5LBSA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
446
structure length
394
Chain Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHDENRAKVEITPNSPRAEATLGGFGSLGLDCEPFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGGSWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system-viral protein
molecule keywords envelope protein E
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
total genus 79
structure length 394
sequence length 446
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbsA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbsA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbsA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbsA03
1RERA 4BZ2A 3IRCA 2GG1A 5LBVA 4L5FE 4GT0A 5LBSA 5B1CA 1SVBA 3N44F 1URZA 5JHLA 3C5XA 4UT9A 2JV6A 3UZQB 1UZGA 4GSXA 2I69A 4AL8C 5JHMA 1Z66A 3WE1A 3N40F 5GZOA 1OK8A 1OANA 4FFYA 2HG0A 5KVEE 3UZVA 3VTTA 3MUUA 3P54A 3UAJA 4X42A 3UZEC 1PJWA 2P5PA 4AM0Q 5AAWC 3I50E 3G7TA 2JSFA 5IZ7A 3UYPB 4FG0A 3C6EA 4UTBA 5GZNA 3J27A 1Z3RA 2JQMA 2V33A 5AAMC 3J2PA 5KVGE 3N43F 3UC0A 2R29A 5KVDE 4ALAC 5IREA 1TG8A 5H37A 5LCVA 3N42F 2ALAA 1ZTXE 1S6NA 4UT6A 4BZ1A 5KVFE 4UTCA 2R69A 4FFZA 3N41F 4UTAA 1OKEA 2H0PA
chains in the Genus database with same CATH superfamily
1FSKC 1UCTA 3CCHA 4LBEB 4QTIH 3VGHA 4UTAL 5FO2A 2X1OA 1B4RA 2EDBA 5EOQH 2A6DB 5L9DH 3ZKXC 2Y5TA 3MV9E 4JVUA 1H19A 2AEPL 3S37H 2W81C 2WVVA 1EUUA 1W0VA 3DKHA 3NSXA 2ZX7A 4OZFG 4HG4K 4YDKH 3FU7A 3IFLL 1ZT1B 3BH9B 4LOVA 3ZXAC 3D25B 3B2XA 4I2XB 1SLWA 1SJEA 5HHMD 5DK3A 3HJ0A 4DFHA 4LMQE 4XCYA 1SPDA 1JPSL 1KBVA 3DRTB 4B3VA 2VDQL 2WVSA 1IBFA 4HQQH 4X6DE 3IS0X 2RCSH 3B7UX 1RIVH 1UEMA 2YMXL 4OIFA 1DBBL 1ZXKA 4L3FA 1BXXA 4KNTA 1V10A 3L7FA 2A38A 3T77B 3C08L 4ZMYA 3V9FA 1X5GA 4MB1A 3BO8A 4YC2B 2OMXA 4OFKA 4JG0H 3SDDD 1FG2A 1Y1UA 4OGYL 2FTAA 1SXCA 1AOZA 4AZUA 1F4HA 4FLQA 2ZUQB 3TIEA 5EULV 5F3BB 2FRGP 2IXQA 1S3KL 4PLKC 1I7RB 4I1NB 2QKIC 4FNQA 5HHPB 3QNZB 4W9ZA 2BP8B 5AYUH 1AY1L 4TTDC 1NMAL 1SBSL 3W9DB 2AV7A 2H32A 3P4NA 3TOPA 4N2HA 5J6SA 3G5XB 3GSQA 4HIJB 5CN2A 3UYRL 2MHAA 1XF4B 2GJ6A 4ZMVA 3FC8A 4X8JA 1K4CB 2YK1L 3LNFA 1NDGA 1WG3A 4LLDB 3PGCB 4MCYB 2MSPA 5DHVA 1EHNA 3LZQA 1IKFL 3WKNA 5C08A 1GYVA 3CU7A 1TSHA 3IXTA 3PG2A 2W07A 3FT0A 3IJYB 4PJEF 2HFFB 2VDKB 1SLVA 3M6DA 5D70L 4XVSH 4EIZC 4ZMXA 2J8HA 3TPUB 4N26A 1A1MA 1UUSA 2PWDA 4JY6B 1UA7A 2EDRA 4R4FL 5ENWB 1YDPA 1MN4A 2R9HD 3X3FL 1UXLA 1SY6A 5KJRH 1JV5A 4GXVH 3BAJA 1NQBA 1BA9A 1G7PA 5I28A 5AVUB 4AM0B 2XTJE 5AENA 5I17B 3SDCD 3QCTL 3DHMA 4AXWA 2QL1A 1EEZA 4UUJA 4FADA 3G6DL 4LSDA 1SJHA 1T1XA 3WY3A 3NSJA 4Z7UA 4WU5B 3DX7B 4P23C 4QI3A 3UADA 1BMZA 1RJZA 1WAEA 1U8QA 2EQDA 2M8XA 4YFDB 1MFNA 4PRPD 4PN6A 4AQ1B 1E2VA 1YN6A 1U8IB 3HG1B 3QNXA 1DDHA 3GI8L 4PV8A 4WU7B 1IAOB 5C07E 1RAMA 3BE1H 1R0AH 3IAQA 5AWNL 1NFDF 1UZ8A 1KELH 2VDRL 4M43H 3MRMB 3TBVA 4CW1B 1MRCH 4D0BB 3KD4A 1Q90A 2BVPA 4KXZH 2ZUVA 3ZE1B 1DN0B 5CR1A 5MEND 2WD0A 1KBPA 4MDIB 1JAEA 5T1DH 3ZLQC 1VZHA 4ANVA 5SWZE 2AQSA 5DJ0B 3IDXH 3B2VL 4ONHA 3ZJAA 1JCVA 2VLRE 3QT2A 4JCLA 4W9GC 5K9JH 2V7NB 2VQTA 1EXGA 2H6PA 3TT3L 1FNSL 2A6JA 4XMLH 4NUMA 4AYFA 5HDBE 1A7QL 5LGJA 5KVFH 4NO2B 4A7GF 4ZO8A 4OD2A 4BFOA 5CNHA 4E41E 5ILTH 3Q1SH 1ONQB 5EDSA 3QZOA 1CG9A 1SMAA 2XNAB 1HZLA 1CXIA 4ISVB 1EJOL 4PWIA 5CJBA 1N9PA 2GFBA 2VW7A 4UT7H 3RWHA 3VXRA 4PRID 1AD0B 5EN2B 2Q76A 1DJYA 5ADOL 2BJML 5TF1L 4IGBC 1EUTA 3HR5A 4IM8A 5GJSL 2JQMA 1I1CA 3DMMA 5IQ9B 5I30H 3QUYD 2BNQB 3O4LB 4HFWA 2VWEE 1F58L 5GPRA 1NCGA 4WSJA 3DYPA 2WXLA 1KIQB 1MLCA 4GRWF 1S7SA 4I0PC 2MRYA 1THAA 4WNQA 3TTYA 2W0KA 1MCPH 2QVIA 2C7UA 3A0OA 3GEFA 4CC4C 2OMVA 3O2WH 5EU4B 3ZL1A 1BFOB 1JV2A 5LQBL 1WEJL 3ABZA 1INEL 3VAEA 1J5DA 4UZSA 3QFDA 1E8XA 4NGHL 4NQCB 4XC1H 5FKAA 1NCCH 4ZUSA 1A3LH 4IDJL 2VDPB 1TLKA 3LX9A 4L8BB 5HHQA 4ZUVA 1IBDA 5EC1A 4NKDA 2C4XA 3EFOB 4XN5A 5DD1L 4P2QD 2QPSA 3ZMRA 1Q9KB 5FCUL 4A7UA 4YQXL 4GO8A 1DVQA 5J5EA 2E9WA 5EBMA 4PJHA 4DEPB 5KYXB 1KN4L 3ARFB 4AYID 1B2WH 1IKNA 1WWWX 2IG2H 3VD4A 4FULA 3MROA 4A63A 3M8OL 4UT6H 4U0RC 3NK4A 3NFPB 3MRGB 3E2HC 3QIBD 5DO2D 3X1FA 3K2IA 3TBSB 3CFDB 5T5FH 3WFCH 4XWOC 5ERWB 3R8QA 4BWUA 2PYEA 5EZLB 5C3LD 2IWGA 4I13B 4LARH 3CHSA 1BOGB 2WN3A 3N9GH 2YPVA 2A2QT 2MKWA 3CVHH 4MA3B 3DO7A 4JNXA 4MMZA 2YPVL 4BFIB 4F8QA 1S8DA 1P2CB 1V5JA 3DOHA 3PUCA 5C9KA 4ODVH 1WRFA 3TO4A 4QHLA 1TJHH 1J9SA 4NAQA 2NNFA 2F5BL 3BEVA 5F9OL 3SGDI 5JNYB 3FU9A 4Y2DB 1WHOA 5DUJA 4A2FA 5AW1B 5EBWB 3W1ZA 1N3NA 3FBQA 1AHWC 2L3BA 2DQEL 1QKZL 4MBOA 4NQQA 5I73B 2Y06L 1H3XA 2ED7A 1TCMA 3EF7A 3FTYA 5D8JH 4ZW6A 1MRDH 5CBAA 5J11C 2X05A 3CDGA 3SJVA 1Q9LA 3NOIA 3IU4L 4I89A 4RWYL 1PG7H 3N5AA 2N0MA 1XFPA 2OSYA 5LAXB 3ULUL 4AEHH 4WW2A 1KPRA 4MQ7A 4FMKA 5IV2A 2YGNA 3EUDA 3NAAL 4NWUH 2ZUXA 2EXTA 2YC1A 4N0UA 2XY1A 1X5AA 4I18A 1DVXA 2WCGA 2R29A 2XVLA 3FT1A 3GDBA 1JK9B 2XZQL 1WSST 3QQ9C 3QNFA 4D8PA 2R29L 4TVPE 4JHWL 3EYVA 1BZ9B 3GO1L 3G08A 4BQBA 1IC5H 1UD3A 1XGYL 2ZWLT 2V9TA 4K7FB 2BDNL 3F6IA 2P8LA 5CGYD 5T1LA 4BQ9A 4JB9H 4QAMB 3RTQA 3MRPB 3KCPB 3GJFH 4C59B 2QLVB 5D1QC 1JZJA 1D7FA 3BQUA 1I3VA 2BRRL 4AKPA 2PKDA 1U4FA 2XN9A 2XLLA 