5LBSA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
446
structure length
394
Chain Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHDENRAKVEITPNSPRAEATLGGFGSLGLDCEPFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGGSWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Immune system-viral protein
molecule keywords envelope protein E
total genus 79
structure length 394
sequence length 446
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbsA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbsA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbsA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbsA03
2P5PA 3J27A 1PJWA 2V33A 2GG1A 3MUUA 4L5FE 1Z3RA 3J2PA 3N42F 1SVBA 5LBSA 3UZEC 4AM0Q 5KVDE 3UZVA 5KVEE 1UZGA 1TG8A 5H37A 4UTBA 1ZTXE 3C6EA 4FFZA 3N40F 2HG0A 3C5XA 1RERA 4UT9A 3UAJA 3UYPB 3UC0A 2JSFA 3WE1A 4BZ2A 4GT0A 2H0PA 4UTAA 5LCVA 5KVGE 4BZ1A 1URZA 3N41F 3IRCA 2ALAA 4AL8C 5IREA 2R69A 4UTCA 1OK8A 5JHLA 5B1CA 5AAWC 2I69A 3G7TA 1Z66A 2R29A 3P54A 4FFYA 4FG0A 1S6NA 5GZNA 5AAMC 2JQMA 3VTTA 5GZOA 3I50E 2JV6A 4UT6A 4X42A 5LBVA 1OKEA 3UZQB 5IZ7A 5JHMA 5KVFE 3N43F 3N44F 4GSXA 1OANA 4ALAC
chains in the Genus database with same CATH superfamily
4B9CA 2AK4B 4KPHL 4BWUA 1V55B 1XGPB 1CO1A 4HXBL 2YGQA 3KXFD 1T4KA 4MMXB 1A9EB 3VXTA 3WIAA 5E9DB 1XF2A 5LCVH 1UQSA 5FW8A 4P57A 4JJHA 5J6HB 1D6EB 3BVTA 4BSJA 1I8LA 2XZAH 4DETA 3LY6A 4U1SA 5F7AA 5LVEA 3ULSA 2VXQL 3KYNA 2TSBA 1HQRA 4HIPA 5I1KL 4M5TA 1CLZH 3QDAA 3QNXB 2NXYD 4K7PL 4UDUB 3TN0B 4UUJA 3MKGA 3SCMB 1DHKA 4AM0A 4Y1AE 1E5CA 4ES9A 5A2BA 1AQDA 3NG5A 3K5RA 1KB5L 3I9GL 3F64A 4OGZA 2DJUA 3ASWA 3CZFA 1J1OH 3W5MA 3ZQWA 2A9CA 5I0YA 1MF2H 5DXWA 4X9IA 3B5HA 1QD0A 2PP9A 5CCJA 5E6SB 4I85A 5JXAH 1S9WA 5EWIL 1FLRL 4E2OA 2B4CH 2CUHA 2VO5A 4KRLB 3KW8A 3TFKD 2RACA 3B7TA 1AC0A 3H9YA 4PJFA 4L0ZA 1NBZB 1IBDA 3UO1H 2P26A 2R0WL 4NUPA 4OB5H 5HVHC 3O2DL 2PTUA 1XL6A 4HXAH 3KLAB 2ZCKL 4HDIA 2BP0A 4K9JA 1P5VB 4UV7H 1IGTA 4XN4A 4JFUA 2WO4A 2Y2WA 2WIMA 1JXFA 3H3PH 2A6KA 1OCRB 4XNZC 3JWDC 5T5NG 2C9PA 2V2TB 4O2CA 1I9IL 4R8WL 3SPHA 2ZWLT 3ME0B 1JE6A 4GS7B 2W60B 2QMKA 5TE6H 1CXEA 4X0KA 1AHKA 5BV7B 5F88B 1CTOA 2AXFB 2X41A 1P4LB 2PO6C 5DD5L 4DVBB 4YN3A 4EBQL 1EJOH 1KGWA 4QYOA 2WLZA 4NBXB 2BIPA 1L0QA 3D4GA 4URTB 1Z0MA 1N2RB 2F7QA 3GSOB 4G7QB 1PZCA 1RIUL 4DKTA 1SXZA 2ZOUA 2GUYA 3G5VB 1QPKA 1C7TA 3D85B 4WUUD 4EXPX 1IL1A 5LBSL 4QOKB 5SWSA 3CX5J 3LDBB 4XP1H 3PNWB 4X7DC 5FA3B 3PWUB 3FK3A 3NQKA 3ZE0F 2VKXA 3BVNA 3EDEA 5INCA 4M5YL 5AOZA 1FYHB 1O7DC 1O6TA 1Q72H 3QULA 2JELH 4LVNC 1F97A 4BHUA 1QPPA 3N91A 3FXIC 2VDLB 5DDHB 4QO1B 4PJ9B 3QRGL 3V4PL 3RFZB 4ORGB 4ZFOA 3PQYE 1MREL 2DMBA 5FYKE 2WUCH 1DBBH 3D85A 2J2ZA 4WUUA 4BKSC 3GI8H 4PJGB 1ZLVK 1MRDH 1WBYB 3K7UA 3KE0A 1MLCB 5DZJA 4JFYB 4QLWA 4WNSA 3RAJL 1AE6H 2MTPA 4PJDB 4I0CC 2AV1B 5EIIA 4GQ9H 1DQLH 3F3HA 4L0YA 4OLZL 1KCUL 3B3IA 1G4RA 4P2RB 2X88A 3RVUD 5F88A 2FD6H 2XQYA 2GCYA 4JG5A 2ZYSA 2CSPA 2DQFB 4I88A 2UZPA 2Z31D 2R8SH 4J2QA 1NEUA 2NY6C 2UX7A 3C87A 3INUH 3KWTA 3U30C 3L5WB 4G80A 4GSDH 2V5SA 1KLFA 2BSEA 2VLKD 4OZHE 3T1FA 1F18A 2YAHA 4D0DB 4JFZH 4QEGA 2VNCA 4FQXA 4AMKL 4UQDA 3HKZA 1NL0L 4JRLA 3ULUL 1CD0A 3KYOA 3ZTCC 3QUMA 3WLWC 4PTTB 4QKTA 3GTNA 2K6WA 4GKNA 2VZVA 2DJ4A 4LCYB 4YO0A 4EUPA 4GRLB 1BXAA 1S6NA 3LKNB 4NO0A 3CHPA 5EPMA 2CJSA 1MLBB 2JV6A 4MNQD 3UTSB 1U3HB 1WAAA 2CXKA 4HKJA 3H6JA 4ZFZA 2FBJH 1P7QA 2VQUA 3L9RA 1R3IL 4XNYH 5CP7A 2CGRL 1Z3GL 2MFNA 1U6AL 2BNQD 4ABWA 3ECQA 5J3HD 1R9FA 3SGDI 2O5ZH 5A3IC 1A7PH 3KLKA 4RDQF 2PTTA 1OGAA 1LO5B 1H6EA 3G6JE 3WIIL 3OAUL 1EHNA 3QAZC 2JWYA 1U8QA 2R0LL 2VDQH 3VXOA 2NZ9D 2WXQA 1G6VK 3QAZB 2J57A 1SN2A 2WP3O 1AGBA 1U8MA 4AKPA 5I23A 1PG7W 3FH8A 1G7QA 4P2YA 5F7EL 2WVVB 4Q74A 2B59B 5KJRH 1OPOA 2MCPH 3D9AH 4KMQA 5CD5C 1NIDA 4AM0Q 4F37K 2P8MB 3BPLB 4QR7A 2VDML 3BW9B 4HUMB 3PAYA 3RWCB 4E5XG 1CFTB 3AAZA 3GKWL 4OKDA 4YIQA 5C0CA 4IIQA 2X7LA 3ZQ9A 1YNKL 4A2EA 3DVGB 4L8BA 1FPTL 1FVEB 4Q7DA 4EZMA 4KY2A 2VZTA 2H3KA 2NR6A 3MLYL 1CFVH 5DJDA 3IDJB 4ICXA 1RUMH 4XMWA 4M48H 4OGAC 3ET9F 3BDBA 4POYA 4TN9A 4GAGL 5GS3A 1PZUB 1JWSA 1XF4A 3HG1D 5F97E 1HWHB 4EN3B 3GDCA 1A6PA 5E4OA 3QHFL 2FJHA 4ANUA 1ADWA 3DX6B 4BQBA 1HDMB 2E7BA 1JGIA 4IOSA 1NC4B 4LSUH 4UAOC 1E2WA 4P2OD 4WFHD 3F12B 1KENH 1XX9C 1CLVA 3CIQA 1JNNL 3PV6B 3P4MB 2BS71 4NQDA 4S1QL 3BWAA 3SE9H 4BBWA 4RGNC 4PSRA 1CGVA 4ZTPH 2K6ZA 4Y2OB 1S9KC 1J18A 4O02A 1KEMH 3B2PA 1HIMH 1FFNA 1JIBA 5DLML 5T5FA 3RWIB 4GI9A 4HIJA 1VFOA 4MSWA 2FECL 1CFNB 1MHHA 3D08A 4PS4L 5ISZA 1MJUH 3US0A 4AIXA 1ACYH 5HHNB 3ZKXC 1G7LA 4WU7A 2E7CA 2NXZD 4O02H 3ZDXE 3FQWB 4IOSD 2YFNA 1QABA 3D39D 2A6IB 3RPIB 1IEBA 1VADB 2X38A 3D8MA 5L4FA 3F8UB 4PRBA 5HYJB 4ELKB 4WFFE 4IRZH 4XBGA 1N5YL 3K8KA 3LIZL 1M2OA 5J9PA 5LDUA 5IK3A 3QC5X 1J88A 4OZ4A 3LV3B 5DC0A 4N86A 1KCRH 3HLAA 4YHIA 1F8TH 3GLZA 3DIFB 4EKXA 3KLSA 4P5MA 1K5NA 4OU3A 2QQNL 2F8VA 4DF9A 2K9FB 3SEPA 2WK2A 1S5HB 1J9TA 3VFPA 3BP5A 1HEZA 4Y4FA 2VUOA 4NQQA 1MFCH 5KVEH 2K45A 3DI2B 5DK2B 3C9NA 5TTRA 2XFXB 1IJNA 3MRDA 1KELH 2APWA 2NX5A 5I0WA 3IXTA 1DJGA 2WWMD 5C0AA 3Q6GH 2M1KA 4F37F 1UKSA 3VGBA 