5LBSA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
446
structure length
394
Chain Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHDENRAKVEITPNSPRAEATLGGFGSLGLDCEPFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGGSWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein E
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Immune system-viral protein
total genus 79
structure length 394
sequence length 446
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbsA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbsA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbsA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbsA03
3J27A 5IREA 1URZA 4FG0A 5AAMC 4X42A 4FFYA 2V33A 4FFZA 2GG1A 4GSXA 1UZGA 4ALAC 3C6EA 2ALAA 2JQMA 3N43F 1Z3RA 5JHLA 4AL8C 3IRCA 5GZNA 3I50E 4UTAA 5KVDE 3P54A 1Z66A 2P5PA 3UAJA 1SVBA 3J2PA 4UT6A 5KVGE 3UZEC 2I69A 2HG0A 5KVEE 5GZOA 5KVFE 3UZQB 1OK8A 5AAWC 4UTCA 5LCVA 3WE1A 5B1CA 5LBVA 1TG8A 4BZ1A 5LBSA 3UZVA 3G7TA 1OANA 3N40F 4UTBA 2H0PA 5IZ7A 4GT0A 2R29A 1S6NA 1OKEA 2R69A 5JHMA 4AM0Q 2JV6A 4BZ2A 3MUUA 5H37A 3UYPB 3N41F 2JSFA 3VTTA 1ZTXE 1PJWA 4UT9A 3N42F 4L5FE 3C5XA 1RERA 3UC0A 3N44F
chains in the Genus database with same CATH superfamily
1R3KA 3FO2B 1JDAA 4DEUA 1JJUA 4LSRL 4WW2B 2HTLD 1H6FA 1ODAA 1IAIM 4ELME 5CAYB 4XE5B 2NYZA 3MR9A 4DN3H 3LS5L 5K9OA 3BEVA 3PUUA 4Y5YC 4MSWB 2Z7WA 2QELA 1LYQA 3QEGL 5CGTA 5I28A 3H9SB 5JO5A 4P59H 5B1AB 1FUNA 5CN1A 3GHBL 4UV7L 3NCJH 4BSVA 2YD2A 2MPAH 2EIBA 2JWYA 2DBLH 2YEQA 3HC2A 1R75A 1YECH 2VJ0A 1UADC 4N5ED 3BP5B 3US0A 1ZHLB 2BXZA 1AO7E 5KS9B 3F2LA 3X1GA 1IFRA 4DKDC 1D9KA 4J6IA 5I1DB 1S9YA 2Y7OA 4MZ2A 4XN7A 4Z18A 1JZ2A 3CDGB 4GQ9L 1OM3H 2F7RA 2V5YA 3ZIYA 3GBLA 5GS0C 5MEND 1B6UA 4FNUA 5DA4A 2CK0L 5CCGE 1FVEA 2CBOA 2G75A 4P4KA 3VM5A 3GRBA 2OJZL 4PRPA 4D3CL 4JY5H 3VTMA 5SX5K 4RAUA 2YD3A 4GAYB 2APFA 2PYFA 1PTZA 1UXSB 1KGCD 1ZMYA 1KCVH 2IH8A 2J7LA 2C4XA 5GZOC 4CU6A 3P11L 2IV8A 3LTVA 2FLMA 5JW4N 1P4BL 3OC5A 1JYXA 2YC1B 2N0KA 5D7LD 1EO8L 1HHGB 4Y1AA 1CBJA 3D09A 3W39A 1MJUH 4WDIB 1MFDL 3ULUH 1AY1H 1LO2H 1PZSA 3BEWA 3D0LB 2UXFA 2QGCA 3BD3A 3DO4A 4MCNA 4KRNA 5BOZG 4JFYB 3DRQA 3NJHA 4RZCB 2G5BA 1DZ0A 3KR3L 4U49A 4W6WB 2VERA 1AH1A 4Y4FD 4Z9KB 2J43A 5IQLA 1OOAA 5HPMA 5ITBL 4IW4C 2YRZA 4WJ5B 5FHBH 3CPLB 4P2OB 4AE0A 4IBZA 3MROA 5DJ8A 2UUDK 3QFGA 1TQWA 5TGBB 2IWKA 3SOBL 1MVUB 5T33H 1NOLA 3CBRA 2FJFA 4OTXL 1MZZA 2A9CA 2X2HA 3EO0A 3U2JA 4F2MA 4JO4L 5D5MA 5CZKA 4NFBA 3PHSA 3KLLA 1N12A 4P5TC 4TMPA 5C0BB 3D0VA 3UTTD 2AANA 4X80L 2BW5A 5FUZH 5CKGA 3WSQH 4XZUB 4WSJA 4L9LA 1WZLA 4NZJA 1QBML 2GSIB 2VN7A 3D06A 4B3VA 5KSVA 3QT2A 5D7JB 4IOSA 2WCGA 4ONOA 1PJWA 1FORH 5FW8A 3SKOB 5JW4Q 5CN3A 2Y7QB 2VUKA 2Y7MA 1ZD6A 1XB3A 3F05A 3WKQA 4D8PA 2PYEE 1SF3A 4E0RA 1F3JB 4X9YA 5HYQB 4QDGA 1DJSA 2UX7A 4XXDA 2OXHA 4HUXA 3CIAA 1N5AA 2DH2A 3UAJC 1TVHA 2JQAA 1IV8A 2DWDB 4NZUL 2IWEA 1EIBA 3TFBA 3RL2A 3WNMA 5LGHL 5EBMB 2JTYA 2ICEA 4KO5A 3BZ4A 2IOIA 5IQ9B 4N0UE 5E1QA 1F58H 1PGRB 3GMNB 3NH7H 3NSXA 4I5BB 4MQSB 4FI8A 4OIFA 4X0KB 2NY6C 1NWPA 5C0CE 5IB5A 5C0NC 1ILSA 5EUOB 3GRWH 5AB0A 1XXDC 1CDIA 4AYEC 4IOFC 4UB0H 5CLTA 1C08B 3X14A 3TPUA 4X7DC 2YD4A 5T1DL 3SCMD 1WFNA 2N59A 3L54A 4PJEB 3FQXB 3FTUA 5DZ9A 1SDDA 4AQ8C 5IV2B 3O3UN 2WAQA 1BFVL 3STBA 4HPHA 2E6QA 3H42L 4S1DC 3ME0A 1GPOH 2GIYA 1BZQK 1T04B 3PDDA 4GKNB 4HXBH 1CDYA 4RFEA 4GG6E 1SJXA 2XNAB 4IBTA 3LQMA 3RKPA 4C58B 4ZTEA 2O5XL 2IDFA 2K45A 3MRHA 1EEUA 3LN4B 3BP7B 4AEFA 5F0PB 4KH2A 2FGZA 1BBDL 2C9RA 5F1IA 1QRNA 3F7PC 3INUL 4N2FA 3HS0C 3QRGL 1WZKA 1UFGA 4G7YH 4G8GE 3KLHD 2HT3D 4OW6A 3BPLB 3QULA 1OF0A 4R4FH 3QNZA 4TVPE 1MQKL 1KBPA 4WW1B 1D5BA 3GMQA 1GYAA 1A25A 3SKUD 4EIZC 2F58L 3VXSB 4LZKA 3SGDI 3EOTL 5FFGA 3FUHA 3MXVL 3SJVB 4PS7A 4PJDA 1A1NA 4MA8H 4WU7B 1SLXA 4ADJA 4S1RH 4DT2A 4MJHA 5DSCB 1Q9WB 1SZNA 2FQFA 2XN9D 1KPRB 4KJQC 3CQFA 1NGPL 1CDGA 1CI5A 3FPYA 2Q20A 4DEPB 4G7VL 5ACLA 3LKOB 2QQLH 3CHOA 4EIUA 1J05A 4DGWC 5CZRA 1ZLDA 4ZPVA 4FEIA 5GGSA 4GKSB 1IB5A 1NFDF 5DI8A 5L8LB 5HYEA 1J5DA 2KDGA 2PW1A 4KO9A 5LLIC 3BZDA 4QD2E 5MEQA 1FFOA 3U2GA 3QH3A 3V0DA 3WLWC 3TFKD 4FTDA 4UINL 4M29A 4OF5A 2VDOB 2DWEA 5MENB 4FS0A 3ILQD 1PFOA 4JFXA 5D7KD 1A6ZA 5CMAB 3L3GA 3LNIA 3HG5A 3HBQA 5JXAH 4JVPA 2CGYA 5C0AD 3HAEB 1UH2A 5ETUA 5JNYB 4CVUA 5I8OH 3ZL4L 1I8LA 1XCTB 4AYBA 4OGAD 1M71A 3F5WA 2BCMA 2WQVA 4DP0X 3G3LA 2HUHA 1BBJB 5D7LB 1RY7B 1ZEAL 1TF4A 3TLRA 2X4OA 3RTQD 4DETA 1LDPH 2LOEA 4AKQA 2F53A 3CVBA 5FWRA 3RKDC 4AQAA 3SYPA 4P07A 4Q9CA 3B1TA 1GGBL 5CLZA 5FLVA 3GSQB 4ZBJA 3V0WH 4IKLA 3IFNL 4IKKA 4R4BA 4Y4FB 4NQDE 3FFOA 1WAPA 5JPMC 2DIEA 1T0NA 1JPFA 3CFIC 4UDUB 2P24B 2MKLC 4GJTB 3HLAA 3UYRH 3HC0A 1V7MH 2DY2A 2LR4A 3IBOA 2CUAA 2WM0A 3MLXL 4Y4HC 5B22A 3AXLA 4EO5A 4EZJA 5DVMA 4W81A 2E9JA 1IGYB 2XPGA 4LLWA 1FLRH 4HP5A 4J8RB 3SBWC 1E9OA 1I7RA 3FAXA 5E08L 3WJJA 1JNHA 3AS0A 2E4TA 3DDFA 4KPHH 3UGUA 5LCVL 3EJYD 5AW6B 3VD3A 3THML 1JTTA 3MJ6A 2NW3B 3ZHDA 2DB8A 1GYUA 5T3XD 4MYWB 3MO1B 2VMEA 4H0HB 4I77H 1C5BH 2F7OA 5LCVA 4PG9B 4NQCD 3LRSA 3X13B 2PR4H 3JT0A 3LDBC 4YSEA 4K3GA 4Y16C 2D9QB 4HWEH 2WTRA 3IMVA 