4OZFA 4JM0A 3O9WC 3V55A 4TUUA 4FQLH 2ZNXA 3C6LA 2P42B 4MSWB 5IFJA 1KCBA 1MJ8L 1N26A 4R0LA 3UTPE 5DC0A 4FQXA 1FA4A 5FECA 4FFVC 2MJWA 1CD1B 2WTRA 4PJXF 2MCPL 1MY5A 4HCGA 1E4XH 3MX0B 3QHFL 3WEXB 1I1AB 1QRKA 2LTQC 5IGXH 5GRUL 4APQD 4NS0A 5C0CA 1ZJAA 4IS6A 5JW5B 2IWFA 5IM7A 1P53A 3PXLA 5HI4C 3PNRB 3QDMB 4V1DA 4F5CA 2EC9T 1HJBC 2QVMA 3LXAA 3ARBC 1BAFH 2J3SA 1JYXA 2X2JA 2OKMA 1QSFB 3NT0A 4UT9A 3S36L 3QRFM 1PY4A 3T0WA 4Z7WB 3TONA 4XO3A 3D85D 1WTLA 3P2TA 2ZAGA 4HJEA 2CDEA 3P9MA 5IW1A 4WAFA 2ADGA 5AW3B 4GS7C 3HG0A 2L8AA 4MFHA 3L3DA 5DUML 3W2DH 5I6NA 1QEWB 1FL5A 2QPFA 3ES6A 5ICZA 1T04A 4MLIA 3B34A 4FQJL 3VD7A 4H8WL 4WUUE 4J3OF 1UOLA 3CLEH 5CJQL 1N5AB 2D3LA 5C71A 3QCUH 3FAWA 2BNRD 1UADC 5D5MA 4RFNC 4YS4A 1NCDL 3V0AC 3V2AR 3ARRA 4J3XA 2G30A 5HJ3A 1HSAB 5F6IB 2V2TB 2ORBH 1JUFA 4U6YA 3LNGA 4P5TD 4LFHD 4KZEL 1MDTA 2A7BA 4OM1L 4KK9D 1M1XB 3VRJB 3P54A 1JG9A 2UUDK 1S5HB 3GS7A 1EMTH 1FSKB 1R3LA 1X5XA 5I5IA 4DGIH 3TCXA 1NBYB 1MFAH 3D4ZA 4JPIA 3DYOA 2DMBA 3CFKB 3LSOA 3ZKXB 4AMWA 2SEBB 4KMLB 4JRWA 1CE6A 1ECZA 4GQZA 3QR1A 3UPAA 5C0GB 4RCAA 3O11A 4FXLA 4XBPA 3TBYB 3ULVC 2GAZA 3VFGH 3MV11 1MF2L 2XV3A 3WIIH 1ADWA 2JB5H 3G5VB 2ZCKH 1H9DA 2DQGL 2Z35B 4JX0A 2R0LL 5E8OB 2PUQT 3IJ7A 5SX5K 3X3GL 2CMRL 3S8FB 2F74A 3PWPD 4JY5H 4U7SA 3IPEA 1IO4C 2AI0H 3QI9C 4TSCL 4E9WA 1CFMA 4WFFD 5HVHC 5FLUA 3EFDH 2VB5A 5MEPA 3DXAA 4HLJA 1MWAL 1RMFH 1MHCA 4DKEL 5AVZB 1GYUA 1PLGH 4JDEB 1HTYA 4UDTB 4Q8BA 1F11B 1LGVA 5BJTA 1H8LA 1RSFA 2E6QA 3KWWA 1HILA 1NJ9A 1P1ZB 1VACB 2D4FA 4U1KB 3SCMA 1OP5H 4A67A 4F8PA 5IJDC 3RRQA 5D4IA 4QY8A 2YJQA 1P9MC 1WCBA 4G80A 1HCFX 4ABQA 2DQ6A 2QGEA 4PRDA 2LV4A 5IT2H 5BVJB 5I1LB 5F0JB 4WW1B 4KQ4L 2ED6A 1G7LA 3O3EB 1N0LA 4TNGA 3KGUA 2VUYA 4PS4L 1IAKA 4JFYA 3D05A 2CNYA 2AKRA 1I9IH 1D7CA 2BX5A 3F05A 5LCVL 1GZPA 1DHKA 2VITA 2BY2A 2CR3A 2ZAHA 3FSWA 5F8QC 5F7AA 4YAQB 4LF3B 2E7LA 2CHDA 3FTGA 2R0KH 4JFHD 2GY5A 3DURA 3LKOB 4JFEB 3FTWA 4NYLB 3HNTH 1KBWA 3DPDA 4YXKH 4ENEC 5IHBA 1JZ4A 4MJIB 4DERA 1KSRA 3QP3A 3K4ZA 3ZKQD 3UTTD 3UJTL 4NN7C 3VW3L 3ABLB 1P4LB 2QHRH 4Z7VB 3SYQA 3BT0A 3PWJB 1A3ZA 5I0DA 1BQSA 1HHHA 4S1DC 3SKMB 2O1AA 4JLRB 3P3YA 1M7IB 2NY5L 5F7DA 3G9AB 3FB6A 3FONB 1B0GB 3BT2L 5DRWB 2I07B 1JYVA 3C5JA 3HC0A 2APSA 4XMZA 1U6AL 3CSFA 1QO3A 4ZUWA 5DJXA 2IIJA 3P30L 3T09A 4C47A 2K8MA 2XXGA 2IDQA 1YMHB 1MCBA 1CT8B 2ED9A 3CBJB 3KEDA 4OKVA 2YGQA 1JNLH 3K3QA 4F2EA 4S1RL 1V3MA 4WFEE 1KNOA 2QSQA 4YFLF 2P44B 4JKPL 3VXMD 2A74C 3LVEA 1KN2H 3DI3B 1W8OA 4PRBB 2ZCLL 4P23B 4YNYB 3HAEB 4X83A 5T3XH 5GZND 1FC2D 3RY5A 3UYPB 1U2CA 1FFPB 1X7SA 2BVTA 4NHCH 4UIKH 1ZT7A 4EDWL 3LKQB 2W9EL 3LHAA 1QFHA 2MCAA 3H4FA 3TNMA 3VWJA 3TYFB 5F6HI 4WO0A 3CX5K 1O6TA 2IEPA 5AAPA 3QZWB 3AS2A 4P2RB 3KPOA 1PYWB 1WD8A 4EO5A 5C0BD 1AXTL 3CZFA 5DZOA 1IEAB 4B60A 1ZSDA 4X7EC 3HN3A 4P57B 4L23A 4ZQKA 3ECBB 3IT8D 1OHQA 5DQJA 3FUJA 4U1SA 3BN9D 2PO6C 5TJWK 3CPLB 3RVWD 5BV7L 3UYOD 5IROC 4LSTL 3GJFB 1LILA 2GC4C 3DVNA 4X0NA 1SJMA 4OY9A 3LH9A 5G2NA 2OTPA 3WUWB 3KGTA 1TIUA 3MJ6A 3I3EA 2ZOLA 2QMKA 4HPYH 3TBBA 2CIKA 4AKOA 2IADB 3CFIC 2AP2A 3A4EA 3V9EA 2WIIA 2BSDA 3DDFA 3IPFA 1ZVSB 3SGEI 2CJUH 5KTEL 3D50A 4G8FB 4Y2LA 4Z5RB 5TD4A 1FWXA 4JJOA 1AS8A 5E6ZA 4HBQA 1QQDA 4QR7A 2PR4L 3DDGA 5DD5H 4OI8A 3MLRH 1LJMA 1PZAA 1CICA 4PJBB 3WJJC 2E56A 4B5EA 3AQDA 4JM2F 1J88A 1L0PA 1E5AA 3VQLA 2DYPB 3WMPA 3QIUD 1I7ZB 2CO6A 5IB2B 4EI6B 2BY0A 5KBLA 3LXCA 3HJEA 4XXCA 3WHXA 1E4JA 3KEHA 3OMIB 4PJGB 4HUVA 5JUEL 4N9GA 5JDJA 3ZIYA 1AO7A 4XMPH 4I4WA 5AB2A 1T0MA 4GG6E 2AXGA 4LVNC 3RX9A 3B7TA 3GRWA 4I0PB 3HKZA 3DK2A 3M7OA 4KGJA 5IMMA 1ROCA 1IQDB 3GRWL 5AAWA 2WWKO 4AEIH 3LQAC 1NBZA 4KXCA 3U1SL 3QC5X 2E76C 3C5ZA 5E6ID 1EGJA 2EXWC 1I1FA 3AGWA 1OPGH 1ACXA 2P5EA 3CFTA 4OZ4B 2ZT9C 1EGJL 3U82B 1VADB 4QRPE 2IAMB 3L5XL 3PHQB 5GS2D 5JO5B 3MBEC 4OUUA 4MAYD 5E8PB 1HYRC 1W9XA 3GZQA 4Y9FA 3SDAA 4TOYH 4KRMB 3ARVA 5FA3A 1RJCA 1NEZA 3PGDB 1I1RA 3ZT5A 1YNLL 4ZODA 3O6FA 5H2BA 4ELMB 2BSTB 2O6EA 3MJ7B 2WQAA 4E42B 3E80A 2XQYK 2CHWA 4JRXD 2EYSA 2NXZD 1HL5A 3VGGA 5D1XB 3FHQA 3VQ2C 5B7FA 5C0RH 1EK3A 4PRHD 3E2HB 3GUFA 2ZD0A 4OGXL 5D7LB 4LPWA 4OTXL 1S9KC 4MA8H 4ODBD 3BVNB 1GMIA 1N8ZA 5E9AA 3RWGA 2PCPA 3EDFA 3GXDA 3ZSSA 5E1IA 4JRLA 3PAUA 4ZFGH 5D7IF 5GS1A 1F1DA 3GXNA 1PY9A 3CZLA 4ZMOA 4JQVA 3FZUC 1X5KA 2P9RA 4LU5L 1VESA 1RJYB 4KAQL 3E3QE 4ZTPH 1MCWM 3A4FA 4UQ9A 1SN5A 3FN9A 2DYSB 3SGKA 3SBRA 3PL6D 2H6OA 2MTPA 3EJRA 1AIZA 1OB0A 5FUZL 4ZMPA 1JPST 1JDDA 3C87A 4KH9A 4NHUB 1LMKA 3UBXI 1AHWB 4UOQA 1Z32X 1TQUA 4L4TB 4J4PC 4R96B 5JYLA 2RAMA 4H20L 1Z0NA 1XIWD 3QIWC 3QORD 2VDLL 1NFIB 5J11B 4OF0A 1EHAA 3QG7H 4JZOB 3KPRE 5E8DL 1RERA 1JGVH 1KACB 1S9WB 2J8UB 1OTUC 1PFCA 1TMCB 4W6WB 4Y5XC 4CADA 3HS9A 5A2AA 3JWOH 4IRJD 4GP5B 1N18A 3UJJH 4BUGA 1RULH 1T2QL 3B3BA 4F37F 3N0PB 2ZX5A 2IALA 3TIDB 4UU9A 3SE9H 4Y19E 1IFGA 3OM3B 1JPFB 3FB7A 4QJ5B 1CDBA 3CXHK 2DKMA 2GIYA 4JFZL 2MNJB 4OAWB 5EZOL 2FYYB 3T0ED 1ND0B 3FQXB 3ILPB 1ZA3B 2NY3D 4C56E 2XVBA 1DVFD 2HX7A 3FO9B 1ET8A 2QVKA 3QUXA 4YFLI 1K8DA 4CVXA 4Z0BL 5IHLB 4UDUB 4XP6L 3UTSB 3VMPA 1F3RB 2FJHB 1WLHA 1PSKL 1DBKH 2JIXD 5D1QB 1TETH 3ZE2E 2DQCL 3PIQB 3U79A 1U3ZA 