1FPTH 2HJLB 2YSTA 3EO0B 1A7OH 1NC2A 3A67H 5IR1A 5E8EB 3RX9A 4QRRE 1DR9A 2R1WB 2CD0A 3JUYA 3IETA 3P73A 4U3XA 4MMYB 1H5BC 1P53A 3QI9C 3JTSA 4PG2C 2BP3A 3QHTC 3SKOB 1JF5A 2BCMA 3LH2H 5GIRB 1PG7L 4GRWH 3WDIA 1FYTB 4JKPH 1OSPH 1UXMA 3L4ZA 4P2QB 1C5CH 3EOYG 2AGJL 1SYSB 2BNQE 3ULAB 2KZ1B 2RH0A 4KXDA 4YDMA 2WGNB 2YMOA 3FU7A 1CZ8H 4ADGA 4KVCL 3PDOA 4ZFFA 4IBQA 1J9SA 1LE9B 1FRGH 1CU4L 2L7JA 1FZKB 4XNQB 5HY9A 3SDAC 2AJ3A 2ZXAA 3ARDA 3QUXA 1DJZA 1JRHI 4OJFH 2UWEE 1I8KB 3CX5K 4R5VA 4L8SC 1UWGH 5B1JA 5E5LA 4DGVH 4HEMA 4U6VH 5E94A 2BC4A 4OFYA 2C3XA 2VT0A 3CG8A 1GHFL 3GXTA 5CSZB 3HR6A 4POUB 5B7EA 3NZUA 3N1QC 1QUPA 5C92A 2ZUSA 3UZVB 4W9IC 1SLUA 5EO0A 4LPWA 1KZQA 1C1EL 3HG1E 4P5TC 4YH6A 2K70A 4JFDD 3BSZA 3CK0L 1ESOA 1G84A 1KMGA 3QEGL 2NDGA 1ZHKA 1E9OB 3V9FA 3NJHA 1DUYA 4RSYA 4M7ZC 2X1XR 3PHAA 2LFGA 4LESA 2ZYIA 5LGJA 4KFZC 5CLWA 4LKCB 3QZLA 5ESVB 3DOHA 4YAQB 3H9ZA 5KZCB 2IAAC 4JQIL 3OMNB 2EIZB 4OLWL 4JFEB 4AV0A 4XNAA 2EIDA 3CX2A 3HI5L 5KANG 5IBLD 1MI5A 3IDXL 2IBZY 3NRQA 3U36A 1E6JL 1NA8A 1W72A 3PHQB 3CDFA 4AYDC 4K94C 1U2CA 4PRIE 1N7ML 2HMIC 3HG0A 1J11A 4V33A 5JHDB 3OJDA 3UERA 4G8GE 2XV2A 4DAGL 4QNPF 2GT9A 3OSVA 4OFYD 1MRCH 5EBMB 5F9JA 1FIGL 5CEZH 4X4XB 4YDKH 4WENB 1XO8A 2YEZB 4GQQA 5DJAB 1A3QA 1T1WA 2FJGA 4M3JA 2CJTA 1BJMA 1DLFH 1UWEH 2YGPA 3EJTA 2YUXA 3GGWB 1D5ZA 4LRIC 3SPJA 2K78A 2W65A 1EJFA 2F53B 4KC3B 5FO9A 3RB7A 1S7XB 1SN5A 2YMXH 5B3NA 4XAKE 2MNJB 3GIZH 2F15A 1S7UA 4TQHA 3BQUD 3B34A 4CVXB 1IBYA 1T2XA 4ZX3A 1NFAA 3RGVA 4G7YH 2VLJD 1FI8C 2R9HD 4WHYG 1KB5B 2VC2H 4QF1A 3QQ9D 1RZPA 3QUKA 4L2YA 1MFVA 5I1DA 3TH2T 5I1EH 2YQGA 4R0LB 3UPRB 5KSBF 2LU4A 2YARA 2XN9E 4D2NA 3WL9A 2AI0H 5H2BB 3VXSB 3LMJH 3O2DH 5LNDA 1YQVH 3DHPA 3OKEB 4W70A 3UO1L 1WFIA 5I0XA 1AFVL 4MA1C 2V9TA 2ICEB 4MLSA 1YPZE 4NHCH 1QW8A 4P4RB 4OI8A 3IS1X 5HDBF 4NGHH 2BCKA 2N4IA 4FQXC 1KFAH 4HSCX 3DOSB 1E4XL 5D70H 1DE4B 5EWIH 2KC0A 5MEQA 1NJ9B 5J1TC 5IW1A 1HNFA 1ZD6A 3HUJE 1QEWB 2ZP8A 3EZJB 3QWOB 4EIZC 4M8QA 4LHUG 4KI5C 1J0ZA 1HHGB 3L4WA 2N0KA 4XNUH 3TT1H 2RFXA 3QQNA 1PSKH 3MUGA 3QJHB 1N6VA 4E41D 3Q1SL 3NZHH 4OQ1A 3L1OL 1P84K 4P46D 4R7DA 4U6VL 5FF6A 5HGBA 3IGAB 3R06B 1FNEA 4JPKH 1TYEB 1XIWA 3DO7A 4LSSL 3WFBH 5KSAB 3PAVA 4IMLA 3ZTEA 4NQDD 5E8OA 2XY1A 1S7QB 5A2LH 1R24A 1HSBA 5LCVL 1WIPA 2VLJB 2XV3A 2DWXA 2R0ZH 1NKOA 1S7RB 3MBED 5FKAB 3O8XB 1YYLL 3K80A 3N3EA 1QSEE 5A2KH 4LAJH 4ZT1A 1SN0A 3CFQA 1ZRUA 1I8MA 4JKPL 3ESMA 1IC0A 1L5GA 4PJHB 5DHVH 1U8IA 5DHMC 3NEEA 1R0AH 2CO7B 3BUQA 2OQJA 3HI6H 3DIVA 3ZKMD 4S1DD 5H37G 2AERT 2W0KA 4LHUB 2BHFA 2FHFA 5D7IE 3L3DA 5JLZA 1MFAH 4FQCH 4B0MB 5DU7A 1A6TA 3ROLB 3JT0A 4O9HH 3NCYS 1CFQB 5T1JA 3BH9B 4KQ4L 2X4SA 1CG9A 2G9HA 3LHPL 4QRPE 3VFGL 1B0RA 4GW4A 1ZV5A 1M42A 4Q6IA 1F5WA 3PGFH 1M6OA 5EBWB 4APQB 5LWYL 2C9UA 1MQ8A 2C9AA 2GSIA 4ZDHB 1AJ7L 1L9PA 3A0OA 4JO2H 1M7UA 5EIIG 4BDVB 1QI4A 3ABGA 3QJRB 3RL2A 2ARJB 4QOKE 5C6WH 5FO8B 3BKCH 1BYOA 4P4KC 4UOZA 4LCUB 4WNQB 3NIDF 4XWOD 1JNLH 4PVBA 5IIEA 1P1ZA 1M71B 3WKNA 4IRZL 3LRLA 4JO2L 4KV5F 4EIBA 4S0TD 4QRTA 2WWKO 2I9TA 1PZSA 1BFSA 4AGQA 4BFIA 1QA9B 3ERXA 1A02N 5DUBB 1RZJH 1XR9A 5K9OA 4JFTA 2NY2C 2JK5A 1BOGB 3ATDA 3GMPA 4BELD 1QKZH 1RULH 3OVUB 4C56A 1HIML 5DLMH 4HIQA 3ARTA 3SE3A 1AXTL 3NFPB 2LFEA 5JZ7C 1CDCA 3BDXA 1E8ZA 4G3YH 4H25A 4N8CL 4YDVA 5F1NB 1OP5K 3SE9L 4P2RD 3KM1A 5IW6B 1E42A 3SCMC 2IH8A 2BZDA 4MJ4A 4MHHG 3HCVB 5GZNC 2Z31B 3NJNA 4GG6E 5T1DL 4PH8A 3UIZA 3QHFH 2NY6D 3DX9B 2P8LB 4DWHA 1KLUA 2QHRL 3GUTB 3T0EB 4OFQA 2JJTA 5JIPA 4PRPA 3GEFA 4OZGE 1T7VA 3UTZA 2R0ZL 1OLZA 2A4EA 2XKNA 1Z7JA 3Q43A 1G1OA 5FOBA 1TQCB 2F9BT 2CU9A 5KS9A 2KMWA 3D39B 4JRXB 2VDRL 3SGJC 2I60H 3VXNA 3I6KA 5AKTA 1UWFA 3U7YL 5DD0H 5DK0A 4YSTA 1B6UA 1S46A 5ITBL 4OCYH 1KV3A 2ZKXA 1HKLL 4EXKA 2NY3C 5HVWA 2XWBA 4GP4B 3RVWD 1OCCB 1U36A 4PYGA 3K2UH 4XCNB 3EYUH 1AQMA 1UH2A 3MJWA 4W9HC 2DQTH 4YNYA 4HOZA 3HE6C 3FFDA 4H8WL 4MYPA 1MPAL 5ICZA 1I3RA 3WEXA 4XRCB 1IAMA 4F93B 1JZ3A 4PP2B 3D4ZA 4HUWA 2VLLB 1XGRA 2OJEA 5D1QC 4GQZA 4AI7A 1NC2D 1RUKL 2IVFC 3M7FB 2HKFL 3INOA 1AS6A 4FMFA 3WIIH 4MJIE 1M7XA 5KYWB 1GZQB 3I6LE 1QSFA 5ESAA 4Z3JA 1Z3GH 3FUKA 1F1GA 3K3QA 3RZCB 2L04A 1HXKA 3NP4A 3TZVB 4HS6B 3JVFC 4L4VD 4ILDA 4AJVA 4LVOB 1XSKA 4A7GF 4JDVA 4Z9KB 5CCGE 5CKGA 2B1AH 5K9JH 5FHBH 4DN4H 1Q9LB 4L3FA 1E6OH 4NKOB 3LEYL 2JCCF 3CXHK 5GS0H 1USQA 4AIZB 1JDAA 2F2HA 4G42A 4F9LA 2JB6B 3ARZA 3ZQXA 3C6LB 1GTNA 4WCYH 4K7PX 2DV6A 5FB8A 1RP9A 4XN7A 2PO6A 3PJSB 1SY6H 5LBSA 1ZSHA 5CSGA 1NTDA 3DPDA 4NP4L 4IBUA 5DQJB 3L3OA 5AVUB 4ENZA 3R1GL 3RWHA 1Z5LA 2A74A 3W2DH 3GMRA 5ID1B 5D96B 1HHJB 5IHBA 4PJ6A 1BFTA 2EUVA 4UQBA 3UYRH 4AYSA 4NUQA 3T8VA 2W5PA 3SKMB 4IHOB 2X42A 3PIQB 3ARGD 2NY6B 4DP5X 2G0LA 1IGJA 2F54A 3GD1C 4XO9A 1JGUL 1HINH 1TIUA 5EEYA 3V9EA 3VYOA 3DX2A 3LZFL 2NUPB 2ENPA 1QWNA 1PY0A 1TTCA 3SGJA 2NXYC 2EDXA 4FG2A 3VXNB 3QRGH 3V4PH 4TLTA 2G3MA 1NDGB 2UUDH 2XX1A 3F58H 2IC2A 3O0RL 3ARFA 4Y19A 5AW1B 1J1PH 1L9NA 2FIKA 2YK1L 1PY4A 5CEXB 3WKQA 4B9JA 1DUZA 3IFOB 1LO3H 2WLYA 1JGVL 4ZUVA 1QFWH 4N6RA 1NCUA 1YECL 5EUOF 3L45A 2VM9A 5I6PA 4QHMB 4OH2A 4XPAL 3QCVL 3EYQD 3CC5B 4ZUSA 5SWZA 5EF2A 2V3EA 1RFDH 