5LBVA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
403
structure length
390
Chain Sequence
IRCIGVSNRDFVEGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGDLYYLTMNNKHWLVHKEWFHDIPLPWHAGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords envelope protein E
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
total genus 85
structure length 390
sequence length 403
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbvA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbvA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbvA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbvA03
1ZTXE 2V33A 1OKEA 5LBSA 4L5FE 5LCVA 4FFYA 4ALAC 2HG0A 2R29A 3VTTA 3UC0A 4X42A 1URZA 5LBVA 3N40F 4BZ2A 4BZ1A 2GG1A 2JV6A 3IRCA 5GZNA 5IREA 5JHLA 1Z66A 4GSXA 4UT9A 1UZGA 3G7TA 3N42F 5H37A 3UZEC 5B1CA 2JSFA 5KVGE 1S6NA 5KVDE 3UZVA 5KVFE 3N43F 3C5XA 4GT0A 4AL8C 4AM0Q 3P54A 5JHMA 3J2PA 1PJWA 1RERA 3N44F 3J27A 3UAJA 5KVEE 4UTAA 4UT6A 4UTBA 3UYPB 3I50E 4FFZA 2H0PA 1OANA 2I69A 4FG0A 2ALAA 3WE1A 5IZ7A 2P5PA 5GZOA 2R69A 3UZQB 5AAWC 2JQMA 1SVBA 5AAMC 1OK8A 3C6EA 1Z3RA 3MUUA 1TG8A 3N41F 4UTCA
chains in the Genus database with same CATH superfamily
4TRPL 1T20B 2R1XA 4YR6A 3MLTB 2EDYA 3K81A 1BX2A 3GSXA 5GS3A 3TPKA 2BDNH 4WF7A 4APQD 3GTTA 4ZMLA 3G5YB 1SBBA 4HWNA 1JRHL 5I71C 3VE0B 4OZHB 3DETC 2ZWSA 4N0FA 1GRWA 4RWHA 5B38A 1IGFH 1LMKA 2PTTA 3A6BL 4X6BB 3SZKC 4YZFF 1UT2A 1G7IA 1SXBA 4DW2L 1FORL 3PHQB 2WLIA 4XO4A 3AWGA 4P5MB 4ZS7L 2AQSA 1AQMA 2UX6A 1JWSB 1A65A 2R0KH 3FONB 1JZDC 4E9SA 3WS6A 1WZLA 3INUL 3RX7A 2JCCA 2XSKA 2XN2A 3L5HA 5DSCA 5ICUA 4R5XA 5IMKA 2R51A 3B2XA 2VO8A 3DLQR 3FQRB 1EGJL 2FO4B 4NOFA 4DGVL 5KVEL 1Q9KB 2ZCKH 3MBEA 4PJ8D 4Z7WB 2QQQA 2HJFA 4FQLH 4PG2A 4U1NB 4EF3A 1D5ZB 1MFAH 2IBGA 3IU4H 1R3LB 3PG2A 4JFPB 3WNPA 3NZSA 1VIWA 1WK0A 5IKCA 1YUKB 5C9JA 2ZICA 3BC9A 3QT2A 4OD1H 4AUUA 1M7DA 4UT9L 1B0WA 4O2CA 5FYJE 5G55A 5SWSD 3ARGC 3TF7C 2AP2A 1HL5A 3ROLB 3SKMA 3B4NA 3BSGA 2CHXA 4HUUB 3ZOAA 1AZCA 1DBJL 4RETB 3X1GA 3VD9A 1N5YL 5LNEA 1TENA 2BZDA 5AOKA 3U6XA 1OTUC 4A39A 5BZDA 2JKXA 3AMKA 4QRTB 5ENWB 2XKSA 4X6EB 3ZTCC 5FS5A 3TJEL 3U0PB 4HJGB 3CUPA 4K3DL 3BH8A 5TF1H 1DANT 1BM7A 1GHFL 3R0NA 2D73A 3QWRA 1CWVA 3QUMB 4FHBD 3BPNC 4KKBC 4MCYB 5DD0H 2NNFA 2BIIA 1FNGB 5BRZB 3RY4A 1EHAA 1FJ1A 2A74B 1B9ZA 4JCMA 3AU1B 4WENB 3ZDYB 1PZ2A 2BSSA 4RMVA 2RGSA 3MCKA 2HFEB 4W1TA 2ZWLT 5A2CA 2OXHB 3BKYL 1H3PL 1XF4A 1VGEH 2P52A 3KHQA 3KPNB 5K39A 3BIKB 3NACL 4BKLA 3A24A 3SDAC 1WAEA 4NQUA 2OSWA 2E7DA 2ZUVA 3BVUA 2CIKA 1JGIA 3ARDA 1IAIH 3PGCA 2QT6A 3VRJA 2DI8A 4PYGA 1O5DT 3EGDB 3VI3B 1ZS8A 1TDQA 1TNMA 3F7PC 3IU3A 3Q2NA 4Y5VB 2UXVA 1U36A 3QZOA 2CBTA 3SN6N 3DO4A 3VXMD 5KYXA 1U8CA 3GXNA 1IQDB 3DX0A 4PJ5D 3VTTA 3PDGA 1WO2A 4G43B 2YD6A 2MKLC 1TPXB 4W6XB 3NOIA 5DQ9B 4OUUB 4K3EH 1IU1A 4OLZH 2WXJA 1FP5A 4BH7B 4S1DD 4Z3EA 3VXUA 3IRCA 3SKJH 3SIKA 1KJMB 1GGUA 1MI5E 5DUMH 4PCKA 4HUWB 4IOFD 3OKDA 5AOIA 2ZP0T 2DJ4A 3BVXA 1ZAGA 3LMJH 4NZUH 4N2DA 5GIRB 3QQ9D 5DYOB 5FO9B 3D69A 4JLRA 4WW2A 1HCZA 1ZHBA 5K9QI 4XVUD 2HUHA 5JW5A 3DMMA 4Y9FA 2ADGB 4RSYA 2HVKB 2R83A 3ILQC 5KVFH 3ILPB 1W6LA 3GXDA 4WY7H 2A1WH 4XCYA 5AUMA 4HXAH 3K2UL 1N0LA 5EC1A 3OLEA 3MJ8B 1HWHB 5IEHB 4JZNB 1OF0A 1OSZB 2KZBA 3WXWL 3SE8H 1A9EB 1YNLL 4YUEL 2OMZA 2PR4L 4ZTPH 4L2YA 3PNRB 3P73A 4J3UA 3I02B 3ESUF 3QWQB 2PNDA 3HBGA 3BO8A 2ADYA 1GPOL 2OMUB 3ARBC 3QFJE 4C56E 2CCWA 5D7LB 3REWB 1U8NB 1CDUA 5HJBA 2NY0B 4GT7A 4UNVA 3NIFF 3GJEB 1ZPUA 2FQGA 5ITFA 3IYLW 3UYPB 2EUZA 1FYHB 3T6QC 2V2TB 3IGLA 4OD2B 4CJ1A 3QEGL 2OR9H 4HPOL 1HJBC 3DA0A 1CE1H 1Q9LB 1KDIA 3LVTA 2JMRA 5JHDE 5HYQB 2CKBH 2R2BA 1KIQA 1MFCH 3KGTA 1OW0C 3T0WA 3NTCH 4JO2H 3D87B 3IMUA 1V7MH 2EXWC 4BK8A 3M6DA 3EG9B 3LRSB 3HEIB 5TH2A 1NDMB 3HMWH 1B4JL 5C9KA 4ISVA 3SDDB 2CBPA 2JH2A 1GMIA 5I66B 3CQPA 1WZMA 3IE9A 4J3OD 5FUZH 2FO1A 4ONGH 1U8PA 4AJWA 5IROA 1JWMA 2WN2A 4JFYB 4DF9A 4KWUA 2CLRA 3ZO9A 1AZVA 1NCOA 3E1F1 1P5UC 2JFCA 5E9DD 3QYMA 2I9TA 4U33A 4YBQC 4PJ8A 5C0CE 4HJUA 4NJ9L 5IESH 4YWGL 2Q1EA 3PP4L 5K9OA 1HEJC 2EYTA 2WXNA 4R7NA 5D1XE 4UQ2B 4LCWD 4WHTA 3G5VB 5T8IA 4YSOA 3ZMEA 3MLVL 1J0KA 1CL7I 4NQEE 4D9RE 3LQAH 1PYWA 2NNRA 1C8PA 3BSZL 3ULUE 1E27A 3DECA 5FO7B 3VXRD 4DCQA 3FUKA 1YEEL 4L4JA 2A7BA 2QSCL 1NMCB 3CDYA 5DEFB 1BVLA 3RNKB 1MCDA 5JDJA 4AGPA 1QTPA 1INQB 5DWPA 2LW5A 4X8GA 5DGRA 2B5IC 2QQNH 3NN8B 5I1IL 3EFFA 5GPRA 4LSPH 4TKWA 2CNYA 1YZZA 4HCRL 4Y1AA 1DN0B 4KTYA 1V5JA 3MI6A 4FZ8L 4XN4A 4QRPD 3JBG7 3CFMA 3RGBA 5BW7A 3VNYA 1TLKA 3ZO0A 2GJZA 2WVVB 4K7FB 3K6SB 3PWLA 3W0WD 5DHXB 5GGQL 1NWOA 1I4FB 1PJWA 3BAEL 4LHUB 4N0UB 5D9SA 3ULVE 5F9OL 5CBAA 2BM3A 5FWRA 2O6DA 3IVKA 2JELH 4GG6B 2GVYA 1GJIA 1E9OB 1EXUB 4WV1A 1D9KC 4NBXB 2AK1L 2Z64C 4L3FA 5DRNA 1FL5B 2XXCB 3V52L 1WPCA 4LLWB 1MAML 4F37F 3VXOB 2WQUA 1E3ZA 4J27A 1X44A 2AV1B 4LSDA 4EI5B 5JDSA 1TJMA 3WNNA 1AP2A 4KQ0A 2RTTA 1YN7B 3AACA 4OH2A 1KTLA 3VJ6B 1UB5A 5ESQA 5IIEA 2GK0A 2DQUH 4N6RB 2GJ6B 3CHOA 2D3LA 3VFMA 4BZYA 5TK2A 4H20L 2DD8L 3AG3B 4AE1A 2QKIB 4P4KA 5HHOA 3QWOA 5ID1B 5EIIA 3QAZB 3QE5A 4IBTA 1ZTXH 3MV8B 4FQXD 2EDMA 5I1LB 3ZSSA 