5M94B 4OCMC 32C2A 4C57C 3RFZA 4GIOA 4I5BA 2J44A 2B4CL 4EOWL 5I8OL 2GJ6E 1SEBB 4PJIB 3PWLA 5HXMA 1WT5A 4XNMB 3H9HB 4J12A 2LTQB 2V2WA 5CGTA 3H7LA 4Z1PA 3UIYA 3LJ3A 4ALAH 5HGHA 1F6FB 3I9IA 4MWFB 1UWXK 1F86A 4Z7QE 3ARBB 3UPRA 4EKJA 1PDKB 1ORQA 2YRBA 5TF0A 3RNQA 4R6UA 4IHOB 4HVBA 1W15A 4ZX5A 2FZ3B 4M7KL 3BPNC 1RK0B 2EDHA 3U1PA 1NEPA 5DWUH 1RIUL 1G4RA 1Y1DA 3NZ8B 2VKWA 4IBLT 4FABL 5CWSB 3GHEH 4ZTOH 3HMWH 3DBSA 1EBAA 4M7LH 5A3IC 2GJZA 4D9QD 2ZYSA 4OLZH 1RZGA 2ZIDA 3MRLA 2MQ3A 1HZHH 1QFWI 3TJEL 4OCSL 2FYVA 4NFCA 4Z7OF 4RFNB 2WUCH 2J88L 5FYLH 1UCBL 3MRFB 2E7HA 3WLBB 2I9LA 1GAFL 4G1MA 4YDIL 3UO1L 2VMEA 2DEXX 2R0ZL 3P77A 5DEGB 3TFKD 3HRZC 4N6RA 2PXYA 1EZUA 1E5UI 3F5WB 4J3SA 4EIUA 3QDAA 4B9YA 3EH3B 4F7MA 3I9GL 1RI8A 2M2DA 5DYOB 2BZ7A 4JFFB 3OAUH 3G5ZB 5ICYB 2EDYA 3JVGA 3P3UA 4ZNEE 3BP7B 3OKNB 2K7QA 3GYRA 5HDWA 4U6XB 2ZE0A 5LBVA 5HYQA 2Y5EA 4PTTB 1TZIB 2JWYA 2A9AA 4UAOC 4UQ2B 5EUOB 1CGSL 1EEQA 2VSMB 3Q8BA 5HJBA 3IGAB 4NNYB 2PTTA 4KOCA 1XF1A 1TYRA 5D1ZD 4P49A 1TUPA 4YHIA 1Z5LA 3FB8A 4ZAKA 3LNIA 3ZRFC 3K71A 5DYFA 5A1AA 2PN5A 2EUWA 1L5GB 1ZIAA 1N10A 3QI9B 4GRMA 5HVHB 1J12A 5GRZA 3JWNE 3LKNB 3SBWA 5C0JB 1TJIL 2AJSL 3AU0A 3IDIA 4FEMA 3WMQA 5CAYB 2H3NB 4OI9A 1DFBL 2C1PB 1J1OH 5L0QC 2ETWA 4X8CA 1CFSA 1G7HB 4L8DA 1IGTA 4S1SL 2F7IA 3WIAA 5GGTH 2OTUA 2G2RB 3IDMA 3CXFA 3FSAA 4HOXA 1JL8A 3MNWA 4LSPH 5KSAD 3HKFA 4MKTA 4AK2A 4P2YA 1DANT 2VSCA 3ZQ9A 3APNA 2A3TA 3NIDB 3VGDA 2PPAA 2FJFB 4PIRF 2Z4TA 3O2VH 1Z0MA 1J0HA 3S2CA 4ZNCD 4P06A 1OD9A 3T1FA 1OCRB 4WO4B 4Z7UF 5BZDB 1KMGA 5JIPA 2H47C 5DGQA 1MRFL 1RP8A 5EC2A 4TVPL 1ADQA 1ZLWH 3M86A 2YWZA 3QDGD 4NUGH 2KS0A 1ADQL 2FVNA 3CHOA 4AYMC 2NNRA 3QYCA 3WKYA 4M7ZC 1DO5A 1H3PL 4NN7B 4E0RB 5E5MA 1E43A 4JMXA 1YEJL 4K94H 4Q97A 4FNLH 4H5SA 1MJJA 5GGQL 3GBMH 4ZYKA 1R3KA 4N90E 1YNTA 5L4IA 4NKIH 4OF6A 4R8WH 1IM9A 4XX1E 1JZ3A 4HC1H 5DWPA 4CBPA 1ZVHA 2NY0D 1WFUA 3L3JA 1I9RL 4F8LA 3BC9A 2G0KA 2LOEA 2B2XL 1E4HA 1TZHB 2VR5A 3WS3B 3F58L 2VDMH 4FX5A 4WI0A 2XA3A 1TPXC 4DP6X 4ONOA 1EHXA 1H3TA 4PJDB 3NTCH 2BSRB 3HZ3A 5K9OB 9CGTA 3BKML 4EQ3A 3RX5A 3K6SB 2G9HB 2G3ZA 2A74B 2UZYA 4L48A 1I8KA 3V5KB 1NIAA 1JTPA 3MODH 2JJUA 1KCRL 2ADIB 1TZGH 4LBEA 4AIOA 1RIHL 2RB8A 4XPAL 3H3PL 3ESUF 2A6DA 2F5AH 2D9QB 1H15B 4GIPD 4H4NA 1A5FH 1LO0H 1Q94B 5CSBA 3KR3L 4XN4A 1NGWB 2B8OT 3EHBC 3ZRCC 3TASA 4OF7A 3WENA 2FR4B 1ML0A 4QHKJ 1ACZA 2OYKA 1RVFH 1ZT1A 3OF6D 1A22B 1NGQL 1AFVL 2J1XA 3BH9A 1CGTA 1XZ0B 3D25A 3H1ZA 1YQVH 4XVTH 4I2XA 3KL5A 2PO6B 3UTQB 1L9OA 3WJMB 2I5YH 2DBJA 1R3JB 2GT9B 3DRTA 4M8UA 2MTAA 4C8XA 5TFSL 5CJOL 3QJFB 4I3RL 3SJVE 1ZANH 3A3YB 3LN9A 5C6TH 4F27A 5C92A 2IC2A 3WTTA 1S7WB 3MNVB 4MZRA 3FCTA 4RBPH 3TVMC 5ACZB 4YSEA 4JUTA 3T77A 2OMWB 2H2PD 1NL0L 4L3ED 1UOWA 3GS4A 3BPCB 4J28A 2K9UA 1OCWH 3C9NB 2AJZB 4NZUL 3AC0A 2Y1AA 2BP5M 4DN4L 5F3BA 5L7XH 2GJPA 1I7RA 5I23A 3C09C 5HHPA 3IKKA 3QNZA 5FYJL 2F8XC 2BP8A 2J1YA 1IAIM 2EIDA 2WP3T 5I1GH 3W9DA 4HS8H 4PYGA 5E08H 2ARJB 1OAXH 2FO4A 2W80C 3G5XA 1BVKB 2H0FA 2XN9E 4HIJA 3QISA 4K15A 2VR6A 5J3HC 2YZ1A 1K4CA 2D3NA 3K80A 5K9QI 3OPZL 4MX7B 1VERA 5CKGA 4LLDA 2CU9A 4JL2A 3PGCA 4MCYA 1HU8A 3MRCB 4LEOB 5M7QA 3MUJA 1KGXA 3IJYA 4H8QA 5C0CE 2HFFA 3AB0C 1X5HA 3HBGA 2YPLE 5KS9F 4YDLC 2LE9A 3CZEA 1OAUL 2I26N 2VDKL 2EDMA 5DLLA 3TPUA 2IH9A 3K0WA 4E9VA 4YZWA 4M62L 4JY6A 4ZD3H 1KEML 5ENWA 1NEUA 2E47A 1AR2A 4G7VH 4E5XG 1UJ3C 3VGAC 2CK0H 2AQQA 3L1GA 2P47B 2WXGA 5BS0B 3MLWL 5E2VH 5CCKL 3T4YB 2IF7A 1D6VL 4AM0A 5AYQA 5I17A 3RWDB 5EFIB 5DZLA 2EO1A 3BWAB 1FVDB 4XPBH 3ULUF 1VB9A 4NQSB 4LP8A 4PIBA 3ROLB 2OI9C 4XGZB 3WG7B 3THMH 4CVUA 2Q8BH 1BZDA 4WU5A 3DX7A 5EEUA 1I8UA 5SWSB 3GTTA 3V0JA 2NY2B 1ZK5A 4AQ1A 4JCMA 3HG1A 4WU7A 3BLPX 1IAOA 2B15A 2VXUH 3BAXA 5JHMA 3B7RL 1YPZB 4GAYB 3FRPG 4GW1B 3KXFE 3MRMA 4CW1A 4D0BA 2D9CA 1DVYA 4IOSA 3LZFH 2W0LA 3HC4H 1ZE3C 3NJLA 4EUPB 5LGKA 3O3BB 1DN0A 2Y7LA 4QDGA 4DPBX 3RDTC 4MDIA 4XXWA 3BI9X 3LN5B 2A5UA 3WFEL 2NNAB 3EFFB 1QHPA 4M1GH 3B9VA 4FQCH 2HVBA 1AHMA 3V6OA 1LK3L 3AW5A 2VN5A 2XQBL 3HVNA 2GI0A 3QO0B 3NK3A 4JG9A 5C0ND 2X53A 2DICA 3K1DA 3VXUB 4NO2A 5E0QA 5B3JF 2FECL 3KM2A 4Y5XB 5KYUB 3H7BB 2J5WA 3UC2A 1A65A 1NPNA 2I85A 1ONQA 2YD8A 2OZ4A 2G3NA 2VRQA 4FFTA 1GXEA 2XNAA 1JZ2A 1YYML 2OZ4L 4HJSA 3MACL 4ISVA 4PJ9C 4CRPA 5I16B 4L18A 4Y4KD 3FQNB 3OQRA 5EEZA 2AK4E 3KPSB 5AVTB 3QUMH 1MFUA 1JD7A 1SNRA 3B5TA 3IEAA 1PZSA 3IJEB 1AD0A 1FORL 4MQSB 5EN2A 7PAZA 1YEHL 5LXGL 2WQUA 3PFQA 4FFWD 1JGLH 5IQ9A 3LB6D 2BNQA 3O4LA 3L4UA 1SUHA 1P4IH 1KYFA 5DT1L 3NZHL 4HWNA 5CGYC 2BSCA 2WO3B 4GBXD 1KTCA 4ZW7A 4FP8L 1D2OA 2ICEC 1CZ8H 1RZFL 2NPLX 5D5MF 1C5CL 3QQXA 4KO6A 4WTXA 1A6UH 2BVQB 4HBCH 5SV3A 3H4HA 2HVJB 2R56L 3MLYL 4HEPA 3ASWA 1RZ7H 2VR9A 3PUUA 1BFOA 3MCKB 3MBXL 2ARWA 3WY4A 4OF5A 1L6XA 2HJKB 2ZPKL 3MYJB 3Q3GB 3LEYL 3P2BA 4NQCA 2YKLH 4WCYH 4IIZA 1R3HA 3BIKB 2WXMA 4L8BA 1Q0XL 4XNAA 1GH7A 1T83C 2K45A 2VDPL 4QTIL 5JQHC 2WXIA 4M5YH 1IM3B 4U05A 2X4QB 4F57H 4HPOL 4IOFD 3EFOA 5L9DL 3CVDA 1F4WL 3ETSA 1Q9KA 5FAAA 1A3RH 2LVEA 3BPNB 1LP9B 5AFAA 4YJZL 5KYXA 1DQML 3ARFA 4KKAC 4UOW1 1TNMA 4YDKL 5ABDE 4LKXB 2W1NA 3Q2WA 4P5SA 5T1MA 3NFPA 3U9WA 3FT3B 