3NZ8A 4GB9A 1GC1C 3MJ8B 1EV2E 1M7DA 3SDDB 4ZMAT 5EIQA 2OTUA 1UD8A 3NFPA 3SDDC 1T5XB 5E1GA 5IQOA 4HCGA 3SGKC 1A6ZA 4C56B 7FABH 2BOLA 1TU2B 2XYBA 2TRHA 3KPLB 4NENA 3GZPA 4PLOB 2FT7A 2ED7A 1F11B 4PJ5A 2DB8A 5CNHA 3CPUA 1FF5A 4HJ0C 1HL5A 3CK0H 5IB4B 1UB5B 3OMIB 3U7WL 1AZCA 1U92A 1W0YT 4HYTB 1HT6A 4KXBA 5FUZH 3DX8A 1ZT4A 3O45B 1A0QH 1CBJA 5ETUA 5DJ2B 4LCWB 4UB0H 4JY6A 5J6SA 3BP4B 3UBXA 1DYZA 2E7LA 1X5AA 4LSRH 2VR5A 1GHFH 1INDL 2FLBT 1OCWH 1THAA 3QIWD 2P7TA 5EBLA 3R7RA 1QLEH 4KKBC 3HJEA 3TEUA 3BQUB 4UTAH 1EEZA 1O5PA 2QVFB 3N6YA 3D12B 2Q7YB 2P8PA 1AIZA 3OLIA 2CR0A 2PYFA 3VD2A 1FFQA 2WJ5A 4IBWA 1ZWIB 3U4BL 3MRBB 4XPGH 4I5BA 4KJQC 4R4BB 4KI5F 3G5WA 4TNVK 1IC1A 2AMGA 3VD4A 4HH9B 2ZICA 1CFQA 1LDPH 1BMGA 4JPQA 2ZIDA 1NAMA 2E46A 4LQ1A 3T0BA 2NTFA 3RA7H 3WSQH 1RQ5A 2HVKB 4Y4HA 1WYJA 4I13B 3S8GB 1OSPL 3L3DB 3PWLB 5TE7H 4N8VA 5F3HA 3GWJA 3RNKA 1PLAA 3MRLB 4FI6A 1B0GA 2L7EA 4UT9A 4TLSA 1Q90A 3LEXA 3WJLA 3WD5L 2YAQA 1F4YH 1GZPB 2OQJB 1J5DA 2OJ1A 3U9UA 2AFNA 4TUUA 5E00A 1K8DA 1NIBA 3OWEA 5F9AC 4PS7A 1CD1A 4F1ZA 3JSSA 2UX6A 3WKMH 2X4TB 5DRXB 1KELL 4ZZFA 5FKAA 4YR6A 5T1LA 1MCHA 4PRHB 3GB7A 1P4BH 1J5CA 3IGUA 4JY5L 4E41A 2P5PA 1LYQA 1HSBB 2FEEL 5BMFL 4L9DA 3ETTA 4N0UB 3B2VH 1Q9KB 4AEIL 1TETH 2XWCA 4B9KC 1JZFA 1A25A 2VABA 4NN7B 4Y8DC 4B7LA 4H8VA 4OFKA 4KK9C 5DD1L 1OM3H 1F8TL 3MX0B 1UB6A 5TE4L 3KPMB 1D7FA 4JZJC 1SJEB 2Z7UA 5F9DC 2J4WH 1GPOH 1JHKH 2F7IA 2WYTA 5EC2B 4G11A 1IBZA 5I1HL 4UDTA 3TN0C 1FDLH 5F7MC 1CE6A 3GMNA 3LSOB 4L5FL 4R97C 3EOTL 3HZ3A 3WN5B 4G9DB 3L8QA 2PWDA 1X5FA 1V8HA 2DWEA 5D1QE 5ABZA 1AI1H 2BNUB 2DKMA 1MCWM 3T0XA 2IQ9L 3NACL 1Q9WB 3U6RA 3LQAH 5CLTA 3QDMD 3EJZC 3HE7B 4QXGL 3IE9A 3ZKSD 5HYQA 1UZ8A 4ZTPL 3HE7C 5JHLH 3ARBB 4HH9A 4HLEA 1KJMA 5AVZB 1D6VL 1T0OA 1NMCB 1R6VA 4BUQA 3KW7A 4QAWA 5I6NA 2VR6A 5FPIA 1W16A 3VXSA 4WI2A 4TV3A 1OAZH 2C1OB 3E3QE 2GK2A 2LLNA 2X6UA 3HHSB 3QDJB 3D87B 1IAII 1KCSH 4TVSa 2D3NA 5FKPA 3C5ZB 4MB3A 3TP4A 3TVMD 3SJVE 3G9AB 3NFSH 4ODVH 3CSPA 1NGWA 3EDKA 2EDLA 5DZOA 4GOSA 2I27N 2ZCLH 3GBNL 2E6PA 2V5YA 3FU9A 2AQ1A 3WO4C 4Z23A 1FYTE 3FN0H 4HLZG 1OZTG 3MLYH 2VDPH 2BERA 4H88H 4WK2B 1LO2H 1TEGA 1QI5A 3MC0A 3BX7C 3C6LC 1XIWC 1WSST 1JZ5A 5TD4A 4X6DB 4WU5B 2XXGA 4MRCA 4JS7A 4PJ5B 1BJ1J 1TITA 1FA4A 3LKPA 1A6ZB 1J8SA 2EXYC 4RFOH 4ZQKB 1IAKB 4EJ1C 3BO8A 4YVNA 5J8OA 2NYZA 4Z7UE 4LE8A 3MRIA 5DO2D 3TZVC 4F7CB 4ONGL 3ZHDA 3SDDA 4MXVF 3BHBB 1TZAA 4Z7VB 4ESKA 3ULUF 4BH8A 2JKJA 2PO6D 1A6VH 3BIAX 4ZG1A 3CAFA 1DJXA 4P5KB 5LBGA 1JPTL 3GIVA 1OHQA 4OLXH 3GBEA 3KH4A 4GBXB 4YGVA 2A1WH 2G5RA 5FCUL 4Y9EA 1I8UA 4X8JA 5E56A 3DLQR 4MNQE 4ZW3A 4PWGA 1ZANH 5CEXA 3O3DA 2XCMC 5EUOA 1I9JL 1QUNB 2ZKHH 1NDGA 4KJWD 5DVPA 3G5ZB 3MPCA 4XT1C 2RGSA 3FDWA 4H1LA 4OZIF 4WI7A 3QUZB 3S5LA 5E9DE 3BSZL 1XGUA 5IM7A 35C8H 2YGNA 2NNCA 2K8MA 3LNIA 2VLRB 4OVUA 3UYPA 4EI0A 2XHNA 4XBPB 4LOVA 4MJJA 2PP7A 4Y9CA 5DS2A 3VVWA 1UM6H 2EIZA 1MH5A 5D7EA 5G4OA 2DBLL 3OKYA 4QXWA 1NL0H 5ISZD 4XVJL 4I2XE 3SYAA 3AMLA 3VNZA 5H94B 1TEFA 4K73A 3X12B 2R1XA 3PWPE 3KLHD 4RMSA 4QRAA 4UIKH 5MENE 3OAZK 4J8RA 1MHPL 3VXUE 1WUZA 5LN4A 4N2DA 1BVOA 4K2UH 1W72L 2WQAA 2DWSA 1ZSDB 4KFMA 1Y1DA 4ZSOE 2CDEB 3L3IB 2PWGA 2VLRA 5E08H 4MB4A 3TJHD 2H47C 3WE6B 1HHKA 1FHGA 1ZA6B 2Y7LA 1H19A 1I85A 3DV4A 1OF2B 5AB9A 3IK2A 3OAWA 5IMLB 1F3DH 2EYSA 4ZUUB 3MRMA 1NCWH 3QDMA 3BH4A 4JLRA 4U1HA 3CHSA 2GI7A 1CR9H 2DQDH 1EZVY 3N85L 4JHWH 2FSEA 2PWEA 5SWZD 3QUXB 2JJUA 2JCCA 4WK0B 5HY9B 1PKOA 3AG4B 1WFOA 2WLJA 4NPJA 4RAVB 1ILUA 4Q9QH 4K94L 3FU7B 3M1OA 2OYMA 4AC4A 5DZ9A 2IFFH 3PQYD 1QSFB 3L2NA 3MV7D 1WFNA 4S1SH 5A2AA 2Q8BH 4A7GA 3CMGA 4F8TA 3VXRA 3PG2A 3VACA 4IRJC 4R3SA 2C3WA 4WAFA 2X0WA 4GIPD 4ALAL 5BUPA 1SEQL 3EBIA 3PP4L 4RMWA 1FAIL 3FRPG 1PLGL 1EHXA 2P5EB 3FQTA 1MIEL 1CFSA 1N12A 1I3RB 3VH8A 1WFMA 1DQTA 2QPUA 1J5OH 2AJVH 2CLVB 3MRDB 1LJMA 5TE4H 4P5TA 4U1GB 1U8HB 4XVTH 1T5KA 2ZUQC 3HRPA 5DRNA 4ZXBB 4WHYH 5FIEA 5TGBB 1EEYA 3KBEA 3QDJA 2GK0B 4K71B 4M1GL 2VAAB 4JRXA 3UJJL 2DQGH 3DSNA 4P2QD 3S2AA 5I1JL 3BUDA 4YHIB 1UH3A 3RGVD 3WDJA 1A9VA 2ZG1A 2ZTBA 4MA8L 1I3GL 2KERA 4L3CB 3BEWB 3ELQA 2B4CL 5KS9F 4NZRL 1FLRH 2MPVA 3HCVA 4AYMC 2A6IA 4YPJA 2Q6WA 5IB1A 3FQWA 4TUKL 1F4YL 3X1EA 5AVYB 1USZA 2VMDA 1LMKA 4WKZB 2K3TA 4NWTH 1EX0A 1WLHA 2EINB 2X1QA 5IW6A 3E1F1 3GNML 1YJDC 3QJXA 4KZEH 4OGAD 4LBEA 4HIJB 1NPNA 4MSWB 4U1JB 4MWFB 4L9LC 4LBAA 3MRCA 4UT9H 5EBWA 5IMKA 3UEQA 2J6EH 3PGDA 4N8UA 4PS8A 1ETB1 2UVEA 2P5WE 1A9BB 1QTPA 3VDBA 4PGEA 2YOCA 4BFIB 4A7VA 5LCVA 2BRRH 3J7HA 4I87A 2HN7A 1V7ML 3LZNA 1BAFH 2DN7A 4PJDE 5CEZE 5IEKA 1I7RB 2EXTA 4UQAA 3WIHA 3M8OL 3BCDA 2HKHH 2OXGB 1ZOXA 4PRHA 2NR6C 2R39A 3L9YA 3S4SG 5FO8A 2E0PA 4HJIA 1FNAA 1O9ZA 3K71A 4XVOA 1FCCA 1RIHH 1W0WA 4GXFA 4NC2B 4IIZA 3OC5A 4PWIA 1NCAH 5FCSH 2DPKA 2IAMB 2J8HA 1OTSD 3AAZB 1CFTA 1GZPA 2X4NA 2MPAL 3GPSA 4PJ8D 4YIQB 5EU6B 4HUXA 4ACTA 1PPIA 2P8MA 4IRSC 4PY7B 4NYLB 2GJ6D 5IOKA 1RZ7H 1MELA 3H42L 1A6TB 3PWLA 5CJQL 5FWRA 4F57H 2JJTC 3NESA 4XNXL 3RU8L 4PJIB 2ZSVA 2GBTA 2OMBA 1MCSA 2P5WD 2I26N 4M43H 4Z6AT 3BN9D 3O6FB 3BMVA 4JEGB 4PRDA 1IGCH 3D25A 1TVDA 5C0FA 4HCRL 5DHYA 2NY2B 3ZKND 4U1IA 2Y07H 