4X5QA 4URKA 5B1AB 4Y2DD 5T3XE 1OKEA 4FCHA 1G7PA 2AEQH 2ZX7A 1VKXB 4RNRA 3MDJA 5I73B 2OP4H 1QUPA 3KNBA 4LLDB 3VSVA 5I1EH 1UWGH 3N50A 2DWYA 3ZVVA 3TXAA 2F8VA 1PAMA 2X6AA 3GXUB 1WH0A 4JO5A 1BYNA 2WC7A 2O5XL 5JA9A 5HSFA 1RZ7H 4BEIA 4L3ED 3LS4H 4JK0D 3QVAA 3EFDL 4UZUA 4N22A 4TTGA 1K4CA 1NUDA 4Z7OF 3O8XB 2VDKL 3QIUD 1D6VH 2G9HA 2AABH 3L7EA 4MD0B 5JOPE 4JQXC 1AZNA 1B3IA 5JIKA 4IU3A 4WEMB 4YHML 3V0GA 2H0JA 3RDTC 1CK0L 3S88H 1RJYA 4OCRL 4U2ZA 1XMEB 4BH8B 2XWTB 2A6IA 3RUGF 4M1CD 3ABLB 1F58L 4NKMB 3FKUS 4FA6A 4JFXB 4PBWD 3E80A 4FP8H 4IHOA 2CRMA 2R39A 1HINL 1MAJA 3L13A 2FSEB 5JIIA 3H42L 1NUFA 4HKXA 5CSBA 1ZLUH 3U4KA 3UPRA 2V3EA 1QVOA 1MW3A 4GQ9L 2A73A 5EOTB 3PHSA 2VUOA 4MHHI 4GQZA 3L9RB 1SUHA 1XGQA 4HEPG 1GGIL 4U6VH 1UM6H 1AANA 3I6KA 4LEXH 4XPAH 1BZOA 5D2NE 5FO8B 3BPLC 4O5LH 2UWEB 3BD4A 4TSBH 1OP3K 2BP8B 4Z7NF 5KS9A 3QPQD 1S7XB 5J6SA 2N7SA 4QOKA 5HJDA 3FSWA 5IJKA 1DEEB 2A9AA 2QPUA 4HHAA 1GKOA 4LIQL 4N28A 4U4IA 6TAAA 5LVEA 3FBQA 4N1EA 3VXTA 1UD4A 4NKDA 5A40E 1DUYB 5JXEC 4ZRGA 4S0HA 3D18B 3F05A 3DYPA 4OKDA 5DK0B 2YIHA 1CD1B 2I27N 25C8H 4FNQA 4KX7A 3TO2B 1U92A 4PIBA 2FIKB 4QPEA 4QF1B 4JDVB 4ZFOB 4PGCB 3QUZC 1OAYL 3GZQA 5AG9A 3MNZA 4LAQH 5K69A 2VZOA 5I76B 1MJ7L 2E6PA 5AAMC 3UJIL 4FNLH 3RWCB 5C8JA 3IDNB 2VLRA 3EJYD 3Q6FA 1CDBA 3QHFL 3UGXA 3CFDB 1B0GA 1N2RB 3WNIA 4X6FB 2BHFA 2FR4A 3DK0A 3CH1A 4PWIA 4Z7IA 3HN5A 3HI6L 4Y5YA 1FGNL 1QLEB 1N3NA 1EAJA 2ENJA 1JHKL 2XT1B 1DZ0A 1UZ6F 4BQ8A 4PRAB 4NO3A 4CVXB 1NBZA 2F54D 4Z76A 1X6LA 3ABZA 3MXWH 2DKMA 4ANKA 4DQOH 3MUY1 4ZPVB 3R19A 4ODTL 8FABB 1YNTA 4P57A 3IKKA 1UATA 4J23A 2VDLL 4YL4A 5IG7B 3IKCB 2F5AL 4LCCB 4AQ1B 1TEGA 3ZIYA 3MX0B 5DQDL 1EBAA 1PAZA 1XCTB 2V37A 4XNXL 1Z9SA 3U46A 4UDTA 4JM2F 3WUWB 3U1SL 3KYKL 4R7DA 3MRQA 5IMLB 5TJWK 3PF2A 3LY6A 1W8EA 4XOAA 1M9WA 3IM1A 2YARA 5LDSA 3D09A 4N5ED 4PWKA 1MCEA 1CGWA 4IMLB 1IMHC 3HKZA 3POCA 1IZKA 2AJ3A 3PS6A 4PGDA 1GJWA 4TVPH 1JRHI 2CLZB 3SGKC 4TOYH 4NN7C 2I5YL 3LN9A 3M1OA 4FYQA 3TO4D 4R4BA 1L6PA 4GRWE 3N0AA 2NYYD 3PAUA 1F6AA 1X7QA 3D9AH 1HHKB 4KOBA 4AGNA 4BFGA 2CK0L 5AALA 1AS8A 1ES0B 2VZTA 1XIWA 3OAYK 4KC3B 3V9FA 1FVEA 3MRRB 5E51A 3AADB 4F3FA 5JXAH 3LSOA 4QR7A 1F3JA 1HH9A 2BK8A 4RGNC 4LOEA 2B20A 2W07A 2IQ9L 5FA3B 5FUOL 2XWBA 3Q06A 3KPQB 4NC1C 3REVB 2VH5H 3ALXA 1ZWIA 1TO4A 3VO0A 1CYXA 4YX2H 3VD2A 3C60B 1R5WB 2XZAL 4N0YL 2NY3D 3EJPA 4K15A 4Y2DA 1GS7A 4X4XA 3EO9L 1VADB 2EVFA 1UC6A 2MHAA 2VDQB 1JGLL 4GLRH 3QWNA 4S1RL 4KZDL 2ADFH 2BOBA 2EDEA 4R2GC 2XFGB 5JQHC 2DJUA 3CVCA 3BESR 5J4MA 1LO2L 5LGJA 5JPMB 1CFBA 4OIIL 3NBNA 1FL3A 3MA9L 4G9DA 1IAII 5CCJA 2CKNA 4LAJH 3EBHA 1RHHB 4YFLI 4UCFA 4KK9D 3GSOB 1QAWA 4M61B 5AZEL 3IFNL 3AXLA 2XX1A 4XP1L 5BUGA 2BX5A 4DETA 3FUDA 1XZ0A 1AHMA 1GOGA 5EH1A 2A6KB 2WXOA 1S7WB 1EO8L 5LB1A 3O45A 3WD5L 4E9YA 4UQEA 1DSFH 3RZCD 3QZPA 3CFJA 1J0JA 1DR9A 1GJUA 4TYUA 5HYSG 3N9GH 1TZIA 5AW1B 3ZTJG 4B7IA 5TE7L 5K59F 1YEIH 3JV5A 3Q1EA 1QFPA 4MA1B 2P46B 3K46A 3OKNB 4QIRA 3VWJB 2ZCHL 3JT2A 5J8OA 5TFSH 3PWJA 4TQEL 4YHKL 1LO3L 2PXYD 4L1TA 2MQGA 4BFNA 1SYSB 2B08A 3IMVA 1MH5B 4HFUL 2A9DA 4GXVH 3V10A 4W6YB 5AWNH 4X6CE 5IHWA 2VRQA 2AXJA 5IW6A 1OE1A 1CR9H 4N3TA 1MCSA 4TSCH 4XWOD 4ZMYA 2BH0A 5JZ7D 4IM8A 4UNTA 5EZOH 1PDKA 2ZX8A 1IBGH 4HK3N 1GGCH 3W39B 5GS1B 2IADA 4H8WC 3N6YA 4YL9A 2WK2A 2X87A 1MI5B 3CMOL 3UBXB 1L7IH 1N5AB 5ACZB 1GZQA 4J6RL 2JSFA 2EEBA 1ZEAL 2VQ4A 2YFNA 1U3JA 3KLAB 3AM8A 5KEZA 2ZD0A 3BLBA 4IRSC 5SX5H 1F13A 5LG1A 4Z78A 3S36H 2FUTA 1YJDL 2OTWA 1G0DA 2ZJSL 5C2UB 4XPBL 3K72B 1BMGA 3EDKA 3EHBC 4Z5RB 1QHQA 3H9YA 1XSKA 2QGCA 4K2UH 3LKPA 4WDIA 4YDIL 4NC1E 4DP7X 3VG0H 3ULSA 1A7RL 1R3IL 1FZOA 3KPRA 2V2WA 2EC8A 2VUKA 4M3KB 3QJXA 3FB7B 5DR5H 4HVBA 1P7HL 4BSWB 2GSGA 4ZOBA 3QFJB 4Q8BA 4C56B 5BVJA 1QA9A 4ZAKC 3IT8D 3FO9A 5DXWA 5A2KH 1CFVL 1KCUH 4PJXF 3GK8L 3C6SB 4MBRA 5E08L 2I85A 4QRSB 3SE9H 4P3CL 4X7TB 1NPJA 3UTPE 3TFKD 4F1SA 5KJ7E 2F54A 3QNZA 3S8GB 4FMFA 1KBKA 5JHDB 3RQ3A 2ESVD 2N0MA 3OG4B 5CUSH 3U7AA 5AB2A 4I3SL 1DBAL 1BVZA 1OPGL 3Q3GA 3W11C 2PW1A 4HJIA 1BCIA 2D2OA 4D7BA 3BQUB 3VGEA 3ARYA 3EJTA 5T1KB 5C07D 5EZPA 5HI3D 2J7LA 5DS8A 2WTRA 4LARL 2BFGA 4JG9A 3PJSA 5FXCH 3L3JA 2BVUA 2HPOA 2HXAA 1QLRB 2VR4A 3BKCH 1BVNP 5D5ME 3P3SA 2A4CA 2F0CA 4XP9L 4R90H 1JV2B 1UQSB 4M5YL 3TO4A 4OFYD 3TZVB 3S3DB 3ZKMD 2VWEE 2OQJB 3B9KD 1AVAA 1MXDA 2JKSA 3BJLA 5I17A 4ZXBC 4Y8AA 5C0CB 1NEZG 2DZEA 2P26A 2EDJA 3PABB 2HN7A 2NXZC 3NP3A 4HKZA 3CNKA 5E5MA 1Q9WA 3FO2B 5D1XB 4JG1H 3I6GB 2WBJC 1EFXD 1FZMB 3CVHH 1MCOL 2HP4A 2V9RA 4UTAH 3GEWB 5B8CC 3F7YB 1MRFH 1VPOL 2JXMB 4NQEB 3RFZA 3Q2WA 1DN2A 2COVD 3O4OC 4N8UA 3T8XA 3SPIA 2A6JA 2QMJA 4XNMB 4NQDA 1P9MC 3H9HA 3RKPA 2IAAC 1X5YA 4PRNA 2X4PA 3PIQB 4JHVA 3Q05A 2YMXH 4AZ8B 3FK3A 3VRLF 3C6LB 5FKPB 5LN8A 4ZUWA 1UASA 3E8UH 4RZCB 1DVUA 3B2MA 4MD4B 1R5IA 5DQJB 5C0IB 2VISB 3MRPA 5EB9A 1Z5HA 4GS7B 1XWVA 3D51A 3B3BA 4A38A 3FT4A 4OLWH 3GJFH 2HWZH 4FD0A 3ECWA 5T3ZH 2Q9OA 2G5BB 4UT7H 4JS7A 1M2OA 1PFOA 3H4FA 3V4VB 3ZQ9A 4DEWA 1H15A 2R2CA 5DS1A 2D7MA 4GI9A 4TVSa 1MOEA 1JPST 4GINA 5FHAH 5DEGB 3GB7A 3WMQA 1D6EB 1MIEL 1MIMH 2GYSA 1VFBA 2X4UA 4DN3H 1AIFA 2BNUB 4LASL 