 5ABZA 4N90E 1CI5A 4BDVA 1JF6A 2EVFA 1FNFA 4LZKA 5EDSA 1PFCA 2QSVA 3G5WA 3EO1A 2YKKA 3BN9D 5CGYD 6CGTA 4YSAA 3N40F 4PRHE 4RFEB 3H9SB 5CBEB 2H0PA 3HZVA 1ZS8A 3SPVA 5KBKA 1YEFH 2YA1A 5E23A 3RWGB 1XMEB 3ZGIA 5I8EB 1XGRA 1YZZA 3KYKL 4EOWL 2DWDA 4R7XA 5D72H 4IIQA 2NOYA 3PWPA 1A4JA 1SYSB 3ARVA 5I73C 3EJSA 3TNMB 2AZUA 4XTRC 3U2JA 3Q9QA 1MW1A 3VA6A 3N0AA 1ZMYA 1LDPH 1JF5A 3IFOB 1KWKA 4LVHB 4WW2F 5F9JA 3OZ9L 4WNQA 4KROD 3T0EB 1FLRL 4BH7A 3QAZC 5ABDE 3NCJH 2FGZA 1ODUA 3G6AA 5A2JH 3MRBB 1CGTA 2FUTA 3OHMB 3QEUB 4G6MH 5J11B 4HUVB 1P84J 4JFFD 5CM1A 5IW1A 1XSIA 4P48A 1IAIL 3HB3C 2ZCHH 1MI5B 3IFPA 4R4BB 3SEPA 4FABL 3S5YA 4XRCA 1NUGA 3VI3E 4YHML 4HC1L 3EYVA 5J13C 4AIXA 6PCYA 4NIKB 1NH6A 3L95A 4MNGB 1ZLSH 1DE4B 1JHLL 3RHWF 3F84A 2Y6SD 3HA0A 4PSRA 4F9LA 3SDAD 1PIGA 3I50E 1WZLA 3MRLB 4YHIB 1J9RA 2APBA 2UVEA 4HLZG 5ICXB 3KPNA 1P7QB 1DLFH 4ZPVB 1CFQA 1MXGA 1QPKA 4L1DA 3TO4C 3FSZA 3MR9B 3VFTA 3VSUA 1MJ8H 3MJ9H 5HYJE 4ABVA 3VACA 4M9OA 1CXKA 1OLZA 3RJQB 4N8CH 4PGBB 5BRQA 4Y19A 4HKZB 4FLOA 5F7MC 4NNXB 3GSUA 3VFWB 1DLFL 4X6CF 3REWA 4QRPD 3JBG7 4ZTEA 4HMCA 2VKWA 4M03A 3VXQA 5HDBB 3B9KB 4WFHD 4ERSH 3ETBJ 3ABMB 2ADFL 3V8CA 1SLVA 4WZ9A 4GW1B 5J56B 5BMFH 5B22A 1BJ1H 4TSCL 1IJNA 4HD9A 3V5HB 4J23A 1WPCA 3MRHB 5CIPH 4HUUA 5E94B 2VDRH 3UXFA 1KCSH 3PYCA 4L3EE 4Y16B 3N1GC 5ALCL 1MWAA 2K8MA 5HI5D 3U6RA 4QTHB 2B3RA 4WI0A 4Q0XL 5IJBC 4JFYB 4HWBH 4GEIA 1CDJA 3FFDB 1I1CA 1HHIB 1W80A 4W9CC 1JXKA 2YRLA 1FPTH 3A6CH 1BIIA 3MNVA 4QXGL 1QACA 2UY6B 1L6PA 4L4VA 1FAIL 2OCJA 4TVPD 5T5FL 4OLWH 1C5CL 4PD4J 5FKPB 5B3SB 3ZHDA 3VXPA 4O2FA 1KDJA 4PJ7F 1MJUL 4F8NA 5BS0B 3R1GL 3RWDB 1EEYA 3IMUA 4HJ1A 4G8GE 1RAMA 5C07E 1IE4A 3EBGA 3WKPA 2WAHA 5EU7C 4JHWH 4L8DB 2GUYA 4PLJD 4XB8A 2AMGA 1YNLH 4J4PA 3KLQA 4NENA 5DEGB 4Z9KB 4HS6A 5EEWA 3IJYB 1H15B 1BFSA 3CFBB 5IROD 5B39B 5DZAA 1F6LL 4RGMB 2UY7B 4Q9QH 3IS1X 2F8VA 5I17B 5D1QE 2JKTM 2WVUA 4FFWD 1PMYA 1U8JA 3AQXA 1F1GA 4GKZB 4AY0A 1N0XH 2LVCA 3BT0A 1AR2A 3NOIA 1OV8A 1QNZL 1T7WA 3GXIA 4NN6C 43C9B 4PREB 2QBWA 5LWYH 1LL1A 4FQQA 3LS5H 2H4EA 2HT4C 1NGZA 4ODTH 2A6DA 3AW5A 3NEXA 3S3CB 1U8HA 2WQ8A 3SOBH 3JWNG 1HHGB 4NZRH 4C59B 4PJAA 4E5XG 3PGCA 1A1MA 3ROLA 2CKBB 3ZSSA 2IAND 2UYLA 4ZFOA 4QYAA 2BC4B 3CZEA 4OZIE 1QSFB 4ZSOE 3N42B 1N70A 2FIKB 3MRGA 4BSWA 3ASNB 2WXFA 3RQ3A 2XV0A 4QXWA 3ESMA 5CUSH 2JFCA 2KZKA 4FG4A 5FW8A 4F7EB 3V8OA 1IT9H 4I1PA 4QHNA 2QV2A 4QY8B 1BYPA 3ILPA 4X4ZA 4KO7A 3RY6C 2KZWA 2NY6C 5KYUB 1VGKB 2BOLA 1IGTA 4DKDC 3W37A 2VDRB 3KVQA 4HV8B 3RL1B 3L16A 4MD5A 5D7IB 3ISWA 4ZFQA 5LGHL 4F2MB 1FH2A 2X88A 4XVSL 3ARFA 1K9TA 1FNGA 3IE4A 3LXBA 2FX7L 3DDFA 3Q8CA 1QFOA 2IBZX 2DV6A 4G72B 4NRZA 1T20B 2CXGA 2QQKH 5JO5B 4ONOA 4APXB 5CGTA 2BNQE 4Z7VA 