5D8JH 1HS6A 4J4PC 1N70A 3CPLA 1FVDA 1TSRA 4HU8A 2VL5B 4XPTH 1JFQL 4BJLA 1KBGL 4ZPTB 2PYFB 1J9RA 2J6WA 3TM6A 4LLUA 4ZW5A 1LO5A 1YECH 1DJYA 4M8VA 4UQ2A 1MZZA 2WXPA 2Q3XA 4B9ZA 2IGFH 3NN8A 3AM8A 4K3JH 4Z7WB 3B5GA 2P7TB 3BFWA 3SKUD 3EYFA 1UKQA 2JKXA 4A68A 4HKJB 4KWUA 2XZQL 2OTWA 2NY4C 3QB7C 4J3WA 1OSZB 1JN6B 3DYMA 4D3CH 4P9MH 4JVUA 2EYTB 3D07A 4YQXH 5KSAA 3LVEA 3C5SA 2V9UA 3MMEB 3EOBB 4NJ9L 3GSWB 2YUZA 4ODXA 4RBPH 1U4FA 3DTXA 5DYFA 2YPVL 5B38B 5D2LE 1T7XA 5DZPA 1EAPA 3STLA 4TXVB 4RGND 2X3CA 2D0HA 1EZVX 1WZ1H 4WIQA 4X8GA 5D96C 1EHKB 3JV0A 4LMQE 5JDSA 3MODL 4XNMB 3W2DL 3X3FH 3FC8A 1CS6A 5I8KH 2VM3A 1S9XB 4CU6A 4XVUD 1EBPA 3WN5C 1BWWA 1XV8A 4FQIL 4DEPB 1CI3M 1OAXL 1MW1A 1GYWA 1N5AA 4ODTH 3WN6A 4BFNA 2OSWA 3RUGB 5CU5A 3HRZC 2OJZL 4BD4A 1ETZA 4DSYA 5EIIB 5GGQH 4N6RB 4HS8H 1HWWA 3EGXA 4AW4A 2LAGB 4N8PA 5E03A 2Z35A 2ZOLA 5HD8D 5TDNB 2ZPKH 4X5RA 1JGLL 3KR3L 5ILTL 3BGMB 1KPRB 2XTJC 3RIFK 4LCCC 1U8PB 3K0WA 1NQBA 4ZD3H 2BSSA 2Y6TE 2H32H 5GZOA 1JK8A 1I7UA 1N3NA 4JPWL 1KCLA 1QR4A 1FZJA 1OPGL 1T22B 4CN1A 1NUFA 2VDNB 4NC0B 3FB7B 2QADC 5TF1L 4NO2A 5EEVA 4XVUC 3PWUA 2VDLL 1NLBL 4YBLB 3QIWB 4UZUA 4WFGD 5JQIB 4MJ6A 4HUVB 1E27B 4R6UA 2MKLC 3PL6A 3TCLB 1NICA 3O4OB 4FG6C 1AO7D 4OCNC 3IXAA 4CVXA 5JIHA 1IAIM 1AO7B 2BXZA 5ECGA 5I30H 1E67A 2AV7A 3ZW3A 4X4ZA 3VXMD 5GISH 2RD0A 3TNMB 4F7EA 1WGOA 1EUUA 3QORB 4BRVA 4ZMOA 2K4WA 2BNRA 3B9KC 4FZ8H 4OD3L 4GKSB 4AH2B 5E8PA 5G4NA 4KZ0A 3RDTC 1BMZA 1F58H 2L7QA 3FJTA 1PYWA 3MXVL 3O4LE 2G3NA 4PI0A 4Z7OE 1MFDL 1BYPA 4KU1A 1EEUA 3IU3B 5F6HJ 3ZUNC 1BW8A 4FNTA 1IGTB 3R7QA 1JG9A 4LVEA 3NIGE 1JPFB 3BESR 2ESVA 2X05A 5MEPA 1A6UL 2QKIA 3HR5A 4U6XB 3HA0A 2ZF9A 4GBXC 1TZ8A 1H3XA 1X5ZA 3QCTL 3AS0A 1Z6JT 3V4VH 1EUTA 3GBNH 2AJYL 1Y18B 2XLLA 3WV0A 3BH8A 2WXKA 5ESAB 4C4UA 5A43C 3OHMB 4NT6B 5KYWA 1JZIA 5EOTA 3WG7B 2O5NA 1OEZW 1X5XA 3ZE1B 1PGRB 3U36B 3U4EB 3D09A 3T0VA 5JORA 1SDDB 2VXTH 4FERA 3VX0A 1DN0B 3DX4A 5IJCC 2EVHA 3JTBA 1M56B 2Z4QA 2OMUA 4RGNB 4YDLB 4FEMA 3I02B 4WEEA 3T6VA 3MODH 3GPEA 3W0WD 5C09B 2YA2A 3DNKA 3WEXB 3N41F 3MV9A 2FEDD 4WHTB 3L08A 2KKQA 3BAKA 4HKZB 5I16B 3NACH 1SFDA 2AAAA 1B4RA 4JQVA 5ESQA 3TFBA 4AIEA 4F9LC 3IJEB 1T7YA 3PS6A 4U31A 1DCEA 3QFJA 3OF6D 5PCYA 1TJGH 4U1LB 5D7KE 3L3GA 1KXQE 4D9LH 1SVBA 3HUJB 3UACA 3UZVA 3IGKA 4P23B 1FDLL 1NLBH 1MKFA 4HK3J 5FGCB 4Z3GA 1N19A 1BLNB 4MMXC 1NFDB 2X4UB 3D69B 2BC4B 2XKNB 2DQEH 1UXSB 3MNZA 3Q01A 4BQ6A 2VDQB 2IGFL 4OVVA 3P3RA 4RH4A 1PX3A 4DW2H 4LB8A 3TA3A 4KKAD 3U2IA 2COQA 4Q0XL 3PWNB 1D5RA 5T1KB 3FONB 2GIMA 3FMGH 4RLDA 2ITDB 4M7KH 3V5DB 4BQ8A 3CN4A 3NJLA 3QPQD 1XZ0B 1OGSA 2J55A 4X9BA 4KQ4H 4GEIA 1ACCA 5GZOD 3RKDC 2HJKA 1E5YA 3ISWA 1IKFL 2EKSA 1RD6A 2ITEA 4M43L 3MBEB 4UU9B 2Y7SA 4JG9A 3CFUA 3MBEC 4WJ5A 2GIXA 1RZJC 3IAPA 3MBWB 1BFVH 3MDJA 5K9OB 2X6VA 4Z7NB 4LP4A 4L37A 5AAWC 1K3ZA 3TURA 1XXFC 2FYYA 3TV8A 4BFRA 5E8EA 1QSFD 5DMGD 1TJIH 1OTUC 1HCZA 1TPXC 2QEJA 3ZDZF 3FO2B 2R15A 3CHRA 2EO9A 2YSSB 4F92B 4FFZH 1VSCA 4QTHA 5LNGA 4P59L 5LQBH 2NW2B 1EEQA 5B1AB 2WLNA 4MS8C 4F33B 1MCIA 3QW9A 1UOWA 2X2YA 2D3JA 2GJRA 4BIKA 2ARJA 3CXDL 1DL7H 2MTAA 1BQHG 5DD6B 4MB5A 5F7KC 4BDVA 3MJ9H 4YQXL 5IHHA 1V7MH 2V0AA 2XBZA 1KG0B 5FM5M 4NKIL 4YWGL 5I18H 2BMKB 3DWTA 3U0PA 7CGTA 2X2IA 3L1OH 5KVFE 4OZ4B 1LILA 3SCMD 4EI5D 1C5DA 3MU3A 1S5IH 4UT9L 2BSRA 5C2UB 3RKPA 2VR3A 1TJHL 1IT9H 5B4MD 1ICTA 4YMPA 2Z3FA 4OF7A 3FFCA 5AW5B 3KVDD 3GK8L 4N6QA 5AYUH 2PYEA 5D2LF 2WLLA 3U7WH 2VR9A 1F45A 4ZO8A 4XAWH 2Y7QB 5KBKA 1CFNA 1MHHB 5ISZB 4R97B 1F4XL 3HFMH 4XNXH 4NGHL 4YZWA 5CAYB 4X4ME 2OPCA 3LKSB 1A4JA 2D0FA 2ZJSH 4TULH 3SBQA 2BIIA 2MPAH 2WQVA 1A3RL 1NCAL 3DUUA 2YAEA 5A2CA 2C3HA 1G7JB 2QSCL 3S5ZA 3IKCB 5LNEA 1TTUA 2C7FA 1EJ6A 3MBEA 3V0WH 4YLBA 3T3MF 3BAXA 4PJCE 3TJEH 4N0FA 4Z7WE 4EN3A 3S36L 1BD2A 3WHE1 3CLWA 4Y5YB 3DX7A 1PY9A 2AEPL 2J25A 3KLQA 4F27A 4OJAA 2X6BA 3REWB 2OMYA 3CSFA 5ENWB 2RFXB 1E2VA 4BKTC 3WNNA 3CFDA 3C08H 1MVFA 4FULA 2Y7OA 3EHBB 4IU3A 3FBKA 1DFXA 2PR4H 1XR8B 3KJ4C 5D1XA 5AOMA 2DIAA 2ISDA 4LIQH 4IEFA 3S96B 1UM4L 2CDFA 4XVSH 5DQ9A 1T1XA 3WS6C 3FN9A 4JN1H 4Q89A 3I9IA 4MD4B 5DJ6B 4ELMB 1XSOA 2HT3D 4YFEA 1FGVL 4E0RB 4KK8D 4I0PB 5EO9B 1EO5A 2ZNXA 2YGVA 3RYMA 5T1MA 4NFCA 3MYJB 3I50L 2CBTA 1IAIH 1RK1B 3BEVB 2WNXA 3AXHA 3B43A 1WEJL 4YSCA 2EUXA 3FCSA 3F62A 2R4RL 4E42A 4QKXB 2JI1A 2DEWX 2DQDL 3N85H 4QHLB 4X5XA 3QR0A 4KZCA 4BZ2H 1WIOA 3Q5OA 5IHZB 5GGRA 4XHQA 3IJSB 2YQ2A 5D55A 1VB9A 1KULA 4Y1SA 4DN4L 5FHBL 1U41A 4L3EA 3ZXAC 1DFBL 4Q56A 2YN5A 4B60A 1WAAF 3B9VA 2TSAA 4XVTL 2G75B 1FAKT 1IGYA 4NPYA 3WI9A 1I75A 4XO3A 3FZUC 2DQUH 3MUUA 4G6ML 1HL9A 5D7LB 5GGTH 4JKMA 5K69A 5HVGB 4JBSA 3I6GA 1IO4C 2IGLA 2DYRB 4ZUWA 2GSGA 5BRZA 4ANVA 2DBLH 2WZ5A 1M57B 3QPXH 3GHBL 3VFTB 5EU4A 5GSVA 4ALAH 2PCFA 5C0BB 4LF3A 2X9YA 5DJ8B 1BQUA 1G7IB 2HVBA 3KCWA 4P2RA 4HWEH 4HP5A 4LVHC 5M94B 3OKNA 5JO5B 3GINA 3T09A 2W9EH 2NY7L 4EN3C 2HCZX 4X5XB 3D3VE 3X17A 3LKOA 2CKBL 1QFOA 3VG0H 1H3UA 2A1WL 2N1KA 4GH7B 1OVZA 4YLQT 5F96H 4GRLC 1FRGL 3RFZA 1A6VL 5L0QC 1DQQA 4E9LA 2FK9A 3MV9D 4JFEA 5FK9B 3VW3H 2AQ2A 4Y5XA 3TONA 1C5CL 2X2HA 4LKCA 5ESVA 3F7PC 1JK8B 3WJMA 4NNYB 