3TYGH 4Z76A 5BS0A 1XF1A 1J5CA 4WHYG 2CBQA 5D8JH 5T3ZL 3U6RB 1U8KA 3GZQA 4UDTA 5IROC 1BG9A 1BQUA 4EKXA 3SYAA 4P57A 5HVGB 1RVFL 4L2LA 4YPGB 3U46A 3WV0A 1HSAA 2X4RB 4Y2OB 2VW4A 2XVGA 3QCVL 4OCMC 2JQZA 2IDSA 4BDVB 3HRZC 1EGJA 2J4WH 1HOCA 1YEEH 1WWWX 5GGVH 2X05A 2MCPH 5BRZD 5AG8A 1WTLA 3GB7A 1RU9H 1OO2A 4WKXA 3ULVD 3LRLA 3HE7C 4OVUA 1CFQA 5AWNL 5J1AB 2VRQA 2FHBA 2AITA 2Z3FA 3SGJA 5B4MC 1WFJA 4U3CA 5FUCC 5KSBF 1Z5LB 2HCZX 4TTGA 3LPPA 1NPUA 2YD7A 3J27A 3SCMB 1TQUA 3TEYA 3C5SB 2DPKA 3ILPB 1JFQH 1KJMA 2V8MA 2FK9A 3IYLW 2HX7A 1MXDA 2HB0A 4K9EH 5L88H 3QCTL 4Q6KA 3I9IA 1C5CH 4HD5A 4LPYA 1WSST 1HHKA 1K5NA 4WO0A 2DM2A 4FLSA 2HLEB 3WI9A 4K5MA 2VDKH 4KNUA 1L6XA 1EH9A 3ULUC 2AJ3B 1MF2L 1AGDA 4YDKL 5C9KA 1IQDA 3IJ7A 4KY2A 5TDOA 1U8OB 2L8AA 2EKSB 1F41A 1NGQL 5ABAA 4QHLA 3WTXA 4NO3B 3GUTA 1ZLVK 3N42B 2WY3B 1RJLA 3BGMB 1AO7D 4KRLB 3NABL 3TBYB 4R0LC 5T5FL 1NIFA 2EDNA 3QW9A 4A2EA 4QHUB 2VNCA 3QQ3A 4MS8D 4WFEE 4J6RH 4V1DE 1Q9OB 4BQ6A 3DGGB 5T5FA 1KIPB 4M8VA 4WWKA 2J20A 5IWLC 2H9GA 4UOW0 3QQ4A 2YAQA 4I4WB 3D30A 2XN9B 3BW9B 3Q2CA 5E4OA 4KQ4L 3T3PB 1HL5A 3IS0X 3PIQB 4PCSA 1ZS8A 4PI2A 4FX5A 3JZ7A 3IJEA 1SMOA 1HZKA 1CR9H 4YR6A 2OSWA 3FL7A 4HCRH 3TONA 4JFDE 3VB9A 4CC0A 5SWSE 3VFSA 3WDJA 3R06A 3AY4C 3BWAB 4Z7VB 4YSQA 3ARRA 4HH8A 3CVIH 4BM7A 3NACH 3B5HA 5GGUA 2VLKA 2WKLA 1OP9A 1XGRB 3T3MF 5D1ZC 4GQZA 2JJSC 5EFIB 2MCMA 3G5ZB 3TURA 5A43C 5C0AB 4TSAL 3C6SB 3ZKNC 1KLUA 4M56A 3D33A 3MRBB 4ZTPH 2BP8A 4P2QE 1MRCL 2JKRM 5EF3A 2X7LB 4P2YA 1QHOA 2MQCA 4LIQE 1JWSA 2C7UB 3DX3A 3LEVL 3QIWD 1ZGLA 3VWKD 1FG9C 3RWJA 1E4KC 1FNHA 1DJHA 1T80A 4JO3L 4XPBL 2RIKA 3PNWA 3RTQB 1OAQL 2WUBH 4N0FA 3WIIH 3T1WA 2HWZL 4J3VA 4B0MM 5L4JA 1LNUA 4A6YL 1DBAL 1QWNA 2BINA 4JDZB 4APQC 1LO4L 3C12A 4JRYE 2ODIA 3L2MA 3S35L 3DYOA 4MHHI 4A6YA 4LARL 1CLZH 2YD6A 3WGUB 4HGWB 1J5OL 1M9WA 2NDGA 4XC1H 1YEJL 3RVTC 3UG4A 4DOHE 2PYED 4WV1A 2Z91A 4KTDL 3L5XH 4HKZB 1M3IA 3OXSB 3GMLA 4LRNH 1V7NH 2KDYA 2YMXH 1CE1L 3Q8EA 4KBPA 3W0WA 4DP8X 2W07A 1GOFA 2AV7A 4X5WB 3SDXE 3RDTD 3VGFA 2VDML 4KI5E 1AAJA 3E6FB 3TBTA 3VA6A 4HDIA 4JKMA 3QUZC 4RWHA 2WVVB 8CGTA 1BVKB 4P8QA 4OLEA 1BZ9A 2ZTBA 5HDBE 4NKOA 1PBYA 5C0CD 1CWVA 4NQCB 3E38A 4PCTA 5MEOA 3NCCB 2GJJA 2KZWA 5D1QE 4U6YB 4HS3A 4K23H 1HK6A 1MXGA 1CXLA 1DE4A 3MRCB 1NL0L 4U1SB 3QIUA 4LAQH 4M6MH 4GQPH 3NCFB 1R24A 1WD8A 4PJ8C 1TZOA 2BVQA 3FB8B 3SKMA 4PVNA 2HH0L 3QAZC 3VFPA 3FMGL 4GY4A 3K4ZA 2DM7A 2H8PA 2WLKA 4UNIA 3LPGA 5CO1A 3K0YA 3UERA 3UZQB 5I8EB 5GS2D 4L1LA 4H2CA 1I8IB 5FYJL 4LVNC 4KKCD 5BRZB 1ZIAA 4LCUB 1K8DA 3FF7A 4EI5A 5J6SA 2UXTA 2MH4A 4G6KL 3Q2WA 3QIBC 4KDVA 4YZFF 1JV2B 3TM6A 4AQEA 1HEJC 5EDXA 5E9DA 4F9LA 2P28B 2XJKA 1HL9A 4GW5A 4G8GD 4PREB 2ZOOA 2VDQL 1YEDA 3G6JB 3JV6B 4NHUB 3OAUH 1KTLB 2BSED 1F2XK 4JFQB 4OGQC 4TVPD 4FMKA 3WS6A 2W9DL 4GXVH 2AI0H 1A6UH 4NC2B 4N2HA 4PGBB 4JKWA 4OB5H 4KY1H 1IUZA 1KB5L 1H15B 4KAQL 5E94B 2AXGB 3OSKA 5IVXE 1FGNH 4HG4J 5AVYB 4QWWD 4PJIB 1X4YA 2YBRA 1U8MB 1WC7A 2XICA 1AXSB 1KB5A 4K94L 2YR3A 4B7IA 1A3LH 3ZRSA 3FBQA 43CAA 4Q9RL 1TO5A 2ZXEB 4ZT1A 4C57C 3K4DA 5CNHA 1MUJB 1I1AA 3ULUF 1SEQH 3FF8A 3L1OL 2HAZA 2P8LB 3FSVA 1IGMH 4Z77B 2YXVA 2CXGA 1HI6A 2DQIH 2F8IA 2WWNA 2QT6A 1PKOA 3LXBA 1UD8A 5LQBH 3BI9X 5MHSD 4JZJC 4OLXL 2IOMA 5DD6A 4XAKE 3D69A 4B53A 3EBHA 3PV6B 3TASA 4F7TB 4XHJC 2CRMA 3CC5B 1JK8B 1FFPA 1SYSB 3KWVA 5DJ6A 1OCWL 3QJFA 4EN2A 5BV7C 1AO7B 1T5KA 3PDOB 4GAAA 1ZHNA 4WO4D 2H6PB 2CIIA 4IIQA 4ANXA 5IOPB 3MX0B 1FNGB 2FL5A 5B21A 1A1MB 4WWOA 4FABH 4JG0H 4M7KH 1X5KA 2BIOA 4LP8A 5EO1A 4Q74A 4AG4H 4R96A 2X6MA 4Q2ZA 1MW2A 3DROB 1NEPA 4X99B 3VFWA 3RPIA 1S7QB 1A6VL 2Y69B 2WO2B 3K3QA 3AB0C 3U4EB 4OLZL 4B3EA 4BFIA 4LKXA 1WHOA 3V8CA 4AKOA 4I18B 4I2XA 1G7PA 2ZWLT 3QDAA 2DQCH 3TNNA 2OR9L 4WHTA 2BOBA 3ZHKA 2DKMA 1JP5A 5FO8B 4NM4L 2UY7A 1PZ5B 4X7CC 1RHFA 4RGNE 5AAMA 4MA3A 3UJJH 3L16A 1SJHA 2OMYA 5H2BB 1UWEL 5HYFA 3DA0A 4W9FC 1YYCA 4WY7L 4RFNB 3CLWA 3CBKB 4JKPH 5EU5B 1JHLH 1IEAB 3F7KA 2IFFL 4MNGE 2IQAA 3F04A 1XHHA 3C6LD 3SBRA 4F3FB 3DIDA 3JBG7 3X3FL 1P1ZB 4NOFA 4N6QA 3ATDA 5DMYA 5I30L 3QIWB 1A66A 4KXZI 3VWKB 1I1YB 1TG8A 4XCEA 5ERWA 3S4SA 2WCPA 4I48A 1XD1A 3C60A 4M9OA 2O30A 3BH9B 3NRQA 2OMVB 2HJLB 4HUUA 5CIPB 1OAJA 5CBAA 7PAZA 3VUAA 3ENEA 3JWDL 3MGTA 1AHKA 4RAHA 3QUKB 1UYWL 1KEGL 4QLRA 2AEOA 2OL3B 3ASWA 3W1ZA 5BPPA 1KYOJ 2DMKA 1ITCA 2MHAA 4OCSH 4AGLA 1EBAA 2WXQA 5AOIA 5F9WB 4LSSH 3BH4A 1IC7H 3QZNA 4PJFE 5I0VA 3QJHA 5FKPA 1VRSA 4K9EC 2PYEB 4G5ZL 2DQGH 4OAWA 4UANA 4XO3A 2OK0H 3VQMA 3LZNA 4WTQA 3A5VA 3BAIA 3RUGF 1MG3C 4PBVC 1MWAB 2VLLA 2A73A 3OAZK 2XG5A 4K3DH 4P2RB 5EBGA 4HIJB 4PJEF 3S7GA 5ISZE 5AKSA 3K6OA 2OYPA 4DP7X 3RDTB 1URLA 3NJIA 4ZOBA 1D5XB 4FQHA 3UIYA 1MCIA 2BC4B 3RL1A 1OTSC 2MFNA 3KL0A 1I3RA 5I1EH 5F88A 3U4BL 1H3UA 5C0CB 4A7GF 4IRJA 1Q1PA 2OCJA 2F18A 2XPYA 4LSUH 3KPSA 1MFVA 1DQQB 2A1WH 4D7PA 1JZ5A 4LOUD 2QVFB 2DICA 4HIPA 4Q56A 4XP6L 2VAJA 4ZW8A 4Q0XL 3PNRB 5BO1L 4XODA 3IAPA 5DRXA 4ZX5A 3KPQB 3PP4L 3U6XS 2X1PA 4HBCL 4QHNB 1X6LA 5C7XL 1FAIH 2NXYC 3BO8A 4HMCA 1C8PA 3I9AA 1PKQE 1CFBA 2NUPA 3OB0K 4LPTA 3ZKSD 2BSCA 3GSVB 1VB9A 4FQLH 4GG6B 1LJMA 5D2LF 4OD2A 2VR8A 