1OAUL 4I4WA 2ZKHH 4YNYB 4YIQB 1PQZB 5DHMC 4UIMA 4F57L 2R9HD 1U3NA 2Y3AA 1KTLB 5C7ZA 2WKLA 3DX8B 4PWJA 2HH0H 2BSTA 4L37A 3RGVB 1T89C 1PD1A 3MBEB 4PMEA 1RLBA 4XZUB 4DETA 2ZUQC 3MHZA 2IV8A 3GLDA 4ACPA 5MHSD 3GEWB 4IK6A 1MDTA 2H3NA 3MRLA 4HISA 2E6JA 3C8KB 4LGRB 2VXQL 2OTUB 3P1VA 4JHUA 3T0WA 4PJGB 3BLBA 3HS8A 4QEGA 3D06A 3NJGA 1OHZA 2JCCB 1I85A 2XWBA 5T1KB 2QVFB 2D0GA 5T3XE 1KB3A 2FNBA 3PXHA 1YNTA 4NKMB 3D4YA 1SDYA 4B7LA 4R0LA 1N5YL 1KV3A 2X28A 4XVJH 5HVWA 4NDMB 2Y23A 4KH9A 4X7TA 2VLRB 1FIGL 2H0JA 5ID0B 2VISB 5IGXL 5CINH 1G6VK 1DEDA 1AHWC 4N0FB 4RMWA 1S78D 4KI5F 4HIEB 4EI5D 1IV8A 2P8PA 2C7FA 3QDMA 2G2RB 2XVGA 2CLRB 3WIIH 1SJXA 1NOFA 3MKGA 2A83A 4F1ZA 1WCQA 2R69L 1IBDA 3CTTA 4KRLB 2LLNA 4NI6A 1DYZA 3W9DB 4N2IA 2O4EA 2CO7B 1CTNA 3GSNH 3WU1A 3WNIA 3ISRA 4JEGB 1J5OH 3FQWA 1NUNB 4JRWA 3QXTA 4MRCA 5D7SL 1X5AA 4DVRH 4TLUA 2Y36L 2F19H 5FHBL 1GYUA 4H25B 3GSUB 3RA7H 3VFWA 5FO9B 4BZ1L 2Y2YA 2XFXA 3SDXB 1FVEA 1E5BA 4ZFOL 3IMTA 3GKZA 4RMVA 2AJSH 1D7DA 1DVFA 4DUWA 4OFQA 1DVYA 4GQQA 1ACZA 2J1WA 4DN4H 4FA6A 1CFNA 4CKQA 2Z8SA 4DAGL 1EO8L 3F83A 1R75A 4HWBL 4QRUB 3VFGL 4KITB 2BVYA 1GOFA 3GBMH 4XI5C 4YZFF 2QQNH 1XT5A 3FAWA 3HE6A 5EC1A 4YWGL 3U6XA 5AG9A 5B7MA 1QHPA 1EFQA 1QRNB 4WEEA 2XPGA 5FCUL 2MRYA 4GUCA 5I9QC 1ZDQA 1EJFA 4CA4A 2X4SA 3ES6B 3QWOB 2EO9A 3B9EA 3NJNA 4LVEA 1MRCH 4OIIH 4YBQD 5FXCH 3WMPA 1AZNA 5L9DL 1F45A 5A7BA 5E2UH 1OOWA 4YSRA 5JIMA 1M7IB 1IGJB 5CCGE 1IQWH 1U8PB 2XX1A 3GGWA 4OF5A 4BKSC 5ISZD 1T2QH 3QJFA 1KGCD 2K0RA 2X6MA 3KBPA 4HMDA 3LIZA 4DERA 5IVNA 4YUEL 3WLWC 4BUQA 1ZTMA 2BHYA 1AZBA 1G0XA 5CFAA 3U1SH 1A7QL 4G1MA 1OAXL 3BDXA 4K3EH 1VZGA 4XPBL 4CSSA 4B0MM 2AC0A 3WNPA 4L1BA 3VB9A 4LESA 4R2GD 3TPKA 1MKFA 1QYGL 4OSUH 2YKLL 4GAJH 1MAMH 4F7TA 2PWEA 2DQHH 3QA3B 2YJQA 4FNPA 1FN4A 1HVXA 4CU7A 1ZY9A 4U6HB 5PAZA 3US9A 1MCCA 5SX5H 3GWJA 2N01B 5TDOA 1VPOL 1CL7L 5FAAA 4HV8A 2R29L 4G6KL 4OZGB 4Y5XB 4RA0C 7FABH 3KXFA 5DQJB 1FYTE 3CZJA 3MLTA 4G8GB 1YEGL 2B5IC 2FBJH 3BO8A 5DSCB 2UZIH 3BDBA 3UJIH 3AWFA 3HN5A 3FCUB 2VDOH 1E5ZA 1MQKL 2FB4L 3S48A 2L04A 1OSPL 1YNKH 2D31A 4YR6A 4HS8L 5GZOC 2Z6FA 4U49A 3GSRA 1TIUA 2D7TL 3OHXA 1JS4A 4QO1B 3SDDB 1BVLB 4BGLA 1Y1DA 5CN3A 2E4TA 3UTSB 2IH9A 3UG5A 4L4VD 3KDPB 1ZPUA 2G9HA 4ODBD 5ENWB 3TFBA 3GSWB 4XNUL 4AQAA 3B83A 1OCCB 1FC2D 2VSMB 2XBZA 4H25A 1QHQA 1I7TA 3HC3H 1RV6X 1F90H 3HJEA 1GJWA 1T83C 2YQBA 3MV7E 4LLUB 1U58A 4XCYB 4XP6L 2BNUB 3TA3B 3WO3B 1QRND 2PYFA 1VGEL 1OGTB 5B1CA 2B15A 1T0MA 4ODHH 1S9XB 2WOBA 4KROC 4NQDA 3ASWA 1R33A 5HDOA 4IJ3C 3A67L 4RDBA 5E4OA 1LE5A 4Q74A 4WWKA 5CN1A 4G7VH 5KYNA 1VIWA 5EUOA 3EFOB 4O02A 4XXDB 1RZFH 1EAJA 4XPFH 4ZAKB 1B9KA 3ZTJH 5AVYB 3SGJA 4PJBA 2J6EL 3SE8L 5CCHE 3EGDB 1LO4L 2R4SL 1D3CA 