2NCEA 3QJOA 3MCLL 2Q6WB 5C0JB 3LDBB 5E23A 2B0SL 4NRYA 4FFVC 4PJHE 5HDQL 3GXIA 1PD0A 32C2A 3E6HA 4PJDF 1WFOA 1XHHA 3BGAA 3HI1B 5IK3B 4C57C 4GQRA 2WWKT 3VA2C 1RIVH 1WC7B 2FJGB 3EYUH 4JDTL 3RWEB 2PXYA 1JN6B 3FH7A 3W57A 4E41A 3HI5L 2R1YA 4OF8A 5ACMA 1CGXA 2VLLB 1NGPH 5BV7B 1V3LA 3S3PA 3U7YL 2FEDC 3WTWA 1Q4NX 2K6YA 2YSSB 5KAQG 5G5DA 5FYKU 4PTTA 5EU3B 1H3WM 1RAMA 4FRWA 1OANA 5C0DA 4WTZA 1IC4L 2BIOA 3DX8B 1QRND 1TPXC 1TQUA 3O2WL 4J7RA 3WNMA 3DTDA 1MG2C 3TBVA 4MNGE 4H0LC 2AJVL 5AAWC 1Z2KA 3T6XA 3G6AA 1ASOA 1BBJB 1WT5A 2QR0B 5ID0B 3BW9A 4ODHL 2O5NA 2ADJB 1BD2E 3VW3H 1JZHA 1G6RA 3VD0A 4YFLF 2OMNA 2JI1A 3SE4C 1CF8H 2YGVA 3QYCA 4IBSA 4DP4X 3S3CB 2NXYC 3FT3B 2WQ8A 1IKNA 1FIGH 3MBWB 2DQIL 3HNTH 3HCVA 5I8CB 3ECBB 3OAZK 2DEXX 3FB6B 2D2CC 2QSTA 5D1QE 2PYEE 4NN5B 3U25A 4X7EC 3PY9A 1BGXL 2ADIA 5EU6D 1NMBL 4DTGL 1U8LB 2FQFA 4L5FE 2XV3A 5HHMD 1FV1A 4HWBH 4HJ0D 1HIMH 2VITB 2XOTA 5LCVA 2CO1A 3V4PB 3TBWB 4Y7OC 3PFUA 1ZGLM 1DO5A 2H5UA 4YE0A 4NCDA 5PAZA 3QEQB 3UTTD 2X1PA 4PAZA 3GLEA 1LEKA 3KZ8A 4LPYA 5E8OB 3VSUA 3UJJH 1E2WA 2P7TB 3E6FA 4EQ2A 1NEPA 4LSUL 1IKFL 2NY0C 5E00B 5AOZA 4TF4A 3L3OB 1B6DA 1QUNA 3VI4F 1NC2B 4Y5XA 3WYRA 3KLHC 1MJUL 2JIXD 4NFDA 4ELKB 4NM4H 5HHVH 1BQSA 1DUZB 2YPVA 1NEUA 1G1YA 1NKOA 4OIFA 3HS9A 3M7OA 4I0PD 4AVKA 2B2XH 1BYOA 4JDZA 5CWSB 1JXDA 1MCIA 2ESVA 3FDWA 2XA3A 3ZDZF 3QXAB 3UTQA 2IAMB 2UUDH 3V0AC 1LJMA 5D7IB 5BZZA 3FXIC 2ZPKH 4XZUA 2RCSH 4L18A 2VSKB 3PQYA 4DAGH 3ME0A 2Z31B 2JI2A 2H3NB 1PKQE 2X4SA 2AXFA 3COOA 3FB5A 5LBSH 4X7SL 2BWDA 4YHIB 3E2HB 5IBTL 1U8QB 4FC3E 1JS4A 2NTSP 2ZXQA 3L1FA 2C7UB 4ZOCA 5DZAA 3EJRA 4P2RB 3JYBA 5DMGD 3U36A 3BHBA 4LB8A 3QRGH 3QZLA 4RA0C 4M03A 4PD4K 1MWAB 4OFYA 3LH9A 4JY6B 2FQEA 4JY5L 3B9KA 4GYBA 5EBLB 3MLZH 1HWGB 3MCG1 1NM9A 2E9WA 5IV2B 5JYMA 2BSBA 3QORA 5F7EL 1ZD6A 2J6EH 4OVUA 5F3FA 5HJ3A 3NGBB 4D9LL 3OXRB 4HAKA 3EKCA 2BCKA 3HE6C 2WJ7A 2CE6A 2Q3ZA 1I8IB 3LZQA 4HD9A 1A6TB 2V2XB 4OJYA 4KK6C 4BGDA 3LNIA 1KBPA 2EKSB 2XZCL 3DSFL 5FGBA 5GISL 3K6DA 4A6YA 1NMCC 1E4JA 4PSPA 2WN3A 4LBAA 2RIKA 3WIHA 3HPLB 3HC3L 3B6SB 3L4WA 4LHUG 5J12C 4GRMB 5LGHL 3RI5K 4HFWB 4ZFZB 1AR2A 1XR9B 1CLZL 1UA7A 2DQGL 2YFOA 3DRQA 3CU7A 4A7SA 3S35H 1GGBH 3F5WA 4OLYH 3VXNA 1YEHL 4XE0A 4FI8A 2A77L 3T1FB 3N41F 1KCRL 3L5XH 1N8OE 2IOIA 3H6JA 4Y4KD 1CN4A 2J8HA 1NA8A 2H6PB 4KKPA 4TV3A 2DQHL 2Y3AA 3I84A 1MJ8L 4PQXA 1TKWA 1DANU 4PJBB 1DSYA 1U6AH 5EHFA 1U3HD 2BNRE 4M1GL 1CJYA 1A64A 1C5DA 1AHWB 5ISZD 1L7TL 5DHYB 3QNYA 3CDCA 4OFPA 5CP7B 3VVVA 1H6UA 2BSCA 1ND0B 4KK5D 3VH8B 2DQDH 4P48A 3L4YA 4J12A 2YXMA 2YA2A 2IAND 1ID2A 3GS4A 1XQ4A 3MGTB 1Y18A 4R4NC 5F7YC 3X17A 2ICEA 2DQTH 2X0VA 4AM0A 4ODXB 4Q6IC 3DOHA 5HHQB 4C58B 2WQRA 2WW8A 1KB5B 2XTJD 4JREB 3WN5A 5KVGH 5JR1H 5GRVK 1RPUA 3P9MB 1AXSB 1OTTD 3B7TA 5IGXH 4WUUE 5FFLA 1M6UA 3LKRB 1Q90A 4JM0A 4WI3A 3FL7A 1QRNA 4X7DC 1T89A 4BDVB 3HJ0A 1XCQB 3KL0A 4HC1A 3U1PA 1OAQH 2J1XA 1YQVH 1P7KB 4AL8C 3ZHDA 3Q0HA 4YXKL 3IJYB 4F2ME 4N2HA 1IEBA 3G08A 2JKWA 2W38A 1U93A 1P1ZA 3N04A 4PJAF 2W80C 3WNLA 4F9PC 5CJOH 4X4ME 1MCRA 4OJAA 2A6DA 4WVRA 5E2WH 3L7FA 3KYNB 2ZX5A 3T4AB 5IMOB 2H4EA 1FBIL 3P0VL 1AIZA 5DVKA 1ZLVH 2X6MA 5F2FA 1RPKA 4FG4A 3SJVD 1DEDA 1S9KC 4GKOA 1SQMA 2P47B 4HUKB 3OSKA 3RL1B 2I69A 7PAZA 2P8MB 3IAPA 1JPEA 4IOIA 5SWQB 3AQXA 3G6DH 3X3GL 2O1AA 3KYMA 3M17B 2Z7YA 3FW6A 1HX0A 4KJPC 1SDDB 1OL0A 4O51B 3V6OA 3ZRFC 1B0IA 4Z7UE 1XB3A 4RMQA 1IM9B 2A38A 3N3EA 3BLKA 3KLDA 3TA3D 1EAQA 4B96A 3RX5A 5EU7C 2CDEA 1RK0A 5EEWA 4CC0A 2K4AA 2OW7A 4JM2A 2F8IA 1F4XH 3DUUB 4XNDA 1EHKB 2JIXA 4HIHA 2JQZA 2DBLH 4TUOB 5F1SA 2JKTM 3QCUL 4I0PA 1TTCA 4GO6B 5DDHA 5LO7A 4A2HA 5E4OA 3RB5A 4I0KA 5DZOA 1MLBA 3HC0A 4XAKE 3W9DA 3D34A 4NZRH 4ELDA 4QCIA 3B5GA 1IGIL 3GFUA 2VXQH 1TJHH 1HSAB 3QFDA 1WZ1H 4YLQT 4I77H 2VXVH 4DEPC 4KKAC 5IB1B 5HHPB 2C9AA 3UMTA 2HG0A 1LEGB 2J5LB 2KYIA 2IWKA 4AMKL 4N0CD 5EEVA 1F8TH 3QDJE 3TVMA 1E8XA 1ILSA 3F01A 1J8HE 3WAJA 2NUTB 4BFIA 4MAYB 2VLMD 4FFZL 5IM7A 5H35A 3MV7D 1GS6X 1TVHB 3UGUA 4Q2ZB 5C2BH 4NUPA 5I1JL 3EIFA 4JRXD 1MF2L 5EZJA 3LNGA 1N0XL 4KHXH 4PJGF 4DKAA 4U1MB 4QHUB 4UOW1 1EANA 4DZ8B 4LSSL 5T1JA 2LAGB 1UEMA 1Z6JT 2YKLL 3RFRA 4KKRA 2OI9B 1SLUA 1EAPB 3DK2A 5ICYB 3GLZA 4MTMA 4PV1C 2CWRA 2ZKWA 3KPLA 3DVNB 1RUPL 1QFWH 4KXCA 3AY4C 2FLMA 4GW5B 3GBNL 1ONQA 3UZVA 3VM7A 2VXTL 1QHPA 3V9EA 3EF7A 1AXIB 3NABL 4ZTOH 1TUPA 1TQVA 3WTUA 1I82A 3T2NL 1DBBH 5C3TA 4YDJA 5G2NA 2ZF9A 1XCWA 5JHMA 2Y7OA 4R5VA 1H9DA 3QO0A 4M7LT 4PRDA 2AEPL 4KTEL 1EZLA 2GIXA 4G8EA 1J05B 4JO4L 4PP1D 3ZTJH 2GPZA 1M6OA 2KDYA 3QCVH 1AXTH 5BRQA 3S3JA 4IRJC 3FF7A 3RB7A 4JPSA 2X0UA 3MRIA 5CZVH 1G9MC 2HRPH 4MVBC 4JCLA 4FFZA 4NC2B 5J3HC 2H32H 4JFDD 1FCCA 4NRZA 2H0PA 5FM4A 3RVUD 3ZW3A 2L4OA 3QEUA 2YC1A 1B4TA 1CICC 3PL6D 5EFIB 1A1MB 1BV8A 1T0MA 1ZSHA 4QMEA 3WXVL 4J3WA 5DUPL 5ISZA 3K4DA 2ATPA 4L48A 4PJIF 5EU5A 3C9NA 4JPIA 3LEVL 1ZKAA 4PVMA 4ADIA 5JPNC 2DWEA 4P5TC 1YEFH 1KNOA 2IANA 5HGDB 3VGHA 4FHKA 3KPSD 5CINL 4F7CB 4XNAA 1HCFX 2Y7SA 4Q14A 4XNQB 1BFSA 1NSNL 4HMEA 5D5MB 3RVVD 1QSED 4PGBA 1HQRB 5CD3B 3BVNB 1FSKB 4IGBA 2FBJL 3PP3K 1WQVT 2WJ5A 3MRFA 2JWYA 4M6OL 4LKXA 3FQWB 4JPKH 5AW7B 