5LBVA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
403
structure length
390
Chain Sequence
IRCIGVSNRDFVEGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGDLYYLTMNNKHWLVHKEWFHDIPLPWHAGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein
molecule keywords envelope protein E
total genus 85
structure length 390
sequence length 403
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbvA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbvA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbvA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbvA03
3G7TA 1Z3RA 1PJWA 3N44F 2ALAA 1OKEA 2V33A 5AAMC 1OANA 5B1CA 4ALAC 3J2PA 4UTBA 4BZ2A 3P54A 2JV6A 2GG1A 1URZA 4BZ1A 5JHLA 5LCVA 4UT6A 4AM0Q 5KVDE 1ZTXE 4AL8C 2R29A 5JHMA 3IRCA 4FFZA 5GZOA 1TG8A 5H37A 3C6EA 5IZ7A 2I69A 2P5PA 4X42A 1OK8A 1UZGA 1RERA 4UTAA 4UTCA 5KVGE 5LBVA 2R69A 1Z66A 3N42F 3VTTA 3UZEC 2H0PA 4FG0A 5AAWC 1SVBA 3C5XA 3UYPB 3N40F 4UT9A 3UZQB 3WE1A 2JQMA 4L5FE 4GSXA 5KVEE 3MUUA 5KVFE 3UC0A 3UAJA 3N43F 3I50E 2JSFA 4FFYA 3J27A 1S6NA 3UZVA 4GT0A 5LBSA 5GZNA 2HG0A 5IREA 3N41F
chains in the Genus database with same CATH superfamily
4W1TA 5FO7B 3HKFA 4CVZA 2XTJB 4X9GA 5AW3B 1OLLA 4X4XB 5BV7B 3GBDA 3D18B 1XF1A 2CDEB 3C6SA 4MD0B 5F9AC 1KPUA 1IT9H 3GI8L 4PJFB 3V5HB 2FX7L 2L7UA 3PWLA 4YDVA 5F7EH 3NJMA 2X44D 3KWWB 4YMPA 1PBYA 4DEPC 5D4JA 3WYRA 2C3GA 1HE8A 2I07A 3OGCB 3VWKD 3OWRA 2ZUQB 1OAKH 1X6LA 3LY6A 3WEXA 1TZOA 1EZVX 1OTTC 1FFNA 3X3FH 3OXSA 4ODHL 1J8HA 3VSTA 2AV1B 1DVFD 3MA7B 3QDJA 3MI6A 4R26L 4XAWL 4Y7MA 1ML0A 5CJQH 1N6QL 4FMKA 3M7FB 5EN2A 2RTTA 2X9WA 5CSBA 3VVWA 2XTJD 3WD5L 3OAYK 2BSTA 5B1JC 2OX5B 3P4MB 1FVCB 4N2CA 1FN4B 2J8UE 4IRSA 5FK9A 5EOCJ 3GTNA 2BINA 5C3LD 4GMSH 2OPCA 1KACB 3FB7A 2UWEA 3QUMA 4M7ZC 4H8QA 4L8DB 5I19L 3D52A 2WO3B 1J5CA 2NY4B 2FO4B 4KRNA 5K33A 1JZ5A 3VFMB 4FQ2L 3LKPA 1B4RA 1PLBA 1KCUH 3L3GB 4ZW5A 3PY9A 5I8EA 5CCKL 3OXRA 4LSUL 3DO7B 1U8OB 4HUVA 1VRSA 1REIA 3JSSA 5I8CA 1GYWA 4FFWD 4L1TA 2CBMA 1TZIB 4PJHE 5HDQH 1JGLL 1OEZW 1NIFA 4ZMVA 4O58H 5L2KB 3PP3H 1N12A 3GSQB 1JGEA 5T1LD 1CIDA 2IDCA 2PCFA 2H5UA 3KPMA 5FA4B 3CZSA 3GUFA 3PAVA 3QXVA 4G70B 4KJWD 1CGYA 3BKCL 5FXCH 4Y5XC 3VFVA 1MCWM 3MRNB 4ODWA 3REVA 2VQ1A 3QR0A 4LL1A 1NGWB 5C2UB 3GSWA 1ZANH 2J43A 1JDDA 4LDOB 1OOAA 4J3VA 4OD1H 3RVTC 2F15A 4QRUB 3EOTH 1KJVA 4HXAL 1P84J 2OZ4A 2HFFA 4HZAA 4WY7L 4QTIH 4YXKH 1QABA 4DPBX 1F3JA 2JB6A 3A0OA 4EN3D 1D5MA 4MJIA 3WE6B 4O2CA 3T0DA 1JFHA 4HP5A 3LS5H 4M56A 1DDHA 3JV4A 5HYSB 1SQMA 5ISZA 5I1JL 3QUYA 5LAXA 4G6AC 3BKYH 3FQYA 1CIUA 4L3CA 2YOAA 3T0AA 5FO8A 2DQGH 4JFDD 4HX1B 