3SE3A 3A6BL 3IB4A 1WBXA 1HDMB 1T3FB 3IMBA 1U8MB 2O6PA 1JPTL 2R51A 1E4WL 3SDCA 1WFTA 1XL4A 1BJ8A 4AGNA 3L3DA 2BS71 4L4TD 5CJXC 1B2WL 3E38A 3TO4D 3DO4A 3CUPB 3JT0A 1DQJB 5EIVA 3OKKB 4UINL 1IFHL 2DEYX 1PZCA 2FZ3A 4XNZB 1TSRA 3L9EA 2YD5A 3U30C 2X2JA 5BRZD 1R3KB 2ED7A 1KT2B 2YXFA 2CIIB 3ABKB 4J39A 4ONHA 5D2NC 3LIZH 3VI4F 4ODSL 4BFNA 5C0EA 2H1XA 5GRXG 3S34L 2X6AA 2EYSB 5JO5A 4WHTB 1UA7A 4KDTC 1A4CA 4PJDF 3FMGL 1UD3A 3ZL4L 4JN1L 5GS1C 4G80B 3HBZA 1G9HA 1E65A 5KVDE 1FFNA 4RNRB 3LZQA 1OP3H 5DU7A 3WEOA 2GUOA 2ZCLH 2EDQA 3D39E 4HIXL 4IRSB 2VM9A 4PRID 3ZX1A 5T1KD 5IFHH 4DW2H 2IWKA 2ZX5A 2EINB 4O5LH 1LJMA 5J3HC 1TO5A 2X4OA 3LS4L 3PGCB 1YEKL 1FG2B 1QUPA 1RIHH 2NX5E 2Y24A 3DV6A 4LRIA 3CAFA 1VENA 2DQ6A 4XN2A 1I1YA 4KTDH 1CXFA 5JMOC 5TH2B 1L9RA 1T0NB 3VA2C 1YY9C 1WTGT 3ARYA 1MCWW 5J89A 1JAEA 2Y6TE 3EF7A 3FFOA 1G1YA 2DTML 5E1AA 2OZNA 3P69A 2FBJL 3MVSA 3CX2A 3NBNA 4WKZB 2EVIA 4ZOAA 2EE2A 4P2CG 3V6ZB 4RZCA 4MSWB 2QR0A 5GJTL 3N50A 2H2PC 1ET5A 4JFQB 5AQ0A 3RVWD 4RIRA 3G08B 1PZSA 5G4MA 4NQDB 1S9KC 3GXTA 5DUML 1YY8B 5IROC 2E56A 2W59A 4PJ9A 5C0AB 1UD2A 3BKCL 1I3UA 1XIWD 4QOKD 3KS0H 5C8JA 3GSOB 5C09E 3PV6A 1BEYL 2FVNA 4WHTA 3W82A 4RZCB 3RVVD 1PY0A 3CN1A 2A4ZA 2IANA 1UQSB 2YUZA 3IJEA 2CK0H 4X5XA 4BZ2A 5B3NA 4DUVA 3LHPH 4X50A 4KZEL 4WU7B 4KVNH 1JYWA 4XPBH 1TTCA 3BKMH 1GC1H 4O51A 2XTJC 5TDNA 3D69B 3K6DA 4JFFB 1U95A 4HK3N 5DD0H 4DKAA 5SWQB 4YFLI 2CHXA 4PVBA 1AS8A 2B1OA 4Y19B 1XZ0A 2ADJB 3BAEH 1DJHA 5AW6B 5FIEA 5DQJA 5LHDA 2WUCL 3MV9A 4UV4H 1WQVT 1N67A 3PCYA 5FPIA 1D9KD 3AS2A 2FWOA 1OPGH 4HXAL 4ZJ9A 1X44A 3TGXA 1Y6MR 1J0JA 1OGSA 3AGVA 3SDXE 3A3YB 1CFVL 3CVIL 3UEQA 2VXSH 1T2XA 1N19A 1RJCA 1TU2B 1OQOA 2AEWA 1M71B 5AVWB 3TT1L 2ATAA 3IFLH 3I6LD 1TQCC 2H32B 4PJIB 1C08A 4NKDB 2JB6B 5T3XL 4HKZA 1O6TA 1GS7A 4N6RB 4OAWA 3O4OC 4YOKA 4Z18A 3PPEA 2WUCH 3V5HA 3ZRFC 4XO8A 3K2UH 5BZWA 1NCOA 3LKPA 1M42A 4BE5A 4OZ4B 1FYTD 2WIMA 5DHDA 3VAEA 1OGTA 1RVFH 2D2OA 3GFUA 3DGGA 3GS4A 4P9HC 1DQQB 3ZRCC 3LH2H 5DFWH 3U2IA 2H6PA 4DO5A 5LXGL 5JUEL 2VERN 3X11A 5IQLA 4LSUL 3W39B 3DHPA 5I1EH 3THML 3RX7A 3FRUB 3LN4A 2DWTA 1BIIB 4W4OA 4ZMXA 3RURA 3UTSA 2XN9D 1HK6A 4PRDB 3WY1A 2BP0A 1UOWA 3IRZA 4WJKB 4ZO8A 5AB1A 4E9SA 4ZBJA 4PU2A 2OAAA 5FGCE 2EDBA 1IKNA 2VH5H 4Y5VC 3BZFB 2YPVL 2V4LA 2PP7A 3T6ZA 5DVKA 3V4PB 4Y0GA 1I1AC 2V2XB 4TTGA 5C0CE 1UOLA 4R96B 4YFDB 3N1PC 1NL0H 1JXGA 1F3JA 2OXHA 5GGTL 3T0DA 1X7TA 5JYLA 4NN5C 4NC1C 4EI5C 4U0RB 3SDYH 5EZIL 1SY6A 3B9KD 1P53A 3KGRA 3MJ8B 4NJAL 3RZWA 3B5TA 2X6VA 1IKFL 3M7FB 1VA9A 2YHGA 2VZ1A 4LT7A 5TD4A 3ZZLA 2Y5EA 4MAUH 3REWB 4A7GA 4Z7WF 1P5VA 3MYJA 3SKMA 1PJ9A 3X1GA 1D7FA 3KWXA 2IDCA 2IQAB 3AS1A 3L3IB 4NM8H 3HEIB 2IOOA 2P4AB 3FOLA 3L45A 4PR5A 4ZUVB 