3MRGA 1T66D 4X6CB 3HE7D 3TBSA 3CFDA 2DLHA 1F2XK 2Y24A 1UXSB 4B95C 2JJWA 2VJXA 1OP3H 1ZLVH 5EZLA 1G9EA 1YJDL 4PHZA 1BOGA 5FGCE 4A6YB 1USQA 4MA3A 4OLXH 1DUZB 2F7OA 1WZKA 1EIBA 2RCSL 4XO5A 4BFIA 3FOLB 1HQ4B 1P2CA 3R19A 2G5UA 1ZTXL 3CFCL 3WGUB 3QWRA 4R97B 4YSDA 3HRZB 4Y4HC 3RGVC 1KYAA 3NUKA 3S4SB 4YK4C 3OKMB 1OSZB 5EU6D 3U83A 4Y2DA 3QZMA 2P26A 3OXSB 4JG0L 4QAWA 5EBWA 2HRGA 4N2KA 1AGCB 1PKQE 4LLWB 4X42A 1KXHA 4RESB 4ZUUB 1FG9C 1OQXA 2BSBA 4JRYD 3B9KD 2TAAA 3L5JA 4AM0Q 5FOJA 4UAOB 1GY2A 4YSSA 1OAZL 1TT6A 1DQIA 3KS0H 3KLKA 4KROD 4WUKL 2Y7QB 5AYUL 1OF0A 3V95A 5LAXA 1UWGH 1SFDA 3L45A 4KJYB 1G7JB 1NC4B 1M71B 1PNDA 4BA8A 4EN2A 4ODTH 1VZGA 5K39B 4LT7A 3TJHD 2X87A 5A7EA 2YD0A 3BGAA 1DQDH 2P52A 5CU5A 2EUZA 3AUWB 3MLXH 5DFVD 3P73B 4CILA 1XXFC 3NIFF 1A6TB 1JK9A 3AY4C 5L0QB 5FYKL 3FT9A 4GKLA 4PCKA 3TL5A 5DSCB 1BZ9A 4HT1H 3DVFA 4DKAA 3TWCH 1I4FB 3ZE0B 4PS8A 2E7DA 4ZXBD 5HHOB 3ABKB 4KI5E 4OFPA 2VQ1B 1BEXA 5E1AB 5CGMA 1GHFH 2BIHA 2WLYA 3KCPA 3MRPA 1P1VA 4XN2A 4LEEA 1X9UA 3PWNB 4RA3A 3WNJA 3FFCE 3VQ1C 1GS8A 3GSNB 3DX4A 1G6VK 4GXVL 1AO7E 2DQIH 3OKYA 5HPMB 1WGOA 5DA4A 2VN3A 4MSWA 3H9ZA 1FIGH 4JFTA 3EOBB 2JKSA 1AC6A 1CD1A 1HIML 4FQIH 4ZS6D 2B3IA 3MX0A 5C0AD 1K72A 3O3DB 2H41A 4G6AC 2M26A 2AAVA 1I1AA 1WK0A 2CO4A 3VDAA 3WEXA 4OV5B 4GQPH 4PJCF 5JW5A 3OR6B 1BLIA 5KVMC 3QDMA 3KHOA 4H25B 4M7ZB 5HDLA 5GRYA 5ICXB 1B6DA 2XOTA 2DWDB 2EEAA 3U2SB 2UY7B 1QSFA 2RJMA 3BZEB 1BZ7B 3BE1L 3H9SD 1QTYT 4ANUA 7FABL 4Z7WA 1R0AL 2KDYA 4WEBH 3SZKC 1KELL 2A77H 2VM3A 2OZNA 2ROYA 1HYSC 3NJNA 3TWYA 1JDCA 3QHZH 1QYGH 3K7UA 4HD5A 1AQDB 4N24A 1QEWA 3QJRB 5J9PB 3OD3A 4ZK8A 1TPXB 4D0CB 4HJJL 4HP5A 3H56A 1EV2E 1N5AA 1ESOA 4JZNB 3S3DB 5K9JL 5BRZB 2ZQKA 2E8ZA 4BKSC 1HAUA 5J1TC 3TF7C 4XMLL 3LOWA 3GSRA 1HSAA 3AU1B 4XI5D 5B4MD 3RVXC 2V2TA 5KVFL 1OOAA 3VRJA 4K7PY 1S5HA 3MCYA 4PJ8C 3KW7A 3Q1SL 3HI5H 4B7IA 5CN3A 1NBYA 3CFKA 2N7AA 3TBTB 3PCYA 2SEBA 4RGND 4LPUA 3WBDA 3EHBB 4IBVA 5AL0A 5I15L 1GW6A 3DJTA 4JRFA 4UT7L 5FKPB 3EYFB 1AZBA 3FUHA 1ITCA 1QI5A 3TBYA 4DTGL 3SDXE 4RMBA 4MNQD 4FLSA 3HC3H 3G5VA 3C8KB 2IDUA 4BH8B 2Z35A 2Y6SD 5E8OA 3LEVL 1OY3B 2WTOA 4IBWA 5TPWH 5HHNB 5F21B 1XGPA 2XPZA 4L4VD 2NY6D 2C26A 3CSGA 3P40A 2UY6B 4FMVA 4OFVA 4PP2B 3WKML 5I26A 1KB5H 1BHGA 2W9LA 3EJUA 3VH8G 4D9RD 4DEWA 3T6QC 1NBVH 3FMGL 1LDPL 1HINH 3T2PA 4K3GA 4PMFA 5B38G 2DYRB 3TVMB 2DEWX 3OKLB 4JDEA 1R4XA 4UDTA 4CGTA 3O2WL 1F00I 1VRSA 3S9DB 5EIVA 3IFNL 2IJ0C 4U1KA 3P4LA 2UZXB 4HEME 1P1ZA 1VACA 2LW3A 3U6XA 1O9ZA 3HN5A 1KFAH 4K8RD 1OM3L 4XVJL 2R2HB 4XC1L 5D7KE 4JFDE 2CBQA 1OAJA 1A3LL 4HSCX 2HT2C 5BVJA 3DIFB 5I1LA 3WELA 4P9HC 1JPTL 2F54E 4WW1A 3VSTA 5IFHH 3O3EA 4IRZH 4FJ6A 2D7TH 3BUIA 4Z6AT 3B6SB 5IBLD 5FYLE 1UFGA 3C09B 3D07A 4PJAE 4QTHB 4YE4H 4CJ1A 4JGNA 2O5YH 1K85A 3IMBA 5JXEC 1JGUH 1FIEA 5LBSA 2XPGB 4LGSB 4DN3H 3CFUA 1W8NA 2DQHH 3BXNB 3DX2A 4YAQA 4LF3A 2I32A 3WTUA 3LKOA 4JFEA 4A68A 3PREA 2CCVA 5T5FA 4NYLA 5JOFB 2D03L 1KPVB 5FHBH 4MJIA 5T5FL 4J3OC 5DS1A 1NANH 1UUNA 2FNWA 3CDZB 4JPSA 5ESQB 1TJXA 1HKLH 1P4LA 2A9CA 2EC9U 4Z7VA 4IKIA 4LARL 4ZOAA 3BD3A 2Z93B 5I76B 3N9GL 3PWJA 3AB0B 3OC5A 3CVHL 3SKMA 3SD5A 3ZBMA 4X5LA 1M7IA 4PVMA 5JW4R 2WANA 4Q89A 1U8KB 2YD2A 5J12C 2VABB 3FONA 2FAUA 1B0GA 4FJYA 4IOIB 4ODVL 3UAAA 2N1TE 4X7TB 5DRWA 2I07A 4CC0A 1UGNA 1TQBC 4LBAA 3TEYA 3VGAB 2VTFA 1AVAA 3SQRA 2EDQA 1NAMB 4BUHA 1BF8A 4CMMB 1YMHA 4JPQA 2Y5QA 1CT8A 1PNCA 4HOWA 1JHLH 1P84K 3K6DA 2N3JA 1X5YA 2OI9B 4KUCF 1CQYA 1HNYA 3K46A 4PRBA 1UOKA 1B0IA 4P23A 4YNYA 3HAEA 5FM4A 1TVDA 3BD4A 5TK4A 3UYPA 2VUOA 1PG7L 4FG0A 5F7EH 3W11D 1FFPA 5JHDB 3LKQA 2LFGA 4PJ7E 4GUCA 5D2NC 5FO7B 1ZKAA 4XCCH 1A14H 3TYFA 1J9TA 2DDQL 4XZUB 4DUWA 3QZWA 1E8ZA 3WY2A 4P2RA 1IAIL 2GB2A 1JVKA 1PYWA 1CDIA 1U2YA 2EYTB 1YNKH 1F90H 1KENL 2EDLA 3QEQE 1NIBA 2D0FA 2IANB 4P57A 4UQBA 1FE8H 3OV6A 1EAOA 1EO8H 3D30A 3GSVB 3RDTB 4J23A 2YD7A 5K1VA 2QJDA 1I3RB 3CPLA 3MBWB 1MIML 5GZOC 2X4PB 4JB9L 3GJFA 4DPRA 1H6UA 2OMUB 4RETB 3ZDYE 4P4KC 1BDYA 3DGGA 3L81A 4P59H 3RVVC 2XKUA 3WUWA 1CBVH 4PVLA 2Q0ZX 1RZKC 2IADA 5DK0B 2PTVA 4BXSV 1R17A 1ZVSA 3U6RB 4JHBA 1N64L 4G8FA 4YSRA 1A21A 1XB6A 3E9TA 4Z5RA 4ZMWA 1HK6A 4AUUA 1QSEB 2HJFB 4PJ9B 3CD4A 3S5ZA 3DJRA 3BJLA 4XOAA 4PJBA 3RILA 3WTWA 3QXUA 4JO5A 3HHMA 4HS6B 2K6WA 2DYPA 1I7ZA 1BAFL 4WNJA 4GSRA 4PJEB 4LPCA 5DEZA 5IB2A 4EI6A 3ZQXA 3GB7B 1N7ML 2G4GA 3T3ME 1AQKL 4IK7A 4PJGA 3VXSB 4F8OA 2BSED 3OLIA 1CB4A 1NH6A 4XCEB 3B7YA 4I0PA 2ICEB 4NPJA 3MV9D 3MXVH 2Q87A 4OFYA 3W2DL 1IQDA 1PZ2A 5J06A 5KVGH 4IYKA 5T3ZD 5CD5D 3G04B 4UWQB 4JO1H 3T9WA 3UIZA 4CC4A 1T7YA 1DYZA 3IJ8A 4DP8X 2CKBB 3T1WA 5B1KA 3GQFA 3ZR5A 1VADA 4NZRH 3ESOA 3UROR 2IAMA 2CKNA 1LQSR 1ZS8B 5CBEB 5JO5A 1Z5YD 4XNXL 2ORBL 3DO4A 1UOVA 2P8MB 2R0WH 1IC7H 2DL9A 2FWSA 4P2CG 4Y5VC 1I53A 4MCZB 2QGDA 4DGIL 2FO1A 2JK5B 3AS3A 5EZIH 3PGDA 2B1AH 2QQLH 4QHMB 1X4ZA 4D94A 2JKJA 3H6AA 2BSTA 3DROB 3MJ7A 4ELMA 4NXKA 1W0WA 4E42A 5C2BH 3D85B 2K0RA 4UQEA 1BOYA 1BG1A 3VFGL 5ALBH 3AABA 3IGLA 2QBWA 4TRPH 2DB8A 2XICA 3WIIL 4D8OA 2JB5L 4XX5A 1FLRH 2ZCKL 4ATTA 5D7LA 4A2DA 1JNNH 2H26B 3KYKL 3ARXA 3BVNA 4DP7X 4WJG3 3ZW3A 1MFCH 5J4MA 3HNSH 2ADYA 