1I53A 4PV9A 3L1OL 2ID5A 2R0ZL 4KOBA 1NCAH 3VXTA 4N0FB 3ZYIA 1G5GA 5F7AA 3Q8FA 7PCYA 3GMQA 2CGZA 1EX0A 1VCAA 5AZEL 3Q1SH 3EXLA 4LSSL 2UZXB 2VITA 3DGCR 5EU6A 1RZIA 3ZT5A 4G8EA 3H2PA 3ZE2F 1ZLVH 2PW2B 3EW3B 4K23H 1W0YT 4Z23A 3EFDH 2IOIA 1YYLH 1H3PL 3CDFA 2UYLA 3SCMC 2VOTA 5MEQA 1VLXA 1UM6H 2H41A 4Z76B 5I30L 5JQIB 2X7LB 1TR7A 4AMKH 4DNLA 4M3KB 1NIEA 4HIJB 4UWQB 1A66A 3BP7A 5I5MA 3DX9B 4GXVH 3WNNA 3RPKA 4LAQL 1S7XA 1ZLWH 2VDPH 4JFXB 1TXKA 3V0VA 2AQSA 3WMQA 1UC6A 3NRQA 3QFJB 4JY4B 1Q0XH 4ZS7H 5KJRH 1D2PA 4H8WC 2AJUH 1EERB 2FECL 1NC2D 2B9BA 5FGCB 1XF2A 3OZ9H 5KSVA 1IILE 3K2UL 4OZIA 4HJTA 1YNTB 3QWOA 1UURA 3WUWB 2YMXL 5D7KE 2Z3FA 5IKCA 2WCGA 3HC4H 3OAUL 3RURA 3A23A 3VI3F 5FW6A 1K4DB 4YL4A 4YFDB 2WO2B 3BUDA 3CFKA 4DEPB 5D7SL 5HYQB 1RK1A 2AJZB 2DDQH 1DVYA 4JO8A 4QTFA 4E5XG 3ZKXB 1A1MA 1U30A 1M56B 1FL5A 5FYKH 3COOA 5J1AB 3EH3B 3UBFA 1CBVH 4K94L 2R4SL 4L8BB 5AFAA 4MDIB 4K5OA 3QC5X 5E7FA 2C9UA 2AHIA 1KV7A 3RX5A 4MKTA 2X2JA 2LT9A 2AV7A 2XOTA 4EXPX 2F1AA 5KVEH 3HNTL 4NKOB 2JIXB 2HFTA 2M26A 4RWYL 3BZ5A 3QQ3B 3CK0L 4AT6A 5CCHE 4AI7A 3CN4A 3F83A 4GG8A 5I1LB 1HCVA 1MI5E 4M1DH 4N2KA 5D4QA 4PJHF 4XPHL 1GYCA 4M3JA 2JK5B 5L2JB 1Z5HA 1NGPH 2Q7NA 5E8NB 1JWSA 2I9LA 4KDTA 3VD4A 5D72H 2NQ3A 3O9WD 5AZ2L 4FF9A 1P5VB 5DA0B 4L48A 1KEMH 2ED7A 4RLDA 3VFSA 1FZJB 1NCCL 4BZ2H 4GFTB 4C57C 5DMIL 3ATBA 3BN9D 5IUCA 2YQ2A 1MFMA 2C9SA 1MI5B 2HRGA 3H9YA 1X5LA 3CFUA 1WFJA 3SKJH 4U6YB 3RL2B 1JXGA 3PWVA 4GRMA 1E7VA 4PCSA 4JDTH 3LZOA 3IYLW 3NSCA 1RUKH 4ZMXA 2ZYIA 1N5AB 3FN0L 1YVLA 2OTUA 3CXHJ 2DICA 4PJGE 4L05A 4P5SA 3KW8A 1DQQB 3L3OC 2WSPA 4YSQA 2VKXA 4EOWL 4QNPF 1KF9B 5DCCA 2BZCA 5AVZB 1UM5L 4V2BA 1OCRB 4LEEA 3SQRA 2FUQA 4WO4A 3A4FA 4IEFA 3UG5A 5I1DA 1BM3H 3MV8B 3EO9L 5ITBL 3VH8A 4YHKL 1IEBA 2HWZH 4ZAKA 1R9FA 3P3UA 2QGDA 1CT8B 1FBIL 4G8IA 3N5AA 3DNKA 4R90L 2WQ8A 3KPNA 3UTSE 3MRHA 5IHZB 4GXUM 2OSLA 5T3ZD 4M5TA 3RJDA 3GSNH 1K5WA 4XMUA 5JW3L 2WZAA 4XHJC 4OCWL 1J0JA 2V5YA 1SFDA 1LO3H 4LNVA 4AIXA 4L8DA 4M4PA 4ZPVA 5AYQA 2X9ZA 4QI3A 2QBWA 3RVVC 2YKLL 3WS3A 2E9JA 4KPHL 2YQGA 2DLEA 5DMKB 4EUPA 1VSCA 4XP9H 1FVDA 3MLWL 1N6UA 1FI8C 3U4KA 5KJ7E 4RAUB 1ED3B 5BUPA 2XWBB 4MS6A 1AP2B 5CEYB 1R3LA 2FWUA 2GEEA 4DH2A 1FZKA 3WN5A 1DJXA 2YAFA 4J3OC 4IU3B 2OMYA 4H8HA 4EN3A 2V3FA 3H85A 2R0WH 3AXHA 4Z7UB 2UWEE 4LL9A 5INCB 2EDDA 1HTYA 3MBEC 1B4JL 4HIPA 1OPGL 3DETC 3D3VB 3LEXB 5EOQL 1GW6A 2EDEA 2CPUA 2BCKB 2BP3A 3T8MA 4FXGC 4GQ9H 1E43A 2KLSA 2EIZB 3LEVH 4YGVA 2I26N 4PCYA 4CC0A 2GB2A 3CU7A 2XQBL 4W9IC 4ADIA 5FUOL 3KYOB 4HS8L 3U7YH 3GXPA 1SYSB 4WEEA 1D5IH 2Z31D 4G6FD 4NQTA 4JB9H 3GC3A 1XH3B 3SBPA 5D70L 