3HFMH 1WP6A 3OPZL 1A4CA 2YGPA 5IT2L 1OF2A 3CZKA 3VCLA 4IJTA 1QR4A 2VDOL 3BMWA 3UDWA 4I2XA 3C2AH 2G3XA 3B3IA 2XG5B 2WOBA 2EYSA 3KGUA 4MMZC 3ZE0F 1RUAH 3KBPA 5I0VA 1K2DB 1EV2E 4EZJA 2QDWA 4K71C 1X5IA 5E9AA 1NJ9B 4BD4A 1DLFL 3MO1B 1JWUB 2QSVA 4XX5A 1J11A 2XVKA 4TLSA 1XMWA 2WNXA 3S4SB 3LYRA 1K6QL 2NY6C 5EA0L 2WQWA 3WMPA 2UY7B 1IGFL 1Q1PA 3K2KA 3NCYS 4P23A 2WSPA 2A83B 2FCBA 2GHZA 1NOLA 1X3DA 1VCAA 4PJXA 3SJVA 3SCMD 1R5VB 4GAYB 4XTRC 4ZD3L 3ZHLA 3T0EE 1FH5L 3T2LA 2OXGA 3PWPD 2ZWNA 1FFPB 4N6QA 5F7LB 2HFGH 5GXBB 2NZ9D 3H3BC 4S10A 2VXSL 3KD4A 4XBEH 1QPKA 3WKQA 2FX8H 2VO5A 4KNQA 3KDMA 5I19L 3LZFL 1J5DA 2E4FA 2NY5C 3Q9PA 5CJXC 2XN9E 2DS4A 2H45A 4H2AA 5CLXA 5KOVC 4Z7VA 5MEQB 1OAKH 1INDL 2WV3A 4PJHB 4X8JA 4M6NL 3DHJA 3R06B 3QUKA 3VRIB 4AYID 3NZ8B 5EIQA 4TNVK 4PVBA 3MN8A 4BQCA 3VWJC 3UBXG 4HGWA 4X99A 1KXTA 5TQ0H 2YAQA 3CPLA 1EEZA 3W2DH 5LQBL 1DL7H 3S97C 4XOEA 4D2NA 4DGIL 1EPFA 2H9GB 3FO0H 2BWQA 1F4HA 1NBYA 4N24A 3X14A 2C34A 1X7TA 1T7WA 2GITB 4R97B 3QIBB 1SPDA 4LQFL 3QJSB 4XN5A 5C09D 1XF2B 2Y7LA 4M62L 5GRUL 1QI5A 3QUMH 1QMUA 1EWHA 5EPMA 3VACA 1VF5C 3BD5A 1JF1B 2HCZX 3MV7A 4N8CL 5BMFL 3MNWB 1FZJB 3WE6A 5E2TH 1DQMH 1OEZW 2BNQB 1BD2B 3S5YA 2WINA 1U8HA 4F8NA 5HY9A 4D8PA 5ANME 3RPIB 1BF8A 2EADA 3BGMB 4FQPA 2ROXA 4ENED 1THCA 1E30A 3LS5H 1I1AA 4JRLA 1Q0EA 5FYKD 5D72H 1PZ5A 1FVCA 3L3GB 2TSAA 3NSCA 2PYEB 1S9WA 5DZJA 3UCRA 4MQ7A 1IC1A 2K3HA 2PPAA 15C8L 1P6FA 2AJUH 4KO7A 3WKPA 1SY6L 1F1AA 2XHNA 3B1TA 1OSPH 1XF3A 1V10A 1KLUB 3WL9A 2DRUA 1QYGH 4POZD 4P2CG 1DO6A 4AQEB 2GTZA 2X6CA 1WFNA 4X7CC 2BY1A 4JFZL 4MJ2A 4ERSH 1NGWA 3UACA 1MFNA 1A9BA 2J1WA 3QNXA 4MA3B 2C9QA 2W8CA 5D93C 1JGEA 5EWIL 3WTSA 1JPGA 5E7BA 5F7DA 1JZ2A 4KQ3L 5HDBF 3OX8B 4F57H 2F61A 5I1GL 2LTQB 4LU5L 2PWGA 1YYLH 4LL9A 4LPWA 3X3FH 4G7YH 3RWIB 2FHCA 4JUSA 5FC9A 2YK1H 5C0RH 4EUPB 5ICXB 4PJDA 1MFBH 3DARA 3JWNC 5D7SL 4EQ3A 2FE0A 3U4AA 3Q13A 2YQ3A 4BWUA 3C5ZD 4OFQA 4W9FC 1SJHB 3EOYG 4F27A 3CN4A 5GGSY 2WNGA 5L8JB 43C9A 4D8OA 2NNAA 3LQZA 1ZANL 1FNAA 3Q1SH 4HQQL 4XXWC 4KKZA 4GSDL 4KXDA 3UJTH 4LLYA 2QZQA 3HZKB 2MPVA 4LLVA 4QRRD 1PKQB 3I50L 4FS0A 3DHPA 1ITCA 1GL4B 1SY6A 3B9AA 3KPSA 2X41A 3UIZA 2BP3A 2QQLL 4JE0A 2EP6A 4KPHL 4KKCD 4ODUB 2VLJE 3TASA 3ESOA 2J88H 4HX1A 1QSEA 1TYRA 2DEYX 1KTDB 1UACH 3CFEA 1OP9A 1OTSC 4WO4A 3OBAA 4AYFA 1L6ZA 3MLYL 4XN2A 4G2AA 3ZK0A 1VEOA 1ORQB 1YEJH 2OTUA 1URLA 1KENL 1HHIB 3UYRL 1UWEL 1N8ZB 2Z93B 3CJJA 1LM8V 4M1DL 2DLEA 2Z35B 3B2UD 3OAUH 4NAJA 4N9OB 4PRPD 4POYA 5D7HA 5CEZE 5DC2A 1P4LB 2QFPA 2P5WE 3V9CA 1U8JA 3NAAL 5C08D 4PS4H 1KEGL 3LN4B 4QXGL 4KROB 2Y7QA 4EBQH 1G7QA 2VUYA 4FCAA 3M1BA 1H3TA 4FJ6A 4OZIF 2NR6D 4ZQKA 4BWTA 2DICA 2X40A 1ZHLB 2VDPB 5CBEA 4M4PA 4A7TA 4XP4H 1S2EA 1KCVL 4EKJA 4XC3L 4RWYL 3F00A 2CDGA 3TPUA 9PCYA 1TO5A 3ASNB 4GS7C 4F7MB 4JFHE 5I1HL 2DIBA 4L37B 2XQBL 2ZKMX 4PJEE 5FF6A 4G6FB 1QABA 3D4CA 3PWPA 4XC1H 3HMXL 4H0IA 1UB6A 1AGDB 4S1SL 1EO5A 5I5MA 5FYKL 3MLRH 3LIZL 3QXWA 4KO9A 4D0BA 2R7EA 4K5NA 2BNRB 2OPCA 4R3SA 3DVGA 2Q8AL 5C71A 2OX5A 2DL9A 3LH8A 1DVTA 5IESL 3WS6C 5BJTA 3MKKA 5FA4A 3LDBC 1PL3A 3NYKA 3WSQL 1LO5B 1S9VA 2N56A 4H40A 5EO9B 1JYWA 1B4RA 4EXKA 5D7JD 3SOBH 1AFVL 2YD9A 2FWUA 5KSAD 1H5BC 1E9PA 4WEBH 3DVFA 3I3BA 3MBXH 4LRNL 2GG1A 5AKSA 1SEQH 1IL1A 4PG2C 3LQAL 4LHJB 5I2IB 1Z66A 3U4BL 1OXYA 2AJSL 4F15C 5BV7C 5D71L 3ML9A 5CJ8A 5IP4A 2FO8A 3CCHB 4NUMA 1HYRC 5B1CA 4NNYA 1UCBH 5DHEA 5C09A 2AJXH 1WG3A 4NQXA 4PLOB 4WUUB 2X4RA 2EILB 3L4VA 3ARFB 5IB4A 5T5FH 1M71A 1NBCA 1S6NA 2IPKB 4AYSA 4A66A 2PCPB 4NNXB 5GRYA 1YDPB 2IDUA 4ORGB 2YHGA 3FFCD 2YRZA 3BXNA 3MPCA 4F2MB 1BEYH 1UOLA 3IDYB 3UL4A 4GNKB 5DVPA 3HMXA 1JHTB 3V0VA 5DJZA 1BVOA 1ADQH 4ONFL 5J1AB 1FNFA 1J1XH 2Y0SA 4U05A 3GMQA 2Z0BA 3LIZA 3QXUA 4FI7A 3OMAB 1A3QA 5A6MA 1HC1A 1BZQK 4D9QE 5IVXE 1FNEB 3GHEH 4ZODA 3PFQA 4MA7H 3T0AA 3U9UB 1EDYA 1QR1A 1G4RA 1QO3A 1QZNA 1S3RA 1TZHB 3VQMA 3MUZ1 1KYFA 2GBVA 1JZIA 1OAXH 3D5OF 3Q2CA 2ED8A 1XF5B 3KW7A 1KUMA 3LEYH 1BWMA 3RY5A 4S1QH 4XMPH 4LEBA 3QG6B 3W5NA 4P2OD 2NW3B 1WBZB 2F74A 4HF5L 3EZJB 4LDEB 1YUHA 1J1PL 2QVKA 2FX7H 4IK7A 4YC2B 5G4OA 1NCUA 2XG4B 1ZK5A 4JFEA 4Y4FC 2XKNB 2AK4D 2IMNA 3WFDH 1KOAA 3D3VA 3JTSB 1T4KB 2Z91B 1WEJH 1IJ9A 1AS7A 1S7VB 3O3AA 3M8OH 3ABGA 5C1MB 1DJSA 2YOCA 5IB5B 4HV8A 4M7KL 2E47A 3FCTA 4PP2B 5AVZB 4JO1L 1N19A 1IC7H 2OZ4L 3MJ7A 3U2SA 1N4XL 1W8OA 4QRRA 5TD4A 3CK0H 1OCOB 5JLZB 3OR6A 2BS8A 3DIFB 1A7QH 2JCCE 4MJ5B 4GUPA 1HWWA 1PBYA 3MUJA 5F89A 3BIAX 3NPZB 5J9PB 1QFWI 1PD6A 3QDJB 6PAZA 3VB8A 2DV6A 1J8HB 4LCUA 3FQUA 2EECA 1T5WB 2DMBA 3QJZA 2EC9T 2ICWB 3K2IA 4JG0H 4LVEA 4MCMA 4TTDD 7PCYA 1KLGA 4X0KB 4NPJA 4XN1A 4PJAA 2FWSA 1X9QA 2X9YA 4IDLA 5AVQB 2MCMA 1HZKA 3C8KB 4Y16B 1A4JA 3TBYA 2VSMB 2Q10A 1C7TA 3P4MA 3UIYA 2FGWH 1HILA 3BFWA 3HPJA 1BXXA 1E5ZA 4L9LA 2WUCH 4P05A 4AZUA 4HSCX 4NGHL 1FZKA 5GZNC 2VOTA 4DVRL 3P9LA 2FJFA 4ZFQA 5LAXA 4HG4K 3BKMH 4DPCX 2PYFA 3HS0C 2G75B 1G7MA 5KVDH 5AVVB 1U8OB 3MUHL 1K9TA 4XO8A 2NQ3A 4FTVD 4JHWL 5L2JA 3RL2A 5E99L 1ZVNA 4WNJA 2DLGA 2NR6A 3TNMA 1U8MB 4XHQA 3F6LA 4DP5X 1I85A 3HG3A 5J5EA 3L1EA 4Z77A 1TNNA 3VH8G 4TULL 3BYYA 2R69H 3ATFA 1FVDA 