5LBSA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
446
structure length
394
Chain Sequence
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHDENRAKVEITPNSPRAEATLGGFGSLGLDCEPFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGGSWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Immune system-viral protein
molecule keywords envelope protein E
total genus 79
structure length 394
sequence length 446
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbsA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbsA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbsA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbsA03
3P54A 1OKEA 5KVEE 3WE1A 5KVGE 3UZVA 2HG0A 4UTBA 5JHLA 4UTCA 4BZ1A 2JV6A 5KVDE 3J2PA 4X42A 4ALAC 5IZ7A 3C5XA 3N44F 5H37A 3UC0A 1TG8A 3IRCA 3UYPB 2P5PA 4FFYA 4GSXA 3VTTA 4FFZA 3UZEC 3N43F 1SVBA 5GZNA 5B1CA 2R29A 3I50E 1RERA 4UTAA 2V33A 3N42F 3UZQB 1PJWA 5LBSA 5GZOA 3UAJA 2R69A 2H0PA 1OK8A 4L5FE 3C6EA 1Z3RA 3N40F 5AAWC 5AAMC 3G7TA 4AL8C 1S6NA 5LCVA 5JHMA 2JQMA 1URZA 3J27A 5KVFE 4AM0Q 1OANA 4BZ2A 5IREA 1ZTXE 1UZGA 2ALAA 4FG0A 4UT6A 1Z66A 3MUUA 4GT0A 2JSFA 5LBVA 2I69A 4UT9A 2GG1A 3N41F
chains in the Genus database with same CATH superfamily
5AVWB 3NUKA 4FLOA 1I7TA 5JORB 4F37K 3NJIA 5CN2A 1C5CL 4NCC1 4YSAA 4GW5B 3FQNA 4XC1H 1LMKA 3EGXB 3KPQB 2C9PA 3IDJA 3L08A 4J3XA 1N26A 2XWTB 2BVTA 5C0AA 1NFIA 5LWYL 1UA7A 4YH6A 5DHDA 4F37F 3G08B 2FB4L 4Q9BA 4MJIB 1FG9C 4G7SB 4OJEH 3VVVA 4U1KA 5C86A 2JH2A 2Q2LA 4UM8B 3RG1C 5AVVB 2K4AA 5HHME 3EJZC 2VR7A 3V6OA 2TSBA 4R3SB 3S34L 1JF6A 4ZAKA 3DXAA 1N6UA 1BAFH 3OKMB 4D94A 5FPIA 5J13B 4MB3A 5KS9A 1DEEB 2X28A 2CK0H 3S36L 4AYSA 4X6DB 1SN5A 3EXJA 3CTTA 1RK7A 4NSKA 4JCMA 1D6EB 4M48H 5FOBA 5IVOA 1KGJA 2Z0UA 3FUEA 4L3CB 4MLIA 4HCFA 4WNQA 1JTTA 4AQOA 2O6FA 4Q74A 2HVJB 2WLNA 2G75B 3H7BB 4YIQA 5DGRA 5GJTL 3VH8B 1HHHB 2NNCA 2B7DT 1D3CA 2VJXA 4AVIA 4PR5A 5C0DA 5MENE 4WO4A 4AY0A 1JVLA 3QEUB 5FHBH 4DKEH 3IDXL 3SPVB 1OAQH 2EDEA 4N3TA 1DFBL 1N59A 3HHSB 5CN1A 1G6VK 3FUIA 4MB4A 1OF2B 1NAML 4JBSA 3WXWH 4N0YH 3MV8E 3ULVD 3HI1A 1FQ9C 4BH7A 3RWDB 1MH5B 3MROA 5FCUL 1XSIA 4M02A 1JK9A 4JO3L 4PG2C 4AYEC 2MPVA 3ASOB 4QR7A 4ICWA 5EU7E 4RMUA 4YXHH 3ZYOA 2Y1AA 4DP2X 4K9EC 4K23L 4N20A 3QUMA 5CJQL 5LBGA 4DAGL 4P2QB 2Q10A 3P9LA 2PMZA 5D7HA 4L4VB 2RCSL 2LLLA 1TU2A 5C0AD 5CJXA 3GRBA 2J5WA 3VXMD 4LEXH 3MRBB 1XIWA 4Y2DB 4PJ9D 5KSAD 5IFAH 1OE3A 4Z7NE 1YLBB 3JTSA 1HJBC 3B6SA 4FNRA 1ZE3H 3QNXB 1Y0LB 1E28B 1M7IA 3GSXB 2CHNA 3OVUB 4J8QA 3ARUA 1ZT7B 1TTAA 4YVUA 3ZTJG 4YHLL 1DE4A 4ILDA 4KO7A 3LYRA 3V10A 4A7VA 3CH1B 1INEH 1QP1A 4OKDA 2Z65C 3QQ9D 4QYOB 2F58H 1BZOA 1KGXA 3V52L 1O5DT 5A2FA 4HW6A 3CQQA 1W0WB 4JDEA 1ZT4A 3ESNA 1KCRH 4PJAE 4GG8B 3BVVA 2BY3A 4KVCL 2WZPA 3UTTA 3NP4A 4GLRH 1A7OH 1Z5HA 3QFDA 4G9DA 1GC1C 3MYJB 2WLIA 4MLSA 4OB5H 3TCTA 3TVMD 1KJMB 1CD1B 2N7AA 4IRJB 4NUJB 3N42B 1OCZB 2B9AA 1JZ3A 1AMYA 2UX7A 1MW1A 1GYVA 3JWNE 4TNVK 3V4PB 3LQZB 3PY9A 2XKSA 2GEQA 5F9JB 3EOAA 1A4JA 1DSYA 5G5DB 5FF6A 2VLJA 4X4MA 4FAAB 3LZQA 4RMWA 1ID5I 3QZPA 3RY6C 1OE1A 2X9ZA 3V2AR 3LIZL 3AGVA 2ZAGA 3BEVB 3ILEA 4JO8A 3RTQB 4PV9A 3ULVH 3QEHB 1G5GA 2BO0A 2HLAB 2Y72A 2QLVB 1CICB 3BH8B 2Y7OA 3FO9B 1HCYA 3BO8A 4ZTPH 3PQYD 3P30H 2XN9E 4PRIB 3WEXB 2P44B 3CDZA 5HHXH 3EUDA 3F64A 4P3DA 3N43F 2KT6A 4N2HA 4P2QD 3S37L 5E4EC 1R17A 3M17B 1FO0A 4JRYE 1GW6A 5FYJD 3S3CB 1PX3A 2DEXX 3ZE1F 4N24A 3M8OL 3LXAA 3MJ7A 4Z76A 3U7AA 5IB5B 3U82B 2HVKB 1IZKA 1HEZA 4ANKA 1T03L 4LCUB 1EZVX 2WUBH 4PJBF 1P1VA 2I27N 2QVFB 3FSZA 5IMLB 4HJUA 4NDMA 4P5TD 5CD5C 1HYSD 1RZFL 1R5VB 1RH8A 1U9KA 4JRYA 5DJ6B 4HS3A 1KIPA 1U4FA 2HMID 4OKVB 2J12B 3Q6GH 4K7PH 2RA1A 3STLB 5AB1A 2H0PA 4YDZA 3WE6A 4AENB 4JM2A 4NAJA 3PWJA 4UT9A 1K2DA 1QSFD 3BT2H 3PHQA 4GPVA 2C3VB 3GBML 5EPMB 3EYUL 4WTXA 3QUXA 3SYQA 3VNZA 5GRWA 4AGOA 2C9QA 2O6PA 2Y07L 5G5DA 3ML8A 2IWKA 2ZCLL 4N2DA 3QO1B 4U7SA 1P4BL 4A7UA 2IH1B 3TIDA 1BDYA 2XQYG 1JHKH 3OWEA 5BJTB 3ULVE 2J5LC 2QSCL 2I9LA 4LP5A 2J1WA 1AIFB 4U1IB 1G9NC 2A2QT 2XICA 3F2LA 4NRZB 1QW8A 2KPWA 3TLRA 1CFVH 3BD4A 4JL2A 3BZDA 5EEVA 4HLZG 2C1OA 1MQKL 3E0GA 2GJ6D 2MQ3A 5A2BA 5HDBB 1LO4H 2NR6D 1J9TA 3K4AA 1GR7A 2VT0A 4Q2ZA 1FYTA 2YXWA 3UO8B 2CWRA 1J0ZA 1HTYA 3KNBB 4GMTH 4OCRH 3UIZA 4UIKH 3U4AA 4Q4EA 2H47C 5DJXA 5CGBA 5E2TH 1MRFL 3PAVA 2KLTA 4KI5C 3K0YA 1DJHA 2DYPA 2X2YA 1SYSA 2GI0A 5DWPA 4ODVH 1VF5C 1I1AA 4LLMA 2I69A 2LABA 1LP9E 1JV5B 3MMEB 4HJ1A 5L8JB 1CC3A 3I02A 5LQBL 4RVBA 1DN0A 4MMXC 2DH3A 3KBEA 2OULB 1A1NB 1Z2KA 2Z93A 4MQTB 2EEDA 2XG5A 3M88A 3SKMA 2NY6D 5LGHH 2JTDA 1T0MB 3VM5A 2CLVB 2ZKHL 4I77H 4OGXL 3QPKA 3ZUCA 4FXGA 4U3SA 3MV8A 4KK9D 4OT1L 5EBWA 3AS1A 3PWLB 2MMXA 3FTGA 3UTZA 3VFMB 1J0HA 3MAWA 3O3BA 3C6LA 5FYKL 4FABL 1LWJA 2ED6A 1FG2A 3P9MB 4KXZH 5EULV 3RGBA 4PJXF 2OYLA 2KLSA 3GLZA 4U6XA 3C60A 4BHUA 4PJXB 2NX5A 5CCGE 2HUEA 3Q2NA 3EJSA 5DD1L 5DGQA 3HKFA 2CLVA 4G11A 5KJ4A 5IJKA 1N5YL 3US9A 2IJ0C 2PTTA 3D39B 2OP4H 3KPMB 4N2AA 5A2CA 1Q9OA 1XV8A 2NY5L 5AKVA 5T5NG 3MV9A 2HH0L 3V6ZB 4JUTA 5MHSD 4QHNA 4DVBA 3KPSB 3H55A 1UB6A 1UWXK 4XPBL 1UFUA 5EHFA 4F2EA 3GSRA 5BQ7B 1D5IL 