5C0IB 2C1PA 1GS7A 2QSVA 1ZGLM 3PWPA 4WI2A 3TGXA 3IJHB 2DQUH 4Z6AT 3WL9A 2ZF9A 3KPRD 1T0MA 1CXLA 2L7JA 4PI0A 5AW9B 3U6RA 4TTDD 4AWJC 1GR7A 2DL2A 2YFOA 2VUKA 5DZLA 1PQZB 4BSWB 5F93C 3LXBA 3BGAA 1A6WH 2ZP9A 2OA9A 2HX9A 4RESB 3RWCA 2ZG3A 3MOBL 1QO3B 4F9LA 1ZA3A 2ZXEB 2EE6A 3EO0B 3MRPB 5E0FA 2XFXB 1TCRB 2KPWA 2CLRB 3L7EA 2BP0A 5E4AA 2JCCE 5EBMA 2QQQA 5I17A 2FT8A 2WIIB 5ALCH 1XSOA 1O6TA 1EXHA 4HC1A 3VMPA 4L1SA 4QR7A 3JTTA 3OJDA 5LG1A 4X4KA 5D5MB 4P2RB 4Z0BL 3BVXA 1HWWA 2F2HA 3PJSB 1KGUA 4N8VB 4ZUSB 1F58L 3BESR 1ZLWK 4GAGL 4WTQA 5JMRA 1M53A 5AWNH 2R51A 2UUDK 5D2LF 3IMUA 3GMNA 3MJGX 4N8VG 2QGEA 5E08L 3ZOAA 3F8UB 4D9LH 5GZNA 3MRMB 3SDDB 2C5DC 4M6NH 1F6LL 3VD1A 3HR5A 4F8PA 3PQYD 2GK0B 1A7RL 5DTFA 2ZCKL 3FUNA 2CO7B 5A1AA 5IB5A 3Q05A 2LE9A 2H0EA 1NAKH 1O6VA 2Z91B 1QEWB 1RZJL 5CLWA 1NGQL 3DXAA 5CZKA 1A3RL 4HEME 1V7MH 2R2EA 2ZICA 4FKEA 5D71L 5DR5H 3T3PE 2Z8VC 2BVPB 1ZGLP 1UA3A 1CI3M 3DVGA 1BFVL 2DYSB 1RV6X 5DQDH 5CILH 1KBVA 3T4AB 1PLGL 4I18A 1WZ1H 4W9HC 1XCTA 1JZFA 5AVSB 3WNLA 5IQ7L 4MCYB 2EXYD 3AGWA 3HI5H 3JZ7A 3DHUA 4PREB 3ZKND 1IGCH 2WSDA 5F7DA 2WP3T 5BPPA 3GLZA 4R5VA 1CO1A 1ZSDA 3RUGB 1Z5LB 4XNYL 2ROXA 3RWHB 3C6EA 3U6RB 3X1NA 1I8IA 3SD2A 1H15A 1SJXA 1QSEB 4PJGA 3H9ZA 3V6OA 1X5XA 2I85A 3HBZA 2XQ0A 3EJUA 2F8OA 1M2VB 5DD3L 5DF0A 4KX8A 1KCBA 2BVOA 4NQDD 4UV7H 5B3JF 5ICUA 4YZFE 1KNOA 3WEXB 1DR9A 1A5FL 1PCSA 3WGUB 3CFNA 3TFKD 4K9JA 4ZPTB 1U58A 3GUTB 3BDYH 3ZHFA 4K2UL 4HKJB 5KS9A 4OLYL 5KSUB 3KJ6H 3LPGA 3U4EB 3HE7D 3P9LA 2HYMA 4J5VA 3NIGE 2X4NB 2HLEB 4XODA 3NABH 3D51A 2BVYA 3QUKB 2H8PA 4FKKA 3S3BB 5F7UA 5IQLA 4X80H 4FQLL 4F37K 1NUDA 3DOSB 2BZDA 3BW9A 3IDJB 3SHSA 3QEHB 4S1SH 3RIFF 3SE9L 3BPCA 2HRHA 2QTEA 1FGVL 4R0LC 5TQ0L 3V4UL 3FU0A 1AR1B 2RR3A 3SY6A 2YEZB 3RIAF 4EN3C 1JHKH 1NM9A 1WIPA 5HYJE 4KROB 4O02L 4Z7OB 1WZ1L 2CM6A 1SDAB 3ZMRA 1B9KA 2A9NL 3FU8A 5E9DD 2ZXQA 1C16A 1I3GL 1KY6A 2YAEA 2ADGA 2XA8H 3DX8A 3MUHL 4JFEE 4QDGA 1S7TA 2VB5A 4NO0B 2Q7YA 4ZFOB 5E4EB 4PJAF 1CFNA 2UXFA 3GQFA 2Y7LA 4PYGA 3QI9C 4RETB 3O3AB 3LYRA 4A2GA 3ABGA 5CSZB 2VLKB 5D7EA 3WO4C 5FCSH 1UOVA 4LARL 3T3PF 2O61A 5EG6C 1T7VA 1MHPL 1XR8B 4HZLA 2BLFA 4B9ZA 3B9AA 3U79A 2SEBB 4Q2ZA 1AMYA 3KPRB 5ACZB 1M2OA 2KL6A 4GAGH 5MEND 4YVNA 4YLCA 5GS0D 2XLLA 2P28B 3H3PL 4JHZA 5JPMA 5E6ID 2PPAA 4X5WB 2H3KA 4M7KH 3GS4A 4GP8B 2Q76A 4YSUA 2W9DH 3B2XA 4GG6F 3L3OA 4QRPE 1M7DA 4YDNA 1IM3B 2ZUVA 5AKVA 1CD9B 1T1WB 4WKZB 1QATA 3RZCD 3SODB 1U8JA 3DX0A 2IH3B 3QI9D 4F9PC 1DVFB 4IIQB 4HZ1A 2R1WB 4PLOB 1QWUA 3MOBH 4GO8A 1DBAH 5GIRA 4WDIA 2K6YA 1TTBA 3AU1A 2LQRA 3RGVB 3GUTA 1PSKH 4LFHD 2I25N 3PHSA 4ETQB 3VRIB 