2HFEB 5CJXC 4W9LC 5M7QA 4NM8L 1QABA 4MJIA 4WEMB 1JTOA 3BP4A 5GISL 5KSAA 2JH2A 1YG9A 5J1SC 5C0JB 2IBGA 1UD2A 5I1LA 4YVNA 1KGJA 5AL8A 3AADB 4IGBC 4U6XA 5I5MA 4G8GB 1IC5H 1BLNA 3HOGA 4JCWA 1EDHA 1O6SA 2X70B 4N2BA 3VFNB 1XGZA 2VH5L 4EQ2A 1ZHBA 3GPEA 1OTTC 2R7EB 2AJXH 2XPZA 3IJ9A 3V0AC 4G43A 3CZLA 2QR0A 1GC1L 2C3VA 2WGNB 4NSKB 4WIQA 4X50A 2FT6A 5IFAH 4PJAA 2A6JA 1GZQB 4WFED 2CJTA 3O41A 3KYAA 4V1DD 4TSCL 1ROCA 4KKAC 1S8DB 1N6QL 4NI3A 4HPOH 4QMEA 4YQXL 5E5MA 5F6HJ 2ETWA 3CGTA 4LL9A 1BYNA 3DUUB 2JJTC 2YAEA 2BNQA 2PP9A 3FZUD 4M93C 4EOWH 2UXGA 3EO9L 2D3NA 4NZDA 2GW5A 3WO4B 4P5TD 1YO4A 2R59A 3UO1L 3L9EA 1DQLH 1HTYA 4JFDD 3VB8A 3TBWA 3ULAB 2YSSA 2BK8A 2AVGA 5SWSD 1EGJH 4A7TA 5I73B 3VMPA 1I7ZA 4WO4B 2NT0A 1OHQA 3KPPB 5IW1B 3CVHB 4UYPA 3P0YH 1NBCA 1E9PA 3RNQA 1T7VA 4ONFH 4AEHL 1N59A 4OLYH 4DTGL 3HNTL 2A74B 4Z7QF 1E3XA 4RMTA 3JV0A 1ZIBA 2J3SA 3BLKA 4P2QD 3QEHB 1D9KC 4HQQL 1FF5A 4B96A 3K71A 4JHAL 1E50A 1ZK5A 1YPZA 3UAJD 3BKCH 4FTVA 5G2NA 3GNML 1A9BA 5FW6A 5KVFL 5KYYB 3FKUS 2KLRA 3MJ9H 3ETTA 2I25N 4CBZA 1R5WA 3D1MC 2IXQA 3F6IA 1C16A 2QQQA 3DJSA 4B60A 2APSA 4U1JA 1H3PH 1HHJA 3W5NA 5DD1H 4XNZB 1Q72H 3T0XA 4JRYD 3SY0B 4KXZH 1BJ8A 1GJUA 3ET9F 3ZE2E 1UQSA 3SYOA 1XCQA 4NQUA 4JAMB 3RWCB 1AJ7L 1FC1A 2QPSA 3HEIB 4W9IC 3NG5A 5C0GA 3WEMA 5DD0H 1KJVB 2ALAA 4ODWA 4J3SA 2HLFD 2HVJA 3DMMC 3W2DL 3BFWA 3UTSE 3C6LB 4AQ1B 1DBKL 1ASQA 4B41A 5EEYA 2FYYB 5K1NA 1YUKB 4HZAA 3HTLX 4BD4A 2GCYB 3DI3B 4LPXA 2K7QA 2R2BB 3BVVA 3FQTA 4HIHB 3LNEA 4RFOL 4WI8A 2AK4A 2GI0A 2IH1A 3KVDD 4WENB 4KI5D 5EN2B 3PDGA 5E4IA 4IK7A 1UM6L 4K07A 3ARED 3IKCB 3KNBB 4NWUH 3UEZA 4N2IA 1J18A 1WCBB 2NY4C 3CU7A 5TF0A 4HAKA 1WICA 2DQHH 5J9PA 3DOHA 1BOGB 3KL3A 2QZQA 4K9JA 5D1QD 4QRRA 1EJ8A 2J1XA 5HYSA 2J25A 1DVYA 1R3IL 1ZVSB 4L9LC 4NQVB 3RRQA 4HIEB 4M5YH 3QUYD 1X4XA 4WI0B 4CL7A 2XBDA 1Z9LA 5CGYC 3FRUA 3LKSA 5JTWA 5EOCL 5IM7B 4NKDB 1LP9A 3OGCB 3EYVB 5DFTA 5DVNA 4UILL 3LV3A 3F6LA 4N6RB 2Q9OA 3BN9D 4LU5L 3GXIA 4Y5YB 2ZAGA 1Z9SA 2HA1A 4X4YA 1ZT1A 3MOAH 3ARZA 3NSDA 1PLCA 1L0PA 4GP5B 1NC2D 3FB7A 1RZKC 2NSXA 1CYXA 3CZGA 4ZFOB 3PY9A 4IIZA 2ICEC 4DHLA 4CKVX 4WEEA 4WHDA 4PSRA 3PAVA 3O6LL 2Y6SC 5F96L 2BP0A 1BQ5A 1S7RB 1DBML 5SX5H 3H9ZA 2BRRH 2BMKA 2ITCA 4MD4A 2MNWA 1BGXH 4FRWA 4NUMA 3CFQA 3MLWL 3N42F 4ZS6D 4HWBH 4YBLC 1EUUA 2VQTA 5AYQA 4CADB 3FB5B 3HZMA 3GMMB 4DGIL 3Q3GB 1ZSHA 3H9HB 3UFIA 1ZSDB 2CLZA 2VN3A 2P42B 4PBWD 2XCMC 4QLWA 1LK2A 3OG4B 3PP3H 3CCHB 1DUYB 3I2CL 1HNFA 3MLUH 2VDPB 3BUYA 1JPSH 3G9VA 5GGTA 1EHNA 2WNGA 4XAKD 3T4YB 4XNMB 4PJCE 2CPCA 2WOYA 1LK3L 2Y7SA 3IB4A 4U1LA 1AZBA 1GCYA 1ONQA 1IGCH 1KB9J 1O5PA 1ERNA 2AEWA 3C6EA 2BY1A 4N90E 3MBEA 3BSZL 5E8DH 4BGLA 4V1DB 1TO4A 3BHBB 1OGSA 2XWXA 3OHXA 2JLPA 4IHBA 1OSPL 4ICXA 4M6NH 4MAYC 4MLSA 5AVZB 2QVMA 3ZDYE 1B0RB 3BSZA 1H8OA 3WTWA 2YPLA 2ZCHL 3TO4D 4H13C 3W37A 4JQXA 1WFOA 3ESUF 4PV9B 5MERB 2QQKL 2V9QA 4UT6L 5DRNB 5JQ6H 4M43H 3GYRA 2E7LC 1WT5C 1OP5K 1VACA 4P5TB 3SDAC 1PL3A 4JHZA 3NDYE 1XGUB 5KAQF 4UT6A 1NDTA 4O02B 2APXA 4JFDB 2X4SA 5F3HB 4BA8A 3O4OC 1B0IA 2ADJA 5SWSB 5IJKA 2EDDA 5FCUL 3W9DA 2FIKA 1KXTB 1RIHL 5C07D 4RGND 2I9TB 2YPKB 1S9WA 3CFBA 1WA2X 1ZPUA 2R8SH 5JW3L 1U8CA 4P2CG 4HLEA 2X9XA 3RFZC 1NCUA 2CU9A 5CEZL 3S36X 2LLNA 1F97A 1RUML 3B1UA 1UG9A 2WXOA 1QI3A 4FP8L 5E1GA 3JWOH 3L4YA 3L9RB 2UVFA 2Z1PA 1WRFA 4P2QB 4P5KA 5JA8B 3N44B 3TBVB 4KXDA 2VLME 5D70H 2PCFB 4TSBH 3MUHL 2B1HH 3EBIA 4K8RL 1D6EB 1QHPA 2Z4QA 4QOKA 4IU2A 1VFBB 2PWEA 4GRWH 2OMZA 3L48A 1CTOA 1S9XB 1S6NA 4QRFA 2FBJL 2WBWB 3CK0L 4MX7A 1MW1A 2X4NB 1KB5H 1CICD 4M3JA 2A9MH 1FYTE 2AXFA 5FDYA 1JZ3A 1YYML 4OZIE 1N67A 2AMGA 2FB4H 4JRYB 1VGKB 1RZIA 2Z8RA 4P3WA 4G80B 5C70A 1SHWA 3RX8A 3GC3A 5FA4B 1DVFD 3B6SA 2DQMA 5DR5L 3CSYB 4OZHB 1QSEB 2EXWC 5I76A 2OLDA 4KNQA 5KYUA 3LKNB 4DOHB 2LT9A 2ZCLH 1P5VB 3GSOB 3HZVA 5CJQH 1CGTA 4JK0D 3F83A 1IAKB 4PJXA 1G9NL 2YZ1A 2L7EA 3MRKA 1MHEA 4YHML 5GPRA 4WNQA 3U0WH 5AZ2L 1R3JB 2ZWZA 4JN1L 5DZLA 1CD0A 3DSNB 4FQ1L 2HMID 2EE3A 1LMIA 4DW2L 5JPNC 2DWXA 4G8FB 5DWUL 5EIIG 2XA3A 3NA9H 4H8WL 1NCTA 3BDYL 2AABL 5TFSL 2QFRA 4PWHA 1JFHA 5D7IF 3FTGA 4U1KA 4ZPTA 3AREB 1OB1B 1PLGH 4AXWB 5FB8B 5CD5D 4IRZH 3V0JA 1INQB 5HDBB 5FIEA 3RZCD 2FWOA 1XF5B 2X38A 3QB7C 4L2YA 2OKMA 1HH6B 2G3MA 5D1QB 2RAMA 1P7HL 1NSNL 1BQHB 1TJMA 4H25B 1NUNB 2P7TA 4C56A 1CG9B 3RY5A 5FO7A 3VFTB 3NPSB 3DIFA 3QUYB 3ABGA 3TH4T 1KIUB 2JK5B 4EUPG 2V3EA 2P80D 1KCSL 5DD3L 3DTUB 3TIDA 3BISA 4G2AA 1E90A 3KPMB 1NEUA 3QI9C 4GUPA 1TQBC 3D8MA 2APVA 3L3OB 1F4WL 1I1RA 2BOCA 3KD4A 4XBPA 5EF0A 4E9XA 3NSCA 3O6FD 3V9CA 3FHQA 1T89A 2YN3A 4J4PA 4ODSL 4LCYB 4KI1A 3L3KA 3UTQA 4GNKB 1UWEH 2Y5QA 2NQCA 1FH5L 5HI4C 4IMKA 1NC2B 4RGOH 2P45B 1VIWA 4ELMF 4CVXA 1W91A 5IQ7H 4B6ZA 2J2ZB 4DGVL 3QQDA 4X6DA 3LKRB 3P0VL 3TYFB 5F7MC 5F3BB 1JGUL 3ULSA 1SHXA 1KLFA 4KKBC 3NZHL 4NUGL 3SDCD 3HNVL 3GFUA 2NYYC 2Z8VC 3MV9E 2JMRA 2CO7B 2RCSL 3CFNA 5IVXB 3CBJB 4MJJA 4X9GA 3WUWG 4BH7A 4Q9BA 2FR4B 1A4AA 2NTFB 3GT6A 4MB1A 4OM0H 1FSKC 4FOMA 5EB9A 1SYVB 2AF2A 3QHZL 5GRWA 1OAUH 3I9GL 1KEGH 4QHMA 5D4HA 3MLTB 1CXFA 2WINB 3PWPA 4HGMA 1OKEA 4OGYL 4PRPE 2EDJA 5ADPL 5T1KA 5FM4A 3SODB 