1EV2E 3SQBB 4M9OA 1B4LA 3MNWB 2CRMA 4WCYH 5FUZL 5ALCH 1QNIA 1CMOA 1FLTX 2XTJE 4ERSL 2D9CA 2R2HA 1QLEH 4Z7WB 2FJSA 1J5DA 5DJAB 4BFKA 1AQDA 4EXPX 5MHSE 4QRPD 5GRJH 1SYVA 3A21A 1X4YA 2OI9C 2HG5A 4PCKA 2BIOA 4MXQD 1PBYA 2DM3A 1ZHKA 4AGLA 1MLBA 3PJLA 3QH3B 4YMPA 5FM8A 4D8PA 4EF3A 3NIDF 4ZUVB 4QO1A 1MCSA 4N25A 3SZKC 2ORBH 2YAMA 5B1BB 1JPTH 2X87A 2Y7QB 3B5HA 4YX2H 1X5LA 2OYPA 3GZOA 4LLQA 2RJMA 4ZDHB 1MRCL 4OFQA 2VH5L 4HMDA 2VZSA 2XWJB 4KKCD 2VDQB 2NQ3A 1A6UH 2GSGA 3D52A 4L8BA 3MPCA 1KTCA 3D1MC 3HC3H 4AUJA 3UTZB 3SDDB 3IDYC 1X44A 1ZANL 4GXUM 1F6FB 4IIQB 3WNJA 1KC5L 2W07A 2F68X 2BP5M 4MXQC 4ONGH 1G0DA 3HG1B 2Z92A 4H20L 4X99A 3TT3L 1F4AA 2WXMA 3UTQA 4L4JA 4K9EL 3N43B 3U1PA 1YJDH 3KEDA 5DK0A 4IOIB 3H6JA 2IPTH 1F3DJ 1UCBH 1F4YH 1XH1A 2OMXA 2QSCH 3HE6C 3Q9PA 4XRCA 4DOHB 5KJ7E 3KW8A 1JGVL 4RDQF 1EO5A 3QHFL 3QK0A 2DLHA 2WXHA 2E74C 5I16A 1IC5H 2B16A 3KYKL 5DJZB 3ZHLA 4N87A 3VXOB 4XXWC 5F93C 5J11B 3KBFA 2A83A 4P4KD 3AG2B 2YK1L 3EUUA 4UBDD 3POHA 1YMHB 1YSOA 4DFIA 4RFNC 3ARBA 3D33A 4GKNB 4M6NL 4PLJD 4ZS7H 1TYJA 5F72S 3VW3H 1YEKL 4M6ML 4JGJA 2B5IB 1KLFB 2QQLH 4G6ML 2NYYC 4G6AD 3FBQA 3MRDA 2RB8A 1TQSA 5TE4L 5D4IA 1V05A 4K7PY 4QRUA 5E95B 4MDRA 5SWZD 3S6CA 1KNOB 4QXVA 5EUOE 5EBMA 1LO3H 3T1WA 2W0PA 5HGHA 1EFXB 3TO2B 2V5RA 4P2OD 3NYKA 1ZTXL 1EGJH 3O4OC 3OB0K 1U2CA 1S7QB 3ZT5A 1BAFL 2XXCB 2DDQH 2PR9A 2H2SD 3F12A 4GNKB 4I9WD 4EEEA 4A38A 2OMWA 1TO5A 2ZXEB 1KY7A 5E03A 1HCFX 1U21A 4G7YH 4GB9A 4PB0L 3ZE0F 2WO3B 4G6JL 3WEOA 1SVZA 1JDAA 4I48A 4GRLB 2MCG1 1WBZA 2FQGA 3L3JB 3VSVA 5GJTH 4ZMLA 1KT2B 1NOFA 4BH7B 4AJVA 5DO8A 1JPFB 1DVFD 4R5VA 4X5PA 2VQ1B 5BMFL 5LBSA 1MJJB 4Z7UE 3V0AC 3SPVA 3CSYB 3FO0L 4XNUL 4LHUG 4LFHG 4JFDB 5DDHA 2H2PC 2W92A 5FYJE 2E7MA 4Y5XC 3L4CA 3KPRA 5EO9A 1D6VL 1XF2A 2H3NA 1II4E 3QO0A 1T5XB 3I85A 4EI6A 4ZW3A 2RD0A 2Y6SC 1LM8V 3E80A 4GY4A 4Z7NF 3JV0A 1P2CB 2ZICA 1MJJA 4LSVH 4ELME 3IF1B 1MQKH 3REVA 1IC4H 1U8JB 1N12A 4UDTB 5CKGA 2MOVA 3G6AA 2CRYA 1A6AA 5J11C 5BZWB 1I8KB 2WOBA 1NFAA 3OC5A 4IRSB 1HHIB 4G8GE 3T0AA 4DWHA 2BNRD 1HZHL 3V6BR 4QWWD 4BK5C 4YAQA 3KS0J 3JTBA 2J6WA 4Q4IA 1ACCA 2QPDB 3WNKA 2Y3AA 4FMFA 4PRAB 2OYKA 3N6YA 2XZZA 3L6FA 2WBJC 5F3BA 4DN4H 1J11A 2XNAB 5IJVB 3EGDB 4QHLB 5FHBL 4GIPD 4X9GA 4NO2A 3UZVB 5CEZE 3QI9C 5CBEB 2LU3A 2EYTA 3FMGH 2AC0A 2W60A 3BZ5A 3WKYA 1BGXL 1OK8A 2K8MA 1HHHA 2P49B 3EO9H 1DBKH 5D1QB 4F7TB 1NGQH 4M1DH 3OAZK 4RWYL 5DJCB 3I6SA 5J3HC 4OVVA 2ZKXA 2VZTA 3DK2A 1BLNA 1X5HA 2YN3A 3Q6FB 1CLCA 4NQVA 3N40P 3EHBD 1WG3A 3IDJB 4O5LL 4BBWA 4AZ8B 5DJ8A 3QNYB 3WENA 3LKNA 5D7JC 1ASPA 3VXUA 4UQEA 3WAKA 4CVWA 4YK4C 2YRZA 4GSXA 4ZXBB 1BBDL 1MKFA 2NLJB 3MRCA 1PZ5B 4MRCA 5CGYD 4UDUA 1JPEA 4OF3A 3KYKH 3CFJB 3GIVB 3C8KA 4LOUD 1P5UC 3SGJA 1P5UA 3H3KA 5LG1A 3CG8A 2DRUA 1KENH 1I8IB 3H53A 3ZVVA 2NY2B 3IDMB 1M7DA 4FZ8H 5DR5L 3NRPA 1ORQA 4Z0BL 5KS9E 2J73A 2NY5H 3CZFB 3SOTA 5DHYB 2R59A 1S2EA 5I1LA 4G8EB 2CKBA 3MLYH 5I0XA 3HUJF 3SYAA 3D3VA 4DK3A 4ZFOL 1CQKA 5B1AB 1AAJA 3TNMA 4FD0A 1H5BA 1RUML 2R27A 3O2WH 5I9QB 1G7JB 3QCUL 3GEWB 4L8DA 5FYKH 1COBA 4R0LB 2O61B 1X6LA 1BAGA 2FHFA 4PJEE 3ULUF 4UT9H 3DETC 1G9MH 3TFBA 4TPRH 5BCAA 1F4YL 2AQSA 4WFEE 2W5PA 1JCKA 2NY6C 3CN4A 4WFGE 4YX2L 3SJVD 4TNFA 5TTRA 1BZ7A 1PZCA 3ZKNC 5FK9A 4QIRA 2R1XB 3I02B 5CZXD 3L5XH 2OXGA 1ZS2A 1CYXA 1GYCA 4FFWD 4ZFGL 5BOZG 1Q0XL 3NN8A 4IBYA 3HCVA 4N0FB 4UV4H 3WGUB 5IEHA 3SDAD 1KFAH 4Q58C 1MWAH 3R8QA 4M61A 1G1CA 3KGUA 7TAAA 3VI4E 5FB8B 4NQUA 5IQ9B 4V2CB 2WLLB 2A6KB 4YBLC 3RP1A 3V55A 4DP5X 5F21B 4TNWK 2IPUK 5C09B 2KDGA 1JHLH 3AQDA 3O6FC 2BSTB 1AGFA 3RWEB 2LVCA 1CJYA 1SFDA 2NY1C 4MS6A 3S0PA 3BVNB 2OCJA 2DQMA 3ZGHA 4Y2OA 2DQCL 1KCSH 3FCSA 5DC9B 4LP8A 5I73C 5D7IE 1IIIA 2P8MA 1MVUA 1Q38A 4P3WA 3V6ZA 5L7XH 1BPVA 4AE0A 5C6PB 4AV4A 1HL5A 3MXVH 4PRID 2BP8B 3ALWA 2CGYA 5FYJU 1KBWA 2XX0A 4FFWC 2Z1KA 3HNSH 4PJDE 4PJGF 4ECNA 3MLPA 2NYZA 1N0XL 1HK6A 3QBTB 3HEIB 2OTPA 1M05A 2VDNL 3D05A 3EG9B 5IGXH 4OD1L 1A7PL 1Z6JT 3EGDA 2C34A 4U4IA 3G5YA 3LKSA 2EEAA 2NOYA 4EAEA 4PJ7A 1P7HL 3SYOA 4CC4C 4OCWH 1TYEB 5DD0H 2Q5BA 1T4WA 4ZW8A 3IFLH 2FL5B 4PRPE 2QMKA 4M7JH 2H26A 1ZPLA 3DNKA 4JFPB 5EO1B 1S6NA 3L48A 1M1SA 5KVFE 4PV9B 4NSKB 2XY2A 1Z9LA 2IADA 1IEBB 1MXDA 4X7CC 3UMNA 1AKPA 2AJSH 4A6YH 5IW3A 4HEME 4TTDD 5DZPA 1RIHH 2FBJL 3RB7A 3US0A 3ECUA 1U92A 2VDLL 2BIQA 4GP8B 4KOCA 4BSVB 4UDUB 3VXRE 2OZ4L 3EF7A 2PYED 1MCKA 4U6YB 4Z0XB 1AQKH 1FFPB 1NPNA 4ZOBA 3NH7L 5E0QA 1H6EA 4UQ3A 2ICES 3FONA 4GRWE 3ZPDA 2HKHL 5FYLH 1WRFA 2IFFL 1GH7A 1GOGA 1BQLL 2D7QA 1B88A 4XBGB 3N3EA 4G1EA 2D7TL 3V95A 1QI4A 1PTZA 3WGVB 3X13B 3O3EA 3BPOC 4N2GA 5CF3A 4XBMA 3WMSA 4ZS7L 1VKXB 5ESVA 5KZCB 3FO9A 2QHLA 1PEZA 5AW5B 1L5GA 4AIZA 3UJJH 1BM3L 1FIGH 5LVEA 3B2PA 1T80A 5DUBB 5EO0A 2AEWA 4L8DB 1SBSH 4P5TC 1AGEA 2FLBT 3QDME 1SFHA 3ULVF 3P2BA 1HESA 1WBXA 5DTFA 1MFBH 3U4KA 1MELA 1EZUA 2X4RB 1IM3A 2OCCB 1WFUA 3GPEA 3K1KC 1R0AH 2EZ0D 2V5MA 4YHMH 3WTTA 1IAKB 2VB5A 1QSFE 3PL6A 4FCHA 5D7SL 5DSCA 3APMA 5GSRA 3A67H 1YN6B 5I6LA 1AOHA 2YQGA 4I0PA 4YLCA 2WIIA 1GY1A 4L4VD 3UP6A 3HZYB 2EJ1A 5IMOB 3P69A 1BG9A 3HE6A 5KZCD 2HTKD 2V5TA 2AQRA 3DOHA 4HLEA 4OIBA 2XQ0A 1H3XA 