4YAQA 1C5BH 2BERA 3WKMH 4KROC 3ZE0F 4WW2C 2CMRL 4OCSH 3GI9L 4XXCC 4N0UE 5FM5M 3UYOD 4N9GB 2XZCL 1WFTA 2PXYA 4JB9L 3UDWA 4U6XB 5CCGE 2CQVA 3O2DH 1T83C 4DP5X 5T5FH 1T3FB 3CZNA 5FX3A 4GKSB 3B9KD 4JFEB 1IX2A 5JYLA 1FFOB 1SJHA 1A9BA 1CF1A 2XWXA 3FUKA 2O5XH 2ZOKA 4DP0X 3CAFA 4JDEB 4NRZB 4U6HA 5B1AB 4CRPA 5DS8B 3ZL4L 1NBYA 4IMLA 3UX9B 3SGEI 3CHXA 3KVQA 2GI7A 3MX0B 4ZTPL 3SDXA 3W0WE 4YNYA 3VXRA 1N9PA 4BM7A 2GT9B 4MA8H 1CFNB 5E1HB 4L5FL 5E1AB 3FSAA 3TPUB 1NWPA 4QYAA 3KWVA 4AOFA 4P2AA 4X99B 3ESMA 4HEMA 2CAKA 2GVYA 1KPUB 5JIMA 4JFQB 2BVQB 4O2FB 3PGDA 3AT9A 4PRBA 5FGBA 3VJ6A 1KT2B 3D0VA 1SQ2N 1GZHA 1MHHA 1JPSL 3CDGB 3LIZA 1EVTC 2PO6C 4G7VH 1DVFC 1BMWA 4OFQA 5DVNA 3LIZL 2IG2L 3MLUH 1IGFL 3MNWA 3SBWA 4TLKA 3APCA 4RGOH 3PF2A 4PRNB 3FO2B 1N8ZB 2R56L 3CFKB 5HYQA 5JA8B 3OKKA 1SXCA 2VUYA 1EK3A 2VWEE 3ABLB 5TE6H 3M7OA 5IHLB 1BM3L 1LD9A 2VDLH 2OXHA 3SE6A 1KJ2A 4KKLD 5I76B 2BO0A 4C56A 2L4OA 4G3YL 5EWIL 4HPOH 5HHOE 2APFA 4XRCA 2K4WA 1AKPA 5E4IA 1B0GA 2RHEA 3VFMA 2BNQA 1S4IA 2OP4L 3HG0A 4MBOA 1H3GA 5F9JB 2VRQA 1QI5A 5IMOA 2ZAIA 3V55A 4BUHA 3ZZSA 1R1CA 4BRVA 4URTB 2GPZA 5LBSL 2ZYHA 1NFIB 2HVBA 1RUKL 3KYNA 1IZJA 2AEPL 2ARJA 1NUNB 5LBSA 4LHQB 5LLIC 1WA2X 3PWPD 5FLUA 5FEBA 5INDA 1E2ZA 5C8JA 4JPWL 2YMOA 3DXAB 2EUZA 4MS8C 4GP4B 1O75A 3RU8L 2XV3A 4U1JB 2WPGA 2A2QT 1UOKA 4AYMC 5DFWH 2AEOA 5JZ7C 3P2BA 2F5AH 2IEPA 3BPOB 4X6DB 1XEDA 3G5ZB 1CN4A 2BWDA 2D3LA 3O8XA 4LB8A 4RZCB 2X1PA 1K4CA 3QJOA 3JYCA 1IBZA 3RDTA 8FABA 1QW9A 3IKCA 5JO5A 4R2GB 3TN0A 3HI1B 1ZRUA 1OT2A 4IMLB 4NNXB 3W5NA 2CDGB 3QFDB 3FTGB 5CINH 1BYNA 5ETUB 4LCIL 2PPDA 5HGHB 5IW3A 5J5EA 1TJMA 3TEWA 4B9GA 3SCMB 4DIXA 3PNRB 2FLRT 4IKNA 4XNBA 1BWMA 1NEPA 1HOEA 1F4AA 2HLFD 3ARDD 4OM0H 4DEWA 1ZV2A 3L4XA 1N6VA 5JIKA 1UASA 3SE4C 4A6YL 2BJML 5SWZA 5ADPH 1ZD6A 1QHQA 2AERT 3IU4L 3TA3B 5KVMC 1P1VA 1YMHA 4NJ9H 2EDYA 2VYRE 2ZX9A 4D0DA 3CVHL 5B21A 3HCVB 4NQXA 1YQ2A 2FECI 1UENA 2XG4A 3AWFA 4V11A 1XL6A 4PJXE 1NOFA 3MR9A 5IF0B 2UZPA 2EABA 3CPLA 2H32B 5BZDA 3KL0A 3TO4D 4Q89A 2HP4A 3QEHA 3WJJA 1JZ8A 1RVFL 1SXAA 2AP2A 2YPLB 5LGJB 4ZX5A 3SJVB 4OZFG 4Z3EA 5BS0E 1I3RA 3KMDA 1ZMYA 2J44A 1HNYA 4JNXA 2PWFA 1H0DB 5ACLA 4WJ5A 3DX6B 4JLRA 2B4CL 3C12A 4IW4C 4DVBA 1QLEB 4HJGA 5DZOA 2I9TB 4JG1L 1LP9F 3RWEA 3N9GL 3VW3L 3ARPA 2WNGA 4HWZA 4N0UA 1JTPA 2W91A 5FFGA 5C7ZA 3IDGA 4LAQH 1SF5A 1U6AH 4PJCA 1DZ0A 4D8PB 1IAOB 4WJKB 1L9TA 1QWNA 1EHAA 4J12A 4XWGL 1BAWA 4M1GH 4UT9H 3S96A 4JZJC 5E8PB 3SZ6A 1VFAB 4GKZB 5HVGB 4BYHA 3MOAL 2P5WE 4AV5A 1MVUB 2SEBA 2APSA 1HHGB 5CBAB 5K59E 3D4ZA 2YD8A 1TJHH 1A9EA 3TVMB 2A6IB 4IBUA 3EFDL 5H35A 1UXMA 3SYPA 1N8OE 2XN9A 