1PDKB 3QK0A 3VGAC 3F12A 35C8H 5B4MD 2Z31D 2G3MA 3LN9A 4Q7DA 1SEBA 3ARZA 3HE7C 4LIQH 4IS6A 1MFCL 4N26A 5JW3H 3QDJB 3FMGH 2QTEA 1GPOH 1KIUB 1BQ5A 4FC3E 5DEZA 3QUYC 1I7RB 2WYZA 2EILB 3WHE1 5ADPL 2ZZUT 3L5WB 5JNYA 1ZK5A 1GZPB 4HWEH 3V0GA 4D7BA 1OB1B 3J27A 2Q7YA 4F15C 3JWNH 5IHZA 3ES6A 3GDCA 3ZE2B 2JMRA 3BXNA 4J12A 2J8OA 1FL6A 5DRZA 2BIOA 1ROWA 3T77B 3LRMA 2W0KA 1OALA 1RERA 2EUVA 3V0HA 2CGYA 1EXHA 1CG9A 1D5ZA 3SKNA 3X1BA 1TYRA 3L9RA 3NH7L 5HBBA 2CDEB 4S1SH 2K7PA 1OP3K 2TAAA 4QXTB 4UV7L 1Q90A 3C08L 2QEJA 3L3OA 1EK3A 3LD8C 2V0AA 5LAXB 1YEIL 5E2TH 2V3FA 4RDQG 5DJYA 3DX7B 2WO4A 4JFOB 1XGYL 3FUDA 3LMJL 4JDVA 4B41A 2MTPA 4UNVA 2ZUXA 3POHA 2OMNA 5DFAA 2CJUL 3H1ZA 4MJID 1THCA 4XPFL 1NC2B 4XN7A 4L8SB 5TDOB 4DP1X 4GXVL 3IPBA 3RDJA 5I2IB 3FOMA 1HYSD 3I50H 4TS6A 3IDNA 4PYHA 4ABUA 3HZVB 3GB7B 3VSTA 4LNRB 1W0WB 3EBAA 3UZEC 1FZOB 4UQCA 4BUGA 3GMNB 3MRIB 4UT6H 2BZ7A 5EO0A 1XGYH 2H1PL 2E27H 2J7LA 2ZOLB 5EIIB 5F7YC 4XNDA 2WXQA 2YSTA 3QULB 3O6FA 5E2TL 2JJVA 3BQUA 4WTZG 3NIDE 5EA0L 2BSDA 2C1OA 2CO1A 1IGIH 4YO0A 1DZ0A 3RPKA 5I18L 3NSDA 2QVMA 4GKNA 4TULL 3TU6A 1W0WA 4BHUA 3VFSA 1MCOL 3EJZC 3D39B 4G70B 3PABA 2VR8A 3L5HA 2OK0H 2NYYD 1TZIB 1NINA 1XIWB 1FPTL 2HLAA 3K74B 4I89A 4E42B 3GMOA 3RVUC 2HVJB 3QUML 3IFNL 5FO2A 4Y5VB 5EWIH 4I88A 2FHBA 4MKMA 4XN1A 4P4KD 2NX5B 3RTQB 2PPEA 1I8IB 3KPLB 3QIBC 3STLB 4P2YA 1ZGLM 3VGHA 1DDTA 1ORQB 1D2OA 1BD2E 5I1KH 1FORH 5IK3B 4UM8A 4P3DB 2JCCF 3W1ZA 4BCZA 5BW7C 2IJ0C 3ZKXB 3FUEA 3QPKA 1UB6A 1F4YH 4PJXE 1IL1B 1KTKE 4OSUL 5GS1A 2NW2B 3N85L 1ZVNA 4H88H 1RHHB 1MNUH 3AS3A 1DJSA 3D3VE 5I5RA 4KJPD 1CLOH 2CHNA 1FNSH 1G7HA 3B9DA 4ICXA 4JM0A 5DD0L 5K93A 4R90L 4JDTH 3CLEH 2CDGA 4X4ME 1I7ZA 1YUHA 1Y6KR 2WTRB 4IMLA 3EJQA 3U46B 5IJCC 3GIZL 2B4CH 3X3GL 4CC4C 3AFLA 4Y1AD 5KAQF 2ZUQB 3FT0A 3UYRL 4KQ4H 1CLZL 4L1LA 4DSYA 4HJIA 5I1LB 2P42B 2YGPA 2HAZA 4Q2ZA 5GS2H 5DJ8A 4LCCB 5F6HI 3SQRA 2EEBA 4WHYG 5JOEA 3O8XB 4M1DH 2GC4C 3ECQA 2F7IA 3WIFA 3C6SA 4HUUB 5DJ6B 4LDEB 4F7PB 4PRPB 1IRAY 4XX1E 4YWGH 4GSDL 3OPZL 3CHOA 4HHAB 4N2EA 3CD4A 4RAUA 4KGJA 3B9KA 1J5IA 1E9OB 2TRYA 2WN2A 3DIFB 3MBWB 4WK4B 4AQ1B 3E9UA 1YPZE 1LO0L 4GAAA 2JXMA 4EMZA 3OXSA 1BOGA 1XCTB 2N7BA 2DYPD 1CGSH 3T09A 3I6KA 4HIJB 1HNFA 5E5MA 4JB9L 5GRZA 1QKZH 2AJYL 3DTDA 3ILPB 2F74A 2BSCA 4W9JC 4WGWB 5GGQH 5CBAA 3W5NA 1JHKH 4WO4C 2PO6A 5FUCE 1RUPH 3G5YB 3L3KB 1Z0MA 3C60C 2WZ5A 3SCMA 3DDGA 4JJ5B 2AXWA 3QIWA 1C5DB 2SEBA 4Y88A 4MNGE 3H0TB 2YRBA 5CLTA 3G5VB 1N59B 1AS6A 2NLJB 4PUBH 4EI6A 1B6DA 1SJVA 3MRMA 5CZVH 2B1AH 4PJCA 3S3PA 3S34H 3EGXB 1RH8A 1AKPA 1JTPA 4H2AA 1BZ9B 1CFVH 3L6FA 1Q9KA 3EH1A 4ODSH 1IAKA 4AC2A 2ADGA 4EUPB 3IJSB 2FYYB 1NJ9B 5DJZA 4AIZA 1VADB 1FCGA 2ZONA 4GQZA 2VR3A 2LFEA 3GRGA 