3G6JA 2IG2L 5AD0A 5CEXB 4HF5H 3FT3A 6CGTA 1ACYH 2DWEB 4LSRH 1E6JL 4UV7L 4NFCA 1NWOA 2WXIA 3BGMA 3TIEA 5ID1A 4RGOH 3I6KA 4HPOH 4A04A 1ED3B 4U33A 2YD0A 2R23A 4KH2A 4MFHA 4Y5VB 3LXBA 4HFWB 1MI5A 4DPRA 3WL9A 4PP1D 4ODWA 4XBPB 5D93C 4FNQA 3CZKA 1ZXKA 2NY2D 3U2SB 1A3QA 1KTRL 1QFWH 2CPCA 3CFKB 4RISL 2H2PD 3RRQA 3QYNA 3HR6A 4M00A 4BA8A 5FDYA 1VRSA 4G8FA 1DCEA 3O0LA 5DVKA 3ZRCC 5KAQF 1UT9A 3QJFB 3RURA 4FHBD 4JFUA 4Z9KB 4GI8A 1HWGB 3GGWB 3DRQB 5HI5D 4AIEA 1R6VA 3W1ZA 4A2FA 1E4XL 5BV7H 1QFUL 2GAZA 2DQEH 2OMYA 4OCNC 1EO8H 3P11L 1ECYA 4XCEA 3L45A 3LMJL 3OQ3B 2Z9TA 1JWMA 2ZXAA 2GSMB 2X05A 3ZE0B 4M6AA 4ENED 4QEGA 5LO7A 1E3FA 4P57B 4JQIH 5AW4B 5C07D 1IBDA 2OMUA 3PS6A 3AMLA 1DQKA 4XMZA 5I76A 5AOJA 1QYGL 5IG7B 3JWDC 2IGFL 4IS6B 1ET5A 1M71B 2VQTA 1JZGA 3CFEA 5AFAA 3U0PA 1U8OB 5LNDA 1U36A 1XR9B 4NAQA 1WZAA 3U46A 2CJUL 4L1LA 4I88A 4NZUH 3PWUA 2VN4A 2Y7LA 1JL8A 3KJ4B 1SEQL 2DI8A 1F58H 3NSFA 3ZKMD 2V17H 2W88A 2GSIA 5HYJE 1CDYA 3DMMA 4PRBB 4YHIA 3AG3B 1ZLSL 4PJBA 3VI3A 5TPWH 3OZ9H 3QDGE 4N9OB 4ZO8A 4J5VA 5E24E 3HTLX 2XBDA 5AUMB 1FL6A 4EPSA 4ADJA 5IK3B 1XCXA 1SOSA 4EOWL 4NZTH 1MW3A 4JKPL 1NCAH 4NEHB 1OGAD 1E2WA 3SBWC 4ZJ9A 1IUZA 4Z0BH 1SYVB 3U2GA 2Q3XA 4AIXA 4EI0A 3IGFA 3VXMB 2GIXA 3MLTA 4BSVA 3IF1A 4PJ8C 1SZNA 3DHPA 3NK3A 5CILL 1CGTA 4UILH 6TAAA 4XWGL 3GZQA 5IW6A 1S9YB 1ZDSA 1TENA 2EADA 2W9LA 1Q9OB 4YHYC 1NBYB 2JELL 1AFVH 4PGDA 3AXIA 4F2ME 2FJHB 4M7LT 2YFNA 3QUMH 3O8XD 5T1KD 1MCRA 1ZLVK 2MHAA 5GSVA 2DQFA 5I1JL 1NA8A 2XSKA 1B4JL 2ZX5A 3B2VH 3CDFA 4NXKA 3TBVB 2R8SH 4H1LG 3IDIB 2C4FT 3BPOB 4N5UA 3UZQA 1USZA 1WO2A 3B7RL 1BEYL 4M5YL 4Y5YA 5HP5A 1ACZA 5EEZA 1YEEH 3VFVA 3LNIA 5BZXA 3S35H 4WK0B 4QRTA 1B2YA 4N2LA 5IF0A 1W91A 2A74A 4KVNH 5I1DA 5E9DB 5IB1B 2EYTB 3RY4A 2BNRB 4WWKA 3ZKQD 4ZD3H 3CH1A 3GZPA 4IU2B 3SCMC 4UT9L 4X8CA 1HH9A 2MQ0A 1CURA 4HPYL 2AMUA 4XMTA 3HMXA 4OCXH 5I71C 1FRGL 2WP3O 3MBXH 2DWXA 4YQXH 3DXAB 4OFIA 4UT6L 3IDXH 4EN3C 2PCYA 5C7ZA 4LEXL 3MRNB 1TZIB 4JJOA 1ONQB 2C8NA 2QDVA 3KXFB 4OLZH 5E5LA 3V0JA 2VXUH 3HI5L 4NZRH 3NPZB 3CBRA 5DQ9A 4N8UA 2XC8A 1NGWB 3HC4L 5L4MA 5SWZB 1I1FB 4IMLB 1VFAA 1IC4L 1T21B 4B3VA 1VZGA 3LPGA 4H2CA 1CGUA 5EZLA 4EUPB 3IVKB 4P4KC 5F7FA 3GDBA 2YHGA 4F92B 3OR7B 1THCA 1N7ML 4QAMB 3BSZL 2EEXA 3WN5A 1N59B 4PJAA 5CSZB 2RR3A 1WC7B 4GKLA 4JFED 1ETA1 3VD0A 2XN1A 4NENB 4S1RH 3VX0A 3VFSB 4HWEH 4AQ1C 2J88H 1CCZA 4XNQA 4UQBA 1TSRA 3MACH 3NCBB 1XSJA 2XJKA 5IVXE 4CNIA 5A7EA 1IGJB 1R3HA 4UOQA 4G5ZH 3TA3B 1A1NA 2Z93B 4JZNA 3UACA 5EU4B 1MDAA 1WLGA 5DRNB 4HMCA 1ZGLM 2V8MA 3SDXF 4JY4A 5J6HB 2ZXDA 3D0LA 2GITB 5JW3H 2Q9OA 1HKFA 3QIBA 1ZV2A 2AJ3A 2A4EA 3QCUH 3V5HA 1BW8A 2FBJH 3H0TB 2D4DA 3MRHA 4NLHA 3TA3A 1I9JH 5AUMA 2XPZA 3GQFA 4KX7A 2YWZA 4V1DA 4N68A 1OARH 2BZDA 5CUSL 3SCMB 3LZFH 1ZHBB 2RCSH 3EJCA 3MOAL 1DVXA 1EA9C 4Q97A 4CADA 3CVHB 1MCLA 2R1YB 4G43A 5LNGA 5EEUA 3HNTL 2B1AH 1A6ZA 4MA7H 4X98B 4EKJA 3VUAA 3D0VB 2O1AA 5C08B 5KVGE 3DO4A 3ULSA 3DSNB 4JO2H 3FQ1A 2FIRT 5DJAA 1I7ZA 2XUWA 5LN8A 2F15A 1AACA 1KV7A 1DFBH 2LFGA 5HHQB 5C8JA 4HJJL 2HPOA 3VD1A 5B1JC 5IWLA 5K69A 5AVZB 4JREC 1TCRA 3V4LA 3QCTH 4NQCB 4PJ8B 1ZOXA 4AYID 3BH9A 2JKJA 1SEBB 1L7TL 3BH8A 3VFPB 1J12A 4OZFA 3CX5K 5B22A 4BGLA 1V3JA 3FUHA 4P2AA 4NPJA 4Z6AT 5LGJB 4HOWA 5TH2B 2LU5A 4I3SL 4A2DA 4KKQA 4BA0A 1TTUA 3FSOA 1YC8A 1DO6A 3PGCA 1Z0MA 2ATAA 4UAOB 4NQCA 1ADQH 2CO4A 1NLBL 4HSCX 4GO6B 3VGAB 3LIZH 3DURA 4FS0A 4HX1B 1E65A 2DBLL 1DBML 3W39B 1KYOJ 5F44A 3EG9A 2APVA 2DM4A 2YUXA 2YGVA 4XPAL 5G55A 3OHXA 4AUYA 4ETYA 1FJ1B 1WHOA 4JN2B 4E42A 2G5BA 4ZMWA 3M86A 2CJUH 3ARSA 1BQHG 1L9PA 4S1SH 4ABWA 4KQ4H 5DRXA 5IMKA 3TBWA 4G7VH 3HS8A 3T0BA 1A6PA 4RCAA 4AQ8C 4X8JB 3FFCB 1EBAA 4Z95H 3TT1L 4OUOA 4PMEA 2X9YA 1VEPA 4I4WA 3WMQA 3MLZL 5FW6A 2HRHA 2CDFA 1A9EA 2IV8A 1B4JH 4GBXC 2BNQA 2CDEB 5T3ZE 3B9AA 5DQDL 3ECBB 4MWFA 3TESA 2ZUQC 3EZ8A 3CQFA 4YXLH 3I50L 3ZGIA 3F7LA 3RWDA 2OXHA 1OTTD 3JWNG 4HXAH 2MEJB 4DERA 3SQBA 3VFTB 2YGNA 3QUKB 4OCSL 2A77H 5JZ7C 4KK9C 4PWGA 4KRNA 3UAEA 3PAZA 4MA8H 4PJFB 5C3TA 1AY1L 3LRSB 3TN0B 1D9KA 4NO3B 1W0VB 2CGRL 1LO0H 4EIGB 2AQQA 2KLRA 1HKLH 3QJHA 2MRYA 5FKPB 1PCXA 3O3EB 3VI3E 4AVKA 4QJ5B 3VW3L 1TEFA 1E30A 2VDRB 2MFNA 2I60L 3T3ME 1JP5A 4C4UA 3IGKA 1A6TA 4I0PC 3EJRA 4ENEC 5GHWH 1BM7A 2XWXA 3BUDA 4TL4A 2LT9A 5D70H 1U8LB 4GS7B 4DKFL 4W70A 1OB0A 1J18A 3RHWF 5EC1B 4OZHB 1DSFL 3ZO0A 2JKLA 4P23A 3VWKA 5IQMA 2EH7L 3Q13A 1AXIB 1PS3A 3GXIA 5DLML 2E7BA 4MNGB 3HLAB 2WQ8A 2GYSA 4LLMB 4LFHD 2JJVA 2WXLA 1AXSA 3IK2A 4IJ3C 2IMMA 3ZTJH 1FUNA 2QADB 1FN4A 5DJDB 1G7QB 4AMKL 5JIIA 4LLWA 4PB0H 4ZX3A 2BNUB 2DTML 2CUMA 5F1IB 3PF2A 1BFVL 2X4OB 2YZ8A 2VLKA 1A9EB 5IJDC 4NPYB 1J8SA 1G0XA 4I0PD 2AV7B 1MJ7L 2N7SA 3VRIB 2UYLB 4WQOA 4EQ3A 3FUNA 2OMXB 4FQJL 2VH5H 2OTWA 2PKDA 3P4MA 2APSA 3IWVA 3AACA 2EIJB 3QJXA 4NZUL 5SWSD 5CILH 1IGML 1MI5B 2X10A 3O6KH 2OZ4A 3KPRD 1NCJA 5IM7A 1X5MA 4BZ2A 1SHWA 4E5XB 3QWRA 1EEQA 4ZFOB 1H19A 5D1QA 5E4OA 2XQBH 4FERA 4WK2B 1V3KA 3VTMA 4QRSB 3QR0A 2OMVB 3VFOA 1K4DB 3ZZQA 1EXHA 3WJMB 3GB7B 4AUUA 2R8SL 4OLXL 5HDBF 4ZUSA 2EO1A 4X8XA 1JZIA 2IOIA 4NHUB 4Y2OB 2Q7YA 1NMBH 1YYLH 3AVEA 4GQPH 2YXMA 5F3BB 4GW4B 