3GKWH 4J3TA 4FADA 5C9JB 5KYYB 4ZOBA 5K1JA 4N0CD 4ONHB 3ZX1A 3M17A 2ZSWA 2ZUTA 3IFOA 5FF6B 1DN0B 1NC4D 5ITFA 4R96B 3ZY7A 2EYTB 1IGJB 3BHBB 1ZHKA 3FW6A 1BZDA 4PJ8B 4F5CA 3J8F7 5IIEA 3HFML 4M1GL 3LZQA 3ARED 3VX0A 3GXFA 2R0ZH 3T8XB 4AYFA 5IQOA 1NA8A 2R1WA 2XBTA 4JFYA 4WI6A 2DQGL 2EXWD 2ZG2A 1W0WA 4AG4L 1EXGA 2J88H 2JJTA 4PS8A 4NN5B 3WFCH 3PJNA 3L3IA 4BCZA 2A77L 4NZDA 4TULL 3SDCA 5C0JA 1PEWA 1QQDB 3VMOA 2OM5A 4TNFA 1F02I 2GY5A 1IAIL 3P0YH 2ZZUT 3CXHK 1XGTA 3ARBD 1E5CA 1SXNA 4TUUA 1WZMA 3WIFB 5D6CB 1HKLH 4FLHA 1GGYA 1NFAA 4JPIB 4OAWA 4OD1L 3BVUA 1AOZA 1H9DA 3I2CL 2OXGB 4ZFZB 1J1XL 5CFHA 4PGEB 4JQVA 3SJVA 5EIIA 2VDRH 4K3HA 2JTYA 3LZPA 3O4LE 4MLIA 2Y2WA 3WELA 5BQ7B 5FHBH 3FYIB 1JV5A 2HKFL 2XICA 2E46A 2LW5A 4TM9A 4F1ZA 1JZEA 1KTRL 2GSIB 4QWWD 3CVHH 2L3BA 3WTSA 4PJAE 3ZKMD 2OS7A 2WBJB 4DKAA 4L8CA 3EXJA 2C9RA 3HRZA 2BJMH 3SPIA 3WG7B 3T04D 5ADPL 2DWYA 1MCOH 3MO1B 4P2QD 4U6YA 4X5XA 3RL2A 1IC0A 1G6VK 3WY4A 3BISA 3KVDD 2VMDA 2V3DA 4KQ4L 4JO2L 5C3IA 4JX0A 3IGUA 3P11H 4KVNL 2ZKWA 4LSUH 4EZJA 4TMPA 2OMWA 4G80B 4MAZA 5HHMB 1Z7JA 2ENQA 2N7SA 1XH0A 3HR6A 2FRGP 3BZEB 3TM6A 1AZUA 2VM9A 3BGFB 2BIHA 1OAJA 4AENB 1KTDB 2WZ5A 1IVLA 1PPIA 2Y06H 1K8IB 4YSAA 3RDJA 1S3RA 3BP5A 3C5JB 4RDQF 2KC0A 1DQTA 1OSZA 2Z31B 5MERB 5G5DB 2R8SL 4X8XA 3L3GA 3RU8H 4G8IB 1BIHA 4ZNEE 1PD0A 3TYGL 4CC1A 1S78C 3IDXL 1UZ8B 3QWRA 5FUCC 2WANA 4K94C 2CRYA 4MJ6B 5DC4B 5EO1B 1HXYA 1LJMA 3BPNC 4KKCC 3GLDA 3WLBA 1QFWI 5F0MB 4LMQE 1FRGL 5IHHA 4ISVB 4EJ1C 5FO8B 4DOHB 2RAMA 1EEYB 4P2RD 2OP4H 5IMOB 2OMUA 1RUQL 3L3KA 3SGJA 3U30C 1L9RA 4ZFFB 4FNSA 4XOCA 4U0RC 3EYSH 3NZ8B 2P24B 3GSOB 5A2IH 1F4YH 4U2YA 4FXGA 4B27A 4JZOA 3SGEH 2HAZA 1UXWB 2FB4H 3GMLA 3QG7H 4FG2A 1ZHNB 4MJID 4DZ8B 4FFYA 3AT0A 4M4RA 5SV4A 1USQA 5ESQB 2FX8L 1S9WB 3MBED 1MVYA 4RGMC 5CKAA 4OBSA 4AE0A 1JDAA 4TTGA 2CH8A 3B2MA 4UBDC 2EIMB 1F4WH 5C2BH 2FH8A 5GRZA 5DJXA 1F3JB 2JB6B 1CCZA 1IGFH 5JO5B 2D7TL 3QEGL 8FABB 2ENSA 3GNMH 3Q5YA 4AGOA 4M6MH 5JW4R 2HZHA 2HJFA 4HWNA 1P6AB 2Q5BA 4F57H 2FCBA 4P46A 2G5BB 5E5MB 2ZOWA 2AQPA 3GSNB 1JPSH 1EAQA 3FHEA 1EVUA 4JJ5A 4OD3H 2EVGA 2ALWA 4A2HA 1G43A 5DK2B 5EC1A 2RCSH 1AHKA 4OU3A 2IPTH 4J8QA 3ZHDA 2VDNL 4GQQA 4PVBA 5LDUA 4PB9L 2G9HB 2RACA 1MAMH 1CXIA 1A14L 4L5FH 1MFCL 5DRNB 2FWOA 4TXVB 3QYMA 1OGAB 1T5WA 2J20A 1MOEA 3UAFA 3OKMB 3RBGA 1ZHBA 5LXGH 4PJFE 1ZTXE 3ESVF 2JLPA 1TQBC 1CLVA 3O2VL 2AI0L 1AS7A 4S1QH 4LSVL 4P2RE 2XETA 3T6ZA 2WXGA 3QR1A 1CFMA 3TL5A 2JCCF 2YRLA 2XY1A 3WJJC 3EO0A 5I1EH 5IB1B 1RSFA 5MEOB 4KK8C 3HAEA 1NCBH 2XZZA 3EJCA 4UTAL 1DVXA 3POCA 3R1GH 1BOGB 5L9DL 5JLZA 3GZOA 2W65A 4HMDA 3UBXI 3BP7B 