5KAQG 1GS7A 1I8AA 4NT6B 2ZOUA 3NGBC 1F3RB 5H37A 5C08E 4MXVE 3HPLA 5DJYA 3ECUA 1L0XA 3TVMA 1EMTH 1IAIH 1JWUB 2RH0A 5AZEL 2DQEH 4ETYA 1E4XL 5DC4B 4D0CB 4LRIC 4KQ0A 5DS2A 5IW3A 2BJML 5KYXA 3FFDA 3V6ZB 3C08L 2HN7B 3EYFA 4MRBA 3QHTC 1UATA 3BGAA 4XN5A 3DDGA 4U1NB 3BGFB 3BZEB 2N3JA 3HMXA 4QYOA 2ATKB 4X7FC 2VR9A 2LTQC 3OJ2C 1Q9LA 2CRYA 1MY7A 4NP4L 5B1JA 3V5DB 2WLYA 1E2WA 1J8SA 3TO4B 1CT8A 4G71B 1TZIA 5A2AA 3ML8A 4X5XA 2ZJSH 2GIMA 1T1XA 1S5HA 1XH3B 4O2FA 2W0FA 1MIEH 4OD1H 3WIHA 4WWKC 2FZ3A 3ZT7A 4PJBB 5JOEA 2Q3AA 4N20A 3NCEB 4DZBB 3QXVA 1LO3L 2CR6A 4HBCH 1WITA 5C7XH 4YSCA 3T0EC 1MFEL 3CLFL 5C07B 4RGNB 2P47B 5KUMA 4ZUVB 4F2ME 2DTMH 4LLDA 5D5ME 5G55A 4FQCL 1Z3RA 5BXFB 4PY7B 1PMYA 5E51A 2DIJA 1QFHA 3ZKMC 3FCBA 3GHPA 1AG0A 3IWUA 2WKOF 3IRCA 4HKJA 4LEOB 4J39A 1SXBA 5IB3B 2X3AA 1MFAH 1BSIA 3UTSD 3QDMA 5DUMH 3CH1A 4MD0B 3OPZL 2D0HA 4N9GB 1QRKA 5DMIL 3UPRB 1W72B 5E2UL 1DSFH 1BQLL 1E5UI 2DLFL 5H8DA 3H0TB 2G3NA 2X41A 1FPTL 2Y06H 2HTKD 1FE8H 2D0GA 1DP0A 2R15A 4HS6A 2NPLX 4HF5L 5EO0B 4JRWA 3V0FA 3KJ6L 2AXJA 2DAVA 3FT2B 3L17A 4L3EA 2QVTA 1CICB 2YPVH 4H8UA 4NYLB 2DLTA 3KPLB 2NNFA 3QJSB 4AENB 2P5EE 2EC9T 2OS7A 5DS8A 5LO7A 1R3HA 2CA3A 4P5SA 3TTYA 2EYTB 4NDMB 2CKNA 3BYTA 4MXQC 1DVFB 1DQDL 3WG7B 1T66C 2BSTA 4PJFB 5AB2A 3M1CA 4IMLB 2H5UA 4XP1H 1TMCB 2CLRB 4ZS7L 1M1XA 4PVBA 3JUZA 4HLZH 5EHFA 4EZKA 2NLJB 1TPXB 2ZF8A 4MNQB 1CFVL 2AK1H 5EF1A 2NNXA 2VMDA 5EU3A 1A8ZA 4JDVB 4WV1C 3MODH 4YGVB 4YDIH 4BUGA 1UJ3B 1ZLVH 5IJBC 5ICXA 3QUXC 2GBAA 5DK2B 3RZCB 4FHJA 4QF1A 1LEIA 3QXWA 1CJYA 4KROC 3VTTA 3O11B 1A6WL 4FCHA 5B39G 3V7AE 3NCXA 4EBQL 3GSWA 5A6MA 4QRTB 4JLRB 3HI1A 1QRNE 5FGBA 4MDRA 4D9RE 1YUHA 4RSYA 3P77A 2C7FA 4F33A 1P1VA 1PKQB 3KLAA 5ALBL 2WSDA 2R0KL 2R39A 3QUMH 4U1HA 5BUAA 4GW1B 1B4TA 2OJEB 1HE7A 3QJZA 2O6PA 1KEMH 1A6PA 5IBTH 1B0GB 3E8UH 3O6FB 4S1QH 3L3IA 2PXYC 5AVUB 1MEXH 4LVHC 4ATTA 4FL4B 3B83A 4F7CA 1R5IB 4F2EA 2C26A 3WFEL 4HWUA 3S3JA 5I16A 4JBSA 4XPGL 5C6TH 1DBKH 4PIRF 4ETQB 5G5DA 4G7RB 1FVDB 3DTXB 3S88L 1HIML 4QRBA 1AHWA 4N90D 2DDQH 4WTXA 1B2WL 5F9OL 4TOYH 1HWHB 2XIIA 1YZZA 3VGHA 1JNLL 1MJ7H 3JWOC 1G7QB 1MFBH 3BKJL 3FDWA 5D96C 5ANMA 1KYAA 5K39A 1Z5YD 3GSUA 3WS6C 3EDDA 1ZA6A 5BUPA 3DURA 5DRZB 2IPTL 5C0IB 4K5OA 2GITA 5FF6A 3S5ZA 5B7FA 2YK1L 4LNRB 4F8PA 5JXED 1PU0A 4YDLC 1IM3A 4KZEL 1YMME 2D7MA 1EV2E 3KXFA 4IQHA 4OI7A 5J3HC 4AV0A 3QXDB 4HMEA 3P9WB 2UX6A 3QUGA 5EZPA 3SOTA 4B5EA 2Q76A 2C3WA 4WGVB 4OT1L 3D39E 4FYQA 2D7TH 1OK8A 1D5ZB 3NJGA 2X4PA 2PKDA 4OF0A 4UUJA 2VDLH 2V8LA 5HD8D 3IDNB 3WHXB 3VMOA 5C9JB 1MCDA 1OAXL 1UXMA 4LBEB 3RGVD 5AAWA 3ZKXB 1HQ4B 3GDCA 2X88A 1KG0B 4TQHA 4DGYL 5H35B 1UCBL 5E4AA 1SVZA 2BXYA 1J9CT 5IT2L 3EOAB 5JQHC 2D7NA 4HMDA 43C9B 3EOBA 3IFOB 1OCZB 1UOVA 4IIQC 2EINB 3V4VL 2B16A 1FJ1B 1U58B 4FNTA 3DC0A 4YS4A 2VOTA 5D7EA 4WTZA 5B8CB 1CK0L 3V4VA 4UNTA 3FO0L 2DYRB 4GXUM 1LO5B 4JMXA 3HZYA 3E0GA 4S2SA 4NGHL 4Z3JA 4JM2D 1BZ7A 1YHPA 4L3CA 3B3IA 4QTHA 3MLWH 1FO0A 3OM3B 3N9GL 4I13B 2YD0A 5TF1H 2PWFA 4RNRA 2UY6A 1D5MB 2N01B 1A7BA 1QBBA 2XV6B 2ZX6A 4P23D 1NEZA 3LPWA 1IAMA 2WSKA 1M9SA 1TQCC 3LEXB 5GGTH 3WDHA 2C9QA 3DRTA 1UWGL 3LZFH 4J27A 3QFJA 5AAMC 3UTSB 4OZFA 1JV5B 2B4CL 4LEEA 4PYGA 5DD5L 2OXGA 3FU8A 1HHIA 1FI8C 4GS7B 5IR1A 3BT2H 2YEVB 5BQ7A 1KIQB 2B5IB 4N2AA 3QA3A 1REIA 2XXMB 4KK5C 4NQEE 4N0RA 3T4AB 1FRGH 3A47A 4WVRA 3RP1A 3QJOA 4GLRI 5KVGL 5EWIH 1GY2A 3TBBA 5T3ZE 5JZ7C 4ZUWB 3MKGA 5D9SB 3IE4A 3NFNA 3BSZH 1S7UA 4Y4KD 3QPXL 5FYLH 4NO2B 2ZONA 3NAAL 5E95B 5HDQH 4PUBH 1CLYH 2J44A 2NR6A 2X0WA 1CD1B 3IDXL 3FCSB 4XCCL 3V4PH 25C8L 2B1OA 3KLDA 4JUTA 2E4FA 2Z31A 3DBXB 1P9MA 2ADGA 3TA3C 3AS1A 2AEPL 4KJPD 4ZJ9A 3WCYA 4HW6A 1FBIL 2ZWSA 3BP6A 4L37A 4TVSa 4KJYB 3MVSA 1E5YA 2YGOA 4LGSB 3VWJC 3IF1A 4OIBA 4FQ2L 2V5TA 3B2VH 5DZPA 1EHLH 2ZOLB 5F2FA 5GIRB 4FLHA 2Q6WA 4MWFB 4BZ1L 1IFHH 1EJOL 1TETL 3HFFA 4JZJB 4GBXA 5HHVL 1SHMA 2R23B 1SY6L 4BZ1A 3EGSA 2YRBA 1NCCL 1MSPA 2DW5A 1YEWA 1G0YR 4XPTH 1JHTB 3SE3C 1QR4A 1P7QA 1UCTA 1SY6A 4UNUA 4ENED 1N5YL 3QC5X 3M1BA 4IRJC 3W81A 1KLGB 4LNVA 5HHPA 4LSQL 2DL9A 1KDJA 1TCRA 4AC2A 3UZEA 4XBGA 1C12A 4MMZA 4X4XB 3ZRFC 1ZHKB 1SOKA 1QLEB 4XMVA 4JN2A 2JV6A 4X6BB 4Z7WA 1DQIA 1Q9KA 3STZB 2Y1YA 3FQNB 4NQXB 3WL9A 4TTDC 2JSFA 4P4KD 3MA7B 4Y19A 4PRPD 1LGVA 3ZSSA 4ZDHB 1N3NA 4CDHA 4J3TA 1FNEB 2LFGA 3QZPA 5DMKA 3HHSA 4PJCB 5C08D 3UJIH 3D2UA 2XC8A 3DXAE 2ERJB 4ODVH 5I2IB 3O8XC 1A7OL 1A4BA 3U9UB 1D7FA 4R7DA 5CFAA 1TZGL 4Y1AD 2GYSA 4D9LH 3PQYA 3HI6H 4IBQA 4PJGA 4UOZA 5A2CA 1URZA 2EJ1A 4I0PD 2BSSB 3X12A 2I07A 2GUOA 2FUTA 3OJVC 3U0TB 3U30C 5DK0A 5CR1A 5FGRA 3PWNA 1GCFA 3EYSH 3DETD 4HKXB 1SMDA 5C1MB 5I18L 3ZDYB 2ZKXA 2AQNA 3B5TA 2XQBL 4Z78A 5FCSH 1CFSA 3IM1A 4GRWF 1HAWA 3VH8B 4XMPL 2DQDL 1A3RH 2XZAL 3GDBA 4QRUB 2BVUA 1MCCA 2F7QA 3PYCA 5HHNA 5ITFB 1RK1B 4LK4A 5B38B 5JMOC 5E23A 1SN0A 3FBKA 3SPVA 1HL4A 1FIGH 3PAUA 2C9PA 4HAFA 4E42A 4PR5B 1S5IL 1SJEB 1GRWA 1GAFH 4CUCA 2M2DA 3RGVB 4ABUA 4CSZA 3CU1A 2Z92A 4OCXL 5F97E 3ZOAA 4WI6A 3MJWA 4IS6A 2XIDA 4HHAB 3EADA 1U6AH 1FVCB 3OAZH 3U7AA 5LXGL 3QZLA 3GMOA 5LXVA 4PQXA 4FXKA 4IOSD 1GGUA 2PNDA 1F56A 4XPAL 1RUPL 5DJ0B 3VI4E 