3E8UL 1A7BA 4UZUA 3G5VA 1ZS8A 1S9VA 3HPJA 3BWSA 1DQQB 5J0BA 5D1ZC 2P8PA 2V2WB 3CDYA 1H3PL 3B7SA 3GMMA 3M1BB 2GC7C 5D7KE 1EXUB 4XPBH 5GIRA 3PDDA 4DT2A 3CLFL 3O41A 1MLBB 3QH3A 2RFXB 3QRLA 3NZSA 4OVUA 1I1RA 1V3LA 3QCVL 5CIPA 3D25B 2BX5A 1E27A 4QJ4B 3BH4A 4MJ2A 4ONGL 4KQ3L 3LKRB 5I15H 4LOFA 3B3IB 1WWCA 4NGHL 5LBSL 4HMEA 3ZE2E 2VO8A 4ZW6A 3CZEA 4WFHE 1RD6A 1HCZA 2WQWA 1KCVH 2ITCB 4G6AC 2H0EA 3MJ9L 1GJWA 4NIYE 4ZODA 3VXUB 1AD0A 4HALA 3KZ8A 4PJ9B 5SX4I 1JN6B 4UQDA 4OIAA 2JJUA 3I2CH 2F53D 4ERSH 5JXED 3OMIB 3GKWH 4OFVA 4CVUA 3I3DA 5IV2A 1BVKA 4FADA 3U1SL 2FATH 4ZD3L 2FX8L 1MLCA 3HZKA 4JJ5A 1ES0A 2ZOLA 2O30A 3QVAA 1SUJA 1X3DA 2XXFA 2ZX8A 4PCTA 2WYHA 4CSPA 2PPDA 5KSBE 4UQ2B 1F41A 5GRVL 4JANA 1AH1A 3T3PE 4ICXA 2WNKA 3ZKXC 3TVMB 1FORH 3ZE1B 2B1HL 3SGEI 4BXVA 1ASOA 2H4EA 5FV2A 4AQ8A 3CDGB 1SJMA 2VSDA 1SXNA 3H2WA 3HB3B 4WUKH 3U83A 2CBOA 4NHCL 4DGVH 2WYIA 1KJ3H 3OKMA 3BGAA 4CAGA 4HUMB 6PAZA 2R7EB 2BY2A 1OSPH 1GYUA 3EDJA 4WWPA 5FR3A 1XGQA 2EECA 3ARFC 3T9WA 4WZ9A 1T0NB 3T4YB 4AK2A 1U8PB 2F8VA 1SXCA 3SBPA 3UJTH 2GBAA 3TT1H 4R7DA 2I5YH 1Q9KA 3VFSA 4NQQA 1K6QH 4KH9A 5BRQA 4OQTH 5I26A 3N1MC 2BS8A 2EDJA 2QTVA 3MFFB 3IFPB 2CCWA 4PRDB 3BAEH 5EFIB 3GTTA 3SY6A 4F80A 4EOWH 4GRWF 5E08H 1U95B 1VGEL 35C8H 2R23B 4OD3L 4KMQA 1PZSA 1BF2A 1QPPA 3U6RA 1RLBA 1WQVT 1FSKB 4MNQE 4MYPA 4AW4A 5AOZA 2B9BA 3QUYA 4XVUD 4QF1B 3J2PA 1DBMH 5C09A 2VLLB 1BFVH 2EDYA 5K59E 4QTFA 3SDAA 3VFNA 2YBRA 3BP4A 2V7NA 1DQDL 2WVUA 2N1KA 4OF0A 3F7YB 3EH2A 5E5UB 2CBMA 1UB6B 4FFYH 2WZ5A 3T2NL 4Y88A 3WHE1 2JTYA 4WRLA 1Z66A 3O6KL 4B50A 3HC0A 3RJOA 3FQNB 3LS5L 4J4PC 4XNQB 1OP9A 4P4RA 3NJFA 2V7NB 1NMAH 3UEZA 2O4EA 2Z35B 1CDCA 2E56A 1RK1A 1FGNL 4W9LC 1EWHA 4GEJA 3K2IA 4I5BB 3VFRB 1QNZH 2NZ9C 1VKXA 5BVPL 2PYEB 1C08B 2CDGA 2FO4A 3T0WA 4NUMA 1ODUA 4HGMA 1N3NB 4PJBE 3PXLA 4AMKH 5FKAB 2JK5B 1P7QD 3IRZA 2V2TB 4WKZB 1KJVB 5ANMB 1MCPL 1DJWA 4ALAC 5D7LD 3VH8G 1T1ZB 5FGSA 4HIQA 1JXJA 3MFFA 3D2UA 2YAHA 2QDWA 2VXUL 3HI5H 4GQ9H 4K5PA 1JPGB 1R5IB 3SPHA 5FOBB 4I85A 4AWJC 4OCWL 2FSDA 4H5SA 3JUZA 5HYQA 2FHCA 4DZBB 2AV1B 1AGDB 3AY4A 1DANU 1F3JB 3MNVA 1DQJA 4E9TA 2BDNL 4J6IA 3NZ8B 5B3SB 1C8PA 4O2EA 4MQSB 3L1OL 4Y5YC 1E5CA 1T83A 3MLTB 1PKQE 3ESVF 4XOBA 1WFNA 2F7IA 5AOMA 2FWLB 1NANI 4A37A 2IC2A 3EH3B 4F2MA 4YO0B 4MAYC 1CICD 3QWOA 1O0VA 3L3OB 3K2UL 4B9FA 1P84J 2XFGB 2EYRB 3OPZH 1U3HC 3RFRA 1JGLH 1B4TA 1BD2D 3GSNB 4KTEL 2YPLB 3TBSA 1VDGA 4HIHA 3VXRD 3VD5A 1KN2H 1FFQA 4JANB 4YXHL 1J48A 4Y5VA 1HEHC 5EZJA 4D3CH 3ZIMA 3FUKA 5AVQB 3O2DH 4TNEA 1C5CH 4FA7B 3VFVB 3AT8A 4MASA 4OZFH 1QWHA 2NY0C 5EU7C 2GT9A 1IAMA 2W9EL 2Z3FA 3U4EB 3QIUA 3SBWA 4Y7OC 1JFQL 2Z35A 3OB8A 4LLUA 4HEPG 5SWSB 2PO6A 3MRLB 1M42A 5CD3A 4H0LC 2IEPA 3RWFA 3MA7B 1RZPA 3L9RA 1RZIA 3U36A 4QJ3B 1OP5K 3BP6A 2EO7A 4P07A 5JPMA 4NOFA 4Q6IB 4Q56A 2NY7L 4AX3A 1EAQA 3C5JA 2BW4A 1HEJC 3V0VB 4P5TA 2DYRB 1IQWH 1K85A 2ATKA 4APQB 1ZGLA 1W8NA 1NCHA 3RX9A 3BD3A 2GCYA 2QLYA 5AAMC 4HGKC 4DCQA 5D7LA 1BYOA 2NY1D 3VXTB 1CR9H 2C7UA 1Z9SA 2ZSWB 1CIUA 3UPRA 4IRZA 3ZDXF 5B39A 3SJVE 2E9BA 3DTUB 3RIAF 4RZCA 2JV6A 1PLGL 1W6LA 4KO6A 4AC4A 4C55A 2PF6A 4TSBL 1PPIA 3NCFB 3QRBA 3MRQB 2MCAA 3D6GA 3O4LE 8FABA 4EVNA 1QUPA 2YD5A 4PJEA 4Y4FD 2RH0A 3MVSA 3QFJA 4A2GA 1Y18A 2V3FA 4LLVA 5DRXB 3T08A 3VWJC 1XGYL 2BJML 2NPLX 3IJHA 4GKSA 3TPKA 1PAMA 3GD1C 2RTTA 3GHBL 3KM1A 4ODXB 5GGUA 4YHLH 1Q8MA 3SODB 3MV11 4Z7OF 1R3IH 3ARVA 4CC1A 3QJUB 5MEOA 3QFJB 2H7WA 2WBWB 3PNRB 2X4UB 2XKUA 3ROOB 2VE6A 3GLDA 3IRCA 3DUHA 4P46C 2GAZB 4N90D 3VG9B 4PVMA 2WYTA 5F71A 1ADQL 4C56A 4Z5RB 2NRDA 3C5ZD 2JKTM 2CNYA 1LE5A 1KDIA 4N8PA 1GXEA 3KPNB 3C60C 4Y4FC 4YFEA 5BRZE 2QPUA 1QRND 2ZWKA 1I7RA 2A6JA 2WO2B 3O3UN 2DJSA 1CE6B 1RPQA 4LF3A 1RP9A 3BN9C 2VLJE 5C70A 4NKQB 3WI9A 4NOBA 2QMJA 4HCIA 3NIDE 5B8CC 3EYOA 5HHMD 1GGCL 2XX1A 3DJTA 4L3EA 5CR1A 2CO1A 4GP4B 1F1AA 3FS9A 4ZO6A 3VG0L 2YOAA 4PG2A 4XNYH 2A1WL 1J9CT 3QNXA 2AK4D 1XGUA 4YSTA 1KYFA 3CZSA 4AGNA 2G4GA 2E27H 3KYNA 3LNFA 5I1KH 5EC2B 5J5EA 1WFOA 3CSTA 4AXWA 4KVCH 3ULAB 3B7UX 2COVD 1FNGB 5I6XC 5BUPA 4ELKA 4HUCA 3VO0A 3UYPB 3KM2A 4PTUA 2ICEC 2AJVL 4X4ZA 2MTPA 2GT9B 1NIDA 4OZFB 3QHZL 4XMPL 3ABGA 3PDOB 1XCQB 2EDLA 2EIMB 5F96L 4EKXA 3QJTB 4YGVA 3EXLA 4XRCB 4NHCH 3TONA 3ARGA 3GXPA 3KLHD 4E0RB 2NW2A 2P5EA 3I9PA 4Y16A 4ABUA 5I16B 2FJGA 5DZLA 5EUOF 5I9QC 5DYOA 5CMAB 4WO4B 4G5AA 4JHAH 2FB4H 1YQVL 2HP4A 1IU1A 4C56D 4ZBJA 2HKFL 1D5XA 2IGFH 3S48A 2VDOL 4ALAL 2WWMC 1VERA 3RUGF 1XVSA 3ZOAA 5CD5D 4B5ZA 3BQUB 1OP4A 3G6JE 5D1XA 2ZCZA 4JO3H 3N44B 2H8PB 1RHHA 5HI3C 1XF5B 5C0GB 2OMTB 3V79C 1DVFB 4GFXA 4EJ1C 4U3CA 2P80D 1YO4A 3ARFD 4FG0A 3APFA 3FW6A 3P73B 3CVBA 4P2CG 4U1IA 4WK4B 4YR6A 1PL3A 2WN3A 3OZ9L 1DBBH 5EOCJ 1M9WA 1VCBC 3WIHL 1B0WA 3VGEA 4RIRB 1OAJA 2ZUYA 2DQDH 4XN4A 4PTTA 1JHTB 3C5SA 3LD8C 1RVFH 4FXLA 4M8VA 4KXCA 4CC4A 6FABL 1KB9J 2BZCA 3OQRA 3VB9A 1RHHB 5HHVH 1ZLWH 1J86A 5T3XL 1WDAA 4UNIA 4M4PA 3H4HA 3TL5A 1NGWA 2DBJA 3ZHKA 3OR6B 2YMOA 4QDGA 3BAIA 1N5AA 1CLZH 3GBEA 5EU4A 2JI3A 3LQAH 4FFZH 2JXMA 2D4FA 1YQ2A 3WKMH 3HS0A 3LAFA 5JHDE 3RX7A 1HU8A 2P4AB 1TQCB 5FB8A 1HDMB 3U0WL 4J3OH 2O72A 1ZEAH 4HG4J 3L2NA 