2C3WA 3SDCC 2ZAHA 5L0QC 1C5CH 4NBYB 3S0PA 4FTDA 4H40A 5FB8B 5CP3H 1H3UA 2MCAA 4F3FA 1YEJH 5FOBB 2NY1D 1M7IB 4N2AA 1NICA 4G8GD 2VMJA 1TQCB 4AMWA 2IAMC 2K7QA 1JE6A 2C3HA 1MCSA 2X2HA 4J3WA 5DFVD 4AKOA 3G5YA 4DW2H 5CR1A 4M6OL 1WAPA 4HK3J 3K1DA 4LCYA 4YSDA 5DD6B 1JK9B 5EO9B 4GRLB 4KRPC 1KIQB 3UP1A 3GS7A 4XVUD 1ANUA 3D09A 2CO7A 1WO2A 5IB5B 2J5LB 3RILA 3SQOH 2APWA 3B7RL 3PQYB 4M4RB 5HHNA 3CC5A 1HINL 3SJVE 3RFZC 5KSBF 2BC4B 4Y8DC 2V2XB 2A38A 5AOMA 43CAA 4QHLB 1LGVA 4HCGA 1T22B 3FONA 3H53A 3X11B 3N1PC 3PJLA 1UWGL 4PJAA 4PRHE 5T3XL 2OK0L 4YUEH 4R4BB 2NX5D 5C07E 1TZHB 1J1PH 1CDGA 2PW1B 4GSXA 4NCDA 5JW5B 3LN5A 3LQAL 2XNAB 3QJZA 4WSKA 1FCCA 3RI5K 1JTTA 1TO5A 1MAJA 1YYCA 2IOMA 1VFBB 4X0NA 2JI1A 4NUJA 5D1ZI 4UM9B 1MHPH 3HBPA 4X9YA 2H1LM 2BIQA 3MUJA 4DK5A 4ANKA 1L6PA 5JIDA 3KGUA 5LNEA 2QELA 3MGTA 4FLQA 3UH8A 4DN3L 4F33A 1U8QB 2B1AL 1HX0A 2VLMD 3B2UC 4HKBA 1I3GH 1JPST 4L3CB 2XWJA 3SDCB 2CU9A 5C0JB 1HDMA 4QXWA 5AD0A 5DO2C 3EOAA 3FU7B 4NKMA 2A9NH 3FO2A 4MD5A 1JYVA 4KXBA 5A7BA 4KK5C 4NQDE 3NEXA 1ORQA 3ARBB 2W0LA 2NZIA 4B0MM 1XF4A 5CEZL 5IUSA 3B6SA 4Z3HA 4X80L 3I6KB 5GSVA 2QV4A 4XVSH 1ZS2A 3A4AA 3NABL 2ISDA 1G9ML 5EORL 1F0LA 3V0FA 4UQDA 3ULUC 4JZNB 3SE4A 1BZ7A 4WO4D 3MBEB 1ZEAL 4J7RA 4TN9A 2VLRE 4H88L 1KGYE 5D8JL 3R0NA 1OCOB 4N24A 1ITBB 2JB5H 1AP2A 5C9KA 2BIIA 4QT5A 3ML8A 2ARJB 1U8IA 4WWKD 5GGTA 3WTTA 4BKLB 3A6BH 3SDAD 1BFSA 1URZA 3EYVB 4IYKA 4DQAA 1A4JA 3ARXA 4QXGH 4PD4J 1L9OA 4JREB 5H37G 4BD4A 2WW8A 4XPTH 5F3FA 4JKMA 1T03L 2FEJA 2EACA 1LE9B 1L9PA 3ZDXE 4CGUB 4EXKA 1NEUA 3NFPA 4KY1H 5MENE 3S36H 2EVIA 2VLJE 4KJPD 4L4VB 1T5XB 1TFPA 2A6KB 3LKQA 5G4MA 4H1LB 1LE5B 5ICZA 4U1HB 3WJMB 2W0FA 1Z9LA 2QPSA 3KPSA 4G8AC 1MJ7H 4GH7B 3AG4B 2WVTA 4J28A 4MAYB 4NUQA 5CBEA 1DEEB 3INUH 1WAEA 1JFQH 2Y1YA 3K91A 1MUJB 2VERA 3NCCB 4HKZA 4KKNA 5D71H 5T1LA 1NGQH 2YAQA 1RZJH 4UTAA 1T21B 4PJFA 2GBVA 4Z7WE 3P0VL 2ZCKH 3BIKA 4UQIM 4MSWA 1M3JA 3IJYB 5IQ9B 1UWEL 2DM2A 4GYBA 5KN5B 4JANB 2I7OA 3V4PL 6TAAA 2BFVL 4WJG3 2VSCA 4WF7A 1CU4H 1MEXH 1UQSB 4HIEA 1B4LA 2ZT9C 1OTSD 3O4OB 3QHFL 2AQQA 4JDVB 5ESAB 2VR7A 1YY9C 1BAFH 5GZNC 1BFOA 2DIEA 1ES0B 3L3KB 3QIBD 3ESNA 4QGYA 5D5MF 4D0CA 4BDVA 1JGVH 1S7SB 4KHXH 5AW7B 5L0QB 3MJ8A 4HOMA 5AUMB 3EO1B 3QXDB 4JPKH 4OVUA 4Z77B 5EIQA 2BDNH 1Q9KA 3DRTA 4QYOB 1E6JH 1PZDA 4IRSB 4N2FA 4XP5L 1U8HB 2OJEA 1S7VB 2X6BA 1WRFA 3OJDB 4UT6H 3MCKA 5DUPH 3ASOB 3QRLA 4AKPA 5LGHL 2ZX5A 3NCMA 3WIAA 1S9WA 4QRRE 5E6YA 1SXBA 3WJLA 2V2TB 4K5NA 3ZIMA 1YG9A 5T1KD 4XBPA 4JM2B 4N2HA 2VDML 4ZO6A 2MCPL 4E41D 2WUBL 1L3NA 3DX6A 3QUZA 3US1A 5HTSA 1CICA 3UJJL 1KDIA 3JTBA 5GS2H 1NMBH 4X4YA 