3CG8A 1EZVX 4FKKA 3JUYA 1DQJB 1YEFL 3H4HA 5IEHB 4F58L 1GIGL 3RPBA 3GLAA 3IDJA 1XCWA 4L0ZA 3R4DA 4UM9A 3LHPH 1O5DT 4M48H 2D31A 2F0CA 3HE6A 1OPGH 2DQJH 3NEOA 3WGVB 5DHXB 3FT3A 2A6IA 2P5ED 1IM9D 3EBGA 1JF1A 4JM2B 4P05A 3SDXF 3G04A 3QNXB 5DUBB 2CJSA 4L5FH 4CJ0A 4OJEH 4KI5F 1JUFB 2XFXA 1CL7I 2J72A 4AT6A 2PWGA 2R69L 3OB0H 3PE9A 1YNTF 3M1OA 4YWGH 1GXEA 4YDJA 2YEZB 1BPLB 1MI5E 1N18A 2A6KA 5H37H 2W95A 2R69A 4EUPB 1XEUA 1G4RA 2BIIA 4N68A 3ZKQD 4X0NA 5D6CB 4JPSA 1U3YA 2YD5A 4HT1L 2ED8A 2RQEA 1LEKB 3ML9A 3PWLB 2ZCKL 4PS8A 3ZTDC 3H7LA 1UXLA 1OW0A 3CV5A 2HX8A 2KKQA 3HMXH 5FFLA 3L7EB 1USQA 4I3RL 3ZGIA 4DQOH 2DWYA 3NEEA 4IGBB 1VSCA 1BFOA 2YRLA 3CZKA 4Y4KB 5IIEA 1AGBA 4FHKA 4XOBA 2FECL 2VR6A 3WN5A 3VFVB 4PRDB 4C55A 2XN1A 4KRPD 1ZRUA 4UT7L 3WLBB 3WIHH 4JFFA 4ENZA 5FYJE 5JHDA 5IFHH 1QRND 2LU5A 4D9RD 1N8ZA 2I5YH 2ZWKA 5EOQH 4MDIA 1KWKA 3GSXB 4DVBA 3SPJA 3WUWB 1OP4A 4X9IA 3RJDA 1I4FA 3HC3H 1E5AA 4JREB 1RZJL 2ITFA 1J0KA 4FQCH 4LEXL 3QDJE 2O4EA 3I6GB 3CXDL 3CZFA 3D0AA 4L9DA 1H8LA 3ZMRA 3CFDB 4G42A 5KOVC 2KYIA 5D72L 2W5PA 3MR9B 4CKQA 5K9OB 1KPVB 2NMSA 1NAMH 1IBGH 2I7OA 2WUCH 4HC1L 3H9YA 3ZYOA 3GS4A 2AQRA 5J06A 2P5PA 3HZKA 2Z0BA 2CHWA 2YBGA 3FRPA 4FG6C 1QKZH 2BY3A 4BSVB 1O7DE 4B9JA 3GZOA 3DHUA 1A4KA 4DP5X 3L1FA 2TRYA 1KGXA 2VDRH 5IMOA 3ZLQC 1BAFH 1S9YB 4RX4A 1ED3A 3D18B 2GJPA 1YMMD 1KF9B 1FVEB 2ENJA 1CD8A 2G75B 4P4KB 4PRPB 4N86A 1Y18B 3CZEA 1Y07A 4PFEA 3D39D 4RAUB 1ZK9A 1J86A 2PYFB 1BG1A 5ACMA 2AJVL 3NIGE 5C08B 4J3OH 3O2WH 3CAFA 5CEXA 4L8BA 4Y1AB 1QI4A 3L7FA 2EO7A 3W39B 3ZE0E 5GHWH 1A6AA 3Q9PA 4LSTH 3BEWB 1NJ9A 3CFCH 3LNFA 3FCGA 4J28A 4YC2B 3DRQB 4RMVA 1RPQA 1L9OA 3H55A 2VUOA 3R18A 2DI9A 2GIXA 5DHYA 3SHSA 3K7UA 5HGHA 4UT9A 1NINA 2BSDA 4HJGA 4NERA 5IB4A 4G7QB 2VWEE 3MROB 5DJ8B 4F37F 2L04A 4OCRL 1RULH 3RVUC 2FJFB 3G08A 3TJEL 2FLRT 2FEEL 3EO0B 5DTFB 5ALBH 4F2MB 5D5MB 2ZNWA 3V6FB 4PRIA 3WAJA 3F00A 3D0VB 5KJRL 3GSNH 2H1XA 4IU3A 4Z95H 2EEFA 4LCCB 4JO1L 5CSZA 5C86A 5JOFA 1GSMA 4RGMB 4JJ5A 5KSVB 4QHPA 5IESH 4TLKA 1UEMA 3B34A 2Q87A 4BKLA 2YGNA 3V6OA 1T6VN 2K6ZA 5D4IA 3H2QA 1H0DB 4IDJH 5FS5A 1CL7H 4KTEH 3VFMA 2OR7A 4D8PB 4XE0A 2XZCL 1BEYH 3ECWA 4N8CL 4ZTOH 5F8RC 5AW2B 1RUKL 4E0RB 4J2XA 4PB9H 2FSEA 3EDJA 2WB7A 5T3ZD 4NQSA 1SM3L 2OXHB 4HUXB 4XXDB 4FZEL 1S7WA 2XA8L 2DJSA 3LKPA 1YN7A 1TVHB 1T1ZA 2P5EB 1IM9B 4JDTH 4O4YL 4G9DB 4P46A 3CXFA 1ADWA 3BZ4B 4GG8A 4XN8A 4BRJA 2CJ3A 5AZUA 3VXRA 1F00I 3FN9A 2C9AA 4NRZA 3FAWA 2A7BA 1DFBL 5IB5B 4OI9A 3RWHA 3ZSTA 1BX2A 2CRIA 1F2QA 1T7YA 4XX5A 3KPSE 5HI5C 4F57H 5E70A 3ZUNC 3N41B 1ULVA 4LCIL 5H94A 3L3JA 5EU7E 1E40A 3X14B 3TPUB 1CZ8L 2FATH 3CN1A 2E74C 4XP4H 2BX5A 5I8CA 1SDDB 4CU7A 1INEL 1RMFH 4IEFA 2GTWA 3ME0B 1J0YA 4EVNB 3ZDXE 2ZOTA 4RFEB 3VO0A 1EVTC 2IANA 4UCFA 1NFKA 3MRHB 3DVIA 3IDUA 4JPWL 1KN2H 2WVSA 3HJEA 2ED6A 2HKFH 4HUWA 1L7IL 5F1IB 1QRNB 3D25A 4Y5VC 3RBSA 4IJTA 4IBVA 3M45A 3VXQA 4LSVL 5JQIB 4PJ7A 5FECA 2B3IA 1KN4H 3MUUA 4G1MB 3L45A 4HK3J 4P3DA 1ORQB 3EGDA 3QULB 4UQ3A 1PLAA 1G7LA 3QNZB 1FO0H 4V2BA 1J1OL 5KN5A 1D5BB 4QRQA 2CUIA 2DI8A 3O0RL 3NFPB 4PJAE 3W56A 4PS3A 5JHLL 3AG4B 4LLYA 4CU8A 4E5XA 4RBPH 2FX8H 4PJDB 1A1NB 4F8OA 5CM1A 3T2NH 1J0JA 1WBZA 2RJMA 2V6HA 1QFOA 4LAJH 2BOLA 1F90L 3PABA 3A67L 4K7FA 4F20A 3MLYL 5TE7H 2N0MA 3BWUF 3DXAD 4ODTL 4M4RA 5FO2A 3NJNA 3ZYJA 2BNQE 5J6GA 2ZAHA 3FYEB 1PG7H 4YXLL 1AQKL 2WLNA 4OFKA 3Q06A 1JXJA 1H3VA 1AKJD 2UVEA 5EEXA 4JFEE 4IMKC 4N26A 4ZPVB 5TDPA 1QFWM 3NQIA 4GRMA 2G3XA 1TFHA 3QORA 4LVEA 4N2KA 5GGSB 4X2UA 5HGGS 2PW1B 4HJJH 4XNUH 4J2QA 5KVGH 2V7HA 3ZTNL 5MEQB 1FFOB 4YSRA 3ZX1A 2G5RA 3I02A 2O5ZL 1QNZL 1T20A 3EJZC 2CG9X 1T22A 3RY6C 2DWEB 2B14A 2X4UA 4JFXB 1A6ZB 3L3GB 3TJHC 1YMMB 2F8VA 2YN5A 1EJ6A 4BGDA 1HS6A 3O2VH 2VM9A 3MV8A 4GAJL 4ZMWA 3D39B 3MCYA 3APCA 1S7XA 3PGFL 4KUCF 1JWMA 4YSPA 4PMFA 1M71B 3AITA 1YPZE 2OULB 3I84A 3WMQA 2WWMD 2NW2A 3CC1A 4HYTB 4XI5C 4EIBA 1KACB 1MWOA 2ORBL 2XQYK 3MCKA 3MRRA 4NN7C 2X4OB 4Q6IB 3NIDF 2ISDA 1XGYH 4HLZG 4FQ2H 3TOPA 4NQTA 4WUUA 2QKIC 5KVFE 4AQAB 4P3CL 1CB4A 1WISA 2ENPA 1FCCA 2DQTL 4BZ1H 3TVMC 3NJVA 3ZE2F 1DVSA 3HNSL 1CVRA 4R4BB 2N7BA 3NK4A 1UT9A 1AACA 3TPKA 3VFGL 1RZ7L 1JPFB 2AZUA 3HLAB 3HC0B 5IGXL 2N4IA 4X9FA 4JE4B 3AXLB 4QRAA 2N7AA 4OLUH 5B1JC 3QHFH 4LLWB 2XPGB 3N40F 5EIVA 4ZUSA 1CQYA 1E9OB 4NQQA 1I7RB 3CHXA 1DN0A 2QDWA 4HGKC 1BW8A 4JHUA 4ACTA 5I1JH 3ISRA 4KOBA 1ASPA 2AK4E 1L6PA 3MLZL 4HSAC 1BIIB 2V2WB 3H7BA 1ASOA 5JYMA 2Y22A 4GRLC 1OLZA 2R4RL 2EO9A 1QTPA 2GTZB 1HX0A 3LRSB 1MI5D 1ZV5A 5E99H 5K9JH 4KKLC 2WTRB 4Z76B 5BS0B 2HYMA 2QPEB 1T4KA 2ZSWB 3BJ91 1FL3A 4LB8A 3QIUD 1U8KB 4JHWL 5DEGA 4G6AD 4XP5L 2OCCB 2P8PA 5I1HL 4NBXB 4ZMPA 3WTYA 4FFVD 3SQOH 1EEZA 2FAUA 1HSAB 3JYBA 1LP9E 1T7WA 3DO7A 3BD4A 4UAOC 3O3AA 3B5GA 1HOCB 1HXYB 2K8QA 3ZJAA 3GB7B 2GC4C 3FQ2A 5K9QG 4EI5D 1N64H 2AQ2A 4XR8C 3FUNA 3HR5A 1HHHA 3ZQ9A 1G7IA 5FYJD 1CFQB 1QR1A 3H53A 5DT1H 3II3A 2BCKA 4FFWC 4HX1B 3U9PL 5L4MA 1QFPA 1ACYL 3HR6A 5D2NE 5F6IC 5HYSG 5E1AA 5F0MB 4XNXH 5J13C 3Q8BA 5CUSH 2NZ9D 1V5JA 2ZG1A 4NAQA 1FFNB 2X2JA 2H6OA 4R7NA 1KJMB 2BRQA 2QV4A 3HHMA 1J9TA 5T8IA 4XMKL 1IC4L 1DTUA 4Y5XC 1HHKB 5TQ0L 