1A6WH 4X4YA 2WSDA 1EJFA 4LSSH 4FYSA 3AAZB 4LDLB 4ADIA 2EUXA 3DVNA 5FW8A 4OF5A 4N0RA 1GOHA 3BUBA 4XWOC 4Y2NA 4K4KA 2VLLA 3KH3A 4HETA 4IRJA 4NUJA 2IIJA 3IETB 3DI3B 1LO4L 4PYGA 5L4IA 2VIRB 5EBWB 3CSPA 1NUGA 5HHNA 4Y1AE 2BWQA 1N70A 4BQ6A 2AK4E 5FDWB 1PIGA 4DNLA 1ULVA 2D03H 3ZT7A 1ERNA 1UUNA 4NZTL 4D9RD 3ARDB 5IESH 1SMOA 5K1JA 3THML 1GZQB 4J7RA 1T1XA 5FEBA 4P05A 1KTDA 3TJHD 2WAHA 2DQIH 4Y4FB 2L0DA 3T77A 4PP1C 2Y0SA 4R5TA 4O2CA 1GJUA 1TJHH 1YYMH 2GKIA 3FHQA 5ACZB 3EYQC 2XWBB 3UC0H 2L7EA 1BCIA 1E5YA 3LV3A 2DD8H 2CM5A 4TQHA 1KOAA 3NDZE 1D5IH 4Z3IA 2V6HA 2VM9A 2EE9A 1I8MB 4RISH 3VXSD 3HMXH 2GJPA 2QVMA 3GZKA 2IV9A 1BVNP 5JO5B 5JDJA 2DLEA 5IB3A 3OG6B 2OSYA 3SDDC 2GB2A 3IAGC 1VEOA 1MNUH 3AU1B 3B2UD 1BF8A 1NCWL 3CFDB 3RGVA 4Z23A 4UNTA 2XFXB 5F7KC 1WS8A 3FOLB 4AGQA 3H9SA 4JE0A 5CSBA 3AB0B 3MOBL 1RUAL 5IVNA 5L88H 2ODHA 4PY8I 2VDNH 2P52A 3GS0A 4S10A 1KCBA 4L05A 2UZIL 5I5RA 5EIVA 3FQ2A 1U3HD 2XETA 4I1RA 4QRSA 4YEEA 3MCKA 1X6NA 5EH1A 1FFTB 2UY6A 4Z7AA 4L4TD 4AYFB 3KXFD 3L4TA 3MNZB 2AZAA 1YA5A 1N8ZA 3ZSTA 3V9CA 2HH0H 1NBQA 4KUCD 2YAOA 1QLEB 3EJTA 2VSCA 3TX4A 1Z9OA 1XIWD 2OKMA 3HAEB 5F7DB 1MOEA 3MFGB 2NXYC 5I1GL 1OSYA 2B3IA 2VN6A 3REWB 4Y1SA 3FQXA 3RVXC 3RVUD 2E76C 1JHTA 1FZJA 1GY2A 1W9XA 3NFNA 4GSDL 4WI5A 1MHEA 5ITFA 5AW2B 4AL8L 1A65A 3STZA 2J43A 1KG0B 2YD4A 3ECWA 1XCWA 2LW3A 1IQDA 1I8IA 1GC1H 2XYBA 1M7XA 1T6BX 3WEAA 4NHUA 5AZEH 1NFIB 5HHPA 2V9TA 3O3AA 2MNUA 1IMHC 2DL9A 4PRDA 5DJCA 2BP0B 4HQQH 2DL2A 1ZA6A 4PJCB 2WLKA 3ZL4L 4YBQC 2NT0A 4AMWA 1WPCA 4JB9H 2W60B 4KPHH 1XR8A 4Y1TA 3ZY7A 4LHUB 3C6LB 3HC3L 3KYOA 3QS3A 1RK0B 3C2SA 3GIZH 1RZGB 1VFUA 2YN5A 3K3QA 3NTCH 1ZA3A 3QNZB 3CN1A 2DH2A 1REIA 2ED7A 3SKMB 1IKNA 4Y4HC 3D39D 5B38G 4ETQB 2JB6B 2YA1A 1L0YA 1KXHA 1EHKB 1R3LA 3OGOE 1O9ZA 5F2FA 3BVDB 3VD9A 1R1CA 3GMPB 4QI3A 3H3PH 5C6TL 3OLGA 4YE4L 4HWEL 4R4ND 3EDEA 1NH6A 1AMXA 5KVEE 4L8SA 4X6FB 3O0RL 1F56A 2Y5QA 2KMWA 2IH3A 1BMWA 5J4MA 3VRJA 4LSPL 1QO3B 5I1AB 3G5ZA 2Z31B 3ES6A 3P0YH 1JRHH 2BSCA 1PLBA 4OFPA 1F13A 2VLRD 1U8IA 4HWBH 1WZMA 2X3BA 2V9UA 5JORA 4PI2A 3BT2L 1MFDH 1NCDL 1I9IH 4DCQB 1V7ML 4BK8A 4UOZA 4WCYL 3DECA 3SQOL 2MOQA 2D8KA 1WEJL 5TDNA 3ARDC 1SY6L 1T2QL 3T1FB 4DGUA 5JIQA 1E2VA 4ZUVA 5CLWA 4L23A 1I4FB 1P7KA 5HYSB 1TJIL 4CUCA 5IHWA 4JRLA 5CZRA 4XH2B 5AQ0A 1BGXH 4L4VA 1FJ1A 5ISZD 3LZFL 3PFQA 1JMZA 2F18A 3A4EA 4G7YL 5CCHE 5CJOH 3WNOA 4JKWA 2K3TA 1W8EA 2ERJC 1I8LC 3QIWC 1T5WB 1U91A 4XCCH 5F3HA 4YXLL 1P4UA 1SJHA 4WU5B 3VI3F 1Y0LA 4GW4A 2P8LA 3WDIA 1R34A 2R0WH 2NNXA 1NLBH 4GAAA 4P23C 1XH3A 2YMXL 2XV6B 1CLZL 3MKKA 3RDTC 3SE9H 5J6GA 2VLME 4JGUA 4P5KA 1N8ZB 1LO0L 4Y5XA 5D5MF 2UXFA 3JZYA 5DEFB 3ZBMA 2HKFH 1H3TA 4PJAF 2F7OA 5EU6A 3B5TA 3GEFA 1L7TH 2HT4C 1KGCE 4ESKA 1U41A 4HOZA 3F7VB 1QUNB 2DJUA 2CO6B 4NO0B 4ZS6D 3W2DL 1CFTB 3DX7A 2MTAA 5HPMA 1G1YA 1M05B 5IB2B 4KKRA 3ULSB 2ALAA 5F1SA 1UZ6F 3DXAD 1A7NH 5JW3L 1FFOB 3JWNH 1YEGL 3WFCL 3IJ7A 5BVJB 2E6PA 1OCCB 4X9HA 2GBUA 3GMQB 2W0LA 1LQSR 2OL3L 4YSDA 5BO1H 4L8CB 4X5WA 5J1SC 4CSZA 2Z31C 4LDCA 4Z7VF 3N9GL 4UQAA 4WWNA 5CIPB 3QDMD 3TU6A 4K9JA 1YMHA 4EUPH 3S3PA 3K74B 3ZDZB 5A1AA 5FFLA 5DUMH 4TVPD 3EJPA 1ZVHA 2W65A 4FC3E 2H6UA 4XPAH 4R4FL 1FC2D 1BX2A 1MJ7H 4LMQI 2IANB 5IHZB 1HL9A 2R51A 3FO2B 4XVTH 1ZV9A 4O9HL 4WU5A 3U7WL 1MFUA 1UOKA 4WTQA 3UG3A 3D18A 1MPAL 4MAYD 2ETWA 3PWUB 2OQJB 5C0RL 2J21A 1EFXA 1CYWA 5T3XD 9CGTA 2WCGA 1HYSC 3MLWH 3UAJA 3RQ3A 3DX9B 2EXWC 3TYGH 3HJEA 1YAIA 5AALA 1F8TL 3G7TA 3EO9L 3P02A 4WVRA 3UGXA 3GMLA 3F7KA 4A2MA 3NACL 1NKOA 3JSSA 1JZ2A 4KY2A 4EO5A 4H26A 3ROLB 2H3KA 5EZPA 3KGRA 5IV2B 3UCRA 4N0UB 4WO0A 1A7QL 1PGRB 5HI4C 5JMOC 2N59A 3K72A 1DVUA 1U8QA 1E40A 1NAKH 1CU4L 5A7BA 2JB5L 3KPRB 1KLUA 1BWWA 3EADA 5C08D 2P5WB 3ISRA 4IKJA 3GSOA 2YR3A 1FL5B 1T3FB 3DJSA 4RGMC 1THAA 1KPUA 4JFOB 1D5MB 4HXBL 4DEPB 1C8QA 4GMSH 4GO8A 5JOFA 4X6CB 1W15A 4JFQA 3J27A 4APXA 4FMKA 2WTRB 3QXVA 1ADQA 2VDOH 3FUDA 3MJGX 4JFWA 5K1VA 3TXAA 1CIDA 3UAAA 2CLZA 1JZ4A 4LSVL 2KQNA 1DQQA 4F8NA 3KD4A 1ITBB 1F2XK 4NS0A 4PY8J 1JK9B 2OSXA 2AVFA 5TQ0H 1WBXB 2C3HA 3BP6B 4DPAX 3NTCL 1FYTB 1YG9A 1BJ1J 4LCUA 5E1AB 4JMNA 3UBFA 4YR6B 5GISL 2XN0A 4R7NB 1MFEL 2O5ZL 4TQEL 1SLWA 2FWUA 4DVRH 3CC5A 5C0EB 3OXSB 2VSMB 3NABH 2DLGA 5I1DB 4UI2A 1JGUL 3TV3H 3SDAC 5TE7L 3HAEH 4P46A 3CFUA 5J57B 5EZOH 3WMPA 3MGOA 4FMVA 4IMKC 3TWCL 3AXLA 2CU9A 3RWGA 2L7UA 5DEFA 1S5IL 4PJXA 2G75A 1AO7B 2V0AA 3TP4A 2V2XB 3K71A 4PJ7F 3B5GA 4HISA 2XN2A 2RIKA 4QHLA 3GUTB 1DJYA 1UZ6E 1QOKA 3R0MA 5BS0B 2JJWA 1I9IL 2A9BA 1HDMA 4CU8A 4OLVH 4XVTL 3HIZA 4KK8D 4AJ0A 3DIDA 2FEDC 4F1SA 5DD6B 3QEGL 2WUCL 5KYNA 3UJJL 5FWQA 4IBQA 3QG7H 3EYOB 3LEVH 3PAYA 3NT0A 2ESVB 4WTZA 4B41A 3EFOA 1I85A 1TQWA 4MQ7A 5T1DH 2FH6A 2N1TE 4U1LB 5FIEA 1KBGH 2ZQKA 3HE7D 5BZWA 1E90A 5DJ8B 3WHE0 4P8QA 4Q8BA 4IW4C 4OZGF 3MUY1 4E9WA 4ZMPA 4I18B 2FWSA 2V7HA 1X5IA 3Q8FA 4K8RL 1PVHA 2XQYA 2Y6TE 3KLLA 3PJSB 4JPKH 4LPCA 4LK4A 4X7SH 4OZGE 1GZHC 1I7TB 3BIKB 4A2EA 3V5KB 4LIQE 1NCDH 2WMPB 3IMSA 3QDJD 4R7DB 4PWHA 3R7QA 3DMMB 3NIFB 1N2RA 3OKLA 4RLDA 2JIXD 2XJLA 3WY4A 2J71A 5E6IC 4NO2B 4P2RE 4R0LA 3UZVA 1VFOA 5GS0H 2B1HH 3NJVA 3IMBA 3H9SB 