5C3IA 4MZ3A 4JY5L 1F6LL 2AI0L 5LAPA 4E9LA 3IYLW 5LGHL 1I8IB 2VSKB 3MRBB 4NI6A 3UAJC 4OI7A 3F7PC 3ESVF 4N3UA 1RMFL 1TFPA 2Z7YA 5EIIB 1RJYA 1CFQB 4TQEH 5GS2H 3BD5A 4Y4HB 2F8OA 5HHME 3RGVB 4GFTB 3E9UA 4YK4B 3KLHD 3ZZSA 1IILE 2HKAA 4MMXC 1YY8B 1BQHG 4OJYA 4WGVB 4NHUA 4HH8A 4ANXA 2AQTA 1AHWA 3GMNB 4FF9A 5IT2L 4JM2C 1JK8B 4L4TA 4R96A 2R2BB 3G6AB 3M7FB 4LRIC 4LLMB 1OP5K 4XTRC 2XRAL 4N0FB 1FL3B 1NFIA 1NBCA 1VA9A 1I3GH 4UZUA 4GINA 1HXYB 1T7WA 5E2UL 3JWDH 2P5WB 5D1ZC 1S9WA 3MUZ1 1I9IL 2J8UA 4F2MB 4GRWB 3ENEA 5I0XA 3AXHA 4Z7NB 2HN7B 1JP5A 3TIDA 1O7VA 4ODWB 2XTJD 3VI3F 1KJMB 3HNTL 3OZKA 1ZSHA 2WAHA 3LKRB 3HZYB 3SE4C 1ES0B 1YNTF 2Q7YB 2OX5B 4PJFE 4P9ML 4OAWA 4KUZL 2FYYA 2QHRL 1ND0A 3FQXA 3ILPA 1ZA3A 4GSDL 3TGXA 1X9QA 4LL9A 3FO9A 5JIHA 4NKQB 1VSCA 2WXJA 2ZG1A 4OSUH 2QMJA 4NP4L 3N40F 5FEBA 3ALPA 2OMZB 3WN6A 4IRSD 4HUCA 4UDUA 1EA9C 3UTSA 3ZHDA 1H3WM 2FJHA 2O5NA 5C07D 3ISRA 3KYNB 3SHSA 2JMRA 2FSEB 5D1QA 3LRKA 1MCCA 4U1MB 3PIQA 1Q72L 5FUCE 2WTPA 1M56B 1U8LB 5TQ2H 3NA4A 3DJ9A 4QRRB 5GISL 3BRGC 4TKWA 1G87A 1GIGH 3ZYJA 1HEZB 1Z9OA 5C0FB 4NO0D 5HD8C 4KI1A 1JNLL 1SEBA 5LWYH 4PJIA 3S3JA 4XNMA 3H9HA 4LSUH 1SXSA 5DJYB 1GGUA 4K3JH 4Z8FH 5E6YA 3KYOB 3CLFH 3B43A 4MWFA 4MS8D 5IQ7H 5T3XL 4DH2A 3ARBA 5F96L 3KBEA 1B90A 1PDKA 4NHCL 4UIKL 3F7KA 3OKKB 3KBFA 1YMMD 4X4ME 5GS0D 5IVXB 4AQ8C 5IQNA 3FO0H 2FZ3A 1GW0A 2DWSA 2GPZA 2KT6A 4QHUB 1SZNA 1RK0A 4E41D 3KGSA 3TYGH 3N55A 3BVDB 5F9JB 2N1KA 4ERSH 1ZHBB 3NZ8A 3SBQA 2KQMA 4JZJC 1LO5B 2GY7B 3IKCB 2JI1A 2OJZH 2NY0C 4G70B 5CWSA 1M1SA 1E5ZA 3CFNA 4OJEH 4BKLB 3M1BB 3NRFA 4NEHB 3GPSA 1YEEH 1LO2H 3BMVA 3N42F 2DS4A 2CO3A 5AOMA 1F4AA 5DZJA 3MRFA 2AFNA 2B1HL 3WLBA 3E1ZA 4HPYL 1MFBH 5DVKA 4R7VA 2FCBA 5DEGA 1D5RA 4PJ8B 3F5WA 2CJUL 4AL8H 1IU1A 3VWKD 2QTVA 3F2LA 2IQAB 3CZSA 4MB3A 3EJTA 4X6EB 4Y9CA 2VDOH 5DD5L 6PCYA 4JFFA 5ICYA 1XD1A 3K1KC 1XBRA 1H3GA 1NGZB 2PR9A 3BP7A 3KNBA 3OKNA 2J20A 4U6XA 2F15A 5TDNB 2HUEA 4IMKC 3ULVL 4PTTA 4A7TA 1QFUH 1TZIA 4UQ2A 5EUOA 4HFUH 2H6UA 3IGAA 2X10A 4NNYA 1DBMH 4OIBA 1EZSA 4WJ5B 4XNZC 4BE6A 4RIRB 5HTSA 1QVOB 4OGAC 2VIRB 3DBXB 4G2AA 3V6OE 1IGCH 1L5GA 3FUEA 3VU2A 4HHGA 3QI9A 1F0LA 4AIEA 5JIDA 4ZW3A 1TENA 4G6KH 3LKNA 4AV5A 5A40E 1U2HA 2JNZA 5C0JA 4AEIL 2H3NA 1S3RA 2C1PA 1MFEH 3S8WA 3AMLA 4I9XA 5D7JD 2OXGB 5DK2B 4ZFZB 1OPGL 4NLAA 5LNDA 2G2RA 2DLIA 3SQBB 4AI7A 3LXUX 1CYWA 1J8HB 3CFJB 4KXDA 3O3AB 1AE6H 3GI9H 2KLTA 4TOYL 3O6LH 1BXUA 4NZTL 3MCG1 1KEGL 4I7ZC 4NI3A 3O4LE 1U8PA 4AJVA 5E0FA 2F53E 2FJFA 2NQCA 2ATAA 3QIUB 4LE8A 5C0DB 2IBGA 4TSBH 1MZYA 4WO4A 1P69B 1R3IH 3TA3A 5BZDA 3C60C 3VX0A 4A66A 4AJ0A 1BJ8A 5FCSH 4NDMB 5I0ZA 2Y3NA 2XA8H 1CYGA 2ZCZA 4O4YL 2IWKA 4WHTB 2O5ZL 3BAEL 4M1CD 3S4SG 3T6WA 5C7XH 1DUYB 2L7EA 4P2QE 4I0CC 4E0RA 2V33A 2P7TB 3MRRB 3B56A 5CF3A 5E6IB 4AG4H 4ZFGL 2J25A 1TTUA 4HSAC 3ZE1F 5C3TA 2EE3A 4QXWA 2ZXDA 3MJ9H 1YEWA 1DQLH 3EBIA 5HYJE 4RVBA 4U3HA 4DW2L 3DSFH 4MAYB 2NY1C 3HUJE 3GRBA 3WS3A 1KJ3H 1TZHA 4FS0A 3LNDA 3S88H 1HC1A 3QFGA 4JDTH 5E99L 5E9NA 1M4KA 4TYUA 2EVJA 3KVDD 4PJDA 2BSRA 5K9OA 2AJYL 5J89A 1JGIA 2Q7AA 4JRXB 2AXJA 3T8XA 1JPEA 1TZOA 2HT4D 3K6SA 2G9HA 1E9QB 1J1PH 2A74A 1ACYH 4NC1E 3V5KA 3PGFH 2ADIA 3QG7L 3P69A 3S5LG 4DZBB 1JGVL 4A38A 4ZBJA 3JWOL 2H2SD 5DUPH 1J7VR 5HI3D 2COVD 4HF5H 4UNUA 3UJJL 1H15A 1RULL 1CXHA 3NRQA 1Y18B 4HGWB 1Q94A 4WK4B 1NGWA 1URZA 4HK3N 1L9RA 2FR4A 1AQMA 2VC2H 2WSPA 5ANME 3QUZC 4ABUA 5DJ6A 3SKOB 1JBJA 1IT9H 1SJXA 4ZQTA 3PL6B 5E1GA 4PLJD 2FIKA 2XWEA 4LK4A 2O4EA 4ONGL 2PO6A 3UTQA 4BEIA 2PW1B 5F7MC 3PU7A 5I0VA 1AQHA 5IROA 3WJMA 2CRYA 2GT9A 4N22A 5IQLA 1DBKL 3C12A 3QJFA 5BCAA 2FL5B 2V9UA 3RP1A 3IMSA 5MP6L 5DJZB 5JIIA 1S7WA 3MNVA 4MA7L 5IQOA 5ACZA 4F15C 4OCYL 5FO8B 3UBHA 4GG6F 1IEHA 4HALA 2OMWA 1SXAA 3Q05A 3LQZB 4IRJB 3L16A 3WLWD 1ZGLB 1ET5A 1FO0B 4OT1L 3H2WA 3BPCA 3QS2A 4PPTA 5L2KE 3C9NA 4ALAL 2AJZA 2ALWA 4N2MA 3WJJA 5IMKB 3SY0B 3WV0A 4M3JA 1DANU 3BKYL 1WA2X 2NY3B 4ZW8A 3EOYG 2IQ9H 3OGCB 1TOXA 2WQVA 3HG4A 2YAFA 3LZPA 3OX8B 3IMWA 2JTYA 4MHHG 3RU8H 5A7BA 1A6VH 1CN4A 2ARJA 2Z31D 3FRUB 3GEWB 4KTDH 5IUCA 1BVKA 1BYOA 1D5ZB 1XX9C 1FNFA 2YEZB 5CZVL 3L7EB 5HI5D 2JIXB 2NOYA 4ZTOL 4X80H 3UC0A 4WEUD 4MX7A 3ARZA 1MIEL 4OLZL 3UC0L 2Y3AA 4G71B 1KGCD 4LEOA 4XN9A 2GTQA 2E9BA 4PYHA 3N91A 2Q20A 4Z78B 3O81A 2EVIA 4GYBA 1KY7A 1QUPA 3EADA 1CFVL 2AXHA 3MBEA 2KZWA 3GRGA 5GRVL 4Y5VB 3E8UH 1KC5L 4F8TA 3EBHA 4WI6A 3ILEA 2Q86B 5BS0A 2BNRE 3DMMC 3FO1B 3I74A 3QJOA 3T4YA 1Z5HA 1MNNA 2XWXA 1KG0B 5GRVK 1GMEA 3RWDA 1UT2A 5EFIA 3OAUL 3V0WH 3BWAA 1FVDA 3VB8A 3T3PB 3ROLA 4XB3A 4QIRA 1GGCL 4XGZA 2GSIA 1KBGL 1A6WH 1KXVA 1ICTA 1TYEB 2P1YA 1CK0H 4H1LB 5I66B 1T66C 3ISYA 5SWSA 2XUWA 2QSCH 2FBJH 1L9QA 2BNUA 1C7SA 4E68A 4WGWB 5JW4M 2J2ZB 3F7QA 4G3YH 3QXAA 1TTCA 4QKTA 4DO6A 2W60B 1O7DC 1YPZA 4GAYA 4GW1A 4MZ2A 1MCJA 3GKWL 1A64A 5IJCC 1SOXA 1B88A 4EUPA 1J1OL 4BDVB 5CJ5A 3OZ9H 3O3BA 1G7IB 1M2OA 2WLZA 4FZEH 4OCXL 4U7MA 3RX7A 4MMXB 3ZT6A 1Y7VA 3PWPE 5GGTL 3LN5A 1M42A 4WFFE 5IP4A 4FQ1H 2VQUA 4LSPL 1YRKA 1P7QD 3EFFA 4UV4L 3TZVD 3V4VB 1FH5L 3GK8H 2X4NA 4JM2B 3CZGA 3O8XC 4J4PA 5IQMA 1YY9C 3QIWA 5AUMB 1MEXH 2X70B 5I1KH 3QO0A 4FNTA 