5ICXB 1T1XB 4KKRA 5C2BL 2FX8H 25C8H 3NYKA 4NOBA 1F42A 3N9GL 5FAAA 3RY6C 1JZHA 4MJID 4R90H 4W9EC 4P99A 1W72H 3V4LA 3D30A 3QQ3A 4F15B 1P9MA 1GIGH 3T4YB 3REVB 4E0RA 3SE3C 4G3YL 4N8CH 5E6RB 1Z32X 3VXQA 2RIKA 2D9CA 3CLEH 3GXNA 5D6DA 5I71B 4LT7A 1ZHBB 1B0IA 3G6DL 1Q0YH 1EXGA 3SBPA 2NNFA 4X0KB 3II1A 5F89A 1QR1B 3Q7JA 5D9SB 1BGXH 4M6AA 2R2CA 3FTUA 5KVEL 4Y16A 4HHGA 2ZWSA 3QIBC 4L1LA 2MOQA 1OO2A 2DMGA 3F5WB 2XT1B 4NQTA 3BZEB 3TBYB 4NO5A 3LN5B 1UWXK 35C8L 1U3HC 3BSZH 3IRPX 1DQMH 4Z0BL 1GOFA 3IYLW 3MLXL 4EF3A 5JNYA 1DBML 1MW2A 5FA4A 1KCRL 4AYBA 4V1DD 1PFCA 4MVBD 3DX7B 3RTLA 1I7TB 3H55A 3HC3H 3W9DB 4MAYD 4MQXC 1F3RB 3S5YA 2C3VA 1AHWA 5DC9B 4NC1C 2BH0A 1IKNC 4ZSOB 1F86A 2AAVA 1RZ8A 1JMXA 4PJFF 1JPTH 1ZMYA 5KBPA 2IV9A 5J1SC 4U7KA 5SX4H 3IJYA 4UILH 4YHMH 5AKRA 1INEH 2HWZL 4PJHF 2X1OA 5MP6L 5I73C 1EDQA 1HZLA 2CDGA 1JFHA 2JKLA 1D5MB 5C09E 1MFAL 4FQCL 4PB9L 5I0VA 4WKXA 4Y16D 2XG4B 4ZRGA 2OMTB 4M02A 2UYLA 5CGYC 9PCYA 2Y7QA 3QNXA 4UDUA 4OZIE 4O51B 1ZGLP 4RFEB 1KENL 4PJAE 3U0PB 4HGWA 5DD1H 2YRBA 1UD3A 2D8KA 4BK5C 4HIEB 3L48A 4KY1H 2EVFA 2WN3A 1AS7A 4HIEA 4F5CE 1TQSA 5AYTA 5ABAA 4KUZL 3FN0L 2QZQA 4RGMB 1P4BL 4MMXA 1OQOA 3MUHL 5CD5D 2EUWA 1YJDH 4HHAB 3UBXI 2RB8A 1RUML 5F6IC 4ABUA 4Z3IA 4FP8H 2ZX8A 3WJJA 2Y72A 2XG4A 3HAEG 5KTEH 2BP8A 3D2UB 4GP8B 2VXUL 1P2CA 3ZRSA 5L88H 3LKRB 1P6AB 3EGSB 3RPIA 2YHGA 4N3TA 3ILQC 3HE7D 1HZKA 1PZ3A 2QVIA 2VZ3A 5JHLL 5BRPA 3NSFA 3D9AL 4WJ5B 3K81A 5C09D 1CDYA 2R83A 1PSKL 3DJTA 4UNIA 3T0AA 3K1KC 4K8RD 4U2YA 3PV7A 3AADB 5HI4D 2BHUA 3O9WB 1LO0H 4NJAH 2VB5A 1JV2B 3CFJB 4MJ2A 2HP4A 2CIKB 5JMOC 1DSYA 5KVDH 1LDPL 2PW2A 2IANE 2DL9A 4WVRA 5BS0A 2MQ3A 4BA8A 2XIDA 3WIHL 2ITDA 4BSVA 1BQHB 2NSQA 2Z1PA 1HSAA 4Y4FC 2OR9H 3LN5A 3UL4A 1KFAL 1OLLA 2QPDB 5FUCC 2P80D 1FQ9C 5FYKL 1E5BA 1R47A 2WBKA 3KPRE 3RVXC 3RWFA 3U82B 4MFHA 3SGEI 1UXSA 3WFCH 3LNHA 5JIDA 1KOAA 1BLNA 2BDNH 2OM5A 3IDJA 1VFMA 5DJDB 4JKKA 3HZMB 1YLBB 2QQKH 2FGWL 1DLHA 2BNQB 1QLFB 4GINA 4HX1B 4PJXB 5A6MA 5I24A 3EHBC 1IC4L 2EKJA 3E38A 4XODA 4M9OA 1J1XH 4P8QA 3REVA 1CLYH 1JL8A 2D7TL 4L1DA 4OD1L 1QP1A 3ABMB 4S10A 4LSPH 4NNPH 2A9BA 3T65A 1RK7A 1NCTA 3KXFE 5E5MB 4QRRB 4JFOA 1KGIA 1GGCH 2CR3A 5E2UL 2KT6A 3ECBA 3MGAA 3O6ML 4GSDL 4JVPA 5C0CD 1WZAA 3FUEA 5T3XH 2AJUL 4PBXA 1OTUD 1T7WA 2A6JA 2XA8L 3O3BB 4WTWA 2V33A 3T6XA 4ZMPA 5J11C 1NBVL 2OMUB 2Z4QB 1ND0B 1YN6B 1DN0A 4BQ9A 2WXFA 2PYED 1OP5H 1P0SE 2HTLD 4CJ1A 2CBQA 3EAKA 2ZAGA 5EOTB 4WHTA 4NT6A 4UBDC 4RIRA 2OMWB 5C08D 1DSFH 4BCZA 5ACZB 5BPPA 5DT1H 3WY1A 5KYYB 4PGZA 4F8OA 4LOEA 4HGKC 3JV4A 1GKEA 4AC2A 1J1PL 4U6HA 1SUJA 2YQ3A 4DP2X 3V6BR 3O3AA 5MEPB 1MREH 1RVFH 5AKVA 3VB9A 1V3MA 2BHYA 4GRLA 3RFZC 3QQXA 5DJ8A 5ABDE 3QZWA 2J3SA 3J2PA 3KPSA 2PCFB 3QWNA 4WWID 4HLZH 1KUMA 2WB7A 5C0BA 3OSKA 5HD8C 4U33A 3ECUA 1Q72L 3LHAA 1OOWA 1MWAB 3S35X 4FQXB 4CKQA 2H3NA 1UHVA 3RE0A 3VX1A 1NLDL 2XKSA 1JPFA 3EH4B 3PNRB 5FECA 1KYOJ 2E8ZA 4OTXH 1U8JB 2OP4L 4U1KA 4ETYA 3FCTB 2WMPA 3DO4A 4DP6X 2OYPA 3AJ7A 1IGYB 4JLRB 1P7KA 1SQ2N 5IROD 2DQFA 3O6KL 1IIKA 3RRQA 2YXMA 2NT1A 3DV4B 4WV1A 2R69H 3V5KA 5IB3B 4TTGA 2WNKA 4NZTH 2NZ9C 4POZD 4PJ7A 2CBOA 2WYZA 3UBHA 1G6RB 3IFPB 4U0QB 1NINA 2K8QA 2W9DL 2WZAA 2X89A 3WFEH 3B9AA 4LSPL 2W94A 1SDYA 5E1HB 5ADOL 2F7OA 2R51A 2R69A 2V7HB 5K5YA 4PCTA 3H3PL 3D85D 4WUUB 4BHUI 2ZE0A 4E42B 2R29A 3MRKB 1IRAY 4B9FA 5MHSE 4HJUA 1QSEB 4MJ6B 3OB0H 5E1IA 5LG1A 2QGCA 3TO4A 4CMMA 5IWLA 4HUVA 4PGBB 1CB4A 3BGMA 5HDBB 2HSIA 1OQXA 1TZOA 5L2KA 2O1AA 1XTMA 4FL4C 3CSBA 5C0AD 3DDFA 1CDGA 4FFVC 5IJVB 3BKML 2VH5H 3HG5A 5E5UB 3VB8A 3SDAA 1I7UB 2I7SA 2OFQA 3H9SB 2Z1KA 4FD0A 5IM7B 2APTA 3QJUB 4H1LB 1JRHL 1HHHB 2ZOKA 3LZFH 1T6BX 4J12A 1CU4H 4XZUB 5AW8B 1PLBA 3ARGC 3RQ3A 2BVPA 3CDGA 3Q2WA 3ZT6A 3AG1B 4L1BA 1TFPA 4QCIA 2OYLA 1NANH 1X5GA 4DVBA 5K59E 2J56A 4FJYA 4OSUH 4QJ3B 4HK0A 1PG7H 4PJGF 4Y1AA 4FRWA 1XH2A 4ADIA 1UUNA 4DKFL 5I1KH 2AMUA 1ZGLA 3ME0A 4KNUA 4APQC 1OP3K 3VI3A 1HKLH 3RP1A 4AK2A 3VI4F 4N0FB 4F7CA 4PLKD 1NMAL 4WY7L 4ODBD 2HRHA 5T3XL 1PBYA 4HPOH 1JN6A 5EU5B 2J1ZA 4P9HC 2DKSA 2F08A 4K9EH 1GYAA 3GMOA 2FO4B 4CUCA 3O6FD 3EYFB 1Y7VA 4NIYE 43C9A 2JQMA 2H8PB 1RUQH 4DPRA 4OD1H 2QADD 1NBZA 3E6HA 4X6DA 2FH6A 3KMDA 2ADIB 9CGTA 3LKSA 4MDIA 2CRMA 4H4NA 5ALBH 1UD4A 5FM5O 3P69A 4ZPTA 1M53A 2P49B 3FU6A 2OTWB 4L1HA 3SIKA 2WO3B 3ILPA 3IPEA 5T5FL 4OI9A 1SHMA 4U1IB 2WBJB 5FDWB 3ZKMC 4AL8C 5E6IB 4L48A 4LHUD 3S0PA 2OW6A 5F21B 2JJVA 4AVHA 3AT9A 5FKPB 1JTTA 3FCBA 4A2DA 1AQDB 4NUGL 4A7QA 4N0RA 4L4VA 4UAHA 2YPLB 2Y6SD 5HJ3B 1H3VA 4P3CL 4PY7A 4MZ2A 3GHEL 3VWJC 4N0YL 2Z6FA 2DDQL 5EFIB 1EMTH 5EZIH 3F6IA 1ACYL 1HAUA 2HTLC 1T2QL 5F7DA 3UZEC 2WD0A 4JL1A 1W0WB 1D6EA 3QZOA 1KEML 1TKWB 5FM8A 3F6LA 1UQSB 3CVIH 2MSPA 5FYLD 4NQCD 3UDWC 1IEHA 3RWEA 1ZVNA 4EAEA 5T3XD 4HOXA 3CLFH 2CM6A 3D3VD 1DDTA 1I7RA 5BCAA 5L88L 1UG9A 2X70B 3CXFA 2A9DA 2XWTB 4FQ1L 2WXGA 5SX4I 1LVEA 3PQYA 4PPTA 4XC3L 3SE8L 3O8XC 4L8CB 5FFGA 1A9BA 2VMJA 1D9KD 3LHPH 3FT4A 3VFGH 4M48L 1SM3L 3VGDA 4ZTEA 2BOBB 5D7JC 3OPZH 2JB5L 3MRCB 1ZCRA 2EQDA 2WZ6A 5DSCB 3Q5TA 5DO8A 4DUXA 3N0PB 4M1DL 3BZDA 3VWKD 2Z65C 3O41B 5B1BB 4P2AA 4X5WB 4PGEB 1UURA 