1UM6L 3FTVA 4MDRA 3EOBA 1TQBC 2PLTA 4MLIA 3UEZA 3TIDA 5KVEE 1AQKL 3M46A 5KN5A 1S7RB 4N2BA 1DE4B 5D4QA 1RUQH 3FQ2A 4BUQA 2D31B 3L4CA 4HKJB 2Q5BA 2VZ3A 3BWSA 5E95B 3ULAB 2IH1B 1JZ4A 1OGTB 3CZUB 4ELMB 1EEYB 1NGZB 4V1DB 5IROC 4D94A 2X10A 3F6JA 3T0BA 2DI9A 3D39D 3B8YA 3SPVA 5BUAA 1G94A 2E6QA 4MXVE 5KSAA 2YLKA 1TCMA 2W9DL 4DKFH 4E9TA 4AK1A 1UOKA 4XPGH 2IALB 3ARGD 3ZLQC 3OJVC 4XI5C 5AW6B 5TE6L 4PTUB 4U49A 2PO6A 2EXSA 5A1AA 3LHPL 5FK9B 4PLJC 1MHEA 2WXKA 2K9FB 1L5GA 1OCWL 3KBFA 4PJFE 2VL4A 3PYCA 4XMKL 1YMHA 1OTUD 1SBSL 4FULA 4G1EB 1QLEH 1BYPA 3FRPB 3VXUE 4J1UA 4GG8B 1RZFL 1OGAB 3OJDB 4NIKB 4FF9A 3ASWA 1Q0XH 3A67H 4GMTH 2YXWA 2X70A 3V5DB 3GMPA 3PV6A 4BUGA 2HG5A 2VR3A 4KKBD 1WICA 4XVTL 4HISA 4UTBH 1X5AA 2WBXA 4NBZB 4IRZH 5FDWA 2A2QT 5E1IA 3ZMRA 2J56A 4LVNC 4PRBB 3TP4A 3O4LA 3HE7B 3OAYH 3VFRB 4I5BB 4AW4A 4LNRA 3Q8CA 2KZ1B 4EDWH 1F56A 5C0ND 1IT9L 3AVEA 1I7UA 3AG2B 1ZDSA 1KACB 3SDAD 5AYUH 4ALAL 4AEHH 2CO2A 4K94L 1ZGLA 4LGSB 4G6JH 5E2VH 4QO1A 5DTFA 1NIAA 3T0EB 4P2QB 4P2OA 5AD0B 1HKFA 1T1XA 1V3JA 1MPAH 4XCCL 1IGCL 4PEEA 4H4NA 4DVBA 4A04A 2YR3A 3QDGD 2IH3A 4DIXA 4PJIA 5D4IA 2AK4A 2P80A 3NJMA 4PB0H 3T3ME 1R3HA 2XN9B 4L8SA 2EDOA 2ZCZA 4DUVA 3IDJB 4RAHA 5FYJH 5DLML 3OB0K 3UC2A 1BBDL 1CFSB 3K80A 3ZE1E 1LD9A 2CJUH 4Y2OA 4EAEA 3JVGA 3ULUD 3QIWA 3ETTA 3MOBH 4MNQA 3D25B 1PLBA 3OKYA 3RWDB 3TH3T 3U4EB 5CGTA 3NH7H 5AL0A 5EBWA 3FU6A 2NQCA 4K8RC 4RFOH 4F91B 2VDQH 1P4BL 2VR6A 4TMPA 3GBMH 3WBDA 5I15H 5F1NB 1GTFA 4CBPA 5KSUB 3GSRB 1E4WL 2IFFL 2X1XR 4NT6B 2BRRL 1FNLA 2P49B 4L8BB 1YPZF 4P4KC 1G87A 1HU8A 5KYWA 4E0RA 2IG2L 4OIAA 3B83A 1UFGA 4WI0B 2XICA 3ZTDC 2QADC 3NJJA 2W0KA 4OT1L 3JTBA 1CXHA 3EH4B 1DSWA 2F1AA 2ZSWA 1G9NC 1NCAH 5J06A 5ANMB 4GBXC 3NSFA 1IIKA 1NAKL 4YO0A 1QTYT 1LQBC 2E6JA 1OM9A 5MEOB 3ARBD 4W9LC 3FTSA 1I9IH 2D3NA 2BC4A 4LRIA 1BPVA 3IFOB 1DLHA 1R46A 3PHOB 1YCSA 4POUB 3L3IA 1RZJC 3SO5A 3SEPA 1D2OA 3DUHA 1YN6B 3BD3A 3H9SD 4FTVA 3U79A 5AVSB 2HKFL 4QEGA 1KN4H 3F7LA 3DJTA 4WI2A 4PR5B 5AW4B 2E7BA 1GYAA 3EJZC 1T1YB 4N90D 1PNCA 2PR9A 4Q4IA 5E5LA 3WG7B 3FRUA 3PRZA 1WTLA 3OMIB 3TCLB 4MDJA 3RWFB 3NRPA 1LK2A 2YD0A 1IBDA 5F7BA 3JYCA 3QQ4B 5I5RA 2ARJQ 3VFGH 4PV8B 3N40F 4P5KA 4Y4HB 4MX7B 2YEQA 3BUYB 3L9EA 5D1ZC 1IC0A 1R3KA 1IGMH 3TN0B 5EU4B 2HYMA 4G1MB 3G7TA 2EDWA 1QQDA 4ECNA 3OKLB 3VD7A 1LL1A 1TJGH 1CLOL 2C1OA 2H2SC 3RVTC 4JDEA 2LLLA 4YBQD 1YEKL 3FN3A 4XVJL 5GS0C 5KSBF 1MREL 1TQCC 3NCJL 2G4EA 5FCUH 4XMZA 5T3XD 3FU0A 4I9WD 2NY7L 4W9IC 3CFUA 1U95B 5CR1A 2RALA 3SY6A 2LT9A 3S37L 2AFNA 4YFEA 1P4IL 3GZOA 2J8OA 5A3IC 3UXFA 4Z3IA 4KMTH 3ESPA 3ARGA 2VLJB 4PJ5E 3N85L 4JZOB 4P9HC 1GOFA 4DO5A 4Y8DC 2EEFA 3ZYOA 1EHLH 3ENEA 5HGBB 4YLBA 1FSKC 3EUDA 1NCIA 4U1JB 4XBGB 2VZVA 1WBYB 3KYOB 5B4MC 4A7VA 4UNIA 3L5WA 4NZFA 5IVZB 4EE2A 2IPTH 3CSTA 2Y07H 3L3DA 1B90A 5E8DH 3NK4A 3JWNH 3PREA 5CMAB 4TUJA 3LXCA 5HHOE 4NUGH 2CLVA 1ZDQA 3CZFA 4F7PA 3ULUL 4Z8FL 1P7QB 2EH7H 4YK4B 2ZUTA 4IBWA 4YHZH 3FNKA 5FGRA 4ZFGL 3NK3A 3ARWA 2ZIDA 4ZX4A 3E9UA 4YE4L 4RMUA 1P5VA 1ODUA 5I1AA 3SKOB 5C6TH 4MJ6A 2I07B 3L08A 4FFYH 4JUTA 4OBSA 3GSVB 2X9XA 1AQ8A 5J13C 5IR1A 4M6MH 1JD9A 1QSFB 1HT6A 1SF3A 5CGBA 3MNVB 2EDKA 1N6QH 4EPSA 4CN4A 1B6UA 2HT3C 2YMOA 2J8UB 4YHYB 4P4RA 1DVXA 2E27L 5EO0A 5EMYA 4PJEB 3WUZA 4LDOB 4OBRA 1D9KD 3LXAA 2R1WA 2DTMH 1FPTH 2QLVB 4OZHF 5DK2A 3MJ6A 2Y7MA 2YA1A 4OGXL 4XPHH 2JLPA 1CXIA 3FCSA 1J5OL 1AG6A 2Z65C 4HKBA 3QDGA 4NPYA 2WTOA 1QBLL 3O41A 4OU3A 4LDCA 3LAFA 2NCMA 3ABKB 4H25B 4XXDB 3GSWA 3HBQA 1S5IH 3KH3A 1IGJB 4Z0XA 3T04D 4R8WL 1ZIBA 3FPYA 4PG9A 3BUPA 2UZXA 2VDMB 2X42A 4GUCA 2BSED 2X4NB 4XB3A 4YPGA 3QA3A 2FLRT 4PGEA 4NO0B 2FJUB 4OZFB 3U0WL 4DO6A 5JQ6H 4X8CA 1XIWC 5CILH 4DKEL 3O6MH 3MJ9L 4PM1A 3ZTNL 5JNYA 2WZ0A 4Z7WF 4LBEB 2O6FA 3RTQB 3BLPX 1CZ8H 1X9UA 2XWJB 5IQNA 5DJCB 1NANH 4RISL 1IEAB 3EYQC 5KS9E 3D48R 3US1A 1RJLB 2EIEA 1AKJB 3O0RH 2KQMA 4QOKE 1S7UB 5E9DE 35C8L 1BAGA 4ODVH 3V4VH 3C87A 3EYOB 4Q97A 4KVCH 1H6TA 3S36L 4LMQI 3AG1B 3FU7B 1DQQA 5B7FA 2XQYA 4LCWE 4XRCA 5F8RC 2B39A 4OZIA 4XOCA 3GWJA 2BP0B 5EBGA 1EDHA 3ARBA 1PSKL 1KJ2L 5T3XL 3VFSA 1ZLEA 3ULVH 1DBML 1JPFA 5IVXB 3K71A 1MIML 5E4EC 3AABA 3VXRE 1LE9A 1N6VA 3EH1A 4FQHB 4DN3L 3LRGA 5EC2B 4JHAH 4EUPG 1UXWB 1EJOL 1EO7A 2JKRM 5GRZA 4XCEB 4PLNC 4GO9A 5DMKB 3MROA 2F53B 3AT0A 3H9SA 4PRIA 2OZNA 2OV0A 1J0ZA 4UTAA 1A6ZB 4LSVH 2B1AH 3RDTD 2ZP8A 4ZMWA 5BV7H 2C9RA 3ZDYF 5FR3A 1KFAH 1PZAA 2K70A 1V27A 1VHPA 4LCYA 3ARRA 1Z5LA 1NL0H 4HP5A 3WKNA 5GGVL 3SKNA 4BK4A 4F93B 4YR6B 3MJ9A 3FUIA 2PF6A 3GSQB 1BX2B 3GSXB 4QRPE 1DVSA 1KCSL 3K0WA 2YXFA 2PETA 2ZYRA 3FB8A 4I85A 1IEHA 2B16A 4ZSOA 3H4HA 4KMLB 2WIIA 4YHPB 2HT4C 4G8IB 3BP5B 5IQ9B 3PJNA 3KCWA 2OMTB 4N0FB 4WUKH 4JFUA 2RB8A 4K9EH 4LIQE 1S5HA 3VI3F 1OAUL 5E8NA 3LOWA 3D4YA 1IAKB 1EXHA 1P5UA 3EXJA 2NNCA 2OL3L 4UMSA 2EXTA 2PP7A 5DJAA 3C8DA 4IBZA 2FECL 1TQSA 3WFCL 2HH0H 2NOYA 1CF8L 3JQOB 3QDMB 4JFOA 4JN2A 3IBOA 4OD3H 1A6UL 1S7QA 2CUHA 4H2CA 4PWFA 4U3CA 4YZWA 5CJ5A 5JXED 5IFJB 5IJDC 3FU5A 4P9MH 4XVSL 1KPRA 5KYUB 2JCCB 3S35X 5DSCB 2AI0H 2GJRA 3IGUA 3C09B 4PS7A 5T33H 3V4PH 1DVFB 2D7OA 2I60L 3BWUF 4J39A 2VJ0A 2J1YA 