3GMQB 3VXUA 4KK8C 2J55A 2FQGA 5D1ZB 4Y5XA 2EKJA 5KYUA 3BKCH 3H7BA 2BINA 1Q8MA 4TPRH 4NKMB 2IPKB 1OCZB 4MLSA 4UIMB 4YHMH 5JW4N 3ZE2F 2NT1A 4LDCA 5I16A 3VGBA 3FQNA 4P2OD 4NUGL 3KPSA 3POHA 2YRPA 4Z7WF 4LCWB 3WEAA 3QUGA 3IJEA 4TLUA 5DFVC 1IFRA 4KRPC 2FLMA 2FECI 3MU3A 4ANWA 3D33A 3MJGX 4MD5B 1KCSL 3DECA 4GAGH 1ZLWK 4FNLL 4DP1X 4KZ0A 5KWYC 3GBML 3N43F 1OZTG 5JPNC 4GKSB 4QCIB 3GS0A 4WI3A 4JFHE 3OHMB 4KKZA 4NKIL 3IM1A 3VI4E 3ZTEA 4Z3EA 1MXGA 2X4OB 4HWBA 4X5XB 3UTTE 2WWKT 5E9DE 3MRJB 4NSKB 1U8NB 2E9IA 2R51A 3MHZA 1MNUH 2BVQA 5KSBE 3FW6A 5I5RA 2HVJA 4UINL 1ODUA 4LVEA 4RFOL 1OP9A 3NQIA 3PP3H 3ULUC 2BS9A 1RUKH 3MCKA 3VFRB 4UNIA 4XO4A 2UWEF 4H0HB 3GSOB 5GRJH 2HJKA 3H3KA 3MYJA 3Q3GA 2OCJA 3FU0A 5C09B 3MKGA 3MODL 3BIKA 3WFDH 1ZRUA 4NQEE 5AKSA 5EF2A 2XPYA 5IK3B 1KULA 2QV2A 2A4EA 1IM3A 5D7IB 2X4QA 1CJYA 1QMUA 2F5AL 4ZZFA 3QK0A 2VMFA 5GSRB 3T0AA 1LO0L 2DQFB 3C2AH 4BZ2H 4N2CA 3N85L 1KIRB 3VXME 2R15A 1S5IL 3S3SA 4LKXA 4JZJB 2NY0B 1I9JL 4WK2B 3FT3A 5CKAA 3A6CH 2ZICA 1YQVL 4XVTL 4X6CA 2ARJQ 1WQVT 4FTVA 2HA1A 3PHAA 2GKIA 5DMGC 1E2ZA 1UXSA 4LVOB 4XNUL 3C6LC 1UXMA 1UH4A 2ZUTA 5CR8A 3ABGA 4YPGB 3QCVH 4A6YA 5C0BE 3LS4H 1DUZA 1HH6A 3R4RA 4R4ND 1ZANL 4A6YL 5DFAA 3FOLA 1HQ4A 1QW8A 2X1XR 1WAAA 3VCLB 4QGTA 5FPIA 4ICWA 3HRZA 3SYOA 1RPQA 3WSQH 3S4SA 3OKMA 1VPOH 4GAJL 4F7CB 4BZYA 1MG2C 2FX7L 1PD1A 1DQKA 3A4AA 2OSLB 4Y2OB 3KVQA 1AGCA 3JV4B 4GY4A 4LLWA 1NKGA 2JKLA 1TCRB 4GMSH 4ZUUA 4MRCA 1F2QA 3GZKA 3JYCA 3SYCA 1WZ1H 5D72L 4F1SA 4QRPD 2N56A 5L7XL 3QPXH 1DZ0A 3TF4A 2Y2TA 1MW3A 2Y7QA 3HB3C 2GITB 2LLNA 1QNZH 1ZHLB 2WVUA 4KJYA 1G7JA 1NC4A 1M71A 2C9AA 3HNVH 4IBQA 4UTBA 3REWB 4G8GD 2BHYA 4GFXA 5K39A 4M29A 5ALCL 4HMDA 3SO5A 1MSPA 4XNDA 4FXGC 4X7CC 2Z7ZA 4NB7A 5KVDE 3DOSB 4M6NH 5DSCA 3UO8B 5JXAL 2UX6A 4JKKA 1FLTX 2QADC 1I4FA 3K5RA 3D2UD 4KC3B 5HHOA 2GCYB 2VQ1A 5E1AA 3RZCC 3L1EA 2WNXA 4PI0A 3FU8A 1HCZA 2A1WH 4XVUD 5TH2B 1D3CA 3PWNA 4G7VL 1G5AA 3QEGL 3GUTB 3GSNA 2OULB 3DLQR 2CK0L 2VL4A 2ZXWB 1DTUA 3HCVB 4UOW0 3GSNL 5HPMA 4HJ0C 4LKCB 4OLYL 3EDKA 2IPUG 3B9AA 3C60B 5C97A 3EOBA 1ILUA 5ISZB 3MLSH 4EE2A 4LFHG 4YHYC 3L1OL 2R4SH 3N1MC 1E28A 3O3DA 5BXFB 4OCLC 3THML 2Q8BL 4OV5A 1RXLA 3OR6A 3P0YH 4H25A 3ALXA 3RJDA 5ICXA 2DWDA 3MLZH 3SDYH 3U2SA 4EZJA 5F7FA 4ABVA 3QRBA 2IH8A 3BZEA 1KLFB 3QZPA 1F6AB 5DEFB 3SCMC 1NBQA 2VXUL 4WWID 3PQYB 5CIPH 3KPRD 3QQDA 2CXGA 3ZUCA 5L4MA 2Z8RA 4DP5X 4XWGL 1G9MH 1PZ5B 2VXQH 1R34A 2H5UA 2Q2EB 2XBDA 4PRHE 4ZOCA 2NY1B 3LZFL 3HC4L 2LR4A 2AXWA 4AKQA 3ZTNH 1AQDA 3MOQA 4ELME 5J9PA 1JPGA 4WY7H 1OXYA 4XMUA 1HFUA 4FE9A 4D0CA 2CCLA 4JZNA 2NX5B 1EAPB 3D09A 3RE0A 2H3XC 2NXYD 3ILQD 4FQCL 4OZHB 5BRZA 2GJJA 3GLEA 2VOTA 4OFIA 5D7LE 3RL2B 5BZWB 5CHNB 1L9MA 3AU1A 5EH1A 5A6MA 2Z8WC 3TTSA 3S36X 1JZIA 2XZCH 3RIFK 4HWUA 5JR1H 5AZ2H 1RZIB 3TBTA 5LDUA 5B39G 1N6QL 1KT2B 4KJQD 2NY5C 4GW5B 1QABA 4PJGF 2HTLD 1D5IL 3EJZD 3QJSB 5FKPA 2GJ6D 3EYFA 3D52A 3BHBB 3QUZB 4C55A 5E7FA 3VFMB 4C58B 4DVRH 1MJUH 2JJVA 4UYPA 1JGLL 3C8KA 3GINA 3MC0A 3LH8A 3PXHA 4P2AA 4BH8A 2EXSA 3P3SA 5C08D 2ROXA 2WQXA 1P4IL 4QXVA 4L4TE 4YGAB 5HHNA 3VFOB 4KKLC 3GBEA 1HWGB 4G7RB 4JHZA 1WZLA 2BRQA 2DQJH 2XV6B 2UY6A 4PP2A 2BS71 3WO3B 4Y1TA 3D87B 3FHAA 4EBQH 2VW4A 1IL1B 1QRNB 4HBCL 5T1KB 3TVMA 2R1YB 3OKLA 4F15B 1RZ7L 3LNEA 1IGIH 3MXWH 3NJHA 2UZXA 1CLZL 1U3NA 3RGHA 4JY4B 1Y07A 5A2LH 2R2HA 3VWJC 1F18A 2YKLL 4WEEA 3NYKA 4WCYL 3ZKND 1BJ1J 3DIFA 4X2UA 3GJEB 1WP6A 2B3RA 2IBZY 1FFOB 1YSOA 1CU4H 2PCXA 2UXGA 3B6SA 2J6EA 3MGOB 3GMLB 2C3WA 4QTHA 1OGAB 3FTZA 3BZ4B 2XPGA 1YEKL 3BXNA 5D1QE 1JZ7A 1A6AB 4Q74A 2YFOA 2ZUYA 3C75A 4GBXB 4BKTC 4E9RA 4XPFH 4KNSA 1FFNB 3TA4D 2I7OA 5JOFA 1PF3A 2F1BA 1KPVA 4JPKH 3MLUH 4CSZA 1Q4NX 3MCLL 3CDZA 5ESQA 2C1OB 2Z93A 3LKSA 5I76A 4Q0XH 2YHGA 3GT6A 1JHTB 2E6PA 2OS7A 1U8KA 4FFZH 2VABA 5DUBB 4YXHH 1S7TB 1HEJC 4K8RH 3UOAB 4IOIA 1OP3K 1I8LC 1L3WA 4X7TA 4G6FB 1BFTA 4NJ9H 2VN6A 4IBUA 5DC2A 4FYSA 1UJ3A 4CVWA 1W6WA 2EZ0C 1NAMA 1ZGLM 4CMMA 2OBGA 3OAWA 4OGQC 3W9EB 2OW6A 4JFPB 4GQRA 3RJOA 3IRZA 4KMTH 3I6GB 2XY2A 5E56A 3VXRD 2RD0A 3LXBA 1ZV5A 2WLKA 2H1XA 5GHWL 4RISH 5GRXG 5AAWC 3NCFB 3OB0K 1T1YB 2AQRA 4BINA 2QPUA 4R7DB 5JHDA 3AJ7A 3C5ZC 5FO7A 1NM9A 2D7MA 4L5FH 3ARGD 4ODTL 1PGRB 4HETA 1MCDA 1RURH 5F9AC 4LSSL 3LRLA 4G9FB 4XZUA 1SBBA 2XKNB 1ZHNB 2YSSB 3ZIMA 2EYTA 4B9KC 3KWVA 2FNBA 4XT1C 3LTVA 2IH1B 2IANA 4Y8AA 4HT1L 3RDTA 2CBPA 3GSVA 5EU6B 3TWCL 2IPTH 3S5YA 1I3RA 2Y7SA 3O6FC 5AKTA 3MBWA 4JVWA 2X4PA 1IAII 5BVPH 5JPMC 5BW7C 4QRAA 2OMUA 5JDSB 1XGUA 1GHFL 2YPKB 3NA9H 3O8XB 1A7BA 3BGFC 4JRYB 1UM5L 3D4YA 3VB9A 4FNRA 4A2LA 1DEDA 5DK0A 4WWPA 4JFUA 1F42A 3U6RA 1FIGL 3L9BA 5K59E 1OE2A 2WLJA 4FQIL 3GIVB 2Z65C 1PD6A 3APCA 1QSEA 2HJFA 4PJ9A 5E95B 1FYHB 2HLEB 4MXQD 3KG5A 2EE0A 2VMJA 3FL7A 1SXNA 4KRPB 4WF7A 3I50L 4HS6A 3EUUA 3ET9F 4PJEA 1N6UA 3GNMH 2EKSB 3GB7A 4UILH 4KTGA 5KS9B 3VXSA 2CPCA 5JPNB 3EGXB 5DD0H 4HIXL 2XACC 3EXJA 3RKPA 4HCRA 4OBRA 1AI1H 1IGYA 3VSUA 2Y07H 5GS3A 1BD2E 4HCRL 4XCEA 2ICEA 2HTKD 3F01A 1J0JA 1P7KB 2JFCA 3E38A 3QHZL 4H26B 5IG7B 3TO4D 3U7AA 1NLBH 5I5MA 1YYCA 4A2HA 5TE4L 1U8JB 3IDYC 2CUMA 2BP0B 1WO2A 1J87A 3G04A 5F3FA 