2F5BL 3DK0A 5T1LB 4H5SA 2FZ3B 2IO5A 4MDJA 1JGEA 3JYBA 3N44F 3FONA 4LLYB 3M45A 1EQWA 1HK6A 1J05A 3TA3B 4Y5VB 4Z7IA 3L3JB 3LH9A 3N44B 5KVGL 1EFXA 4TUJA 3W5NA 1RZJL 1E4KA 1F6LL 1QRND 3QO1B 1RURH 3H7LA 1DBKL 4Z5RA 4OZGF 2MHAA 1IEAB 1EGJA 4X4KA 1RJZB 3QZWG 5F96L 4JHBA 1OARH 5A2FA 4K8RH 4Q4IA 4L3CA 2HAZA 3DV6A 4URKA 1YEFL 1V3JA 4ICWA 4PJBE 3RVTD 1FGNH 3BPNC 4EVNB 4LRNH 3VQ1C 1BA9A 5ESQB 4CILA 3DROA 5J12B 5IWLC 1T03H 1BM3L 3DMMA 3QXUA 1TQCC 1R3LA 4HWEL 3VYNA 2NY1B 4HBCH 4ZODA 1TVBA 3H2WA 4PN6A 5IVXA 1EDYA 4UT7H 1FFRA 1QVOA 5D7SL 1PL3A 2EDMA 4UTBL 1NDMB 2WSKA 2E7HA 1JDCA 3FQ1A 2CG9X 1QATA 4O9HL 4LASH 2IXQA 4WV1C 4DN3L 3EF7A 3LN4A 1RUAL 2GITB 2Q20A 1A6WH 3CZUB 3WUWA 3DX0A 2HLEB 4B6ZA 3INUL 3SOBH 4HJEA 2NY0D 3HRZB 2FWOB 3FUNA 2ESVB 4PJEA 5IVOA 3V6OC 3CZEA 3CFKA 5CKAA 2XTJB 1YNTB 3AREB 1I3UA 1FH5H 3H53A 1AE6L 5C7XH 3OB8A 4M5ZL 4K3HA 3ZZ1A 1KJVB 3SPVA 4UNTA 2V9QA 2AXGA 3MJ8A 4X6FA 4YSQA 4RX4D 3HBZA 5INDB 3DETD 4ZUSB 4YSPA 1BZOA 5E8PB 2MEJB 2R4RH 1N0XH 5G2NA 4E9XA 4JN2B 1RUPH 4CADA 4HPOL 5FUOH 3MNDA 1MNUL 1ZY9A 2C9RA 3L3IA 4LSSH 1NMAH 1YEDA 3QNYA 4WY7H 5D7IF 5I5IA 2ATAA 3AZUA 1SQMA 3RJQB 4LNRA 2J20A 3M1BA 3IFNL 2WUBL 1OD7A 5E8NA 5GGUA 1UA6L 3OR7A 1FJ1B 1KTBA 4L0PB 1DBJH 4A7SA 4UZSA 2EIEA 1VGEL 4XOEA 4XNUL 4XP1L 1UM4H 4XVSL 5FLUA 5LBSH 3V7AG 4AENA 2IWGA 3FB7A 4CMHB 5GJTH 1IGIH 1OW0A 1OSEA 3TWCH 1T22A 2VDOB 1KJ3L 3QPXL 5CJ8A 4XBPA 5L4MA 3PL6D 1OGPA 3Q8CA 4QHUB 5F7UA 2ENYA 5TK4A 4EBQH 2C8NA 2YZ8A 4TSCH 5E4EC 2ZUXA 5TF0A 5DVNA 2XVLA 5TDNA 3NGBC 2YC1B 2QPSA 3EGDA 1NWPA 3QNYB 4BH7B 4PRNA 2YBRB 4YUEH 1VACB 3O11B 4GG8A 5DR5L 5FHAH 5I1EL 2V9RA 3B8SA 5J5EA 4OB5L 2XZZA 3KPOB 1J0YA 3MHZA 3O2VH 2QR0B 2L0DA 4NAMA 4OLWH 1DQKA 3II2A 3K4ZA 5JPMA 4NKOA 4KNQA 2W9DH 3EJZD 4H8WC 1AD0B 1F6AB 3HI1A 3J8F7 2ZUVA 4K5NA 4GBXA 3R8QA 3CZSA 1EANA 5C0AE 5JW4M 3RY4A 1YC8A 2Y69B 5E7BA 1T0NA 1GYCA 5HXMA 4Z7VA 4YDJB 3C60A 3VYPA 3GSWA 1MF2L 5AYUL 1QNZH 3VWJB 3ZDZE 2UY7A 2O6FA 2ZX6A 4LSVL 4OTXL 2QTVA 2N1TE 5I8CB 3ARBD 1H5BA 5J1AA 4B41A 1T5WB 4KROD 3VFNA 3AITA 4KKZA 4RGOL 5KSBE 2XXCB 3CIAA 1UA6H 3OJ2C 3ZK0A 1JVOA 4PBWD 1ACXA 2XV6B 2VXQH 3CE1A 4NWUL 3AFLA 3EW3B 2VZUA 4YDKL 4JVWA 3C08L 3I75B 4JKNA 4OJFL 3UG4A 1UJ3A 1SXCA 4YNYB 2XOTA 1EDHA 4PBVC 4OGQC 2GKIA 4E68A 4G83A 1NM4A 3UTSE 4EVNA 1AGDB 1OY3B 3GKZA 3ZMRA 3GSRA 4QD2E 4HEME 1FH5L 1OB0A 4X6CB 1IGMH 2EE6A 5J13B 1J5HA 1TJIL 1Q9WA 2QSCH 3BOVA 3W37A 1X7QB 2EVGA 2AQ3A 1CJYA 3DRTB 2QVTA 4JCMA 2DTML 1G0YR 2JKWA 2E75C 2MJWA 3MV8B 4XCFL 3T2NL 4OFIA 5C9JA 1ACZA 2H5UA 3BN3B 4G9DA 1F4AA 3LKQB 2VN5A 1A7OL 2DLFH 2EZ0C 3O6MH 3STBA 5AL8A 1P6FA 1CE6B 2PLTA 4KGLA 2Y3AA 5C07A 3FQNA 1SLXA 4JANA 5GRUL 4MDJB 8FABA 3QEGH 1OKEA 4MZRA 1Z5HA 4W6YB 4Y5VC 1CF8H 1I1RA 3ZE2B 3LEVH 5H4ZA 4UTBH 3L4CA 3OC8A 4ZMVA 4JM0A 4ABVA 5DS8B 3TYFA 2HUEA 4Q2ZA 2EO1A 4I7ZC 5IEKB 1MOEA 2F8OA 3L7EB 4LL1A 1MI5E 1C8PA 1SMAA 1S5IL 4FA7B 3JYCA 2JK5B 1G1KA 3CHOA 1A47A 1SJEA 4PRIA 1ZS8A 2RALA 1XEUA 4TQPA 1XR9B 1UB6B 3LS5L 2DQIH 5DMYA 2PTVA 3D3VB 1XH0A 1VCBC 5CEZD 2B4CC 2VABB 1KIRB 2ZCHH 4NUJA 1KTJA 4J27A 4D9LL 3RVVC 5IY5B 1U4EA 4LSTL 4WFEE 5DS8A 2HT2D 4LCUA 4I77L 2HPOA 1DBAH 2R59A 3DURA 4JDTH 4MJHA 3GB7B 2PPAA 5FYLH 8FABB 5DRXA 3MXWL 4YEFA 4G43B 2N7AA 2A0LC 2UXVA 3ESOA 1V10A 3U2SA 1YO4A 2CK2A 3IMTA 4R2GC 5CCKL 1URZA 1E8XA 2CGYA 2E59A 2YKLH 4A2HA 1U2YA 3LPWA 3RNQA 2FEDC 4DEPC 3DVFA 1WRFA 1BQ5A 1F2QA 1LLAA 2F5BH 1IBBA 5BRZD 1J8RA 4F7TA 5E6ID 1NCNA 4MYWB 3WFDL 5CJOH 5DGQA 1SLVA 4W68A 5E9NA 4YBQD 1CTMA 1OCZB 3GI9H 1URIA 1JZ6A 5IG7B 4W4OA 4XC1H 4RDQG 5AVSB 2YAMA 3L5XH 1SM3H 4AQ1C 3SDXE 1J8HD 1WWBX 2CO7A 3IM1A 3FMGL 3BP4A 3MRBA 3APNA 3AU0A 4NRZB 4PRAB 5I8EA 1IMHC 3QS3A 1E7UA 3VH8B 1ETJA 1IM3D 4U7SA 2XZCL 3DX8B 4JFHE 4DW2L 4YC2C 4HKBA 2XN9A 3UTSD 5I74B 4FXGB 1YN7A 4NERA 3PLYA 1UT2A 2QZ5A 1A4KA 1A1NA 3GMOB 4R3SB 4ZMWA 3KYMA 4PB9H 2ZX5A 1YPZA 3BWUF 3MOQA 4L4JA 4Z7VF 3HEIB 2W92A 5CU9A 4DK3A 2E7MA 1E4KC 4G8EA 3PE9A 5HHQB 5L9DH 3X14B 1RZKC 4XXDA 2JKRM 3BQVA 3KLLA 4YBHA 1UD5A 1UT1A 2QFRA 3GHEH 3QEHA 4HWBA 1KPVB 1NKRA 1VFAA 4JFFE 4QTFA 5IB4A 2ERJB 1MJUL 4H7VA 3KH3A 4CU7A 3EJYC 5LJYH 4NUGH 4OGYL 1JPST 1NGZA 2I25N 5IROC 4CN6A 4O58H 1AMYA 4KZDL 4XB7A 3TA3C 4PJBB 3VRIB 3DGDA 5GS0D 1R3IH 2BVPB 3L5JA 3RWGA 5BVJB 5IV2A 4HU2A 4FQ2L 5KJ4A 4YHKL 3MTXA 3C60C 4X9YA 2NCMA 5MEQB 3CC5A 3I2CL 5F1IB 1NFKA 1VACA 2YRLA 3RKDD 2NUPA 3SDAB 2H1LM 4BH7A 3QP3A 5IJBC 4WSGA 2C9XA 3ESPA 3K2IA 5F2FA 3TBWA 1CI5A 2AJSH 2FQEA 3QT2A 4FFTA 5DEJA 1YEGH 2W9LA 4OY9A 4MJ5B 5HYJE 3WKPA 3Q44A 3WJMB 4WJKB 1IM9D 5ANMB 1QSEA 2VISB 2FWSA 4F91B 3F7VB 3QZNA 4WTXA 4M62L 2WBWB 2QT6A 3NMEA 1OAXH 2V7HA 4ODTL 3CN3A 1WZKA 3A6BH 5DJXB 3OKMA 1IGJB 2VR7A 3GM0A 2J5WA 1JHLH 1SHWA 1CL7L 4ZS7H 4DKFH 3PJSA 4WTZA 2IPUG 5D1ZC 5KJRL 2YR3A 3S5LB 2VDOL 3CSYA 4OLZH 5GRWA 1DQLL 4WV1B 5D7IA 2Y5TB 5F8RC 2J88H 3QAQA 1QUNA 3VMNA 3ULUC 2GC4C 3KYAA 4AIZA 1UEMA 4UYPA 1YEJL 2Q3ZA 5FV2A 2H32B 1IZJA 1D5XA 1VAHA 2CJUL 5B39G 5DFVC 1JHTA 1U8JA 4CNIA 3SPGA 1WITA 4YGVB 3UG3A 1OXYA 1UGNA 2D7OA 1ZTMA 2W65B 1KIPB 3N42F 2ICWJ 1GA2A 4RRPM 2VWEC 5LGKA 5DMKB 3BZFB 2JB6A 1IFHH 3N1PC 