3P3TA 3PPSA 3NUKA 4GH7B 1BQRA 4ORZC 5F88B 4ZPTA 3CC5B 5IKCB 2QMKA 5I0ZA 5C9JB 5KAQF 5DVOA 1A0QH 5C0FB 5JHBA 2D9CA 1M7DB 2YUVA 5GQBA 3CN3A 4O2CB 1Q8MA 2ZCLH 2OFQA 3DPBA 1A1NB 1DFBL 4NPKA 3GIZL 3SKMB 3KPOB 2R2HB 5HHNA 1RUKH 2OCJA 1JK9B 4LF3A 4OM1H 1ZT1A 3ZY7A 4FJZA 1NCBL 3CLFL 2VRKA 2XPYA 3ES6A 1UA6H 1N59A 4HETA 4DJMA 3IDMA 1UKQA 1JI2A 2FJSA 3BVVA 4CRPA 3NZHL 1NDGB 3TT3L 3RWJA 3S96B 5TQ2L 2B4CC 1J9CT 1OLLA 4OZ4A 1LVEA 3GHBH 3F7RA 1ZT4A 2GEEA 1PPIA 2YJQA 4D7PA 4KFMA 1LK3L 3HVNA 1B2YA 4AVHA 2XBDA 5CJQL 2D4DA 4L29A 4BM7A 2WCGA 2BSSB 1MWAH 2O72A 1D9KA 4WRLA 2JVUA 3MCKB 1BF2A 1HAWA 3E0GA 3T6WA 5GRVL 3NQIA 1IQWH 1XF4B 3APDA 2EUXA 1MCLA 5A16A 2VDRH 4YOKA 5DURB 3WFEH 4YEFA 3LZNA 1NTDA 3HZMA 4GRLC 5MEPB 3FU9A 2CIKB 3ARDB 4UILL 2B1OA 4UUJA 1RZIB 2ZAHA 3TWYA 4LLAA 5KTEL 5KOMC 1SHMA 3VRJB 5L6YH 5D2LF 5FUCC 1ZS8B 4W9ZA 1BQKA 5F6IB 1K4DB 3DO7B 1P2CA 3UO8B 1QEWA 3O6KH 1SEBA 3FN0L 5L88L 4QHLA 4HW6A 1RMFL 3L6FA 2VKWA 5DJXA 3VWKA 4O9HH 2QHLA 4PJFB 2IGFH 1JK8A 4M7ZC 2ZQKA 2LOEA 3QQDA 2NDFA 4HBCL 5JHLH 1BLNA 5A2JH 1C12A 4I48A 3HBPA 3IS0X 3ARFC 1CMOA 5L9DL 2O4EA 2XETA 2X4TA 4WJG3 4R2GD 3T71A 4H88L 2JNZA 3I2CL 2W0FB 4XMUA 3UTPD 4UB0H 5LBSA 1BOYA 2Y5EA 5ETUA 4XNYL 4JLRB 4WW2B 1IM3B 1PG7H 2FH8A 4ZDHB 3WENA 5AW8B 3IDYC 4HDIA 1E7UA 1OALA 4UQAA 2EDFA 1I9JL 1U3NA 2VSDA 4IDJH 3LPFA 4RESB 4RH4A 1IE5A 2P24A 1AZRA 1TQTA 3AXHA 5AZ2H 3STLA 4M02A 3IF1B 3BT2H 5IB3B 3AJ7A 2ZONA 3B2VH 4CDHA 5AW9B 3WDIA 3TV3H 5DRWA 1JMXA 1K72A 4H1LA 2J6EA 2DQMA 1RP9A 5AVUB 2VIRA 4QKXB 1MJJA 4OV6F 5I16A 2W81C 3BCDA 2NSQA 5EN2B 2ZF8A 5L4IA 2VC2L 1KB5H 1MQKH 3QB7C 4A2FA 2CXGA 1S7SB 3RVWC 2Y5QA 3EBGA 5I0DA 3I9GL 4UIKH 1F4AA 2V5YA 4APQB 4JZJC 2F54E 1UWXK 2BMKA 1KULA 4NCC1 4IOSA 3CIAA 4F7KA 4BK5C 4GG6F 1U58B 3ZE1B 2EIBA 3MLUL 3U2JA 2ZKYA 5TE4L 5CGMA 1OT4A 3P30H 4HXBH 5TH2B 3I9IA 1V3MA 4AEIH 1Y0LA 2R8SL 4I3RH 1QFHA 3NIGE 4ISVB 1IE4A 5KVMC 1XV8A 3EJQA 1BQ5A 4CADB 2GW5A 4IJ3B 3T4YA 4KAQL 1U8PB 1WT5C 4M8VA 1T03H 5SV3A 3GMOA 3MR9A 4F58L 1P7BA 2QKSA 4G7VL 3W9EB 1FO0L 4F8TA 4TNEA 4KZEH 2LHAA 1R0AL 3WHXA 5GGTH 1NPUA 3FQXA 3AROA 3NCBB 3QUZA 2I9TB 4PJ8B 5BQDA 5IFAH 4ZUVA 4LZKA 3Q7JA 4JQIH 4AQZA 3UMNA 5K9OB 4LCIL 2EYTB 2EE6A 4R7NB 4IYKA 1GVIA 3GUFA 4H13C 3QK0A 3D8MA 4K3JL 4H5SB 2RFXA 4ATTA 1AY1L 3QAQA 3MXVL 4OCXH 4GW1B 1XB8A 1RULL 3L4ZA 4KGLA 2IVFC 5SWSB 3LCYA 3X1EA 4C4UA 3VU2A 1PYWB 4LLQA 3EGXA 4ZAKD 3DX6B 4EN3C 1QG3A 4OTXL 2W59A 4MNHA 4BV1A 3PGFH 2V9QA 4F1ZA 5F96H 2D3VA 1WA2X 1UFUA 1AYOA 3UBXI 4TN9A 2OMWA 5CZKA 4AQ8C 1C16B 2DBLL 3KM2A 4NDMB 4TLTA 4XXCA 2CR0A 1A5FH 2R0LL 1I8MA 3H0TA 3D4ZA 1ZT7A 1A7PH 4NHCH 5I0YA 4UU9B 1KELL 5DJ8B 3W11D 3V0IA 3BP7A 4UT6H 2YOAA 3JZYA 3AQDA 4J3BA 3DO3A 1W72L 1WIUA 1VEPA 1JPSL 1JOIA 1JXGA 1ACYH 3GDBA 5M95B 3Q8EA 2D03L 2DI7A 4D0CA 2APVA 4R6UA 3PWLB 2Y6SD 5FYJU 4KTDH 1ECZA 3V4UH 2BY3A 3F58L 2EEDA 5D9SB 2YPLD 2ZOOA 3GRWL 1IFRA 2YN3A 1WGVA 3P0YL 4WSJA 5F7HA 4K7PL 1GA2A 1FAIH 3QI9C 4ZXBD 1M57B 3TTYA 1OOWA 4ZUSA 5CBAB 5D1QD 2J4WH 2NXZD 3U6XS 2FUQA 1NAML 5TF0A 4WV1B 2WXMA 3BEVA 4GAJH 2WBJD 1PLGH 4DKTA 3FSVA 1YPZA 2ETWA 3DC0A 2UWEF 3VXMB 3WHE1 5DMJB 3GSNL 4B9FA 2Z1PA 3R8BB 3QORC 1KJVA 2XYBA 4NX0A 4PD4J 1BVKA 4PJ5B 4AGMA 2Q8BH 4M7JL 1AP2B 1IGTA 3MLXH 4I18A 3UZEA 3BFOA 3WIFA 1U42A 4PHXA 3P77A 5ESQB 3QRLA 4LFHG 5IIEB 3UTSD 3WV0A 4HWEH 3SDCA 4XPTH 1W72A 5E6UB 3VFMB 5CSZA 3X12B 2VJXA 2W9EL 1AJ7H 5FGBC 2BVQB 1FN4B 4PREA 1G1OA 3V0DA 3WY1A 3SQBB 3GI8L 4H8WL 1UXLA 2EAEA 5BOPA 3TBCA 4P3DA 3PP3H 1II4E 1MELA 3LXBA 3OKMA 2XXGA 5GS0H 3KCPB 3OXSB 1RL1A 3MRMA 1UEYA 4GP5B 3UERA 3T0DA 3LV3A 2W91A 1FYTA 3BUIA 4RNRB 4YDVA 1F18A 1D5IL 1BZ7B 2FNBA 4LVHC 3HN8A 1TVDA 5M7QA 3KNBB 5I1CL 5B3SB 4U3SA 4FFVD 3GNMH 1J0YA 3IETA 5MI0C 5FHBL 4N0RA 4R4FL 1MY7A 5ESAA 1XB6A 5GJTL 4HS8H 2A9MH 2F7IA 4QYOA 4WGVB 3OZLA 1FH2A 1T66C 4YDZA 3B2DC 1OCZB 2RJMA 1HHGA 3JV4B 3QHZH 2FEDD 2G9HB 2ZG2A 1L0QA 2ZUQC 3AREA 2F15A 3L7EB 5KSBA 1G7HB 2VB5A 1WAAF 5EEXA 3A6CL 4YDLC 3DBXB 5CIPB 1YECH 2YPKA 4WWPA 1NANI 3SD5A 2P3YA 3MREB 1U3ZA 1IFHL 4GQPH 3BT0A 1RJYB 2A9NH 4R0LC 3WLBB 4AIZA 2ESVE 5HYSA 5JHAA 2I9LA 1E6JH 5IQOA 4ONOA 4WW1A 1KCWA 4IHOB 1OB1A 3UG4A 4NXSA 2O5YH 3MGOB 2W60A 5JORA 3PQYE 1TYJA 1WFUA 5HTSA 4MDIA 5BO1H 1URZA 5ERWA 5F21B 4HKXB 3UX9B 1RJCA 5D8JH 4UINH 1MRCH 1T89C 2M2DA 2XN0A 4HWUA 4AENB 2H32A 4JGNA 2NXYD 1XGQB 1KPVB 3I6KB 3PXHA 4M48L 4U1SA 1SN5A 2QQKH 3B9DA 1F1DA 3HC4H 3C08H 4IRSA 4YIQA 3RY6C 3GLAA 2BP5M 4UIMA 4B3EA 5KS9B 2B15A 1X5KA 3MRKA 1A7NL 4JPWH 4N2FA 4IBVA 1GYCA 3V6FA 5E9DB 1CGYA 3T8VA 4P04A 4N8VB 5DJDB 4FKEA 4FLSA 5DHMC 3VXTB 4NKDB 4ZNCD 2CA3A 5ABAA 4L4TD 4LCWB 3KWTA 3CZNA 2VDKB 1CE6A 1NGYA 4FFWC 2Q87A 4FABL 4DUXA 1JGUH 3W82A 3MLSL 1CT8B 3NVQA 1KXVC 4JN1H 1U92B 5EO1A 3BPCB 2EC9U 1PQZA 4ZAKA 4W93A 1AACA 1T20A 1YNKL 3VXRB 3MLTA 4MJHA 1TCRA 1GY1A 1XFPA 5HHXL 2R29H 3R1GH 3KLHD 1XR8B 3FAWA 4MXWH 4XMLL 2RQ8A 4YSAA 1EMTH 5C8JB 2MH4A 1CI5A 3BZEB 3Q6FB 3G5YA 5I75B 3FHQA 1QBMH 1B0GB 2BIQA 1BVNT 3VE0A 2FR4B 2A99A 3CH1B 2FDBP 2IWGA 4Y5YB 4J4PA 2IGTA 3NCMA 12E8H 1A25A 4OGZA 4QRPB 3PHQA 2CQVA 2DYSB 4HIPA 2FBRA 2O61B 3TCTA 