3GD1C 1VFBB 2IFFH 4X4YB 5K9KA 1YEGH 4LPVA 2CKBA 5D6DC 4YGVB 2LU4A 3ZHFA 4JO3L 2CKBL 1ZS8A 1UWEH 2MQ0A 5CBEA 1S9YB 3CX5J 4WFHD 2P8MA 4HDIB 3LIUA 4U1JB 3PV7A 4OCRL 1T83A 3VSVA 1B4TA 2L0DA 1HQRB 1J9RA 4MCZA 3D4GA 3SJVD 3QJQB 5KYNA 2QDWA 2JK5A 3OJ2C 2YMTA 1OVZA 3ZTJH 3BMWA 4PWFA 2DJMA 5GS0C 4QHMA 4XBEL 3HE6C 3H9SB 2CZNA 4M7JH 3DROA 3QUXC 2PETA 1XF5B 5DHYB 4XMXA 2X6MA 3BOVA 3D85A 2ZSVB 3FBKA 3LZLA 4AC4A 1CR9L 1RD6A 1OL0A 2OK0H 3UAEA 2VLKB 4XNBA 1Z2KA 4N8CL 4XP5H 4ODXB 4RNRB 4S2SB 4GI9A 2DIBA 4XP4L 5HGBB 5BOZG 3WIFB 2ZUWA 1IGFH 2CLZB 3ESPA 5T3ZH 2ENJA 4LNVA 1U3HD 4ZTEA 4XP9H 2YJLA 4HUUB 4MXWH 1I8IA 3MRBA 2IGLA 5LBGA 3RTQD 1KIPB 2IGTA 3WN5C 1HINL 1BM3H 4EN3D 1I31A 4A7GA 5EIIA 2AC0A 3US1A 1CFQA 3BQUD 4GRLC 5CFAA 2WMPB 2XN9D 3RURA 1VEOA 4P0DA 4Y4HA 3RGVA 4FI7A 4U4IA 1YY8A 4XHJC 3KWTA 4FQXD 3TJPA 4ZRGA 1KFAL 2C9VA 5IESH 2IPUK 1A7RH 2E7CA 1BZQK 4L1DA 4GUOA 1PTZA 1UGKA 2VDNH 3GMNA 1ASPA 1CVSC 5ACMA 1IKOP 1JK8A 1NSNH 3IU3B 3KWUA 3W82A 3G6AA 5C0CD 1QASA 2YRLA 4IRZL 4HZAA 2AEQH 2ZWZA 1BF5A 4FCAA 1BREA 4KY1H 4LLMA 3X1NA 3ECUA 4MNQB 4N0FA 5BO1H 1FL3A 4W6YB 1HXYA 4OLVH 4XC3L 4YE4L 4L3EE 1PS3A 2P5WA 2D4DA 2O5YL 1P5VB 4MJJA 3IRCA 1FYTE 1EJ8A 4F2MA 4P3CL 3UCQA 4DN3L 2WLLB 2XN1A 2OL3B 3TC9A 4L4VB 4N0YL 4HLEA 3WEBA 1INDH 2NY6B 3L1FA 2HN7A 4HIIB 4QKXB 1N67A 4ODWA 1KJMA 3LCYA 4NNPL 1BM7A 2DJ4A 3LKRA 4AGNA 3HZYA 1ES0A 4FXGB 4GSXA 2Q7YA 2OX5A 4Z9KB 5IKCB 3AY4A 3KPQB 1UH2A 2N7SA 2QADB 5JIMA 3RG1C 3BEWB 4ZFOB 2OMZA 4D7BA 1J1XL 3WJLC 3RFRA 2IOMA 4QHNB 4DP0X 25C8L 4N85A 4WI5A 2XXMB 3RZCB 1KCVL 1QLEB 4AQEB 3KYNA 4PCYA 4M1DL 1SDDB 2FSEA 1T22B 5EA0H 3JTTB 1T5XB 4U1MA 2Q8AL 3KXFD 3SE8H 3WCYA 1U8LA 1BQ5A 1JXDA 2X9XA 4QRRA 4QRFA 2TSAA 3NSCA 1WFIA 1HEZA 4ZAKC 3P0GB 5C0FA 1MXDA 2VXTL 1JHLL 2KQNA 4U33A 4DUXA 5FWRA 4J3BA 4YHYB 3MZTA 1KGYE 3NZSA 3PY9A 1BIIB 2MQCA 5DJYA 3Q2VA 1MWAB 1QBLH 3D51A 2P5PA 3KYOA 2WQSA 2VLJB 5I1CL 2JJSA 2DQDH 5I0WA 1EXUB 1FRGH 2P48B 3PHSA 4FHBD 2G5BB 2VXVL 5DZAA 4KX8A 1QI3A 4BQCA 5IVXA 1S78C 4BFFA 3U0WH 1LO4H 1A14L 1J0IA 4QHUA 1J8RA 1I9EA 2OSXA 1XH0A 2VZSA 5F9JA 1XGRB 1YNKL 1ZHBA 5I6XC 2X0WA 3I75B 4G7SB 4FYRA 4Z18A 1LO5A 3DXAD 3IKCA 3D39B 4NQTA 3BCFA 4G6JH 4X8XA 1FE8L 5JW4Q 4BKLA 1EO8L 3M1BA 1V3LA 1BVLB 1P0SE 2O72A 4GQ9H 4ZSOB 1OT4A 4FKHA 2IH3B 1QR1B 1SGKA 1WBZB 1CDJA 3FFOA 3SDXF 3AM8A 4XBMA 3NSFA 3D48R 5JQ6L 2B9AA 5ES4B 1CBVL 5DJ8B 1JZFA 2DJSA 1N12A 1G1CA 3DX6B 5J6GB 5KSVB 2BFVH 1A25A 3CXHJ 2AJVH 4PJ8A 3HBPA 3N1PC 1K4DB 4R90L 2ZYIA 5D2LF 4KJPD 5AKVA 1PCXA 5JLZB 3WIHA 2IQAA 2VJ0A 3HVDA 2JKRM 3EGSB 4GW4B 4PWHA 4X6EA 4AYDC 4AGQA 2BC4B 2CALA 1NGZA 1BECA 1EFQA 1RZJH 1WC7B 5TDNA 2RH0A 4R9HA 4BGLA 2HFGH 4WJ5A 2WBJC 2VXSH 4LLYB 3OLEA 4HIQA 3PPEA 2OSWA 4RIRA 3DTDA 1QVOA 1E6OL 2VIRA 3DBXA 3BWZA 1UWXH 4KX7A 4Q2ZB 4RAHA 1CTOA 4CKQA 2FHFA 4IIQC 1T5WB 4MNGE 4AW4A 3A67H 4HWEH 4PP1D 3MXVL 35C8H 1G6RH 4R26H 3Q8AA 5KVGL 5ITBH 1IEBB 1KB9K 4S1QH 3UAFA 1I7UB 4JO1L 1F1GA 2Y1YA 1TTGA 4OZGB 4B9FA 2OXGA 1EO7A 5DK2A 3H0TA 1S7UB 3C2SA 3KPSE 4ZFZA 5IEHB 4IQHA 4L1BA 1ZLSH 3EKCA 4NZRL 3SQBA 3RZWA 2VM9A 4AQZA 1J8HA 4TUJB 4PJCB 5DCCA 3CFJA 1H9VA 2APVA 3O3AA 2CR0A 1FNLA 3UEQA 1GZQB 4R2GD 1ZK9A 3J8F7 1GGIH 3HC2A 3OAYH 2YGPA 3VU1A 5JHLH 4XP1L 4A04A 2E3VA 3L5IA 1GTNA 4P9HL 1F56A 3NGBC 4F9PC 5I1DB 3QIUA 1M3IA 4UQIM 1H3VA 4XHQA 5C0DA 2QQLL 2VERN 4RGMB 3II3A 5JXEA 4FEIA 1E4KC 4HW6A 1KWGA 2DMKA 4PRAB 2BIQA 4ORZC 5ALBL 1BP3B 3X13B 4XMTA 2G60L 4NDMA 4TRPL 3CGTA 3MV9B 1FLRL 4FYTA 5HI5C 3CBKB 4WHTA 1JNNL 1YPZF 4AQAB 4DP2X 1DUYA 5CINH 5ADPL 4TULH 3QYMA 1MFCL 1UH3A 3HNSL 3AAZB 2P7TA 3MRRA 2UXFA 5H4YA 2QR0B 3F04A 5E6IA 3NFNA 5CP3H 3EO1B 4ODSH 2V9RA 1MFDH 2Z64C 5IY5B 2C4FU 4TUKH 3NG5A 4L4JA 4KWUA 2ADFH 4CGUB 4PB9H 5CLTA 1ZEAH 1NINA 1A7NH 3DVGB 4X6DB 1W16A 4LHUD 4OB5H 4N28A 2VDNB 3PDDA 1GR7A 4ZMAT 3PWVB 2ESVE 2JI3A 4QXTB 4JRXA 1HJCA 2FX9H 1GC1C 1CICD 4AGLA 4FTVE 1E9QA 2NNCA 3D08A 4KI5D 2BH0A 1DSFH 2Z8VC 2XDHA 4WI2A 5AW5B 1UASA 1WGVA 3WTSA 4DZBA 4RMTA 1B0RA 3FFCD 3ZDYF 2AJUL 1T7ZA 3RL1B 2WYHA 3DHJA 2YLKA 4ZX4A 1Y18A 4HGWA 4E36A 1AO7D 1XV8A 2DQTH 1HXMB 3B2UC 2VZ3A 5EORH 4D9LH 1UURA 3ZZQA 2VZUA 3UGUA 5FDWB 3EYUH 4B50A 1GS6X 3KL3A 4B9ZA 3SKOA 1P4BH 2DIEA 2L7QA 6FABH 4N9OB 2W91A 3PL6A 1U8OB 4H40A 2QGBA 3IDJB 4BFKA 2P5ED 4Y8DC 5GZOA 2PW1A 3V0EA 4C4KO 4ADGA 5E2WH 3GZOA 3MRHB 4YIQB 4P4KA 3VO0A 4JUSA 4MQXD 3SDAD 4KHTH 2BY1A 2FB4H 2FL5A 4NIKB 4QOKB 2Q2LA 1VGEH 4KY2A 1CXKA 5DJZA 3TBCA 3L5HA 4GIAA 5E03A 5FO8A 2X1WL 1RZKL 3P11H 5LNGA 1NCIA 4DKTA 4UANA 5B22A 1ECYA 3LQZA 4IRJA 1DLHB 1ZGLA 1FO0A 4EI5C 4E9YA 3CSBA 5SX4I 3OKOB 3Q8EA 2ITCB 1IC0A 3PP4L 1FO0L 4K3JL 1SOQA 2Q1EA 2XTJB 1LP9F 5MERA 4LB8A 2BW4A 4LDLB 1H6FA 3APFA 5IMKA 3SY0A 4B7LA 3CK0H 4W93A 3V79C 1UZ6F 2HMIC 3H3BC 3OGCA 1OAQH 4G43B 3OX8A 1BCIA 2VZVA 3ZPDA 4JAMB 4FFYH 3TYGL 1OWWA 3FRUA 4ERSL 1RUQL 1DR9A 4LCUB 2DKUA 2P28B 2YEZA 3MV8B 5KW9L 3L7EA 1RCYA 3R06B 2J12B 5C07B 2VDLB 2JIXA 2ZWNA 4HU2A 2Q6WA 1DP0A 4ZPVB 3IMTA 1RLWA 1WAAF 3QO1B 4KO5A 5L2JB 5MI0C 4KK5C 4Z78A 2PMZA 5MHSD 2GSGA 4LZKA 1YUKB 3ESMA 3LZNA 5SWZB 2CGRL 1C16B 1ID2A 4KKBC 1E8WA 1ZLDA 2VLRB 1TU2B 