3FKUS 2JSFA 1T1WB 4NCC1 4PJEF 2YEZA 4ODWB 3OR6A 1FBIL 4JO4H 2WOYA 1FE8H 4AV4A 3MRIB 4ZX6A 1KY6A 2WLIA 5LUMA 1PNCA 3KPSB 3BZFA 4LEXH 3HKFA 3G5YA 3PWJB 5DWPA 5F1KC 4U6HB 1D5XB 2AW2A 2IADB 3QJQB 2YD7A 4FFVD 1MCEA 1TTRA 3QFDB 1IGCL 4JFZL 4AMKH 1ADQH 4XB8A 5DD5H 3ZKNC 4HS8L 1H0DB 4KO5A 5GGQL 1ZLWK 2E9JA 3FTWA 5CN2A 2NY2D 3ILEA 2R69L 1DSWA 4U0RB 4QWWC 1KNOA 5IVXF 5BW7C 1L3WA 2V7NB 2FVNA 3F00A 3IMWA 1I9IH 1XGRB 2X6AA 4LPXA 4ZAKC 3X3FL 5F9WC 4XCCL 5DK0B 3CFCL 2GJPA 5I28A 5ICZB 1DVFC 4PB0H 3R4DA 1KCUH 2FBOJ 2ZOTA 3BWSA 2ARJQ 1KXHA 4IGBB 4GG6A 3MJ7B 2YPVH 3GXMA 4M8UA 5EO1B 4Q4EA 4CC1A 1P5UA 3GI8L 3TBWB 3UP1A 4OZGA 1H9DA 1I8LC 2NR6D 4AE1A 5KS9E 1DBBL 2WUCL 4PJXA 5JA8B 3V0VB 4YSRA 4ZW8A 1QSVA 1I4FB 3FO1A 4LVNB 1CGUA 3OMZA 3D34A 2DD8H 3BAEH 2JQAA 2YAOA 4LKXB 1J1OL 1FL5A 1YCSA 3LX9A 3UROR 4M5YH 1UADC 1ZXQA 3I84A 3V0GA 3LSOA 3D4CA 1NGZB 3UMNA 2G5BA 1FL3B 12E8L 3OX8B 4A6YA 5KBLA 3PJNA 2ZYRA 1BOGA 4KZEL 4IKJA 4LZKA 2J1WA 3WS6A 2Y1YA 2PW2B 1J0HA 3HNVH 4F9PC 2NYKA 1NPJA 4J2XA 3DHJA 3SODB 4XPFH 1HKFA 4YXKH 2AJUH 5HHQA 5I17A 4JMXA 2XZAL 1RJYA 2BIMA 2P5ED 4FABH 3RTQC 4NXSA 3C60D 4PEEA 4QLRA 4Q9BA 3BP7B 1Z9LA 3GSNH 1TFHA 1RZFH 4YSEA 2IWFA 1HCFX 5F0JB 3VD7A 1A1NB 1A4KB 2AEPH 5DLLA 4QXUH 4LAQL 1QSFE 3GS4A 4HXBH 5AAMA 4CSZA 2Q86B 1IE5A 3RL2B 2DQGL 1OTTC 3MA7B 2IV8A 3VWJD 3QH3A 4F2FA 2HJLA 1TYRA 4J1UB 3MO1A 4IW4C 3HPLB 3KBPA 4WTQA 5FOJA 3PP3H 2XWJA 1QFHA 4PREB 4HGMA 3VXPB 4BFGA 3QNZB 1L9QA 5FYKH 4QGTA 4Z7OB 5H35A 3HFML 3S35H 1BAFL 2BY3A 4DH2A 2NTFB 5ELIA 1KYUA 5FDYA 4K0OA 4AGMA 4XX1E 2OI9B 3WIHH 3K6OA 5MEND 4JO8A 3MACH 5ID0A 3D05A 5TDPA 1OCOB 2O26U 5F7YC 1B0RB 5CN3A 1SEQH 4X9HA 2W95A 2CHNA 2YPLA 4HD9A 5HJ3A 4O5LH 1GY2A 4ZMQA 1HE8A 4TVPH 2Q7YA 5LXGH 1EEZB 4UV4H 4AQAB 3BQUA 1E5UI 2Q8BL 3SHSA 1UEYA 3CD4A 3GNMH 4QAMB 4XX1G 1GGUA 3IJYB 3ZT5A 2DD8L 3TO4D 2Z34A 1SXNA 1CICC 2UXTA 1XGTA 5F93C 2CO4A 2PCYA 2X6MA 2GBAA 3Q8BA 4PCSA 4GO9A 5IQMA 2ZAIA 4LCWA 4NZJA 1JXJA 2XYCA 4FNPA 2VXUH 5DJ2A 1SEBB 3H2QA 1ZT4B 3U46A 1J48A 4MA8H 4Y2OA 5D71L 5ADPL 2VE6A 2W1NA 2WW8A 3BKJH 3GRWA 2YD8A 3JZYA 1MQKL 1O75A 4FTVE 4LPUA 4PMEA 4RWHA 2H8PA 4A2FA 4UTAA 1QFUL 1F11A 1O0VA 3BMWA 3VI4A 1R24B 2VQTA 4H40A 1S7QA 3VI3F 4L8SB 5EU5A 4S1RH 3TYGL 3GRBA 3BZEA 2V5TA 3VXSD 3DO7B 4IRSB 1IFRA 2EXWC 3VMPA 1K5WA 4HS3B 5D9SA 1OP9A 3FH7A 5HPOA 1KN2H 1EAQA 2BVOB 4N87A 5IW1B 1B3IA 4G5ZL 1AH1A 4PWJA 4Y1AB 3P9LA 3OXRB 4QHMA 5EC1B 3I85A 4LLWA 3RDTB 5C3LD 4KK6D 1UH4A 4AYFB 1IKFH 4QCIB 3B2DC 5HI5C 1OT2A 4MXVE 3QWOA 4OUOA 2X28A 3CFEA 4G8FA 2CO2A 1ZEAL 4NAQA 3RWCA 4DHLA 5JOFB 3BUBA 3OKEA 1LP9B 4EZKA 4Z18A 4EIUA 5DJZA 4GUCA 1JDDA 2B59A 3QUGA 5GGSY 1T0MA 3H9SA 3P9MB 1HH9B 2YD0A 1FE8L 2DIBA 1MVYA 1FBIH 2DJSA 2F54B 4Y4HC 4YOKA 3RGHA 1LD9B 1AGBB 2BP5M 1EIBA 1G0XA 4PCKA 1QHQA 5IHUL 4GIOA 3S9DB 2Q1EA 2H9GA 5J12C 4Z0BH 3RGVB 3QDGA 5C9KA 1B2WH 5DUMH 1BHGA 2E4FA 2GIYA 4XMLL 3S2CA 3GMRB 5D93C 1FNHA 4OQTH 4PJ7F 3ISYA 3R0MA 4N2MA 3PREA 4QF1B 2H26B 5L8KB 1IU1A 1PZ2A 4PWKA 3GSUA 5C0BD 1QRNE 3WY2A 5EA0H 1INQB 3QG6B 3FTZA 5CUSH 5IVZB 1CDJA 2IDFA 3CLEL 4WI8A 3BAWA 3C6SA 2YXVA 5I26A 3VG9B 3A6BL 3FYEB 1FO0A 5KBDA 4DP1X 1P7HL 2CCLA 5BRZB 1S7XA 1PQZB 1CYXA 2J5LC 3D48R 1I1AA 2F53A 1LO2L 4GNKB 3B6SB 4FJ6A 5AVQB 3GMLA 4NM8H 5JPMB 3ZE1F 2FJGB 3TTSA 2G75A 3DYOA 3DGGB 3ARBC 1WPCA 4HQQH 3S37L 1ZHLA 4X4XA 3PHQA 4K3GA 1OAYH 3ARDC 4E41E 1KCSL 3W0WE 4WFED 4ELDA 2DI8A 2G5UA 2K0RA 4WI5A 1DVFD 1QFWM 3IJSA 2CKBH 1G9EA 1SJVA 1EXUA 4O2EA 2OJEB 5GGRB 1ZANL 5LB1A 2CO3A 3VRJB 4PP2A 3V0FA 4ABQA 4KZDH 3BWZA 3JV6A 4MX7B 3H7BA 4KMLB 4DUWA 2DTSA 2WHVA 5B7FA 5KG9A 4Y2DA 2MWCA 1LK2A 3U25A 1M2VB 1E2ZA 3DX3A 4BK4A 3KEHA 2F58H 1GSMA 1OGAD 3DYPA 5HDOA 2JE8A 1ZEAH 4MMZA 4XBEL 3QULB 2A6JB 1FNLA 4FEIA 3X1GA 4B5ZA 3WTYA 1BVKA 1BZDA 4KKQA 5H8DA 4K4KA 2Q76B 2IBBA 1T04A 4HLJA 4RFOL 2ZWYA 3DOIA 1I1FA 4IEFB 3T65B 4M61A 3UTTD 1GGIL 1PCXA 5E94B 3SB3A 3V0HA 3C8KA 3GSOA 4IU3B 4LNRB 1OM3L 2J12B 3LDBC 4LPVA 4CSSA 3VM5A 6PAZA 3ZHKA 4JPSA 4JUTA 3IGLA 1DFBH 3O81A 3MLWL 4HX1A 5I75C 1X3DA 5HHME 4OIAA 3CNKA 2CIIB 4AUUA 2OMYB 2DQCL 2VDPL 3K46A 4H88L 3PF2A 4ATWA 4JFPB 4ONHA 4LDCA 4QXTA 4L4TD 3SJVA 4X6FB 1NGYA 1SF5A 4YDVB 1CXIA 2Z92A 1E9QA 4ODVL 4Y19D 1J8HE 4KJWC 1L0YA 1FYTA 2BY0A 4I9WD 4PJEB 3SKOA 3GMPB 4BSVB 4J3OF 1LE9A 1FNSH 3IETB 4M56A 1WBXA 3VGEA 1DCLA 5DUBA 1QA9A 2AQTA 3FRPB 4P05A 2DM3A 2JJSA 5DEZA 2GJ6E 3VGHA 4BGLA 1JOIA 4M7JH 5I1CL 3MRRA 3MNVB 4O5LL 1V3KA 4DP0X 1OK0A 2IXQB 4CBPA 1R19A 1SBBA 4F15C 2XFXA 2WLHA 5FYLL 5M95B 4DPCX 2IDQA 3VQMA 3U30B 4Z7UA 3FF8A 1NBYB 2ZUUA 3MACL 5JOPD 5C0JB 4N9GB 1BQSA 2X4OB 3FT1A 2DICA 1Q1JL 2HLAA 3LXCA 4GXUN 3BP5B 4J3OG 3EO0A 3CH1A 3K6FA 4MA3B 5ACLA 4UTCA 2B5IC 3D2UA 4FC3E 4Y16C 1E4WL 4AM0B 3IXTB 1MI5D 4Z7QE 2KI6A 1BXXA 2MRYA 3HLAB 5KAQF 1RH8A 3SDYL 1OCWL 3V95A 4MNQA 1ZLUK 3BIKA 4GXUM 5I66A 1T1ZB 3V0WL 5DF0A 4TNWF 4N1EA 3VFPB 3WO4B 4KOBA 4AEHL 1JFQH 1GGTA 1A0QL 1S3KH 4GEJA 4YHPA 4PLNC 4H26B 4Z1PA 4WSJA 5E0FA 3ARED 5E9DA 1KYAA 3QCUL 4G72B 2Y1AA 4WWPA 4MAYC 4O51A 4QRQB 2R7EB 1TO4A 5JOEA 4WI0B 3JZ7A 4QTHB 4PJHA 2OL3H 4MZ3A 3WUWG 3FSZA 1AS8A 4L1TA 3RU8H 