3P11H 4P5MA 1JXKA 3U9PL 4Z76B 4XPFL 5GZOA 1RH8A 1TXKA 1YY8A 1JWSA 3FONA 4P57B 4TNWF 3W0WB 2UXGA 3ZE2E 1O75A 4AGOA 4D0DB 4OCWL 2R4SH 1O6VA 4OF7A 2XPGB 4XN9A 1U4EA 1Z9SB 2Y9RT 3FQRA 4UDTB 1WD8A 2FO4A 4ZXBA 5IMMB 2ZP9A 2WKOF 3TVMC 2OMVA 1NCCL 3E1ZA 4U1NA 5DD6B 1JG9A 5I6XB 2WBJA 2WZ5A 4L5FH 4WI8A 3CBJB 5EBMB 3HE6D 1KFGA 5EULV 4BE5A 3P9WB 3NPSC 5B8CA 4OM0H 1RURL 5JW3L 1W15A 4NQCD 4RSVA 4LSQL 4UQ3B 5DD3L 2F6AA 4KK6D 4HUUA 1NGQL 4JJOA 3IXTB 4PW4A 1QRNE 2VM3A 4CBZA 2H8PB 4X9GA 1A4KB 3VQLA 1WUZA 3UTSA 5C3LD 4XNUL 2XNAA 3HR6A 1I9EA 1VFOA 4QUOA 4QRTA 2P28B 4UI2A 5ENWA 3WGUB 3TF4A 4X6EA 4F3FB 3LSOB 1X5ZA 2BVYA 2DM4A 3BZ4B 3G6JA 3TBTA 4EUPH 4IU2B 5IREA 1CGVA 5L0QC 4GAAA 2Y5TA 2PWEA 3AMLA 3QUMA 2NY2C 3ARSA 1ZWIB 4JVPA 4MCYA 4XGZA 3QQ3B 2VDLB 1TJIL 4FQXB 2A74A 4KX8A 3HIZA 3W37A 3AU1A 2ZKHH 2WVTA 4Y2DB 4X4XB 4GAGL 4M3JA 3FQ1A 5LXGH 4KI5C 2BOBB 4G80B 2HFEA 2GC4C 3ESNA 5HHME 3WLWC 3QBTB 2OXHA 2EH8L 2BW5A 2VLKD 4UBDD 43CAB 3BIKA 1RKRA 2B59B 4KJQC 2AQ1A 1OM3L 4YHOH 3CMGA 4L3EB 1E28A 3V6OE 4R4ND 3CXDH 2XXFA 1XZ0B 4EJ1C 4GUOA 3VI3A 3EGDA 3O2VH 3O45B 4Y5VA 3QIUB 1AR1C 1AQDB 2E8ZA 1UYWH 4FFTA 4OCYH 1RCYA 4X5XA 1Y07A 1YQ2A 1DQLH 3UADA 1LWHA 3TJHD 5I1KL 1IQDA 5JIHA 5TDNA 2D0GA 5D7KD 2EVGA 2EIKB 1QSVA 2WXFA 5C0BD 3VYNA 4FLRA 1EFQA 3PWJB 1MVUB 4JR9H 4D3CL 2KLRA 4ES9A 2X6VA 2WYIA 4BH7A 1N70A 3L5IA 4JVUA 1A4BA 4IGBC 1MRDH 4UOQA 4W6WB 5IF0B 3VM5A 3VD3A 4WWKC 5IW6B 2X89D 5GIRA 4EBQL 3WEMA 5FO9A 3UDWC 4XCNB 5CJBA 5DU7A 3MOQA 2G5RA 3Q44A 3MV11 1MFVA 3V7AE 3VFTB 2HVKA 4G3YH 4AEFA 2DJMA 2IADB 3ILPA 2F18A 3KGRA 5JQIB 4XCFL 3FTWA 3ZYZA 2YN5A 4N2KA 3MJWA 1AH1A 4O4YH 3MRHB 4NSKB 3MJ8A 4CILA 2MCAA 5DJ6A 5IEHA 4JZNA 2VQTA 1B3JA 2EIDA 4I13B 3ATAA 5GHWL 4P23C 3GRBA 5C6PB 3I02A 3OV6A 1KT2A 2HLAB 4KJPD 4BGLA 3JWDH 3N1MC 2OMUA 2OTWB 5G4NA 1CBVL 4G8FA 5D7LA 5DC0A 1U8NA 1SFHA 3MUGB 1E3XA 1WWCA 4R26H 3RIAF 5DVNA 3CDGB 3UYPA 1AI1L 1TSRA 2V2TA 2FB4H 1LO4H 3LKPB 4HIXL 4OD2A 4M7LL 3ULSB 3K4ZA 4YXLH 1FZOB 3HNVH 1H19A 2V2WB 1J88A 1Q9LA 5I1DA 1BXVA 1RI8A 4PI0A 5A2BA 5HYQA 2GSGB 1D5XB 2XTLA 2PMZA 4G6KL 3FO9B 5E2UL 2OYMA 3EG9A 2Y06L 3LRSA 4OF5A 3O6FD 3VG9B 1A9VA 1X5LA 2F54B 4IMKC 3ULVF 5EG6C 5I66A 1E4KC 4O02L 2OJZL 4UQDA 3ATEA 5D2LA 2DQCH 4UWQB 1HNFA 2HFFA 2J1ZA 1NLDH 4N2MA 1B2WH 5ISZE 1RZKH 2A9CA 1HL9A 3R8QA 4B5EA 1DBKL 2XWDA 2AGJL 2H1PH 1HK6A 3KM1A 2X3BA 2ORBH 3AU0A 3NIGB 2HA1A 5ALCH 1CURA 1QKZH 1KN2H 2KZWA 3IE4A 1YEDB 1PEWA 2IANE 4NM8L 3NCCB 3PJSB 2WM0A 3GMNA 4PIRF 3S0PA 4BRJA 1RUMH 1E7VA 3G5VA 3HE6A 2AAAA 2CU9A 3MRBA 3TEUA 3B34A 5I23A 3RGVD 4BFKA 5IFHL 5JO5A 1SLVA 5I74B 4NQCA 3TO4B 2QHRH 1DVFC 3FQNA 5I17B 1I1AC 4N2CA 4U1HA 4YVNA 1NOAA 4NQVA 1OWWA 3RNQA 5E5MB 4HKZB 3SDYL 3UROR 4NFCA 5DEFA 3RNKA 4I2XE 4OLUH 5MERB 4ZO8A 3RFZB 4NP4L 4NHUB 3F3HA 3H2WA 3NN8A 3T8XB 4UQ9A 3WTYA 5JMOC 1MEXH 2B8OT 4YDKH 5EOCL 2CPUA 4LSRL 1DN0A 2BHUA 4AL8L 4MLSA 4IRJD 4ZUUB 4MVBD 2NY3B 1HL4A 1RJZB 3TYGL 1BWWA 3HLAB 5J3HD 1NMAH 4K7FA 2WVVA 5IBUB 5K1VA 1F4YL 3ZL4L 3I3DA 3MRPB 1BAFL 1CICD 4WIQA 5I6KA 1A14H 2Y36L 4WI7A 1ADQA 4PJXE 5DLLA 3SJVE 3QXDB 5IJCC 1IAOB 1I4FA 2VLKA 4U6YB 3U82B 4MBOA 3CV5A 3AB0C 4HPYH 3ORJA 3TX4A 5T5NG 4P5TD 1GZPB 3Q01A 2Z8SA 1OARL 1SZNA 3GMRB 4Z23A 1H15B 4XP6H 2BY0A 3LH2L 1EXUA 2P42B 5JW4R 4MJID 3GB7B 4L1BA 4Q6IA 4ZMAT 3EO1B 1C9SA 3RZCB 2A0LC 4LLWA 4Z7VE 2ZX6A 1BFOB 2HLFC 3MV9D 2IDSA 4NRYB 3L45A 4WFED 4PMEA 5D7IF 3VXOA 4AI7A 4K9JA 3IEAA 2AV1A 32C2B 4EI5A 1B9KA 1YN7A 5C7XL 3DX4A 2Y4SA 2PXYB 4JHZA 4KHTL 3HW7A 4PY8J 2R1YB 2GJ6A 3C8HA 4WO4C 4Q9QH 1X6NA 3FCGA 4F8LA 4FXKB 1JPTL 4OF6A 4UV4H 3UG5A 1EAOA 3RHWK 1TTUA 3DURA 4XAWH 1BQUA 2WYZA 1QSZA 7FABL 2QKIA 2SEBA 2M1KA 4F9PA 3FQTA 4IQHA 5ID1A 1EZUA 5I26A 3RZWA 4OZGB 3L8QA 2EDNA 3MV8A 1AC6A 4P3WA 2NY6D 5I1LA 4ICWA 3G6AB 2VLME 1RIHH 2KS0A 3MV7E 1HL8A 3R18A 2ZOTA 5L4MA 1LO0H 2H6UA 3BW9B 1VKXA 4Q9RL 1BFVL 1MFEL 4X9YA 3QR0A 3U6RB 3K4AA 4YQXH 4NLHA 1NIBA 2G5UA 4FNPA 4LLDA 4XTRD 4XWGH 4M43L 3HCVB 4BZ1H 1SJEB 1JXJA 2XC8A 3FOMB 4TPRH 3OZ9H 2J2ZB 2X4OB 4G11A 3B9VA 4GAFB 4OFDA 4OB5L 4EOWH 3K6OA 3BE1H 1Z7JA 1FV1B 3KS0H 3O8XA 2CO4A 1AO7D 2H3KA 5TPWH 3H7BB 5EOQH 1TZ8A 3F8UB 4MD0A 4E9LA 2UZIL 4HIJA 5AZUA 1Y1DA 4RIRA 4ZFOL 5F7AA 2K4WA 3VWJD 1LEKB 4EMZA 3ARTA 1OVZA 2A3TA 1ZVHA 4M5ZL 5GSVB 2XWTA 3E6FB 1NM4A 3IFLL 4PJBF 4BH8A 4MFHA 1G1KA 4NKMA 5IW3A 4BZ2H 5K1NA 1BQHA 3JTTA 4JFXA 4ACPA 3D85D 2EYRB 1EZSA 1QUNB 4UM9D 4PJDE 1IZJA 3RWGB 5F6HJ 3ECQA 4APQC 2L3BA 1QX1A 2YD2A 1E50A 5FIEA 5IV2A 1NCWL 3S3BB 2EO7A 2GSMB 4JDZB 3K2MC 1HOCA 2ESVB 2P5WD 3OWRA 1Q1JL 2NLJA 1R17A 5KZCD 2YAEA 1G9ML 4W70A 2BPBA 5FO2A 5L4FA 2UWEA 3ARXA 1MHHB 2BP8A 3QJUB 5AKRA 4HWZB 1S7XA 4X98A 1A8ZA 4ODBD 4NWTH 1JIBA 4HSAC 1MNNA 4LXFA 2VMCA 5C07B 2BJMH 3X11B 1DEEA 1S9YA 4KZCA 3KPSE 4G72B 3FB5B 3FTXA 1JGVH 1OB0A 2R0WH 1M7XA 3D33A 4IJ3C 1BREA 1PZBA 2PTUA 3OB0H 5FECB 3D18A 1JTOA 5DK0A 4QRFA 3NJVA 1QSEE 3TO2A 1M2VA 3B9KB 4QF1A 1USQA 4JDVA 4ZFOA 4MA8H 2DKUA 2V7HB 5IWLA 3V0WH 2Z8RA 2KMWA 4CVZB 3EAKA 4FQJL 1EFXB 3R7QA 3RWCA 1KV7A 3IDNA 1DQJB 2DDQL 1JFQH 3SBWA 3CFDA 4RFEA 1N2RA 3IB4A 3OMNB 1C5BL 5INCB 1GZHC 1BP3B 