3T0EE 5FEBA 3VD4A 4JPQA 4ANUA 4JZJC 2XJKA 4JR9H 5I73B 4NUJA 1PPIA 2F8XC 5CIPB 4YK4B 4J3OD 4U1MB 2CKNA 2X10A 3ULUC 1FFTB 3EFDL 2ZP8A 1SOXA 1T4KB 4U3XA 5IB5B 1GL4B 4OCRH 1R4XA 4PTUB 4WI5A 3TBSA 1OCWH 2BHFA 1NIFA 2EDKA 3FTYA 4OH2A 5SV4A 3QAZB 4XTRD 2DYPA 3GTTA 5DZ9A 5JZ7C 5AKSA 4JRYB 3BSZH 1I9JL 2WZ6A 1G9NH 4PGBA 5D5MF 2EDOA 1XF4B 4FZEH 5HGHA 1U8NB 4K7PL 4H8UA 4ZX4A 3KL5A 1L0QA 2WXGA 5KS9A 1J8HA 1OO2A 2QMKA 5DT1L 4HUKB 4QXUH 4NC2B 4UQ3A 1XV8A 4IBUA 4JRXA 2EO1A 3FAXA 1IEAB 3QZWA 3QHTC 4IW4C 3QCVH 4KTEL 4EO5A 3T0BA 2YEZA 3INOA 4C4KO 2YXMA 4E2OA 1TJHH 4MJIE 4PBWD 1T03H 2KYIA 4NPKA 3I2CH 4MA1C 2OX5B 5CJQH 5DYOB 2EKSB 3QYMA 1DL7H 2BZDA 1A7RH 1WFMA 4NNYB 2X1OA 4Z7VE 4FRWA 2V5MA 5E8NA 1NICA 4POUB 1USQA 4WNJA 3O2VH 3N9GL 3CSBA 4ONGL 4LSRH 2JXMB 4M7LH 5E00A 1TJGH 1KN2L 4AJVA 1PW3A 4TVPE 2LU7A 2P5PA 5GGTA 3TH3T 2J25A 1PLCA 4ZQKB 1CWVA 4A7SA 2YJLA 4WNQB 3T0EA 3WJLC 1UJ3A 2E75C 4I48A 5I15H 3VGBA 4B96A 4HPHA 4NZRL 3WHXB 1DBAL 3ASOB 2X87A 4P46D 4KJQD 5AW0B 4HIIA 4ZNCD 4B9ZA 3L5XH 5HVFB 3SE3C 3P4LA 2GTZB 1HZHH 3NGBC 3NIDB 5C09D 4B9JA 1KEMH 2JKSA 3K8KA 1NLDH 3BKYL 5DD5L 4DGYL 5MEOB 3TO2A 4EN3C 4ZNEA 4MNGA 3MRQA 4FTDA 4JFEA 4HZ1A 2D0HA 4NO2A 5AWNL 3RE0A 5D6CB 1U0QA 2AJZA 3IMWA 2F53E 3QDME 4MMZA 2Y7LA 1SXZA 2YKLH 4GAJL 1NFAA 5F6IB 4WAFA 3VGAB 3F04A 1E7VA 2C9QA 4XOCA 4M4PA 2XV6B 5BRZB 1HH9B 5K59E 4B9YA 1AHWA 5FB8B 3CN3A 2CRYA 2Y06L 4LCIH 3OAUL 1A7QH 3BW9A 4JO5A 4E41A 2DWSA 4LDCA 1HSAA 3QH3A 3QNZB 1E27A 5T5FH 1RJZB 4JHBA 3O0RL 5IMMB 4I3SL 3KVDD 3ZYOA 5J5EA 5L2KE 1CU4L 4FFYH 5EO0B 4AKPA 5EO1B 2IADA 5E8DH 3SBQA 2GT9B 4JO3L 1NDGA 2YD1A 4U1HA 3H3PL 4BFIB 5F3BA 4NP4L 3S0PA 3ZUCA 4HUMB 2WXOA 3ZBMA 4DEPB 4OF8A 1PYWA 4CVUA 4IIQB 4Q9CA 5IKCA 4AQ1A 4MWFB 2DW5A 4P04A 4P3WA 3OWEA 1K8IA 4FL4C 3O2DH 3ETSA 1ZHKB 4Q2ZB 1Y1UA 3SDCD 1LGVA 2HFTA 4DWHA 1QEWA 4K5MA 5HGAB 4ODHL 3VFMB 4DAGH 1B2YA 1F4XL 2EYTB 3OKDA 4OKVB 4PI2A 4DN4L 3OKEA 3VWKC 5GGRY 4NP4H 5HTSA 3FW6A 4EBQH 5AZEL 1F97A 4HEMA 4X4MA 1L9OA 2VABB 3F5WA 1BXUA 1DANU 1IC1A 3QULA 1O7DC 2V9RA 3O3AA 3A4DA 4P2RD 4W6YB 4JX0A 1KBGH 2ATKA 2YARA 4TNEA 3OAYK 2QT6A 1TZIA 4UTBH 4Q6KA 1IL1A 3RY6A 5IB2B 3FQ1A 5EF1A 4QHLB 5GRJL 5IHHA 1A4AA 1U3ZA 6FABH 3CH1B 3JTSA 1BBDL 5I71C 3M6DA 2FB4H 1L7IH 2W94A 3HPLB 3IKCB 4WU5A 3PDOB 1TCMA 5EOTA 1VAHA 5FUZH 2PWGA 4UQEA 4Y5XC 4YC2C 1MHHB 3KPRB 3JV6B 1WZ1L 3BIAX 5MENE 3EO0B 4E9YA 1D5MA 3Q8FA 5EC2A 1KXTA 4ZK8A 1WT5C 2DLTA 2GVYA 3KBFA 1IAIH 1ORQA 3M1BA 5I1IH 4EXPX 4N0RA 2GI0A 1RU9H 3RZCB 4UT9L 3K8LA 5IWLA 3UBXI 1TJIH 1RMFH 3GTNA 4GNKB 2V6HA 3ESOA 2FNWA 3GPSA 2OR9L 2VLMD 4UMGA 3GSNB 2J56A 1JWSA 1AOHA 3HPJB 5F7BA 1FCCA 3W2DL 4JZJB 4FA8A 1WWCA 1WO2A 4TN9A 1AQHA 2BIHA 2VZTA 2XJLA 4G8GA 