1D5MA 4CJ0A 1G7PA 5E6ZA 4K3EH 3CC1A 4OLEA 5AW0B 3TEXA 5MENB 3OXSA 3PWPA 4XPFL 4YXKL 1IQWH 4H5SB 4H0GA 2UUDK 2NUTB 3VXUA 4WU7B 4I2XB 1UACL 2VLJA 5K1VA 5E2JA 3RJDA 2HZHA 3D4YA 1RJLB 1S3KL 3N43B 1RZ8B 1HDMA 2Y06L 2J44A 2DQMA 4YZFF 4ZSOA 5HHPA 4GT0A 5D5MF 2F19H 3OHXB 3WSQL 3W9DA 4BK8A 1HWGB 4P2CG 3AT0A 1H8SA 4R7DB 5HGBB 1J7VR 3UFIA 2VDKB 4L8CA 5AAMC 4LO9A 5I18L 1ILSA 1ZHNB 2P24A 3IDGB 3MKKA 4OBSA 4YWGH 2EEBA 4WWKA 1A14L 5JNYB 3S88H 1CWVA 1RHFA 3DSFL 2VN4A 3O2WL 5EZLA 3MJ9L 5JYMA 1WK0A 3F5WA 5JHAA 2XPYA 4A04A 4M8QB 1IBHA 2JCCE 2JXMA 2EIJB 4M6NH 1CYWA 5G55A 1AHWC 5D93B 4AK1A 3AWFA 3NJVA 1JZDC 4KVNH 4JFQB 1P84J 1Z9SA 3FT2B 5F89B 4LSRL 4IM8A 3D50A 2J6EL 3SSGA 4U2ZA 4KNTA 4KDVA 4BKLA 4N26A 4N90E 4EKJA 2WVVA 3U0TA 3BUTA 2K7QA 4J39A 3ZZSA 3A4AA 4R2GD 2YD1A 2EP6A 3JWOL 5CM1A 3KVQA 4NWTL 2ED9A 5C3IA 1TQUA 1GL4B 2ITCB 3OG4B 3RL1B 5H2BA 5DZLA 1TJXA 2OX5B 3QEUB 3QXVA 3BE1L 2X9XA 1A7NL 1YEHH 4R0LA 3RVVD 3UPRA 3WKYA 3E9TA 3MLUL 1DJIA 2XSKA 2WBJA 3WAJA 4MNHB 3MZTA 5BZWB 1MN4A 4ZFZB 2HX9A 2CLRA 3ZIMA 1OT1A 4CC4A 5IQ9A 1GS8A 4M1GH 5K9JL 5TK2A 5DRZB 2OZ4L 4Q0XH 5EOQH 1RPUA 2QSVA 4UT6A 2AQNA 4FTVB 1N18A 1MCOL 1SOXA 3QDJE 4ODSL 4KJQD 3CSTA 3CVHH 2UZXB 2GTZA 3MLVL 2YK1H 3OLDA 4L4TE 4Q52A 2FO4A 2O5YL 4UMSA 1XEDA 3DHMA 2D03H 5DHEA 4FNLH 1MVUA 3G5XA 4KRPD 4LCYA 4YO0B 1BQLH 4DGWC 3FSOA 1JGUH 3N1GC 3NCXA 1R75A 4DPBX 3L4XA 5I6LA 3LRGA 3KYOB 4DGIL 4GUPA 2APBA 2FAUA 2F58L 3QIUA 3H9HA 5D1QD 2GSGB 5D1QB 1MPAH 3KPRB 4NQXB 5F1OB 2XVKA 4CGTA 1FCGA 2Y2TA 3WOVA 5IJKA 4U6YB 2QQQA 3MOAL 1E28A 1GW0A 4Y1TA 2GVYA 3TNMA 3ES6A 3KPTA 4M3HA 4Z0XA 3O6FC 1HNGA 1FZOA 3QIBB 4K94H 4L5FE 3UJIL 4Q9QL 5FO2A 4DFIA 2P5WA 3T6ZA 3CDGB 2VIRA 5ITBH 2E9WA 3EH3B 1OHZA 3GQFA 5D72H 2FLMA 1HHHA 3H85A 3SDDD 2VQ1A 1FFPB 1MJ7L 1GYUA 1WC7B 2EECA 5GQBA 4ORGA 3T4AC 1Q0EA 3TCXA 3WLBA 2B1HL 4NO2B 4PJDA 1CR9L 4FLRA 3L4TA 4Z7QB 4ONOA 5JQHC 6TAAA 2AJYH 1WBYA 2C7UA 5EB9A 5EU7C 2CUIA 4QHLA 3NSXA 1DZBA 4YAQA 2QHRH 4E9VA 1T21B 4YPGB 1XH3A 2Q5BA 4LSDA 5T1DH 3RZCD 2B1AL 4YHKH 2Z0UA 5E2TL 2YQBA 4ZFOL 3P2DA 1X5LA 1YEEL 3PRZA 2ED8A 1A6WL 3EJCA 1HILB 1AXTH 3EJQA 3WLBB 5F0LB 2Y9RT 4IBSA 2E9GA 3FCGA 3V5KB 5IB3A 4NHUA 2OMVB 3PGCA 3RVTC 5AW7B 3TASA 4KRPB 2P5WB 3FBQA 4R5TA 2OTPA 2DS4A 5D7SH 1NH6A 1YG9A 2A5UA 4FHKA 4HWNA 4XNMA 1I8KA 2RA1A 3MLZH 3PXHA 5ENWA 2BIOA 1IBGL 3MAWA 1GS6X 1SOSA 3QVAA 4W9GC 4EZLA 4OF6A 4RRPG 5TF1H 4AYEC 4M6OH 4Y5YA 4PJFB 1T0PB 3FTXA 5KSUB 1XH1A 1JF1B 3ZHFA 2EJ1A 4HJGA 4NS0A 2XZCH 3QZWB 5KVFL 4Z7NF 1FG9C 1CCZA 5CZXD 3IKCA 2QGBA 4Q6KA 4LCCB 2BS8A 4X50A 2ADFL 3SBRA 2JI3A 4DUVA 2OA9A 4MMYA 4OLUL 3CVDA 2BFVL 2GTZB 1EVTC 2WAQA 1DDHA 2IAMC 5IR1B 1AKPA 3SY6A 3ULVF 3QG7H 4HMDA 3T8XB 4LLUB 3TF7C 1XB8A 4MLIA 5D2LA 2KZWA 4KAQL 4PY8J 1V27A 1X9QA 3CFIC 2IQAB 4I89A 3CPLB 1YN6A 4U0RC 2O30A 5BZWA 2OMXB 3E2HB 1XZWA 2PYEB 1ZLUH 2E6JA 5I71C 1R0AL 3UCRA 1O7SA 4D9RE 3IGFA 1NCCH 3HG3A 4HZ1A 5F9WB 4X5QA 4PR5A 5AOJA 1KTRL 3N06B 1C5DB 2Y7NA 4TVUA 2DM2A 2PCXA 1A5FH 1TSHA 1T4KB 3V4UL 1ZPUA 3HUJF 3WO3B 2X4NB 1HQRB 3F2LA 3FQXA 4IHBA 3SE8H 2EEXA 5D71H 4UM8A 4WEMB 4FQ1H 1VEPA 5C0NC 3VAEA 5HGGS 1OAZL 1DLHB 3WFBL 1C12A 4M00A 5B39A 1MDAA 1NIAA 3AS3A 4I3GA 5DZAA 1Z9SB 3FT2A 1T80A 2D0GA 1V5JA 2UXGA 3S3BB 5GZOC 5ICUA 2YSSA 4QRUB 2VDKL 2G2NA 4WLCA 2ZWKA 3TT1L 4O02B 2GJZB 4J28A 1BQHA 2GEEA 4W9FC 2JIXD 1N0LA 2CBPA 1ZHNA 1WS7A 5B8CC 1BZ9A 3VGAC 2W38A 5TH2A 1AI1L 4NQDB 3PV6A 5C71A 3LEVL 4GQPH 2BSDA 2CHDA 2UZIH 3V79C 3A47A 4DOHB 3CFJA 1Z2KA 4AQOA 3DRQA 2I5YH 4R26H 3RILA 5I1HH 2OSLB 4BA0A 5DJYB 3FPYA 3P1VA 4AJWA 3EFDL 2GPZA 4OUUB 1Q0XH 3Q06A 4PG2A 1XZ0A 1Q1PA 3SE6A 1VENA 1YDPA 1PVHA 1NWOA 2EDYA 4XCEA 5D2NA 4AQ1B 3ZY7A 4KXAA 5ANME 1VLXA 2J1XA 2G9KA 3VCLB 2WYIA 5HYSA 4YSDA 3AROA 1FNGB 2B5IB 3L2MA 5DUPL 4FE9A 2EDBA 1BX2A 2ESVE 3AXIA 2VC2L 3M7OA 3LIZA 5KSAC 1L6ZA 5B39B 1HXMB 4YHPB 2YJQA 4BYHA 5B3JF 1A4CA 4DTGL 5A1AA 3DO3A 3QFJB 4K15A 4JPKL 4J3UA 3SKNA 3O4OC 3HNVL 4NUMA 4F8LA 3FQYA 3PABB 3HC4L 3MRPA 1IM3A 4U1NA 3IF1B 3NZHL 4H8UA 2CLVA 1A22B 2AQSA 4QPEA 3UXFA 4P3WA 5TE7L 3VXOB 3KEDA 4HC1L 1QTYT 2A74C 4TPRL 2WQRA 4JFFB 4DGYL 4UMGA 5FGRA 3IDIB 2P5EA 3FQTB 1L3NA 5FYJL 3P54A 2AC0A 1KJ2B 1R5WB 1VGKA 4G1MA 4N90D 4J23A 4TUKH 3NSYA 1PG7X 5HJDA 1SJHA 3MNVA 4ALAC 1N6UA 4EUPB 2KPWA 1KXQA 4N22A 2HFEA 2ZG3A 4MAYA 5F7LB 2YRZA 3KJ6H 4IDLA 5A2JH 1DDHB 3QUMB 4K23L 2GUOA 3MN8A 3DTDA 1W80A 1UT9A 3GJFK 3TS8A 1A4BA 3ABZA 4FNQA 2FSEB 3OQRA 1E9QB 3JWNG 1G1CA 2EE9A 5KSUA 4ERSL 5EF3A 2BHZA 4JQIH 1KPUA 1ANUA 2J8UB 4S2SB 4D8PA 1ZA6A 2AJVL 4H2AA 4LARH 4TSCL 1S4IA 4QTIH 4W6XB 2G3ZA 4JM2D 3QORA 3NOIA 3HMXH 3ZUCA 3TEWA 2X4QB 3O6KH 1ORQA 4JFYA 1BQKA 1C16A 2G2RA 4HWUA 1K2DA 1Y07A 2WO2B 4AQ8A 5AD0A 2WTOA 1CLOL 2J2ZB 1ADQA 3BKYL 2OMVA 1OGTA 2A83A 4XPAH 2WQUA 3MRGB 1IQDB 4KXCA 1NLDH 1T21A 4YPGA 4DK6A 4F7MB 3WAKA 4F24A 4XNBA 1IFHL 2F7RA 1CGXA 3UYPB 1BFOA 5HPMA 3GM8A 3IAQA 3PNWA 5FA3A 1MNUH 3BIBX 2BVTA 1U2HA 1RUPL 5KVGE 2ZXQA 3SPCA 1MFEL 4JHWL 5MERB 5EUOB 4KVCH 4TNEA 3WFHA 4XTRD 2VKWA 1REIA 4ZMYA 4XX5A 1S9VB 4TRPH 4PJAB 2XBTA 4M5ZH 1D2OA 3ARQA 2JI2A 1XGYL 3JWOC 1N68A 1ETZB 5EOCH 1URLA