3DX8B 4Y5VA 4NO3B 1XCXA 1UB6B 2K9FB 4YN3A 3P3TA 5EU7C 4AL8L 5HDBB 2Q86A 2WQ8A 4ETYA 2CSPA 2R1WB 4JFQB 5AB9A 1FZOB 1KG0A 4HJIA 4WWKC 2VDOL 4X4KA 1MCHA 3L3OC 3M45A 3RUGE 5I8KH 2V7HB 4JJ5A 3ZKSD 3BSGA 4ORGB 4Y1AE 3U0PB 4JL1A 4YHLL 1QFUL 4GQQA 2NRDA 2VJ8A 1T2XA 1CFTB 3KJ6L 3OJDB 5D7KD 5E7BA 4PS7A 5H37H 4PW3A 4H1LA 3TV3L 4AMKH 4CMHC 5I66A 5D7EA 1GGTA 5JIQA 2F54D 4UBDD 4RGNE 5D55A 1H0DB 1OOWA 1R5WA 5FUOH 4XOCA 3U2IA 3VYOA 2J2ZA 2ZCHH 5FYLD 2OQJB 4UV7H 3UMTA 2BVOB 4G6KL 2KPNA 1VF5C 2W60A 1UA6L 3WN5B 2A0LC 4L8CB 3U25A 4RDQG 1RFDH 3ZE0F 1V7MH 2W65B 4GRLB 1WDAA 1N2RB 2OYLA 4BDVA 1BPLB 1CGUA 2WSDA 4JQIA 2AVFA 4ODUB 4TTGA 4FG2A 4NM4L 1AJ7H 2GIMA 4MMXA 1NICA 2HRPH 2HWZH 3MV01 2BOCB 1NCBL 2E4FA 2ZP9A 4D9RE 3V4VA 2C9XA 4CN1A 1WS8A 1AE6L 1A0QL 3ZYOA 3O6LL 4JM2A 2NY4D 3OB8A 1AKJB 3BN3B 4YUEL 4LASL 4LRIA 5AUMA 2X70A 4OQTH 1N68A 5LDSA 4DKFH 4XXDA 3GMQA 3EJYD 4L9DA 5D1ZA 4LLAA 1G94A 4F58H 2X4UB 3JTBA 3MRDB 4NKMA 1YG9A 2IPKA 4H8UA 4UIMA 4K3DL 3QULB 4XO9A 3PDOB 1FHGA 3SSGA 3ZL4H 3U4BL 1SHWA 1MAJA 2XA8L 1XAUA 3C6EA 1NCWL 2JKNA 3SE4A 4LCWA 5C7XL 3QG6B 4DQAA 5AOLA 1E9PA 3FUDA 3I3BA 2UZPA 2FEEL 4MD5A 1OCOB 4L0YA 2YXMA 1YUHB 5IHUL 3BKJL 4ZMTA 4GKSA 1FGNH 1TTRA 3MJ9L 1DQLL 3NBNA 5E24E 4OD1H 2X4OA 3DSFL 4X5XA 1U58B 3HMXA 3RIFF 4DT2A 3VJ6B 4NSKA 1U8NA 2DH3A 4OV6F 1KJ3L 1SEQL 4P5KB 3LEXB 2PXYD 4PB0H 1MCEA 1QSZA 3COOA 1F02I 3INUL 2BERA 3VFRA 2J1WA 4FC3E 4PTUB 2D3JA 1K2DA 5CUSH 3GSOA 2X6CA 2R8SL 1QOKA 3PJNA 1QFWH 4K73A 1XWVA 5C09A 1ACYL 3RVUC 4OU3A 2WSKA 1NMCC 3PGFL 2BZCA 5IK3A 2XIIA 4M03A 4NUJB 2F1EA 1SUJA 4XE5B 5E5UB 5DUPL 3ZDZE 5D7IA 4YSCA 4HF5L 1URIA 5DHXB 5JZ7D 4Q9QH 1D9KD 3TH3T 1P6WA 5F89B 1BVZA 1MCOL 2DQFA 1TR7A 2A4CA 2MEJB 2C9PA 5GXBB 3I9AA 4YX2H 5I6XB 2VC2L 4M4RB 4JZJA 4DAGH 3P2DA 4QHKI 3OVUB 5EIQA 1IT9L 4N2AA 1KGUA 5KVEH 1PIGA 4FQQB 2DAVA 1GCFA 1KZYA 4E9SA 1CDYA 1R1CA 3RKDD 5I6OA 1A9VA 2WZPD 4AUYA 4W9JC 4YPGA 2FD6L 3SQOH 2FEDC 2MMXA 2X3CA 4QT5B 3QFJE 5IB1B 3A23A 4CDGC 2R69H 1HOCB 4PUBH 1NFAA 3QH3B 4FQ2L 3T8MA 4WKZB 3VCLA 4LSRH 2WOYA 3FH5A 1IUZA 4PG2C 5CZXC 4A39A 3A4DA 3D3VE 3NCYP 4JHAL 3EYQD 4F7CA 4N86A 1OTTC 4ANKA 3A22A 5AZEL 1BJMA 2OSLA 4Y2OA 3VI3B 1KCLA 3JV4A 3O45B 1KTLB 3MFFB 1EEUA 1TJGH 1TCRA 4F9LC 1HOEA 3TH4T 4POYA 1GSMA 4O02H 1C9SA 1E3XA 3M17B 4FERA 4IMKA 3SGJC 4ZS7H 3DETD 3V6BR 1PL3A 1HL9A 2WBJB 5I6PA 4KO9A 2IQ9L 2QQKL 3Q2CA 3ZRSA 1LMIA 4AE0A 4GUQA 2GITA 5AKRA 4X99B 1ZHLA 4KU1A 2N4IA 2JQZA 3RU8L 1A6VL 1IC4H 3QPQC 4IIQB 3REWA 1IM9D 4NN6C 4NQVB 1PPIA 1QWUA 1XDTT 2C9SA 1JMXA 1KCKA 3DOSA 1K6QH 2ATPB 3ZT7A 4Q6YA 1MVFA 3GF8A 4KZDH 1A4AA 1KJ2B 1MCRA 3QEHB 4OBSA 4LIQL 3VA2C 2DBLH 4Z3JA 1EAJA 1S6NA 1TEFA 4WUUB 4L1HA 1AR1D 2GCYA 1QP1A 3FQ4A 3UABA 2YQGA 5TH2A 1IBBA 2XC8A 5T3ZE 2HKHH 1QATA 1L7TL 3VXSE 1J5HA 1T6VN 3E8UL 2WNKA 2JCCF 3NGBB 3GUTA 2HXAA 1C7TA 2MNUA 1M6UA 3HCVA 1OHZA 4LKCA 3S8GB 1QLRB 2KLRA 2XWRA 4WI8A 5I1IH 3C60A 5DRZA 5JHAA 2KMWA 4FCHA 3V0WL 3FJTA 4CSTA 4LSQL 2QPEB 4X5RA 2VAAB 4ZPTB 5ISZA 1GSKA 3HUJF 2Z31B 1DVSA 2EEXA 2IGFL 5BXFA 2OA9A 1A6WL 4WHCA 2WYIA 2DD8H 1CL7H 2HG5B 3CMGA 1S7RB 4BJLA 5D96C 3D6GA 3N42B 4K7PL 4R7NB 3KZ8A 2WXNA 3CIAA 3JUYA 2VERA 2DRUA 1KLFA 5DEFA 4QLWA 3PQYA 2IOOA 1Q9WB 1OSEA 4L29B 5L8LB 5ECGA 1COBA 1PZ5A 2CJ3A 3GXPA 5KUMA 2IAAC 1E90A 3DX0A 4MVBD 5LO7A 1TO5A 1YQ2A 3ECWA 1YYLH 3OZ9L 1HZKA 4TSAL 5GIRA 1NFDE 4FZEL 5DTFB 4JS7A 5E94A 3U46B 1SDYA 2XCMC 4JDVB 4UTAH 1C5DB 4GEJA 4R83A 4FQ1L 2ILLA 2AJXH 3AT8A 3ARQA 3GK8L 3WS6A 2NX5A 1EAPA 1ET7A 5GGUB 4I1PA 4OZHA 1J8KA 2WY3B 3RL2A 2AEPH 2NQDA 5CHNA 4YE0A 5BZWA 1A6ZB 2PWFA 1MEXL 1ZPLA 4J6RL 4BCXA 5DJAB 3PFUA 3MV7B 2NYZA 2EVGA 3D8MA 2DLFL 3AG4B 1UB5B 2HP4A 3ESNA 1X3DA 4B53A 1LD9B 1RZIA 4M8QB 1EX0A 4CU6A 5A2CA 1KT2A 3I6KB 1LWHA 3ARDC 4GW5A 3WDIA 4LOUD 4DGYH 5F72S 4X5WB 1JPSH 3S97C 1RJLB 2VDQH 1G7QB 1OGSA 1Z9MA 3BHBA 3EO9H 3QUZA 1OALA 3VFMA 4AITA 2Z6FA 4EEEA 2YMXH 3JV6B 5TDPB 1SN0A 2CHZA 3VFOA 1KTDB 1MW1A 2BCKB 4PBVC 3TZVB 4POZD 4V2BA 1TO4A 1Z6JT 1N4XH 2GW5A 1F41A 2EC8A 2OMTB 2P5WE 2EDWA 1IL1A 1QRNA 5T1KA 3FUMA 1DJHA 4GRWE 2MNWA 2R1YA 4AY0A 3GC3A 3VMOA 1XCTB 3V4UH 3DOIA 1RUKL 3QWQB 2LAGB 2UX7A 2WLHA 1ETA1 1RK1B 5FOBB 3ZO9A 4EI5B 5HHXL 1TZAA 1HE8A 4JY4A 2CLRB 1ANUA 4N5ED 5DD3H 2D7OA 5BUPA 3UYRH 3GJEA 2X6VA 3PP3K 5HGDB 1FFOA 1N8OE 4X4XB 4MGXA 5F3HB 1FAIL 3MGOA 4XH2B 3GMLA 5K33A 4F33B 4BZ2A 2FUQA 3ZOAA 2FQEA 2J56A 1OGAA 4N1HB 1IKFH 1U0QA 3BZ4A 3C2AL 4BZ2L 2NUTB 5DHVH 3L9EA 4Y4FC 5D70H 1A6AA 2DQUH 4GBXA 1BMGA 1A1OB 1Z9LA 2DN7A 1F45A 2F08A 4PWKA 4CU7A 1FFNA 4TNVK 4LPYA 1CF8L 4KQ3L 4HWZB 4WTZG 3FQ2A 4NKOB 3QRGL 2X6AA 2F58L 1YMME 1T6WA 2C1OA 2P4AB 3QJXA 3BH8B 4P46C 2ZXCA 5MI0B 3FU6A 3QCVL 1SY6H 3EOAB 1KF9B 1JHTA 2GBVA 4Z77A 2YA2A 3QCTH 1SDAB 2YD9A 5DUBA 1S7TA 1QTSA 5LG6A 2HCZX 5E6SB 3V4PB 3B9EA 2FGWL 1VPOL 1K8IB 2K78A 1RPUA 4BK4A 5I0YA 3DHUA 3ARSA 3KAAA 4WWKB 1BQKA 4XNYL 3W9EA 2E46A 2E75C 3L3OB 1DL7H 1NOAA 4JFPA 3RWCB 5CU9A 5AWNH 3CHPA 3KM1A 2VDRH 3I6GA 4NJAH 1OAKL 1AG0A 3QPXL 5HVFB 4K2UL 4Z7NF 2V17H 1H8SA 2J73A 4YSTA 5E4AA 5M95B 3NIGF 4CMHB 1KLGB 3S96B 4MAUH 1T1YA 4PEEA 2NY7L 2BNQD 3O4LD 4AENB 4R7DA