1YAIA 4IOSA 1DBKL 2FT7A 2OULB 4A6YB 2XQYK 4KZDH 3SEPA 7PAZA 3VDBA 1M1SA 5DK2A 3HMXA 2H1PH 4AUUA 3S4SG 4D7BA 3FQRA 3AW5A 1QBLH 4JM4H 5F1OB 3KS0H 3KXFE 4WUUB 5IK3B 4DGVL 3T0XA 5HHPB 4G9DA 5D7LD 3SKOB 4NQQA 1AQ8A 5SV3A 4Y4HA 4XAKD 3U7YL 1BJ8A 5FUOH 3EADA 4ACTA 1O7DC 4QY8B 5IB2A 5D1XB 2ZF8A 3Q0HA 4OLUH 1F00I 1RMFL 5EZIH 1YEEL 1I85A 4QRQB 3MLTA 4LOUC 2BX5A 3ML9A 1BZ9A 1AY1H 1YUHA 3GMRA 4YE4H 1BMZA 1OHZA 4YWGH 4L3EB 3K71B 3LN9A 2FVNA 2JXMA 4HALA 5E2TH 4R83A 4GT7A 1M2VA 3ARDC 4JVUA 2ZWSA 1S5IH 5I76A 2YPKB 2NY3D 4AVHA 4FX5A 4YWGL 1IAKB 2E6PA 4L0YA 1S7WB 3MLWH 4KDVA 1P2CB 1DQMH 2D8KA 4XP9L 4IIQC 4LPTA 1XF5B 3D0LA 1HL9A 5FECB 4EI6A 4OLUL 3CZJA 2NRDA 3NFSH 4CN6A 1T6WA 3T2NL 3B7TA 3AQYA 1JGIA 1M42A 1N26A 2HB0A 3HS0A 5E8DH 3WKNA 4LXFA 3MBWB 5EA0L 3ARWA 3VCLB 5GGTL 1A22B 1FNHA 2MHAA 3IFNH 4MMZC 2BC4A 5I5RA 2Z34A 1FBIH 3I75B 1JNLH 1YSOA 3V5KB 4U33A 1HYSC 1UADC 1DLHA 1IGTB 3D6GA 3SPVA 2A6DA 3VFUA 5CEZE 4X6DA 1IAMA 2CA4A 2OSYA 1KWKA 4PJCF 1X5GA 3EO9H 3X14B 4BCXA 1G7IB 3HE7A 2F1EA 2NY7H 5EZPA 2ICCA 1WV7T 4ZAKC 1NMBL 3DX2A 4UV4L 1T1YA 5ID1B 3QZWG 3EUDA 1MNNA 1G9EA 3BFOA 4HX1A 5SX4H 1WITA 4D94A 2AEQH 2O5YH 4B9KC 5E9AA 4WW1A 1EEZA 1JHTB 3NZUA 3MUZ1 1X5JA 4ODSL 3CN2A 4NEHB 3TTYA 3SKJL 3OR7A 5DUPL 5FDWA 2YD6A 3VXSD 1NAMA 3WHXB 5IP4A 2XQYA 2DOCA 2BDNL 4MAYC 3SB3A 4HJJH 2NX5A 1AGBA 2K78A 2RH0A 4Z7VB 4POZD 4K8RH 3SBRA 1NAML 5I0ZA 3ARDB 3TJEH 5E56A 2XN9D 3L16A 3QQ4A 4PUBH 3IETB 3L3JA 1MHEA 3NJJA 4LLQB 4MX7B 3W0WA 4KQ3H 3C5XA 1DVZA 3NJNA 1D5XA 3K5SA 4JRWA 3GMRB 4ZODA 1M6OA 2IH3A 3DJ9A 2EIKB 2CJUL 4A2EA 3I3DA 1WGVA 4HUUB 3SGJC 1ID2A 3DIFB 4ES9A 2WHVA 1R34A 5KSAD 3P0VH 4BZYA 4U3CA 4PBVC 5DURB 1HSBB 1K8DB 1TU2B 4IBSA 1XFPA 2VDQB 2EVJA 2VXTH 5C6TL 4CW1B 2Z92B 4ZMLA 5E9DA 4QRFA 2VGLM 1R4XA 4RAVB 1EMTL 5T1MA 1Q9WA 5T3ZE 1DJYA 5LQBL 3KPRA 4YSPA 1QSVA 3NP3A 2E7BA 4NN5C 3P4NA 1J9RA 3UCRA 2Q8BL 4JFOA 1G87A 1HI6B 2HTLD 5DJ6B 1UXWA 5CN2A 5K59F 2O93L 4C47A 1CFSB 4FNLL 5EFIB 5BVPL 4JM2D 1GH7A 4Q6KA 5SWSD 5A2BA 1PKQA 3VWJA 4AKQA 1RZKC 1V27A 25C8L 1MKFA 2BVTA 4H0IA 4QXGL 3RWJA 2YUWA 4EI5C 1VPOH 1Q0YL 3MJ7B 3QCUL 4AH2A 3GSXB 4S0SD 4JE4B 2AW2A 4NKQB 2IQ9L 3UMNA 5AOJA 5DJAA 3GM0A 3DMMB 5DDHA 2TSAA 3OZ9L 2K8QA 5AAPA 4EPSA 3I9GH 3CBJB 1YQVL 4J2QA 3TS8A 1WBYB 1R5WB 4NRYA 4ZS7L 4XVUC 2HFFB 4QOKB 5L8LB 2WNKA 5HI5C 4HXBH 4UTBH 1G9MH 4GG6A 2VH5L 5DRNA 2KH2B 4GXVL 5CEZH 1FNSL 1LWHA 2JK5A 5L2JA 3QB7C 3ZTJG 5HYJB 1ETB1 4AMKL 5JHLH 2QADD 3HLAA 5I0DA 3L2NA 1XGRA 4WFGE 3EGXA 1M1XA 4CU7A 1ONQA 3LKSB 1FF5A 2IH8A 2P5EE 3TASA 1TTAA 4JDEA 4CKVX 4UYQA 5HHME 1T1ZB 1WIOA 4TNEA 1OWRM 4TF4A 3DOSA 