5I6XC 3REWB 5J11C 2V4LA 4J3OC 1QFUH 2J1KA 4XWOD 5DJXA 5JLZB 4WEBH 4NIKB 4KUZL 1G7JA 4B9CA 1HU8A 2OP4H 4S1SL 1I1AD 2C3XA 3FU6A 1QYGH 4K55A 3RHWF 5ADOL 1UB6A 2Y7NA 5EZOH 5HVHB 1AGDB 1IQDB 1P84K 1RHHA 5TDOB 1ZWIA 1WD9A 4YBQD 1M42A 4XH2A 1YEFH 1P4IL 3L08A 4PJCF 3T8XA 1PG7W 3GJEA 5AW5B 5GJTH 5E5LA 1RJLB 3IJHB 1R0AH 5IHUL 2KHAA 1FZJA 4HIXL 2HP4A 5FGBC 5DJAA 1FQ9C 1WUZA 4AIOA 2BNRA 3QQ3B 2ADIA 1W9XA 4OF3A 4W1TA 5DEFA 3X1BA 4LCWA 2Q86A 4OKVB 3F7QA 2O5YH 5FX3A 5HGDA 4LHJB 3OSVA 4MZRA 4GMSL 1UA6L 2X0UA 1NUDA 2H9GB 3KAAA 1AD9A 3QQ4B 1RK7A 5AOZA 2XY2A 5SWZA 2P8MA 4RCAA 2OCFD 4HXAL 3NCMA 2A0LC 2B1AL 4OQTA 3UMNA 1ZS8B 4ZZKA 4JL1A 5GRUL 1Y6KR 3IJEB 3MBWB 2WQUA 2N1KA 3TWCL 2E46A 4YR6B 4XO5A 2EH8H 3UYPB 1FNSL 2D7OA 1GGYA 5DHDA 1OAYH 3R06B 1P69B 2R2CA 3V8OA 4A7UA 2OFQA 5ECGA 2ARJA 1AE6H 1KXQA 3BVXA 2F08A 4OIIL 3LCYA 5J12C 2P5WA 4ZMQA 5GGUB 1RERA 1AHWC 2WBKA 3IBEA 3IDYC 3NSJA 4KX7A 1YEGH 2GBUA 4L18A 4NNPL 1EEYB 2YLHA 1KLUB 1WA1X 3BE1L 3V9EA 5CEZE 2BP8B 2E6PA 4ZO7A 2NQ3A 5FOJA 3QPKA 5B3SB 1JWSB 1UVQB 1GYCA 5KVMC 4TNWK 1ZGLB 3RWJB 4FXGA 4YHOH 1CBVH 4GAGH 5DEJA 3PNWB 2CE6A 1MRDL 3C60D 3QEQA 1LO0H 3MACH 1B4JH 3DSFH 3RVVD 1DJGA 1LNUB 4NXSA 1AS6A 5AOLA 1DCEA 4OZIF 4G1EA 2NY0D 2HKHH 4UBDD 2YZ8A 3W9EA 4ERSH 4JFZH 2VDNH 4L05A 2H32H 4A6YB 1GHFH 2ZKHL 4F8TA 3KZ8A 2AJYH 4N8PA 5GZNA 3GHEH 5I1IH 1VFAA 1WWAX 1JG9A 1OF2A 2Z91B 3FO9A 3BPNB 4P06A 4FJ6A 3GMLB 4PJXE 5CJOL 5L6YL 3LOWA 3GINA 2IV9A 4PGDA 1XF2B 5B7EA 4HIIA 3IFLL 2W07B 5GRJH 2AV7B 5MP6L 1I8KA 1LWRA 1CFNB 1NCWL 4NJ9H 4W68A 2V3DA 4W4NA 3TBTB 5DZAA 3NRFA 4HDIB 3NJLA 3VCLA 3ARGA 3QDGE 3DHPA 2AXWA 4N2LA 5AW9B 2VDMB 4NKOB 2FX9L 4HFUH 5MEOB 3KPSD 4GINA 5B3JE 3QQ9D 4HS3B 4IJ3C 3V4UL 2MCG1 4AJWA 1D6VL 35C8H 2I60L 5FYKH 3UAAA 3QIUB 2R2EA 2BVQB 3SKMB 1V3KA 5TE4L 3VFPB 1NDGA 3RBGA 1MH5B 3DVGA 5TPWL 1EAPA 3OF6A 3FTSA 3P4NA 4KK8D 4QGTA 3HG0A 4QXUH 1IBYA 1G6RH 3I3DA 3SE9H 4DAGH 1F6AA 3ARDC 1K8DB 2HRGA 4BA0A 4EI5B 5KTEH 3IXAB 4PLNC 3SEPA 4UT9H 5KSAD 1ROWA 4AQEB 2PP8A 3C5ZD 3DPBB 2D4FA 3GI9L 1WE5A 4MASA 5E9DB 2PWHA 4EKJA 1KYFA 4YHIA 1A47A 2X9YA 4GW5B 1CQKA 3O2DA 4OD3H 1YEDB 1MHPH 5CFHA 1L9TA 1PD0A 3ARBD 1MCOH 2VR4A 5D96B 5I24A 1XBRA 4J12A 4D0BB 2LLGA 2NR6C 3SDDA 4FJZA 2VDQB 4HUKB 4ODHH 4EN3C 6CGTA 3SZ6A 2F7PA 2Z31C 4XCNA 1JZ4A 5DQ9A 3OX8B 5IB2A 5D7SH 5HHOE 4AC4A 4LPCA 4J3OF 2RFXB 1WC7B 2YBRB 1KB5B 4OCYH 5LBGA 3DV6A 4NPJA 4X8JA 43CAB 3AWGA 3EYUH 4DKEL 1SDAB 3FOMA 1K72A 4JL2A 4NJAH 1I1AB 2FBRA 2BNQD 2E7HA 1IQWH 2G9HA 2XU9A 3PWPE 2EDMA 4C54A 1VZHA 4PLOB 1MIMH 4XBEH 4OFVA 1N6VA 2FWLB 2ZT9C 4GBXC 2CDEA 5DD6B 5CINH 3D69B 4MVBC 4LSDA 4UTAL 3DWTA 1HQRA 3U36A 1FFPB 4MXVF 2NSMA 4TS6A 5DJ6B 1HEZB 3QJFB 5AYTA 5C2BL 4XPFH 1CLCA 4W9GC 1ZHNB 3LQAL 3ALXA 4UTAA 1JPTL 5AW4B 3SY6A 2Y1AA 4LP5A 5J57B 4RMSA 2G0KA 1A1OA 3VGEA 2QQNL 4I3SL 5EO1B 3Q01A 2IGFH 4R96B 3UZEC 4Q2ZB 2LHAA 2HG5A 2V17L 3NIGB 3RPIB 3VFWB 1E8XA 4B9FA 2A9NH 3CTTA 3BWZA 3SIKA 1U3NA 3Q6GL 4FTVD 2EQDA 4MXWH 2J6WA 4YHYB 1CF8L 4TNGA 4LKXB 4BFIB 5JW4R 4BK5A 3VI3F 4I2XB 1G7PB 2YKLH 1WIUA 3TNNB 3ZE0B 4U1IA 1KNOA 1QEWA 5E2VH 3TTSA 1BMGA 4WHTB 1A8JH 1E7VA 5H37G 2BOBB 5JDSA 1A64A 3MRPA 2WQRA 1MLCA 4FZ8H 2PW2A 3KPRA 4MA3B 3FYIB 5GRZA 2VR7A 1SJHB 3ABMB 3P4OB 5FDWB 4LQFH 2WMPA 3D50A 1RV6X 2VO8A 5DRWA 2WXGA 1V3MA 3LH2H 4R90H 4UM8B 2IQAB 4OCWL 4A2GA 5HYJE 3QDME 2QHRL 1IKNA 1X4ZA 3B9KD 3G9AB 4A63A 4NZTH 1NLDH 3PPSA 3UIZA 2VE6A 4G8AC 3TCLA 4BZ2A 1CS6A 3F7VA 3Q1SL 3OMZA 4XCEB 4KXAA 1BD2A 4JR9L 2AK4D 5DYOB 4PCYA 1J8RA 5ERWB 1RIUH 4I48B 3S4SB 5HHQB 1A4CA 3C60B 4DPCX 4HUUB 4L3EE 5CBAB 3P3TA 1OAKL 1ACCA 2UWEF 5IK3A 3MGTB 2NY0B 2VYRE 1OCCB 2WLLA 5A3ID 4R2GC 1Q1JL 3QXUA 1CURA 2H1PL 2XQYA 5I1GH 4ZFGH 4Q9QL 2MHAB 1AFVL 1K8IA 2EDEA 4GSDL 4KKPA 5I5IA 1NIAA 3QJHB 1IMHC 3L5WB 4NPKA 4OCNC 4OAWB 1R46A 4FFZA 2EIZA 3F6JA 3EGXA 2VMCA 5GJSH 1KJ2L 5DFVD 1JNNL 2YJLA 1K6QL 4DFHA 4TYUA 4PEEA 2VLLB 2VXQA 2A73B 3VGAB 1MCPH 2XG5B 2AGJL 4R26H 5FXCH 2EABA 3VA2C 1S7TA 4AEIL 2WTOA 4U7KA 3RL1B 3X1NA 5CZXC 4YDZA 2EH7L 3GMPA 5AAPA 5GS0L 2OA9A 1NFDA 3G6AA 3GBNL 3K6IA 5F88B 2PPCA 1MOEA 2VITA 4NWTL 1D3CA 3KPSB 4QY8A 3U1QA 3DECA 1X5IA 1DFXA 1IVLA 1U8JA 2BVEA 4JB9L 5BNXD 1WPCA 4HJ0D 4DP4X 3ZL2A 1THAA 3N04A 3MOBL 3OKKA 5DRXB 1YLBB 4L0YA 3WKNA 4XHQA 2ZP8A 3BO8B 4TM9A 5J4MA 1RD6A 3ZDXB 1YN6A 4BYHA 5GZOA 2OMTA 2QSTA 3RVWD 1AIZA 5JUEL 4BFGA 4OD2B 1A9EA 5CLXA 5IHWA 1R5VA 4PBDA 3OLDA 3BP4B 4PVMA 4WCYH 5IJDC 5KSAB 2B39A 3PWJA 4K5PA 3X17A 3RAJL 5ICZA 5JMRA 3C5ZB 4ICWA 4L4TA 4U6XB 5C71A 2H2SD 3HB3C 1BLNB 1HINL 2CGRL 1O6SB 5E2TH 1I75A 1MRFL 4XVUD 3PFUA 5AL0A 3UPAA 1PIFA 1ZHBB 3STLB 1AMXA 1MW3A 4G43B 5HHXH 2C3VB 1JZIA 3GJFH 3MUGA 4PJ6A 3EFFA 5F6HI 3WXVH 1SPDA 5EDSA 4X5QA 4PJAB 2A6JB 3D5OF 1A5FL 3IT8D 3MBED 5GGQL 1KXVA 4YDNA 1NMBL 1H3GA 1UACL 2KC0A 1L9SA 2YIHA 5DCCA 1OZUA 3LD8C 2LV4A 5E5MB 1A7QL 3K81A 4OJAA 1EPFA 3P73A 1U8PA 2BNQB 3L95B 3KXFE 2FJGA 3A4DA 5KVEL 2EC8A 3R1GL 4NUPA 4ONGH 3UH8A 2MRYA 1RKRA 3EUDA 4RA0C 1U93A 2D2CC 3TBWB 3QC6X 2YSSB 2RALA 1MCWW 4LSPL 5FWQA 1I9IL 1PVHA 1YVLA 1I7ZB 2NY1C 4JG9A 4UZGA 1XDTT 1J8KA 3LRKA 3UJTL 3U9WA 4YSOA 