4JVPA 2WLZA 3MLTB 4RGOL 1CLOL 3ARRA 1FZMB 4IKJA 3VRIB 3BH9B 3MLZH 4TLKA 3VXTB 3K6OA 4OJEH 4DTGH 4XH2A 4MDIA 2GITA 2VDQB 4N86A 1AZUA 5IOPB 3SZKC 2E74C 5IFJA 3C60A 4WUKH 4PP2B 2VC2L 1TCRB 4P57A 4KKZA 1SMOA 4YGVB 5IFAH 3VD3A 3PGDB 3J2PA 2ROYA 3LEVL 3T77A 1SLUA 1IBGH 4QCIB 4FA7B 3ULSB 4F7KA 4M93C 4KX9A 5MEQA 4KV5E 5H94B 5DCCA 5GZOD 1D5MB 4DPAX 1RZQA 2H8PB 2AK4D 1O75A 4GP5B 5IM7B 5A40E 2O6DA 5ADOL 2B2XH 4ESKA 1IM9B 1CDHA 1OGAB 5ANMB 2YQ2A 4OZHA 5CHNB 1HFUA 4GRWB 4K73A 2R56L 3JTBA 1JZ6A 4JDEA 1VB9A 2WBWB 3OJVC 1H8NA 4WEMB 3DECA 4QNPF 4M48L 3QORD 3IJHB 2XQYG 5ANHA 1RIVL 4R4FH 5I1HH 1B3IA 4IM8A 4M6OL 5D1ZB 2BSSB 4MD0B 1KJVA 4RZKA 1RJZA 1T89A 4OJCA 4ODTL 4WWID 3SD2A 2N3JA 2BP8A 4OCXL 5DZOA 4HZAA 4GAYB 1QBMH 2BXYA 3GLAA 3C9NA 4G43B 1G9MH 2ERJC 3CXFA 1RZKL 1XTMA 3I50L 2IPUK 4QAMB 3IDXL 3QZPA 5A2KH 3TONA 4HF5L 1ZLWH 4LCCC 3RG1C 1WWAX 2ZXQA 4BGDA 5L0QC 3I02A 2G0KA 3GC3A 5HGHB 4LLYB 3OKLA 5B21A 4UM9D 1QRKA 4WCYH 2V5RA 5I0VA 5T5NG 2QPSA 5LBSH 3UERA 4BKLA 1L6ZA 2DQIH 3EOYG 4NLAA 4PTUA 4U1HB 4OCYL 3DYMA 2Z92B 3QDMD 2DMBA 3M1CA 3UDWA 3DJ9A 4OLWL 2HRPH 4D7PA 2Q3ZA 4N6RA 3T4AB 3UPRA 3C8HA 3DHMA 5GGQL 4N3TA 4Q14A 5IF0A 1MSPA 1CGYA 1WGOA 3PWUA 4NHUB 4Y1TA 1O5DT 5C08D 5K9OA 1OAZH 2DL9A 1PG7X 3MCLL 2FJGA 2OMVB 5HY9B 2KT6A 4JRXB 5E00B 3I9IA 2Q5BA 5L2KD 3CFDA 4UIKL 4GLRI 4GQPH 5FYKD 5KSBF 3CSGA 3GBNH 5ALCH 3EOBB 3REVB 3V6ZA 2CM6A 1URLA 4UILH 3NZ8B 4RETB 1BQRA 1MCPH 1GPOL 4UOW0 2OX5A 2QFPA 5HDQL 3TCLA 1NJ9A 3DTXA 4AIZB 2WLNA 3E7JA 4IBWA 3U7YH 3F3HA 2YEZB 2VDKB 4FYRA 4ZX6A 2N1KA 3MKKA 1TQSA 2VZUA 5GSVB 1JPFA 2G75A 3EJRA 2A99A 3D85A 2NRDA 2DJUA 1R3JA 4OB5H 3MA9L 2VW6A 3NJVA 2IXQB 3SJVA 2FEEL 1CK0L 2VLLA 1KPVB 4FQXC 3QIWC 5D1ZD 2B4CL 1Q72H 2V9QA 4NZFA 1MFAH 1UJ3B 1G94A 4JKNA 4PEEA 4FQHA 4B3VA 5CGMA 1IIKA 1PZAA 2BOBA 5E08H 2AI0H 5T3ZL 4PJHF 2ZKWA 3GXMA 1B3JA 5LB1A 3L3JA 3RLSA 1E9PA 4DFHA 2PYEB 1EMTH 3NESA 4TM9A 1RCYA 2Z92A 1DJGA 4YXKL 3OKMA 4P23D 5BQDA 1RPUA 2CPUA 2EDLA 4RCAA 2WLIB 3KVPA 3UYPA 3MV9E 1Q0EA 4MMXB 1UWEL 2A9ML 2WYTA 5CLZA 4CVZB 4D3CL 2QADC 3O3UN 3QJSB 2ZXWB 1SVZA 1XSOA 4YDZA 4G6ML 5LCVA 1NCJA 5I6XB 2H1LM 4RMRA 1FL3B 1W72B 1E4KC 4H26A 3U4BL 4UDUB 1Z9PA 2B4CC 1JWMB 2IMMA 5FUCC 3VD5A 3DX9A 2I7SA 3MLXL 4L3CB 4LAQL 1XCTA 4X5XB 1E5AA 3ULVL 2CSPA 1IC5L 3MN8A 1T21B 1JV5B 3WNMA 1FAIH 5SV3A 3KWTA 5CJOH 3EBIA 4UOZA 1UOVA 3MLXH 1UB5B 1JZEA 3FL7A 4MS8D 1A0QL 2IDFA 4EOWH 2Q8AH 2FSEA 4JUTA 3QUXB 2LU4A 1OT1A 3CFJA 3VCLA 2R0WL 5H2BB 4RWHA 4JFTA 4KVCH 2C9VA 3FTVA 3OXSB 3JWNE 1I8IA 3ESUF 3NCEB 3STLA 3WJJC 1FFNB 5FYKL 4MQ7A 2VXQA 1FNEA 5DXWA 5ID1B 1SJEA 5HI3C 5FKPA 4NQEE 3VG9B 1SPDA 4M6NL 5HGGS 5JHDA 1WFIA 2WLLB 2XWZA 4OGQC 4B5EA 4DZBB 3R8BB 4M6OH 1M05A 1ZSDB 