5ADOL 2WB7A 4YNYB 2QQNH 3BIKA 3D3VB 1IFGA 5AVRB 3E7JA 2CMRH 4WI4A 1OCWH 1N4XH 4RBPK 3RYMA 2XYCA 3TZVB 1TVBB 1ZSHA 4CW1B 4P9HL 4Y5VC 4GUCA 2QSQA 2E6QA 2ICEA 2PW1A 2X1WL 5T3ZD 1LE9A 4WFFE 2R0WL 2F54E 4HS3B 5ESQB 2WQUA 1A0QL 4JFYA 4QKTA 4HWNA 4ACTA 2ATPA 3WXVL 3ET9F 3AFLA 4Y4HD 4IBZA 3BPLB 1PNDA 3S34H 4BZ2H 1FL5A 1XXFC 3N1PC 3IU4L 5H94A 1DL7H 2WBKA 4Z7VE 1WWWX 3KMDA 1YZZA 2GHZA 3ARZA 3QA3B 2CRIA 4FLQA 4PR5B 3TASA 3WD5L 3CPLB 5K9OA 1D5ZB 1QFHA 1RUKL 2J56A 4ZMAT 3KLAB 4R7VA 5K39B 3WV0A 1LGVA 1OWWA 2UWEB 4D9QE 4L2YA 3QULA 3APNA 1NOAA 3JWDL 4ZFZA 5LWYH 4XTRD 4XCYB 2CHXA 4PTTB 3FULA 4LEOA 3RJDA 3ZSSA 1C5BH 1TTRA 2ZUTA 1BFOA 2GC4C 3QA3A 4HPOL 1KIRB 4JKKA 4HUNB 4KK5C 3RL2A 5I1JH 1P0SE 4M29A 3GKWL 5I76B 1OB1A 1K8DB 4XP4L 2XZCL 5ALBL 2R0KL 1NLDH 4JFTA 3UTSE 4IOSD 4LBEA 2Y3NA 4FN0A 1G1KA 1KCVL 5IROA 1BVOA 3L3IB 3AS0A 2C9XA 3IDNB 4NKDA 5T33L 3K6SB 3D0LB 1G7MB 3CXHK 3EYSH 3LIZA 2UZPA 3I74A 4DPCX 3V4VL 2X4RA 4WTWA 1AGBA 3TFKD 1LJMA 3QDJB 3QEQD 1IGJA 1R3HB 4G9DB 1E4KC 4JKPH 4XTRC 1S7XB 4XH2A 2LW5A 3L3KB 5DD0L 1S46A 4H1LA 3GJFH 3LKSB 1NSNH 1BZQK 2BLFA 3ENEA 4R26L 4UT7H 4YHZH 1NDMB 4H8PA 2G0LA 1DVYA 1P5VB 2XBTA 5GPRA 4BFRA 1A7RH 1N0LA 3LXUX 2QGBA 5GHWL 4PJ5B 2P7TB 1RUPL 3FQTB 2WINB 5L6YH 5FA4B 1RHFA 3BGMB 5ID1B 1IKNC 3R8BB 4Z78B 5ILTL 4EBQL 2QQKH 1B6DA 4NN6C 2O5YH 3A4DA 5KYUB 5CKAA 5L7XL 1DBJL 3IMVA 4CADB 1HI6B 2WXQA 1EJOH 2WWNA 1I9RH 4JW3A 1HIML 1W8OA 2IGLA 1G6RH 1I3GH 3BPLC 3QHTC 4FQXB 2WINA 5EG6C 1GCYA 1UA6L 2VRAA 2DF3A 3L5IA 1KCLA 5FOJA 4PJHF 3M6DA 1U33A 3GSNH 5IGXL 3G5ZB 1KN4H 3PG2A 4HP5A 1JRHL 1T22A 2VW4A 2BY0A 1T1YA 2WVTA 2FBRA 1L9TA 1SF3A 3CX5J 2G3XA 4YGVB 4YHKH 1NEZG 1RURL 3ARFA 4OCLC 2DQJH 3D7PA 3PAUA 4XE5B 3NCCB 1E8ZA 3U48A 1T5WA 4H0IA 1JNLH 5GZND 4G2AA 1U58A 5EDSA 3O81A 1IM3B 1EEUA 1A6TB 1EEZA 2ADFH 1S9WB 1K9TA 2OR9L 1GZPB 3CHPA 4ZAKC 4LCVA 5GZNA 1NAMA 4OZ4B 3FQUA 3VAEA 1YNLL 1UYWH 1QEWA 2YJLA 4CN4A 1QSED 1NICA 2LU4A 5JHMA 4NN7B 2R4SH 4QUOA 1G94A 2CXKA 1CBVL 2JQMA 5CR8A 2Y1ZA 1AGEB 2UY6B 3O9WA 3FU6A 3FQRA 3NJLA 1IGCL 1D7BA 2GFBA 3QEQA 4YJZL 1YAZA 2M2DA 4C83B 3FKUS 4M03A 1ZSDA 3QC6X 5C0CE 4DGYL 3OHMB 1DBAL 3PGDB 2E75C 3LB6C 4ODUA 4WW1A 1HC1A 3KDMA 3MV7E 4HV8B 4MMXA 5I8OL 1AZVA 1L7IH 4OT1H 1FO0H 3WJLC 1PKOA 4RESB 3WS3B 5INDA 5F6IC 3WNNA 1CFTA 1EEYB 4HHAA 2OR8A 3ECBA 4MWFB 5DJZA 2FX9H 2BERA 2ORBL 1YPZA 2D7TH 1MZYA 1S4IA 1WVZA 1JF1B 2JJTC 4W1TA 5E4AA 1QYGH 5T1MB 4HIIA 3OR6A 3QWNA 4K7PL 5HGDB 4ODVL 2ZUSA 4KNSA 2QHRL 5CHNA 4UUJA 1P5UB 3N41F 1MEXL 4QNPF 1INEL 3SDXB 4P9MH 3SOBH 4HBQA 5CWSA 3BEWA 1BD2E 1VCAA 2CDFB 3RGVC 4PCSA 3S5LB 4TULL 5B7FA 4LHUD 1FVCB 5T1KA 3DJZA 3VG0H 2EDTA 3WXWL 1IM9D 1XWVA 2CHZA 5FUCC 2G3NA 4JY6B 4BCYA 1TFPA 4UCFA 3OHXB 2AJXH 2BRQA 2I24N 4Z7OE 3R06A 4XPGL 1FNHA 1O5PA 2NZ1A 3C12A 1FWXA 5F89A 2P80A 2D3LA 3LX9A 1UEYA 5C0GA 3MUJA 2YEVB 1XTLA 1UXSA 3UGUA 4ZTOH 1QVOB 5CJQH 4Z7QF 3OKEA 4BWWA 4QRTB 5DSCB 1M71A 4P46D 5D2LA 1I3RA 2DM7A 15C8H 3LEYH 1HHJA 4IRSD 2A9AA 4EE2A 1BLIA 4NUQA 2IOMA 3FRPB 2OYMA 5FFGA 1FBIL 2W1NA 1VADA 4MDJA 4PJGB 1IGFL 5GS0L 1ACYL 3RGVD 4G3YL 2LHAA 3B2DC 3BAKA 3MBEA 3EYUH 1WICA 2X9XA 5JHAA 5CLZA 5BRZA 4R26H 4UT7L 5DJ2A 2NUTA 1EMTL 3ZQWA 3HVNA 4MHHI 5JW4N 5F1IA 5HGHB 1KXQA 2UXVA 3HLKA 4TQ8A 4KROB 3OKOA 2J1KA 2CIIB 2X3AA 4LQFL 3DSNA 3N1QC 4XMKH 2DB8A 1BQRA 3O2DA 4BHUI 5KBDA 4BSJA 1G7LA 3MGOB 1GIGL 4AQEB 4W9IC 3ZJAA 1I8UA 2PXYC 4R4BA 3DGDA 3FH5A 4JO5A 2KYIA 2Y2WA 2Z4QB 4LPXA 5EIIB 5F6IB 4BH8A 4ANXA 1VLXA 3LS4H 3MNZA 4U6VH 1WAPA 5FXCH 5TGBB 5I28A 3FZUC 1A4AA 2LU7A 3BWAB 2K6ZA 5LKNA 4MCNA 1U3ZA 2Z6FA 3VWKC 1INQB 2DAVA 4UIMB 3BRDA 1EAOA 1O7DC 3FOMA 3Q1SH 4Y19B 3ZDWA 2G30A 3P3RA 1PG7X 3FN0H 1FZKB 3HZMB 5HJGA 5IFJB 1KCKA 4J2XA 2WIMA 4OLEA 1KYOK 1QBLH 4GSUA 4IS6A 3FQUB 4ZYKA 2VR8A 3CZLA 4GUQA 3ZTNL 2P43B 3I9GH 1FP5A 4U1GC 3TT3H 3JT2A 3JVGA 4RAHA 4CA4A 1UGNA 2Y4SA 3KW7A 5KYXA 3QG7L 1IZJA 2YGOA 1QABA 4NNYA 2EKJA 4LVNC 4JO1H 5B7EA 4NN5C 4ZUWB 4ZMZA 1G7PA 3L4ZA 4O2EB 3WXVH 3WUWB 4NQEE 3BDBA 5IFHH 3IFNH 2AXJA 3IKKA 4L2LA 3RKDC 1ZLEA 1EZVY 2PWEA 3T2PA 1M2OA 4HOMA 3MJ6A 3NIGB 2A4ZA 1YUKB 4MA7L 1BQ5A 4TOYL 4WUUB 4LIQL 3H9HA 2FZ3A 3A6OA 1J5CA 4YDKH 4FULA 5L2KD 3LEYL 5DUJA 3CFBA 3BC9A 4G1MB 2CA4A 2JCCA 4NP4L 2ZSVB 3KS0H 3X14B 4JPWL 1BVKB 1F4XH 2Q3ZA 3SIKA 1FZMB 5EEWA 4R4BB 1YECH 4HK0B 4IDLA 4GW5A 3MRJB 5INCA 3FONB 1VEMA 2VXVH 2OJ1A 4JZOA 4X6EA 1PZBA 3DROA 1KMGA 2VIRA 4Q9RH 3QZWB 5AB9A 2XWCA 2A99A 3WSQH 12E8H 3CSYA 4F7CA 2A83B 3D51A 3QQNA 2EVIA 3MRPA 3K91A 4O4YL 1TETL 1EGJL 5DVOA 3AWFA 2FGWH 5SWZA 3BEVA 3BN3B 5DHMC 3B9KD 3ARGB 3G04B 3SE3C 5D5ME 2F53E 4OV6F 1C12B 4I3GA 4URTB 4H25A 1SJXA 3O41B 4OSUL 3KHQA 8CGTA 3S3BB 4X0KA 3A47A 4P5TB 3M7OA 5D96B 1D2PA 2Z4TA 3AQYA 1DQML 1M4KA 1SDDB 1UT2A 5LLIC 4JZNB 2OS7A 3DGGA 4GRWH 5DTFB 4GQZA 3KLHC 3D4YA 3OJMB 5GS1A 3HRZC 1DUYA 2E3VA 1FO0L 3UTTD 4PW9A 4NWUL 1BBDH 1TQUA 5AAWA 3BDYH 1NCBL 3OSKA 2P5WD 4UMSA 3BSGA 4V1DD 3NRFA 4MD0B 1VPOH 3FO0H 4XNUH 3CXHJ 3FO1B 1OAKL 1MSPA 3OAZH 3NCYP 1IGFH 2WWMD 4N9GB 2Q8AH 4YLBA 1KNOA 5I8EB 3TO4A 2XVLA 3PQYE 1QQDA 2EAEA 3IJHB 4L3FA 2VWEC 3FB5A 3FYEB 3I9GL 4PJ9C 