1E9PB 3LH8A 3RNQB 4AUUA 3BKML 5KVDH 1ET5A 1N59B 3D9AH 1AYOA 4A1RA 2OSLA 1IZKA 2XWTA 5K9KA 2VC2L 5E5UB 3KDMA 5CEZD 4OZGE 5I8KL 3MUZ1 1ZANH 3K71B 4YO0A 1IGIH 2K7PA 1YPZB 2CDGA 4Z0BL 1DLFL 5JR1H 4ZNCD 3C09C 4FTVB 3W11C 4FA7B 3CFKB 4QOKD 2CO6B 3C9NA 1H9VA 1ZLSH 1J48A 3NFSL 4DP6X 4ZXBC 4FQIH 4IK6A 4NNXA 3D3VE 1TJGL 3OB8A 1R5WB 1VEPA 2IXQB 4K8RD 4PCKA 1KENH 1C16B 3BLPX 5D4QA 5T5NG 5IMMA 3GD1C 4U1JB 1HHJB 1I9JH 3RPKA 3FN0H 5KSBA 1S3KH 5L0QC 1NH6A 1NC4A 5J89A 1IE4A 3MNVB 3P2TA 2XY1A 3G6DH 5KW9H 1UQSB 1XCQB 2D2OA 3KW8A 3F7LA 1HT6A 1YYLH 3IE9A 2X6UA 3SDYH 2CCWA 4J1UB 2ILLA 3BLBA 1H8NA 4ODWB 2Y6TE 1PCXA 2HVJB 3IU4L 4WK0B 2WLHA 1JPST 1NMAH 3QFJE 2J57A 1PZBA 3J07A 2AJUL 4PRNA 2QTEA 1T0OA 4MB5A 3DYMA 2CIKA 3FQTB 3HS0A 4WTZG 1OIOA 4NEHB 2AK4B 2IH1B 5F7NC 4YHKH 3RY4A 2XACC 3SKNA 2ZUQC 2WYIA 3ZR5A 4GYBA 2NYKA 3WNNA 2X53A 3FU7B 4ANWA 1BP3B 1PNDA 2ZPKL 1A7RH 1P4LB 2WNXA 3BSGA 1X5JA 5J9PB 3ARUA 2F5BL 4OQTH 4I9WE 1P7KA 1O6TA 2X9ZA 5HYSB 1RIVL 1NEZG 3K5RA 2X1WL 4PP1D 5F89A 3HW7A 4C56D 1FFRA 1KCRH 3P9MA 3CDCA 2EACA 3P0GB 1Q0XH 3QSKB 4XWGH 4F8QA 1SVCP 3GBML 3EYQC 4DP2X 3FRUB 3WN6A 3LKSB 2F54A 2HT4D 3MRGA 5I71C 3DX8A 4O00A 1VKXA 1LP9B 4A2HA 2KL6A 1PZUB 1I3GL 1QSFA 1V55B 3LV3B 4FKHA 3KYKL 3TZVD 4NCC1 4XXCA 4DUVA 2ATPA 3GPSA 1TVBA 5DC2A 1RZGB 1Z9SB 5HDRA 1DZBA 4X4YB 1ZT1B 4J4PD 1QFWL 1HVXA 1V05A 1SXZA 1TTFA 4PJ5A 4IRSC 3FB7B 1GGIH 4HEME 4P46C 5F93C 3ZIMA 1VGEH 1ZE3H 1J10A 3MXWL 2GG1A 4XP9H 4TVUA 2CKBL 3OHMB 2BP0B 2TRHA 4JG1H 1E5CA 3HZ3A 4PRBA 1GGCL 2JI3A 5KS9E 2QVIA 4MD4B 2BMKB 3FJTA 4NKIH 3VYPA 1RZFH 1M6UA 5HHOD 5E2JA 5I26A 1PD6A 3WY4A 2CKBA 1G9HA 1AP2A 3ECQA 4N0YH 1W0WA 2ZUTA 1M2VB 1E8YA 1PIGA 3HZMB 4PRHA 4ZSOE 4UQ2B 1YEKL 5KZCB 1G6VK 4Z7WE 1OT1A 1LK2B 4P5MA 5FC9A 3B9VA 3PWPD 4EZLA 3RJQB 4Y19E 1CLOH 5T1KD 2W8CA 5T1JA 3BUYB 3UC2A 4LT7A 4AM0A 3EXJA 1WGOA 1XCXA 1H8SA 3N40P 3PAYA 4OF6A 3U7YL 3GKWL 3GBDA 1D2PA 4X7EC 3RA7L 4U1LB 3S36L 4DVRH 1ONQB 4N2EA 1KCBA 1BVLA 1DANU 4LHUA 5CP3A 4KMTL 5AKRA 3VXPA 3PQYE 4Y4HA 1QBAA 4YIQA 3L4XA 3QYCA 3MBEB 4P5RA 4PPTA 4RMBA 3FFCA 4ORGB 4WSKA 4PWEA 3SBWA 1UURA 1DEDA 1W8NA 3OHXB 3P30H 1ESOA 3REVA 2YPLB 4H88H 4RDQG 5B3NA 2EDOA 2EEDA 4G6ML 4NAJA 4AEEA 4CMHC 1Q94A 1VACB 4W9CC 1KYUA 2I60H 3P9LA 4IOIB 3G7TA 2NXZD 4LLAA 4XN1A 3MRFA 2B08A 1K5WA 3VAEA 2X4SB 5C0BE 3ETBJ 3HMWL 2ADJB 1OM9A 2FH8A 5IROA 1S9WB 3CFBB 3ALPA 1Z3GH 3WENA 4DN3L 1U8CB 1MG2C 4B9KC 1SBSH 1CE6A 2IH3A 4XN4A 3MCLH 2CUHA 3AT0A 3ETSA 3NIFE 3QORC 4P59L 3O2DH 2O6DA 1DEEA 4GEJA 3HRZA 4K71B 3IJYB 5HYJD 3QDMD 3Q6FB 1KELH 3IRZA 3NCJL 2MPAL 1NCOA 1E4XI 2DBLL 3VI4F 3U83A 4M7ZB 2IPKA 1UKTA 4QOKB 1Y0LA 5HDOA 2Z4QB 1IBFA 1Q0YH 3UC0A 4IU2B 1RJZA 3PLYA 3MLRH 4YSAA 5KBNC 3K8MA 1OM3L 3VDAA 1KDIA 2OMZB 2V9UA 4N0CD 2Y25A 4MX7B 5E6IA 1LHZA 3VDCA 3FHAA 4L3ED 3S96A 2O61A 1A6TA 2C1PA 2EE0A 4JY5L 3A6CH 3B37A 4M1DH 2FO4A 3X3GH 1KCVL 1UZ8A 2JNZA 2WBJA 3A23A 3B6SB 2XV3A 1DQTA 2APWA 3JV4A 3RU8H 4F27A 3G5XA 2JB5H 3RJOA 4H2AA 5EH1A 5I76B 5KYUB 1S7VA 4RIRB 2SEBA 4BQ9A 3HZVB 4E9VA 1I3VA 4Y2DC 1MJUL 3ULUL 1AY1L 1LO2L 4GXFA 3CDZA 4PJXB 5L2KA 5I1DA 5FA3A 3MRKB 1AKPA 4WNQB 4I87A 5HXMA 3FO1A 2XWBA 5HI3D 1TZHA 3K2UH 4M1CD 2HSIA 4UMGA 3K8LA 4O9HH 5A40E 3N85H 1LWJA 4NPYB 5DZJA 4ZFFA 2F8XC 3FTGB 4U1KB 3L4WA 4ZPTB 5K59E 1J8HA 4K15A 5FHBL 5FYJU 2Q8AH 4XO4A 1SHSA 4RRPM 2WAHA 3ARSA 4R0LA 5DJZB 2YC1A 1XSJA 4JPKH 1XAKA 1HHGA 5T33L 1YQ2A 2P7TB 5JHDE 4C56B 4KV5E 2DJ4A 2FH6A 2Y5EA 4GEIA 3D0LA 4KGLA 5FO7B 5CEYA 3DIFB 5IWLA 1G43A 5EZIH 4M61A 4GFXA 4NFCA 3UP1A 2YXMA 2E76C 5FUZL 3WSQL 2CLVA 2VSKB 4LESA 4RZCA 4N8VG 4O2CA 5FGSA 2EE6A 3T65A 4GUPB 1IIIA 1TXKA 3TZVB 2BOCB 4XTRC 4P2OA 4XBPB 4AGPA 1ZTXL 3MMEB 4MJ6A 3T6WA 3L3KB 3UTQB 1GL4B 1OE3A 3AY4A 1CGYA 1AC0A 2WC7A 3BMWA 2VL4A 4WAFA 4CVXB 4FULA 3AU1A 1A22B 3RWGB 4BZ2H 2VR5A 2K8MA 1RSYA 4X6DB 2ICWA 5D1ZA 4AIXA 1UA7A 2JJSA 3R19A 1KLFB 2JCWA 4A04A 1PD1A 2RHEA 1RFDH 4ABQA 1T2QH 2A99A 5GSVA 4N2NA 1I8UA 1F58L 2NX5E 3N43B 5HHOB 4BH7B 3NH7L 2R0ZH 4JUSA 1JYNA 3W82A 5MENE 5DMGC 3SKOA 3V5KA 1SF5A 1UUSA 5GSRA 1DVXA 5AOKA 4M00A 2X5PA 4ADIA 3GRWL 5FAAA 1JYWA 4YHPA 4UB0L 1ZXKA 4QHMB 4OLWH 3QFDA 3WY2A 1IM3D 3OWRA 3PWPB 4FFZH 5IREA 1IGJA 3KXFD 4APQA 4NCC2 2PPFA 5T1KB 1GPOL 5D7LE 4R5VA 2VXQH 3PWUB 1GJIA 4HXBL 4F7KA 3RIFK 6FABH 5F7EH 4AWJC 4B0MB 5DJYB 5IQ9A 1TR7A 5F1OB 4G8IA 3TVMB 4FQXC 2I9LA 3BC9A 3FRPG 3TJPA 5AOMA 3CSTA 5KYXB 4ZAKA 3ZE0F 3P69A 3EYFB 4AZUA 1BAGA 1FAKT 3WMSA 1DBJH 5IVZA 3VRLF 2EIJB 2D73A 3RUGA 2QADD 5I6NA 1Q9LB 4G7YL 3L4UA 3NN8A 4PJEA 4M8UA 1CT8B 5IV2A 3VSUA 1TZIB 3I6KB 3T5WA 5IQOA 4R4FL 2WWKO 4X5XB 4H0IA 3QUZA 1T1XB 1S5HB 5CS7A 4O2FB 2W0FB 4BFNA 4Z3EA 5DYFA 2FZ3B 1MAJA 3D3VD 3MOBH 2EIMB 2NXZB 1MLBA 2IG2H 4A7GA 1FGVH 1PSKH 3DJTA 4X6EA 4AV5A 4MA8L 3Q8FA 3LN4A 1W80A 4S1RL 3F58H 2W9EH 5LGJA 2GFBB 5KBMA 3S8GB 1PAZA 2W0PA 4PJ8A 4LLDB 2VLRE 4FHBD 4MMXB 4PRIE 4GP8B 5EMYA 3AS3A 4HKJB 4TRPH 2QQLL 1OTUD 5HYJB 3HG3A 3QFJD 3QDMB 5D2LA 3CH1B 1JHKH 3V6OE 1FDLH 4QKTA 4FCAA 5FEBA 3QIBA 2CJUH 2FX7H 3LPFA 3RWDA 4NENA 4PGJA 2OAAA 4LLQA 4HS6B 4NI6A 1UB5A 4AUJA 3M86A 1DVQA 4L3EB 2Y07H 5JXAL 3NZUA 2G4GA 