3MCYA 5F44A 4TNWK 3CFEA 4OVVA 3ZDYB 1HOCA 2QPFA 5E99L 3C08H 4F93B 4Z7QE 2AK4E 3W0WE 2ZPKL 1IE5A 1S5IH 2NTSP 3BVVA 1Q72L 1QA9B 3STZB 3F85A 1AXSB 3LDBC 4BSJA 5A2BA 2AJ3A 1BVZA 4F80A 2V2WA 1G6RL 5C0RL 1SZNA 4LQ1A 3O6LL 3BZEA 2VRAA 3NA9L 2NNXA 4KZDL 1I1AD 4OGAD 5ANME 5I2IA 5J13B 3GMQA 4JBSA 1S9YB 5E1HB 1NMCC 2XETA 2EIBA 4OLXL 3IDGB 3V0FA 3WDIA 3UZEA 1PSKL 4RAUB 4XXCC 1N6QL 1CE1L 4RGNE 1GGBH 3VYOA 4LNRA 5IQOA 2IDTA 1P4UA 4FQLL 4DP2X 1OW0C 3RZCA 1BREA 1ADQA 1KMGA 4PJFE 1BLIA 4NQCE 1DBMH 4YX2L 3M1BB 1F4WH 2B16A 3LPWA 3QUKB 4WTQA 4NSKA 2A9AA 3JTTA 2ICES 1UM6H 3ESPA 4QTIL 2CRIA 2EC8A 2CBMA 2WZPA 2BIQA 2X4TB 4JRFA 3KBHE 4K4KA 1PKQB 3TN0C 1UD6A 1QLRA 2N7AA 5KSAC 3L9RB 2D9QB 3I3DA 4UOQA 5JIKA 3AU1A 1YAZA 5DUBA 5I8KL 4G6JL 2DLEA 1M7DA 1WEJH 4KDVA 3PHAA 2APXA 2W0LA 3L3OB 5EBLA 3GSWA 4FD0A 1JWUA 4WV1B 4AT6A 2R1YA 3OR6B 4I0PA 5AFAA 3QZNA 1T7ZA 4X7SH 4GRWE 2UX6A 1NLBL 4X42A 2FT6A 1SF3A 2XY1A 3VMOA 3L48A 1WBYA 2APSA 4PY7B 4OLZH 4ZO9A 3ZL1A 2GIYA 1J88A 3OR7A 2B9BA 3ENEA 1Q38A 3DIDA 3FT2A 1NOAA 4G7YH 4OQTA 3MV7A 2QHRL 4ZUUA 1GW0A 2GTWA 3FN0H 5DTFA 1M4KA 3V52L 2J8UF 3B9AA 3VDAA 3S35L 4JG1H 2YPLD 2YO3A 3BKJH 4LLVA 3O3DA 5DK2A 1ASPA 1ZXQA 1E4WH 1ZHLA 3TL5A 3JYCA 2DS4A 2E6PA 2R56H 1UURA 4R7DA 2E7HA 4EAEA 1UT9A 4YDIH 1JN6A 2C3VA 3STBA 1VSCA 1A7OL 4U33A 2OM5A 1MFUA 2P46B 3WFHA 5JXEA 2G3ZA 2X9ZA 2NT1A 2RH0A 5GZNA 1TVHB 3VXSA 3ARUA 5CGYC 2BHUA 4MA8L 5HDWA 1UEYA 3GQFA 5AZ2L 4QRPE 3IFLL 4KOBA 4YXLH 1AQKL 4A2GA 5CD5C 5EUKA 5KSVB 1AMYA 1M9SA 2W5PA 1EH9A 1A8JH 4IDJL 4N0YH 4FNLL 3KPOB 1YN6B 4NOFA 3RNQA 2R1YB 3OR6A 3CZKA 2J5WA 4P2RE 3V5KA 5DC4B 1OGPA 5FO9A 2K45A 1JNLL 1I3GH 1P5UA 3AM8A 4L1TA 3QS3A 2P1YA 3QZOA 1EXUB 1I9IH 4BSVB 2BY1A 1QSVA 4GRLB 2IAMA 4RFOH 3UTZA 4TNWF 2D4FA 3QUXC 5CEXB 2G2PA 1NCTA 2LLGA 3CFNA 1PKQA 3MBXL 4JPSA 4CDGC 3GKWH 4PHZA 1CMOA 2QKIA 3M1OA 1CVSC 2A9DA 3L3IA 1Z6JT 2CJTA 3DX8A 4FHKA 4MNHB 1YNKL 4JY6A 3QIBD 5AYQA 3R0NA 3TX4A 4HGKC 3NFPA 4LF3A 4ZQKA 2WHVA 3WEAA 2Y4SA 3PNRB 3MLWH 4XMKL 3ZE2E 1JK8A 2WCPA 4C58B 2G3XA 3LXUX 1QMUA 4K5OA 2VE6A 2N0MA 2DJSA 3WL9B 1IC4L 5HHOA 4D0BB 5IQMA 1RJYA 3P9LB 1MCSA 3RUGF 4G9FA 4Z1PA 2HLFC 1E90A 3G6JA 3LSOA 3T0AA 4CNIA 3FQXA 1VHPA 3FRUA 3MRCA 3MV8A 3Q05A 2QFRA 5C97A 5CKGA 2BVQA 3RDTB 3CFIC 3J7HA 4IBZA 1WUZA 4U1GB 4KZ0A 4UF7C 3H9SE 3N3EA 4Y9FA 1G0YR 1YPZF 5BOJA 3WNKA 2QV4A 1C16A 2BWIA 1A6PA 1JHTA 4LLWA 1A25A 1IGCL 2BM3A 3MREA 1DQKA 4KTDL 3O9WA 4WEBL 5J1AA 2O61B 4UIMB 2WQSA 3PF2A 1KGIA 2AEQH 2HSIA 3Q2WA 3QG6A 4R7LA 5KAQG 4U1LA 4XNQA 4N68A 5B8CC 3SPJA 1OWWA 4HWBA 3UO8B 4JFFA 2ZCZA 4O5LL 5HD8C 3L1EA 2IGFH 4TNGA 1QLEH 1WIUA 5LNEA 2Z7YA 5AW9B 2VDPH 5GPRA 4LARL 4KI5D 5HI5C 1OTUC 1P6AB 4A7QA 3QCVL 3IPFA 4KQ3L 