3TJHC 3DV4B 1E3ZA 4GAJL 4E5XG 5IMKB 1J0IA 2DZEA 2SEBB 4PGCB 2DWDB 2VDQL 1ED3A 3LN4A 3S35L 1NANH 4QD2E 1WZ1H 1IL1A 3ZL2A 4LCWB 4UOJA 5I1CL 2FJFA 3MLUH 4V1DB 5D71L 4XPGH 3KJ6L 1U92B 4X80H 5CEZH 1LD9A 4BFIB 4J4PD 43CAA 4H13C 1UJTA 1QZ1A 1PG7L 4QHKJ 5I5IA 1D7FA 5IBUG 3TVMC 2FT7A 1L9RA 4QXGL 3P3YA 4G6FD 4Y4KD 2WXPA 4DHLA 4MZ2A 4PGJA 4NBYB 3S36X 2N01B 4G5ZL 5H37A 1EGJA 2D03L 3B9KA 4LLYB 5IJBC 4QTIL 4QWWC 2FJUB 3BZFA 3HS0C 3D85B 3II3A 5FW7A 2UZXB 2EUZA 1GGYA 1P9MC 5ILTH 1OOAA 5I6KA 3QJOA 2EE3A 1FZKA 4JFFE 5JW5B 2E8YA 2CR0A 5SV3A 5DK3A 3VXSE 1QI5A 5ISZB 3H42H 5DHVB 1ZLUK 5IQ7H 3OD3A 3CZJA 5H2BA 5HDOA 2HB0A 1EVUA 1OPOA 4H7VA 5A2KH 2AQNA 1CWVA 1M2VB 4POZC 5EOTB 2OJEB 2L04A 5GGSY 4R3SA 5I5MA 1OM9A 3MRBA 1Z9SB 5DEZA 1UCTA 3QXWA 2NTFB 2UVEA 4L48A 4DZ8B 3HA0A 3QNFA 5A2AA 2QGEA 2E86A 2GABA 3ZDYE 2ZP0T 4LIQH 5IREA 2ADGB 4D9RE 5L2JB 4TXVB 3V4UL 3L1FA 5I18L 5D7JD 2AMGA 4M48L 3EYQD 5GGVY 3SDAB 2V2WA 3M1BA 3VFNB 4FEIA 2A38A 2NCMA 5JPNB 1QMUA 3JV5A 3HG5A 3VDBA 4UM9D 4GG6E 4A7TA 4YPGB 1OM3H 4LOUC 4XPHH 4Z7UF 5I1HL 1NC2B 4PB9L 2E9JA 4WUKL 1C7SA 1FNFA 5L8KB 4NCC2 1RJZB 4WEEA 4HJ0D 1WTLA 3OL2A 3NESA 4GQRA 1BF5A 3K8MA 1EQWA 2APWA 4IBVA 3Q6FA 1NC4B 3JBG7 1QUNA 1ZVSB 2WSPA 1MFCH 3SDCA 3FB6A 1HIMH 4JLRB 4XOEA 4ZTOL 2BWIA 4JRFA 1DLHB 3HMXL 5C0ND 3ZMRA 1HVXA 4V11A 4QXTA 5I0YA 5GZOD 1EEZB 2QZ5A 5LGYA 2ZONA 1S7TA 3EF4A 3X2QB 1V5JA 1EHXA 2FLRT 1TZOA 1MCJA 3FO2A 3FU0A 4LE8A 1RUAH 2E7LA 5LXGH 3F58H 3PHOA 1FZJB 4YC2C 4HUKB 1MEXH 3SOBL 1IARB 1MJUH 3GMOB 3TH3T 2W65B 1UD8A 2F6AA 2WQSA 2AS5M 2G2PA 1NUDA 3OKKB 2EYRA 3QYCA 4K94L 1E9QB 5LAXA 1R3KA 2XRAH 2QV2A 3TCLA 5T5FA 5E6IA 4UQCA 3IFLL 3CV5A 4IU3B 2H6OA 2VISA 4QTHB 3WL9B 2WTPA 4HIXL 3ZHDA 3DPBB 3L1OH 4LLDA 4BRJA 4AK1A 3HKZA 4N8CL 1UXMA 1IBBA 3RWIB 3GYRA 4PJHE 5JXEA 1DBBL 4IKKA 1AD0B 3LRLA 3MOBH 2PO6B 3MRLA 5CD3B 1EH9A 4A6YL 1N0XH 2VAJA 3KCWA 2DTMH 2CH8A 1PIFA 2QELA 1QBBA 5IMOA 5K1NA 1YN7A 1Z3GL 4E41A 4MMYB 4NX0A 1OGAB 1PFOA 3QJHB 1KZQA 4MNQA 2BRRH 3UTPE 1NGXB 4EN2A 1B0GB 4IOIA 1YNTA 4PEEA 5HDQL 1QTSA 5HGBB 3U79A 3TIDB 2I25N 4LAQH 4LO9A 3HUJB 3BP5B 3GS7A 3QORD 4LOEA 1OALA 4GMSL 3FK3A 3RVVD 1LP9A 3NCJH 4XOAA 4HAGA 4MXWL 1LEIB 1HE7A 1JGDB 5I1HH 4N0YL 3QZOA 5IROD 1XH2A 4AE1A 5KJRH 1Y6KR 5HHOA 2ZWSA 4NJ9L 4WSKA 5DRNA 4KI5E 1NWPA 2NY6B 1RJLB 3K8KA 1HNFA 2V3DA 2BNQE 4OLWL 2CLZB 1U8HB 5A16B 1TMCB 3MBWA 5JUEL 3QJFA 4DW2L 5C9JB 4W4OA 5D7LB 5JHBA 2X6AA 5HYQB 3QDGA 4HZLA 5DMKA 1TTBA 3QJQB 5GGVH 1OGTA 3AGWA 2NX5E 1BZEA 3V0WH 4LSUL 1HHKA 5DJXB 3MC0A 1A4CA 4PD4K 2C3GA 3UMTA 1MW0A 4A2HA 1L6ZA 1J05A 4Y1AA 1QBAA 4HKJA 4J3SA 3H56A 5H35A 1BREA 1J1OH 3ARDD 3W38A 1UM5H 2PWGA 4XVSL 1B0RA 2FQEA 3EH1A 5JHLH 4KZDL 4FQXD 4OZIF 4JVPA 2Z4QA 2VMCA 4OGAD 2XA8H 3U9PL 2TSAA 2VZ3A 2VZUA 5D1XD 2FWOB 4KGLA 4ANUA 1MG2C 2V33A 2O5XH 4JMXA 5DEJA 1RULL 1FA4A 4WUUA 1HZLA 2RQ8A 3E6HB 3MLVH 1ET7A 1M57B 1G43A 3S37H 4L37B 2HRGA 3PIQB 1QSEB 4MKMA 1UG9A 1TJMA 3QE5A 1RZ7H 1GSMA 2VJ0A 3AAZA 2NZ9D 2F58L 2UUDK 1ESOA 4JREB 3V52H 4AG4L 4EIUA 2RMNA 4N1EA 1L9QA 3PP3K 2IDCA 2GUYA 1YEHH 4HK3J 3E8UH 4EZKA 1BP3B 2WUBL 4U1SA 1BZ9A 2XWZA 2X2IA 4GAFB 4PJ7E 2VXTL 3B3BA 2H0FA 2HX9A 4OH2A 5E9DA 5IB1A 2J2ZA 3PL6D 3BPCB 3FUMA 5A3ID 5DURB 4NQDB 3DI2B 1Q0XH 1NC4D 2EZ0C 2FNBA 3PWPE 2DWSA 4WHYG 3Q2VA 4ZOEA 3QIBD 4OKVA 5KSVB 1N10A 4Z3FA 1AQMA 4HC1L 2BP0A 3BISA 1J9QA 4XP5L 3VX1A 1M6OB 5GRXG 4BUGA 5DQJB 4ZFZB 1ND0A 3U7YL 5DA4A 1F6AB 3PCYA 5IBLC 3UROR 3SQRA 2TRHA 5IMLA 5D1XB 4OJDH 2BHUA 5TD4A 3L3HA 4OLZL 2BW5A 2VUYA 3L9EA 3P2TA 1CFSB 4PD4J 5KEZA 3L3GA 1OT1A 3VXQB 1G0YR 2MCPH 4M5ZH 5CEXA 5AD0B 5I6XB 5IFHL 3QRGL 3GRWA 4X80L 3AU1A 4J3OC 4XCCL 2JI1A 4HIXH 4UUJB 4Y16B 5K9KA 2IXQB 1SLVA 5TQ0L 4NWTL 1P69B 1AHMA 4QKXB 4BFBD 3I6LD 1SLUA 3KJ4C 3OBAA 5JLZB 3RILA 1A4JB 1KB5A 2EIDA 3GMPA 3OAUL 1B2WH 4P5SA 1AGCB 4XN2A 3DHJA 1EJ8A 3A3YB 2OL3H 1EJ6A 1IKOP 4JY5H 1FYTD 4F3FA 3RTQD 3L5HA 4H25B 3S9DB 1PDKA 4TSBH 3CHRA 1HINL 3SQOH 3TURA 4WFFD 5BOJA 2PR4H 5CGMA 3ABZA 3LKOB 1AC0A 1UXWA 5G2NA 4LPUA 1VB9A 3U4EA 1KEML 1MVYA 3A4FA 1CL7I 5FM5M 4FP8H 4UOW0 4WI9A 1DVFC 1JGEB 3QIWB 4XO4A 3CX2A 2A9NH 5EZLB 3GHBH 4EUPA 2F8XC 1KIQB 1QTPA 3NACH 3A6BL 1AGBB 3C8HA 1RZ7L 5LGJA 2AJYL 4KTEH 4NM8H 4XO5A 1MFCL 4GSQA 4GRMA 4WWKD 1XGUB 3Q8AA 4J3UA 2AVGA 3VDCA 1JWSA 3VYNA 2PWHA 4Z5RA 4C56B 3RWCA 5LDSA 1YUHB 25C8L 1IM3D 1E3XA 5AYUL 4CBPA 1WCBB 4PHZA 4HD5A 4OZFG 2R2HB 3FXIC 4N2EA 4QHKI 3D09A 2X4TB 3DHMA 1ZAGA 1P53A 4LCWA 4A66A 1FNEA 1ORSA 3MRFA 4QT5A 3RUGE 2ICEB 3RWCB 5I18H 1MRCH 3D2UB 3ULUH 2IAMD 4FL4C 1CFMA 3PGDA 5CNHA 1GRWA 2VDPB 1AHWB 1T04A 3C5ZB 3JV4A 1SXBA 3FB5B 3MV9B 4ODSH 1UACL 2A6IA 3D3VD 4KDVA 1LQBC 2FR4B 4XMLL 1KCRL 1NL0L 4J3OF 3JYBA 5K9QG 1KXVA 5M94B 3B1TA 4I87A 1T7ZA 4QY8A 1FNEB 3UTTE 4PRHB 1CK0H 2O26U 4FDWA 4AKQA 2VKXA 1ZSDB 1TPXB 4I48B 5AAMA 1RK1B 2AITA 4MB1A 3LZOA 4GI6A 1MHPL 3B2MA 2Y1YA 4QRRE 1AKJB 4N0CD 1PLAA 1NMCC 4BE5A 4BQ9A 1YEHL 4PLKC 5D9SB 5J3HD 1B3IA 3O3DA 3D12B 1GAFL 3FQWB 4OLUH 2J8HA 3WLWD 2FYYA 3AREB 4NQEA 5JMRA 3BJLA 1ZTXE 2ROYA 4JRXE 3B9KB 1BV8A 1Q72H 4KKNA 4D9LH 1JUFB 1HT6A 4HUUB 2K1MA 3P30L 4CNIB 4WIQA 1B4RA 