1ZE3C 1S7SB 2WWKT 3CFUA 4FI7A 4HCFA 5I8OL 4FXGC 1R3HB 3TS8A 3F7RA 3LKOA 1NTDA 4I9WD 1E27A 2VXSH 2BSTB 2PCYA 2HLAA 4L1SA 3DKHA 1OARH 4UAHA 2FSDA 1AQMA 3V55A 1U30A 1M1XB 1LDPL 4E36A 1GMEA 1MFMA 4K5LA 3T6VA 5A2KH 4X5LA 4X4KA 1PG7X 1B9KA 3GTVA 3MAWA 1OE1A 1QPKA 4YE4H 3P40A 1ZJAA 5J11B 1UXWA 3ASOB 5CMAA 3V0WL 5ID1A 1H9DA 5EU3B 5BV7L 1YNLH 3TV3H 5HDWA 3PWVB 3FQRA 3GK8H 5BCAA 3V2AR 4TUOA 3IJ8A 3ZDXF 3OGOE 3C8KA 3BAEH 2HFGH 3IAQA 5D1XE 4OLVH 1F1DA 5ICXB 3UYRL 1V7ML 1MCRA 2GAZA 4R4ND 3B2PA 4QF1B 1LEIB 1RZPA 1TVDA 4FA6A 1QHQA 4ONHA 2OZ4A 3GSWB 2ZOWA 3HI1B 1P7QD 4Z0BH 4KPHL 3FQUA 3HBZA 1QA9B 3ZE1E 4UZSA 3P77B 1U3HC 4TN9A 4F33B 2WYTA 4LBAA 5E9AA 3KLAB 4RISH 1ML0A 4M3KB 2YQ3A 4I77L 1C5BL 3HUJF 2I85A 4U1HB 1E9QA 1NCBH 3KH4A 3N5AA 2IAMC 2PR4L 3MUY1 3L13A 3H6AA 1IIKA 4UDUA 3U4AA 4HWEL 3ILDA 4XC3H 3TYGL 5EU6A 4YMPA 5D8JL 3UBXI 2IOOA 4Y19D 4U1GB 5T1LA 1IAOB 1S78C 5LWYH 1DBBH 3NJFA 4PJ9D 1RP8A 4F7CB 2R9HD 1AZCA 3GO1H 5I16B 3WJLC 5EEWA 3D2UD 2M26A 1X9LA 5G5DB 3UTTA 3E80A 2PTUA 4MQXD 2J4WL 1YEEL 5GGVL 1KMGA 1TJIH 3MO1A 2MCPL 3PQYD 1RU9L 1JF5A 2JCCF 1IEBB 3D87B 5HY9A 4AZ8B 3RB7A 2P44B 5E4EB 1AI1H 1MW0A 3ISWA 5ANMB 5K39B 3GSUB 1KSRA 1ZA6B 2XT1B 2OSXA 2ZICA 3DURB 4O51A 3SDDC 2GITB 5FF6B 2EYSA 3IAGC 1HFUA 2UV3A 3BAWA 3MJ7B 4YSUA 4YPGA 4GKLA 1IM3B 1NCHA 3KXFB 1ZV2A 4YXKH 1JFQL 5C09A 2Q76B 4XCYA 3HS9A 4K9EL 1IZJA 1KZQA 1R6VA 1LDSA 2FQDA 5L88L 1C5CL 4YXHH 2X4PB 3ZU8A 4E9SA 2OTPA 3EIFA 5CF3A 3JWNE 1UD5A 5TQ2H 2EDHA 2VDKL 2L4OA 5DHVA 4LKCA 2E8YA 4OFQA 2HPTA 2QEJA 3G5VB 4HZLA 4QTIH 4WUUE 2QADB 1GZPA 4OZGB 3EOBB 1NOFA 1ECZA 3ILPA 3OMNB 4DKFH 2FWUA 2Z4TA 4DP9X 2MEJB 1DL7H 2BH0A 1NMCC 3EOYG 1XEDA 3D3VB 3V4VB 4J6RL 1MNNA 1OE2A 4AMKH 2WXFA 3O81A 4UM9D 3ZZLA 3ARYA 3AQDA 3BUIA 3HE6D 3HZYB 3Q48A 3OL2A 1BZ7B 2H4EA 4L3CB 3B3IB 1FO0B 3GIVA 5E8PA 4RNRB 4RA3A 3NTCH 1INDH 4XX1E 5DO2C 1NEZB 4NO3A 4ZI8A 2AMUA 2VXTH 4S0TD 5IMKA 1MCEA 1EERB 3MQIA 2I7SA 3DRTB 3QFJB 1CR9L 4OZFB 4HCRL 5E7BA 3L2LA 5CJXA 5DUPH 5HJGA 1AZRA 5CCJA 4ZMAT 4R97C 3TP4A 1HHIB 4Z7UF 5KJ4A 4KHTH 4DFIA 1M05A 4HCRA 4LVOB 3CFJA 5BQ7B 3AGVA 3CVIL 3QA3B 3S48A 3NACL 3LQZA 2HJKA 3MA9H 3PUCA 2YGPA 2XHNA 2G2PA 2XN9A 3C2AH 3NFNB 5AYUH 1AC6A 1F4XH 1I1FA 1TTGA 3ZBMA 4ZTPL 3PIQA 2J5WA 3UTOA 4X4ZA 3ZRCC 3UBFA 4XX1G 1PFCA 5B1CA 5JHDD 1NLBH 1HWWA 5IBUG 2BWIA 2F1EA 1CXIA 3KLKA 4WWNA 4H20H 1L5GA 2WUBL 2KH2B 2KZKA 2H1LM 2Z31B 2OMNA 3NP4A 3WIIL 2J12B 4X83A 4CADA 4JVWA 1QVOA 4H44C 3CD4A 3LZQA 2JJTA 3QE5A 4L37B 3BP6B 1A7PH 3KGRA 2JJWA 4FNSA 2NSQA 1XGRA 2CM6A 2QGEA 3CMOH 3JZYA 3FU3A 4H5SA 3IF1B 3AUVA 3G5ZA 2Q7NA 1CLZL 1Z0MA 1KFGA 1CGSH 2V3FA 3C6SA 5C0AA 2Q6WB 3QJTB 4XC1L 4NO5A 3VD0A 4U6VH 5F70A 4MCZA 5GGRA 4QJ5B 4PS4H 1FL6A 3L5XL 4M7LT 4OFIA 3SE8H 1FZOA 1KBKA 3S37H 3EGSB 4LRNL 1V7NL 3WE6A 1NCNA 2YMXL 2ZG2A 3KPNA 3UC0H 4WSGA 5JOPD 5EOTA 1P7QB 4HETA 1AXTH 2DM4A 4L8DA 3DGDA 4ZQKA 4G11A 2HT2C 4GO6B 4K7PH 2NX5D 4JW3A 4A68A 1F1GA 5HHPB 4WFFE 2FECI 1I9RH 2LU4A 4C4BA 4U0RC 4XBGB 4MMZB 1XSIA 2P9RA 5EO9B 5KANG 2OJ1A 4RX4D 1KBWA 4ZSOB 4K23L 3I50H 2B0SH 4HV8A 4GSQA 2YA2A 4FQQA 4Z7WB 1YEHH 5PCYA 5KBDA 1Q9KB 2JLLA 4JPVH 3OXSA 4LAQL 1JERA 2WD0A 4M6ML 1KFAH 4Y19B 3WFBH 1N3NB 4PJ9B 3KCPA 1NZRA 2X42A 5DMKB 3HHSB 3B9AA 2ZXDA 3D2UB 3PP3K 4NRYA 2XUWA 4R7DB 1RI8A 5FYKD 2WSPA 4Q52A 3DMMA 3PQYB 1BVKA 4TUJA 4JFWA 1AQ8A 1S3RA 4NQCA 2I07B 2GUOB 1SUJA 2BSBA 2OI9B 3L4TA 4FF9A 4M62H 4U6YA 5DK0B 3PWNB 5H4ZA 3N1QC 3MRCA 1JRHH 4ZX3A 4Z78B 3AAZA 4N25A 1KXQE 4F80A 1CFSB 3J2PA 4Y9BA 3OAUL 3FB8A 3O9WD 4GXVL 2AI0L 1A6UL 1KXVC 3SGEI 1KTKE 5D7IA 4OB5L 3EW3B 4KY1L 3WBDA 3IMWA 5HHNB 3EFOA 4MZ3A 5I8EA 1I82A 1ZA3A 3OC8A 3S3DB 1I8IA 1FGNL 3KMDA 1LL1A 1BXXA 4R2GB 2VMJA 1ANUA 2GBTA 1A3LL 2WQ8A 3HKZA 2VLRD 4YE0A 4PRID 2FJHB 1F4YH 2Z92B 1Q8MA 4MAUH 2JE8A 4AGMA 3QEQE 1VERA 2DMBA 1JGLH 4EE2A 3IGUA 1SEQL 3NIFB 4F2FA 1ZTXH 2Z6FA 1IGML 2GJ6A 2DQIL 3GMOB 4X98B 4E41A 5LQBL 1AGCA 4CVWA 4FXKB 3CN3A 4XB3A 1X5LA 3WXWH 3UX9B 2AXGA 1WZ1H 2YOCA 1OEZW 3WEXA 4ANKA 1RK0B 4RMRA 4PGEA 1JDDA 2QBWA 2WIIA 3BAXA 4P2RE 3BQUC 1AXSA 3GS0A 5PAZA 3IDJB 3CX2A 1E6JH 1WAAE 4FABL 4ELMA 4JG0L 4M7KL 4UM9B 3HE6B 3BX7C 1SJMA 3P2DA 5B39A 4FNLH 4AG4L 3FT3B 3OQ3B 1MUJA 1OXYA 4JQIA 3RX5A 1P6FA 3G04B 2P8LA 3MTXA 4Z77A 3TBCA 2XFXB 4AT6B 1U42A 4Z7AA 3U82B 2VN5A 2JKLA 2W0LA 3HG1E 2A9BA 3M88A 4F93B 5IP4A 1JZGA 1V54B 3AU0A 2DQCL 3WFDH 1WIOA 1AO7A 2CHXA 2MIZA 4ZOEA 1T5WB 4PN6A 4KZCA 1HKLH 3GUFA 4KXCA 3R7RA 3GLDA 1CF1A 4YFDB 3O45A 3ZZ1A 3T8MA 1JF6A 3JSSA 3UJJL 3K72A 2VW6A 4AGQA 5IW6A 1JZEA 5IKCA 1HCFX 4X9BA 4JKPL 1BM3H 1JHLL 1TT6A 4X99A 1X5AA 5D1XD 3QO0B 5IIEB 1BFOB 1KV7A 2IAND 3WFHA 1AGBB 3KVQA 4MQ7B 3NRPA 4G7SB 1R47A 4PWGA 2EIDA 1JSYA 3PHQA 3EH4B 4S11A 3T1FA 3WN5B 4QXGH 3QUHA 4OJYA 5JHDB 5CCKH 2XKUA 4MAYA 3V9FA 5IQMA 4X8XA 1N8ZB 3LB6D 3RLSA 4X4ME 1B4RA 4MDIB 2DIAA 1NGXB 3CX5J 2XTJE 5GGVY 2FLBT 3HVDA 4DVBB 1SMAA 4KK6D 3MLSH 1JXFA 1EBPA 3QWOA 2E7LA 1CXEA 1WT5A 2J21A 2DKSA 1I4FB 1CN4A 1QG3A 3SDAA 3L2NA 3L1GA 2VKXA 4JFOA 2LLLA 1IEAA 2EEXA 2XSKA 4OCSL 2FEDD 1WAEA 1XIWC 4LSSL 1IC7L 1K4CA 2DJUA 2AQ1A 1F18A 2AAVA 3CZFB 4FQJH 2DQGL