1LP9E 1OCRB 2CR3A 1W0YT 2Y1YA 2JKIS 2WKLA 4OJFL 4CVXA 4ZZKA 2FD6L 3APFA 1ASPA 1VZHA 4M3HA 4ZPVA 8FABA 2RMNA 4C4KO 4OIBA 1CICA 4KRMB 4U7KA 3APCA 4UTBA 5KW9H 3AZUA 5ILTH 3I50E 4O2EA 3F5WB 3LEXB 1X5XA 3GO1L 4NB7A 3VXNB 3MRJA 5IG7A 1MCQA 2HJKA 3ARVA 1WAAA 2EDLA 3MX0A 2G0LA 2YKKA 2VDQL 3UPCA 5JPNA 2VERN 4P5TA 3H6AA 1KTJA 4PVLA 2MCG1 3T2PA 3PWPE 3WUWA 2J3SA 4AK2A 3TT1L 5IMLA 3L95A 4OCLC 1MW2A 2CHZA 3ZDZE 3WE1A 4M29A 4MJIA 4U1LB 1SMAA 4IMLA 2D7TL 2JLLA 3ZE2B 3BDXA 4MQSB 4BWWA 1E6OH 2Z92B 1IGYA 1A4AA 3BP6B 4WAFA 5IW1A 3MV9A 1OTSD 1NICA 2OA9A 1TETL 2KKQA 2Y24A 4D9QD 2DN7A 2NY5L 5DMIH 4N3UA 3F84A 1Y18B 1F41A 1ES0A 1RZGA 2QELA 2CGZA 4NJAL 1E4XH 3MRRA 4AM0B 5ABZA 4NKIL 5HI5C 5MHSD 1O6TA 5EIIG 2APXA 2FATH 2P5ED 3WN5B 3UAFA 5F1KC 4ZW3A 2EEXA 5FA3A 3DGCR 1INEH 5C09E 3MTXA 3KPQA 4L9LC 1CLYH 3DDFA 3HHMA 1MCHA 7CGTA 3QS2A 3WKML 1QRNB 2BHYA 4CKQA 1CL7H 1ICTA 1R5WA 3L1OH 1XVSA 5DJYB 1BFTA 1VADA 1IEBB 1KCBA 2JV6A 4HG4J 4N5UA 3O2DH 1U93B 5DCCA 2WZ6A 3VXQB 3EH5B 3KPPA 3ZYIA 1I85C 3HB3D 5FYKE 4ANUA 4GI8A 4AUJA 2A6DB 1A7OL 3DGDA 3L7FB 5CEYA 4KXAA 1RHHA 4FQ1H 5LBGA 1TZOA 4M61A 4XBPB 4OI7A 1YC8A 5HGAB 3U30B 4JKLA 2OTPA 3KJ6H 3MNDA 5EU6B 4I4WA 5D96C 5H94B 5G4MA 3NIDE 5HHMB 5A43C 2K7QA 3AAZB 2ENYA 1AO7A 1NFDB 5CJXA 4L3CB 4ZMOA 4UNUA 2UY6B 3S8WA 2G60L 4OCSL 3WFBH 1CC3A 1VENA 2HUEA 1A66A 4CSZA 3CLEL 4JO3H 4BXSV 3T9WA 3UTTB 3VWJA 4HUNB 1A2YB 3KYMB 1BA9A 1V54B 3MBED 1S9XB 3O3EA 2XA8L 4XR8C 3JVFC 1L3WA 3H2PA 4JFEE 4J3OG 2QSQA 1FRGL 1UH3A 3CHQA 5IHLB 5F6HI 2WKOA 2V5TA 2ISDA 2JIXB 2IDFA 4HIHB 2AQ2A 1VFAA 5CEZH 1ZLSH 2WO2B 1ZXKA 5DMYA 4EEEA 4I0PB 5GRJH 3AITA 3RU8L 4PWEA 5E8DL 5ELIA 4C8XA 4UOJA 5GS1A 4WJ5A 1DJZA 2X05A 3TYFB 5LWYL 1MI5A 4X80L 4EDXA 2JJTC 3EGSB 4QRRE 3QFDB 1Z9MA 5D5MF 4CJ0A 5DT1L 1J9QA 5ANHA 4HGMA 2ZNXA 3DX9B 3QWRD 3KLAA 4YHLH 4OAWB 4BFIB 4N9GA 3KS0J 5H35B 1K8DA 4CC4A 1E90A 2N4IA 5E8PB 3K72A 1DJYA 5EZJB 1DQTA 4Z5RA 2MOQA 1PX4A 1JDCA 2O26U 5ALBL 1QFUH 1BW8A 3HKFA 3ISWA 2DMHA 1K5NB 4ZMVA 4OSUH 4X0NA 4TUKL 3KPLB 1HQ4A 1U2YA 2NSMA 4ODSH 5C08E 1I3GH 4PI2A 4QTIL 1ACXA 1UVQA 5AYQA 4P59L 1XH3B 4L1SA 3UZVB 4UV7L 2VDMH 4Y4FD 1BZ8A 1CG9A 1DYZA 1GC1C 4QRSA 1NC2D 2AQ3A 3J07A 4JGJA 4AQAA 3K0YA 4XP5L 2A4EA 4OZFH 3D0LB 4OGAC 4W4OC 4KVNH 3QO0B 3FT0A 1ED3A 2H2PD 4L8SC 1SHXA 2R2EB 3TNNA 4G8EB 1FHNA 1I3UA 4XXWA 1M6OB 4G8GD 4JO8A 2Y22A 2N1KA 3VXUD 2AEWA 3MLWL 4Y4KB 2FEEL 3CN2A 5GS2D 5T1KA 4N4YB 1CGSH 3NESA 2ZXGA 3V8OA 2DQJH 2XFXB 2YC1B 4MMXB 1U3HB 2DLFL 3MODH 1QLRA 1T0MB 5HYJD 1ILUA 5ISZB 2WMPA 2ATPB 3DMMD 5EU5B 3HNSH 1JNHA 1JNLH 3C9NB 1JV2A 1CDGA 1UQSA 1UXSB 4JPIB 3TZVA 1AE6L 2XRAL 3FZUC 3QCTL 5C0CA 2IANB 3FMGL 1HZHL 4GUQA 3PABA 5K9JL 1MHPH 4HYTB 4PUBL 5E6IC 5MP6H 3FO2A 5D1XA 3D2UD 3I6GA 3CG8A 5GZND 3PNWB 3EF4A 3QYNA 3FT2B 3R7RA 2ZZUT 3HS8A 2P5EA 1H3UA 2XTJB 4FYSA 5L2KD 3F7YA 4NQEA 2JXMA 3D6GA 3KWXA 4PV9B 2BOCB 4XNMA 1OQOA 3B5TA 4LKXB 4WJKB 3LNFA 1CFTB 2V4LA 4ZMTA 3DUSB 1GH7A 4DK6A 1U33A 2X3AA 4LRIC 2KDGA 3C6LA 5FKPA 4L1LA 3LRMA 4RZCA 1RD6A 3B3IB 3FFCE 4YHNB 4DP6X 5C0IA 5DQJA 2EYSB 1T0OA 2ZXBA 3SE6A 3BDBA 2X6BA 5DRXA 5EN3A 4MGXA 3ALWA 3ABMB 4FLQA 4MAUH 5EORH 1DHKA 1ANUA 4QHKJ 2E86A 5F7MC 3ZUNC 5EZLA 2ICWI 1N26A 3RIFF 4AXWB 2G5BA 3O4LE 3GBDA 3JUYA 3V4VA 5FM5O 4LGPB 1ZV2A 2ITDB 2ICES 2XZQL 4O58L 1R75A 4Q0XH 1FE8L 5EEYA 4G83A 3QRFM 4QXUL 5DEGA 3ZHNA 1MNUH 1CGTA 4I1NB 5FLUA 2WUBH 3SJVB 1LDPH 2PCFB 3DV4B 1HKLL 5IROD 5C0JA 4FEMA 3SKUD 3PGDA 1BOGA 3F2LA 1UD8A 5J6HB 1AGEB 2OXGB 5IK3A 1LILA 1H5BA 4AW7A 2YUZA 3RWHB 4G6MH 3RWEA 4XN7A 1F11B 3N06B 3BRDA 4XI5D 1PG7X 1PD1A 3MNMA 4TRPH 5D6DA 3TA3B 1V55B 2AK4E 4PLJD 4Z7VB 2YSSA 2NDGA 4X8JB 2VDOB 4X9BA 3BH9B 4J3VA 3VDBA 3F12A 3QUKB 4KKLC 4JQVC 2G2NA 4EN2A 5E1AB 1JRHH 3QJTB 1PIFA 4X99B 4MNQE 1YA5A 3M7FB 5DEZA 4AV5A 1LQSR 1EEZB 2RA1A 1BBJA 5DI8B 3A6BH 5ID0A 3V0JA 2YZ1A 4DW2H 2ZUUA 1FORH 1NEZB 4KKQA 3OLGA 3QSKB 1QWUA 4ZS7H 2JI3A 3MBWA 1BM3L 2MTPA 4XHJC 4X4YA 1F00I 1DQDL 3D4GA 1FL6B 3ECBA 3FB6A 4Y1AD 5EPMB 1A3RL 3INUH 2OSYA 3Q5TA 1PVHA 1W0VA 1G0YR 1X5HA 2AQNA 3MV7B 1A6VH 4X4KA 2HT2C 3APMA 5J11B 1I3VA 1NCDL 1EGJH 4JRXB 4PWGA 4W9KC 4DGVH 5KVEH 4D8PB 5CN3A 2GUOA 4X5RA 4R7LA 4HUMB 1KLFA 3TBWA 2BIHA 3BKJL 5DO2C 1BPLB 4KV5E 5C86A 5I5IA 4RAUB 1GIGL 5JIDA 4MQ7B 4WCYL 4FL4C 3QEQA 4Y9GA 3NA9L 4UT9H 3ZZSA 2CUAA 4JFWA 2CO6A 5E8OA 4JPVL 2P7TA 3D07A 2ITEA 1GS8A 3TM6A 3RRQA 1XF3B 4ZX5A 4FTVE 5E00A 1DBJH 4HIEA 4Y4FA 2CUIA 3WOVA 1N5YH 3TEZA 3GMMA 3L3OA 5K9KB 2GTZB 1XSIA 1NC2A 1QNZL 2UYLB 3K6FA 3ZR6A 4ELKA 4XNZC 3A6OA 1DUZA 4YBLB 4AE0A 1A9BB 3VXPB 2NY1C 1MFDL 3TJEH 1JDDA 4NS0A 5AKVA 4K3HA 5CWSA 5AQ0A 2UVEA 4K3DH 2CBMA 3QXAA 4EKXA 1GHFH 4FNRA 3U48A 1UM5L 4G8GA 5HGHA 5D7IA 4K8RD 3QULB 2MKWA 5KJRL 2QGBA 5CXPA 3EJCA 4RDQF 2H3NA 2C9SA 1PKOA 3WHE0 1ML0A 1USZA 2N1TE 2V6HA 4JFDB 4YHIA 5J1TC 3WEXB 4AG4L 2P43B 3QUYC 4P4KD 3MACL 5HHOD 3PHAA 3PL6B 4P2RA 3VTMA 5HYJA 5L8KB 1KEML 2DIAA 1XDTT 3BKYH 1FFRA 4LP5A 2AEOA 1H3PH 2QADD 1T2QL 1NDTA 1L9QA 1SLXA 2MCPH 4LSTL 2FWOA 3NACH 4LLVB 5EBLA 1EH9A 2FT6A 3D39E 3CQQA 1M1XA 3KL3A 4GBXD 3NFSL 1T6BX 1UWXH 3KPSB 4YPJA 5ITBL 4MCZB