2WTOA 3KL0A 4G9FB 1I8AA 3L3IA 1MCHA 3WNIA 2GCYB 1NDGA 1XF3A 2OP4L 3EFFA 1OE2A 3KR3L 2DYPB 1HX0A 5TK2A 1IBHA 1EXUA 4IBSA 3B2VL 1KPRA 4RAUB 4BIKA 2YC1A 3WY2A 3CK0H 4GYBA 1Z5YD 3HAEA 3P0VL 3JWOC 4OZIB 2ARWA 2BFGA 4R9HA 3SZ6A 4B9JA 5C92A 3IXAB 5FHAH 3ARBB 4PCYA 3MRJA 5F6HJ 2AEOA 5INCB 4HJIA 5F9OH 2K3HA 3NA4A 3S8WA 1VADB 1XSKA 2DS4A 1AO7D 4R2GB 4KK5D 2MNJB 2ZXCA 3BT0A 1N18A 1QD0A 2ICWB 4FZEH 5D2LF 4AM0B 5MENA 1O6TA 1NJ9B 2OCFD 4XHJC 5D2LB 4OIFA 4G7QB 4KKAC 2AW2A 3IMTA 1G5AA 1MXGA 3ZZSA 4V33A 3VTTA 1RL1A 2XDHA 3OKOB 5ICXA 3DX6A 3N42F 1K3IA 1S3KH 2ITDB 2QPEB 2XA8L 3FU7B 3RFZC 1MRFH 3JT0A 4P2YA 2A6KA 3A24A 3D4GA 2EDNA 4HPHA 5JLZA 5CZKA 4IKIA 2J8OA 3ALXA 4YDLB 4HC1A 5E8NA 2GBTA 2JXMB 4BCXA 4P9ML 2WBXA 5ICXB 3WELA 5EU5B 4NLAA 5GGUB 2Y5TB 3HE6D 5HYEA 4MJ6B 1RAMA 1UYWL 5E70A 1OT2A 4HIJB 3VE0A 3B56A 4F33A 5ETUB 3MLVL 1EUUA 3BQVA 1ZA6B 2C4FU 4HT1L 4E41E 3MJWA 2V9RA 4XHJD 4JFHE 3HZMA 2O5YL 3C6EA 4LEOB 3BXNA 7PAZA 3N41B 3ZDZF 2HN7A 4NBXB 4JHUA 4JHWL 2LLNA 3PP4H 3IU4H 3S88H 3OX8A 3G5WA 4P04A 2PP8A 3GPSA 3P73A 4YWGH 2EINB 5D96C 1XF2B 4YHYB 1R3JA 1UD2A 3G5XA 3H9YA 4NKIH 4Z7QE 4Y9FA 4YHZL 1PX8A 3RLSA 2YQ3A 3CH8A 2EC9U 3X1BA 1T66C 3LDBC 3GS4A 3WFZA 5EUKB 1H0DA 1DUYB 3O6LL 4DFHA 1J9SA 1XAUA 1G7LB 2MWCA 2CK2A 4QOKE 4Z3EA 3E2HC 1SXSA 1WWAX 5KBMA 1CGSH 2YAPA 1CDGA 3QPXL 3RNKB 4B5EA 1TNNA 5C0AE 3QPQD 2NUTB 1KCWA 3LNGA 2DD8L 2KC0A 3R4DA 2Z92B 3MRMA 4MZ3A 4M1GL 3VTAA 3F7YA 4CMHB 3AT0A 3DX4A 1U3HA 4IQHA 3QYMA 4HS6A 1I82A 1TJXA 5H35B 2CR6A 5KVEL 1KY6A 5TDPB 4NI3A 5AOKA 3PUCA 1AIZA 4MCYB 5AG9A 1IC5L 3SBQA 2MPAL 4X5LA 2FCBA 1W2KT 4FI7A 4H26B 4RFOL 2WGXA 4MQXD 3V5DA 2NNRA 4OUUA 4NUGH 3FTVA 5C3IA 2JJSA 3OV6A 4Z3TA 2UXGA 3L5WA 5F9DC 4OZGA 3CMOL 4HIEA 3PJSA 5EEXA 4G6MH 1JNLL 3FOMB 5F89B 1YMMB 3FN0L 5LCVH 1HL8A 3MX0A 4KZCA 5FO7A 4FP8L 1QX1A 2RACA 4OW6A 4ZTEA 5AOLA 5F88B 3ZX1A 2Y06H 2GK0A 1UKTA 5D8JH 2DQIL 2Q86B 3QEGH 1YPZE 2AI0L 3BJ91 1XGQB 5C0IA 4AC2A 4I2XB 3BQUA 1MNNA 5CINL 3NCWA 2R83A 1UCBL 2VWEE 1FVDA 3UADA 3GK8H 1MUJB 3MGAA 3DIFB 5KVDL 3V0WL 1I53A 4MD5A 1INDH 4L8CA 5KUKA 2AQ1A 4W68A 4W9FC 3MV7D 2D3JA 1T1ZA 3GXDA 4J4PA 3D69B 1SQMA 1U93A 3UAJD 4YSSA 1WH0A 5IK3A 2EXWD 4XNZC 4P9HC 4NFDA 5F9WB 3BW9A 1G9ML 5K9QI 2P26A 5B1CA 1AQKL 3HHMA 3X3GL 1R4XA 5DI8A 5I8OH 1XZ0A 1CFNA 4NQXA 2EDBA 5D4JA 2R39A 5L88L 5AZ2H 3FN3A 2BIPA 1A6UL 1ZGLP 4KJQC 2V2XA 2EDOA 4PJIE 4PJDF 4UTAH 3NCJL 2VQ1A 1G6RA 5AW6B 3ALPA 3L3DA 3U2JA 1AP2B 5EUOA 4PGDB 1BMZA 3UL4A 2R4SL 4FQ2L 1D9KB 2HRPH 5T1LA 3A6CH 4X50A 2H45A 5E5MB 3ARED 3RVXD 3GSNA 2J2ZB 4LHJB 2ZXWB 4UAOC 5HYSG 3FB8A 5I1EH 1RERA 3VXMA 3AC0A 4ODHH 5I19L 4Y19D 2MSPA 3T6VA 2Z0BA 5CGYC 1NKGA 1PW3A 4DKFH 2VLRB 4LPYA 4O58H 1UWGH 1NKRA 4AKPA 3FB7A 1NBYA 1UHVA 1KXQE 5C0FA 2VXTH 3S5LA 4BM7A 1PEWA 5I1GH 2ZJSH 1SDYA 2J57A 3WNPA 1LD9B 2Q1EA 2NY0D 3GSNL 4YHPB 4XMPH 4KJWD 2DJ4A 3RPBA 5IESL 2Q87A 1NUNB 3IMUA 3DDGA 3UDWA 3GKZA 3RBGA 4YE4H 4JZJC 3X1FA 4ZOAA 5E5RB 4JFQB 2QTEA 1E43A 5K9JL 4HAKA 4F9PA 1M6OA 4DP9X 2FX9L 3DYOA 4YGAB 4XO8A 1I3RB 1FV1B 5D2NE 1M2VA 3G5XB 3TBYB 4AKOA 4QLWA 1U8PA 3N5AA 3K72B 4MJ5A 4PJEF 3V0GA 4OFYD 1WWBX 4NPYA 4ELMA 2E5EA 5IQOA 4L0PB 4L3EE 3TCXA 2VXQH 4ABQA 3UPAA 3IFPA 1TKWA 5EU6B 3ZR5A 4ZMTA 2OTWB 5F0PB 3BLPX 4UM9A 1OL0A 1WZKA 2WGNB 4KJWC 4S0TD 4XP6L 5FM4A 1HZKA 2Y5EA 4F9LA 2XFXA 3EOAB 3GHEL 1K2DB 2C9SA 3GGWA 3ZTDC 1TVHA 3MDJA 3UPCA 2O6DA 5GS1C 2VW7A 4Q6KA 1A4KA 1I1FA 5DD3H 1EHLL 5BO1L 4JPIB 2WLIB 3D08A 3HE7C 4JN1H 4NUGL 3ELAT 3PLYA 4AL8H 2ZG1A 4XMXA 2X2UA 2DQJL 1GAFH 1JPSL 2EDMA 3P3TA 1VZHA 3Q1SL 4NN7C 2DLFH 2VJ8A 5FO8A 1AQDB 3IKCB 1PLCA 1KEMH 1CPUA 1OP5H 2CLRB 1C1EH 5DZOA 3I6GA 1YUHA 3ATAA 4MA3B 4EMZA 5G4MA 1R5IA 2P47B 4IDJL 1CBJA 3V5KA 2VDMH 4NC0B 4O02B 3BWUC 1G1OA 2HVKA 3IMRA 1YMMA 2GSIB 5E8DL 4ZQKA 3V0IA 4QRQB 1H8OA 2BIHA 2ZYSA 3T1FA 2KPNA 5KBNC 2X5PA 5GJSH 4F91B 1AO7A 2DQHH 1WT5A 2VABA 3TYGL 4OI8A 3WO4C 4PVNA 2WXFA 1LYQA 4P23D 1HOCA 4KMTL 4XNXH 5DC0A 2F54D 5A16A 2OFQA 2P8PB 1QRNE 3RBSA 3U1QA 3NABL 3ZT6A 2VDLH 2X6CA 5L2KE 4GAYB 1MQ8A 1G7PB 2HKAA 3TF4A 2A6DB 2X70B 3LQMA 3X3GH 4I0PB 1KFAL 3D25A 2WY3B 5DVNA 1BXXA 2PW1B 5EZJB 4XZUB 2LE9A 3NCMA 2IADB 1T0MA 3NN8B 4LCCA 4H1LH 5IW6B 4KQ3H 5DUML 3QPXH 3CPUA 5PCYA 3SCMD 3VACA 4D8OA 4NCDA 2QKSA 4JPWH 3QP3A 1CQYA 3INUH 2CJ3A 4GXVH 3W9DA 3OKNA 3C09C 3WTYA 2NR6A 1NJ9A 5IVXF 2DKSA 5AVTB 2Q6WA 5DURD 1E67A 3JTTB 1DSFH 1OQXA 2GJZA 3IPFA 2PP7A 3IPBA 3ZHNA 4XBPA 4JE4B 2NY4D 3OKLB 3Q5OA 3U30C 3H42L 2XXMB 1YYLL 2YD2A 4F7CB 2PYFA 3O4LD 3OC8A 4LSTH 4XAKE 2IPKA 1H6FA 1S7UA 1AZBA 5E8OB 3SPIA 3C6LD 3MUGA 1K8IB 3MLUL 2BP8A 5D71H 5AYUH 4DKDC 1S7SB 1CDHA 1T7XA 4JNXA 2QKIB 2JKWA 3I9AA 2BNQD 2CGRH 1N64L 4K2UL 3HW7A 5E6IB 2BVYA 5GSRB 1AD9B 2WVVA 4M5TA 5DA0B 1ONQA 1OSEA 3GSQB 5DS8B 3IJEB 4O2FB 1NEPA 4MJHA 2ZIDA 4XVUC 2R0ZL 3DURB 4NPKA 4DP6X 2WZAA 2PXYB 2V4LA 3LPPA 5DCCA 4ZZFA 1OM3L 3DJ9A 4Y89A 1WA2X 1S5HA 5KSAC 2AJZA 2VDKB 1CDUA 1HNGA 1TZGH 4NKOA 1IEBA 3C08L 2BCKA 4UTBL 3FU7A 4PGBA 2ZXGA 4PBDA 1Q0YH 2OPCA 1R3LB 2JB6A 4C83A 1VGEH 2C3XA 3S4SA 4NBZB 1XGTA 2JCWA 3VWKB 4DP8X 4MJ5B 1NGZA 4ODTH 4K23H 1Q4NX 3N9GH 1RZJH