3MOQA 5B39A 1G6RB 2XXMB 4HH9B 1USZA 1AQKH 4JVWA 4Z3GA 5I6LA 1NCUA 3MJ6A 2KMWA 5KTEH 1URZA 5DJXA 2X4RB 1SFHA 5D2LA 3RNKA 4GMSH 4OFIA 3DO7B 2GBUA 1RK0A 1YEJL 3MUY1 5D1XC 1OCZB 2X41A 1H6EA 1E6OH 1XTLA 4CVXA 1T0NA 3II1A 4YDMA 2YGOA 2XIDA 2XPYA 4EI6B 2AJVH 3FS9A 3V95A 2NLJA 3JWOC 3WS6C 1OD7A 4M7ZB 2VWEC 4FXKA 5IJVB 4L37B 4KH2A 3MRDB 4UQAA 3WFDL 2AV1B 1ZTXH 2YMTA 1KF9B 1M7DB 2A74A 4PB0L 3BCDA 5I28A 3CCHA 1NCHA 1Z3GH 3OAZK 3VU1A 1MIEL 4GS7C 4I9WD 1KB9J 4JR9L 1YHPA 4NO0D 4PJFA 4LRIC 3GS0A 1E9QB 4P8QA 2YAPA 3A6BH 3BWZA 3HN3A 4B5ZA 4BE6A 4TLTA 2PR4H 1MVYA 4HAFA 3NGBB 4Y16A 4S1RH 4Z7UF 4KGLA 4UMSA 2WXHA 1JDCA 3W0WB 1J1OL 2R2CA 5DFVD 3INUL 1F6AB 2JJTC 3FCBA 4HYTB 1D5IL 2WXJA 5GRVK 5J1TC 3JWOH 1KZYA 4HJEA 5GJSH 4B53A 3BVXA 1VFBA 4PRPA 3QXAB 1QSFA 4XP6H 3W0WA 3F58H 4APQB 3ELQA 3BZ4A 4ONHB 3BWUC 3JUZA 3QQ4B 1AO7A 1DVTA 2XFGB 4DOHB 3IGLA 5DWUL 4AEFA 4N20A 5K9QI 4HGWB 1HHGA 3HE6C 3WO4C 3OX8A 2ZOWA 5D1ZI 4KKAD 4JMNA 1VFBB 3QIUB 5I1LA 5T1DL 2O6CA 3RKPA 1A7RL 4I9XA 4AMKH 3FUNA 4JFDA 2EYSA 1U8OA 3RYMA 4GG6B 1AYOA 3DTXB 2EXYC 3QWQB 1BJ1J 5K39B 3I2CL 3EH2A 2RGSA 5F9OL 1U92A 2D03L 2P52A 2KDGA 4FQLH 4YE4L 5EOCJ 5F6HJ 3VWJC 1CI3M 3B3IA 1F86A 1YMMA 5DD3L 1YN7A 5IHUH 3QDGD 2C9RA 4RISL 4JPVL 5DR5H 4PJBB 4OLUL 2O5NA 2UUDK 3PP4L 4MX7A 4WENB 1OEZW 3HVNA 2YFOA 4LSVL 5C07A 2X4NB 1JVLA 2LLLA 3PLYA 2WGNB 2P5WB 2V37A 4BK5C 1A14L 3MJGX 3KPSA 5SWSE 3JQOB 5D7JA 4DCQA 1A2YB 4IK7A 1WBXB 5FYLH 3TV8A 3QO1B 3T3PF 1RK1B 3ARGD 3L95B 2X42A 2J4WL 1NBZA 1QFUH 3VFSB 4CUCA 4IU2B 3O9WB 4ADGA 4AYFA 1NIDA 3ILQD 4AM0A 5DMIH 3NCWA 3DBSA 4OLVL 2CBOA 5E2UL 2CUMA 4PTTB 4N5EC 4O58L 4TTDD 5GISL 5EUKB 5KSVA 4N28A 5IEKB 4OIIL 5F3HA 1FN4B 3TXAA 3WI9A 4XCCL 1IBHA 3LCYA 1AKJD 3PQYA 4AJYV 4W9HC 5I1JH 2WLIA 5JORA 1XR9A 5GRVL 1UT1A 4OQ1A 2GW5A 4HK3J 2A6JA 3ZRSA 4AW7A 1OCOB 5MENB 2E7LA 3R19A 3ZN6A 4AEIL 1WVZA 1KCWA 3L3JB 2ITEA 4RAHA 2AJSL 1MUJA 1E0OB 5I6NA 5ICXA 1C5CH 3OAYH 1SYVA 3ARFC 5I71B 4Y9GA 3DMMA 3S5LG 4JY6B 1CJYA 1T22B 4NNPH 5EPMA 5EG6C 3RWGA 5AZEH 4KRPC 4WHCA 3UGUA 5A2AA 4JPIA 2E7DA 2RFXB 1GIGL 4OM0L 3U1PA 4GFTB 1U8MA 4Y5YA 4LMQI 3HKFA 1HI6A 3GNML 4U2YA 2XPZA 4M4RA 4ACTA 2Z31B 3SYPA 3OPZH 5C0JB 5FECA 5DQ9B 5IVXB 4F7TB 1Q1PA 3MUUA 5AVQB 4AIOA 3OD3A 3QEGL 5D2LB 3RNKB 1DO6A 3ZT7A 1GTNA 2H9GA 4B27A 1V7ML 2AQSA 3RWEB 2DIAA 4ZI8A 3QJZA 3RWCA 3HZ3A 3P0YL 3WENA 4BK8A 2FX9H 3DVIA 3EH3B 3N44B 2VM3A 4B60A 1ZOXA 3UJTH 3FO0H 2AABL 4OI8A 4RQQA 1J9CT 1I9RL 3EYUL 3RY4A 3FQTA 4KQ4L 4FFYL 1ITBB 4I3SH 3LVEA 3T6QC 3D25B 3VD0A 2VDKL 5D7KD 5ILTL 1GKOA 1EDHA 1IGJA 5CMAB 3S3SA 1AGBA 4YHOL 2JKIS 4JDTL 2CBTA 4OB5L 4QAWA 2LU3A 2ZTBA 2R8SH 1KTDA 4M61B 1OAYH 5K69A 3N1QC 1T5WA 2ENJA 3FCGA 1KTJA 2C3XA 4YHKL 3VH8G