3IDJA 4UU9A 4NZRL 1IM9A 1KBBA 2ITEA 4D9QD 1D7BA 2FR4A 4FI6A 1XVSA 3E6HA 4QHPA 4LNRB 5I1KH 5AZEH 3S37H 3EJYD 4P05A 1KCSL 2DTSA 3OM3B 3PP4H 1HS6A 1HCYA 4W9FC 5CLTA 2J2ZA 2J8OA 4MA7L 4K3GA 2E7DA 2BXZA 4JFHE 3UZQB 4B53A 3LEYL 3ESUF 3LDBC 4P2OD 2PCPB 3VTAA 1WC7B 1J5OL 1AANA 4GT0A 3O6MH 1WFOA 2R4RH 2NXZB 5I1JH 4UT7H 3OGOE 2G2RB 1VFMA 2L7EA 3FFCA 3LS5L 5DHEA 1CGVA 1RZ7H 1A4KA 3WNOA 4PJDF 1KG0B 3MLXH 4WY7H 1UCTA 1UWGH 3V9FA 3MU3A 1IARB 2VJ0A 3ATDA 3EOTL 1UCBL 3SDXF 5CP7B 1B3IA 2R9HC 2P45B 4LCWE 3T2LA 3U36A 1JV2B 3Q1EA 4WHTA 1CFTA 1OY3B 4HEPG 2VQTA 2NUTB 4DT2A 2B5IB 4BHUA 3PUUA 4GEIA 3BGMA 12E8H 4WUUD 1RHFA 2CUHA 2Q9OA 1SZNA 3KPLA 1JNNL 2WM0A 2DM3A 4U1KA 2I7SA 2ILLA 4Y16D 4Y9CA 5FW8A 4ZXBB 2KLRA 4P2YA 3RVUD 1A1NA 3PWNB 4NO5B 4GAAA 4LCCB 3KH4A 1YN7B 1YECH 1TQBB 5TF1H 3VD3A 4QRPA 3PFUA 5E2VH 2CDEA 3A3YB 3EOBB 1HXMB 1KJMB 1UZGA 1CD1A 4G43B 2DLIA 2QQNL 3GBMH 3VI3B 3JWNE 1KLUB 3R4DA 4MZ3A 3U9PL 5IB3B 3TA3A 2Z0UA 2OZNA 3M1CA 5CCKH 3CLEL 5EU5A 1VZGA 1JXFA 1SJVA 5C0DA 4LVEA 5C0RL 2V37A 1NCBL 2CRMA 4Y19D 2IANB 1BX2B 3GRWH 3APDA 1BPLB 1I7UA 2K8MA 2QR0B 3KPPA 3SSGA 2A1WH 3TBBA 4Y4KD 3SDXE 3VFTA 3L3HA 2BSTB 4N8CH 5DJYA 4N9GA 4N86A 4KI1A 3G04A 4WK0B 5BV7H 3BT0A 1HL5A 1NCWH 4FQXB 4JL2A 1INEH 2IH1A 3H9SA 4NQEA 4HKXA 4NFCA 4L1BA 2VZVA 1T3FA 3OB0K 2EH8H 3TBSB 3UFIA 2E8ZA 1R3JB 5JQ6L 1F1DA 1BD2D 4JY4A 5JYMA 4OW6A 2R0KL 1HH6A 4ZQKB 5A2FA 3DX4A 3V5HA 4BQ9A 3FB8B 3ZTEA 5FPIA 4AW7A 1QFUH 3EJTA 1AZNA 1HEZB 1LQSR 4L29B 4DVBB 5AB2A 5J3HD 2QZQA 1LWJA 2H6PA 4GSRA 4RA3A 2FX7H 3VGBA 2NY1B 5ACMA 1UACH 4HGMA 4JKWA 4P3CH 4Z7OE 5ANME 1MIEL 5AALA 3TFBA 3PDOB 2AK1H 3DA0A 3UO8B 1OCWH 5HHQB 1O9ZA 4WWPA 1E4XH 3FO0H 4PBWD 4W6WB 2AXGA 1AR1C 2A6IA 2WTOA 2N7AA 2VL4A 5EZOH 4EI5A 1LE5A 3HMXH 1SRDA 3N44B 2UWEB 1IBGH 1QA9B 1UATA 3RKDC 1JF6A 3LZFL 1T2QH 3VUAA 1ZXQA 1RUQH 1FORL 1LK3L 3QZNA 2OMTB 3FAWA 1P84K 4BFJA 4M62L 1I1CA 4JPVL 1FRGH 3S35X 1EDHA 3BE1L 3QA3A 5CMAB 3U7AA 4DP4X 3QO1A 1SVCP 4MQXC 3HS9A 4OI9A 1DDHB 1CLOL 5HYSA 1KIPB 4A7SA 1YDPA 1ORSB 3VXOB 4Z8FL 1HQ4A 2Z9TA 3UTTD 2FYVA 3LKOA 5EBWA 5C08B 5HD8C 1OAZL 1UQSA 1KLFA 2CUMA 3A5VA 3QRGH 2DTML 3ZKSD 1DTUA 4S1RH 4AL8L 4NQVB 4GW1A 4MJJA 2Z35A 3MGAA 1BQSA 3CFTA 1MWAA 1KWGA 2H47C 3ISWA 2R2HB 1DBJL 2DQEL 4J3OF 5F7WC 4ZNCD 2BWQA 4JKPL 4NNPL 4ALAL 2XJLA 1A6TB 4G1EA 4HHGA 2CO4A 4HAGA 3U0WL 2DQFB 4JHWH 1QKZH 5ERWB 3PE9A 1LEKA 5SX4I 5KW9L 3K6SA 4GO6B 4R96A 2EYSB 3V9EA 4Q9QL 2Y1VA 4KVPA 3W2DH 1CLZL 1N0XH 2CHWA 4MVBC 4B9YA 1XGPB 5HPMA 4Z7UF 3DBSA 5C0GA 1U8MA 1F97A 3GSXA 3QUZB 5MHSD 2X6AA 1NIDA 3OHXC 1AJ7L 3D39B 4I77H 3ROOB 2J57A 2ZWKA 4MA1B 4NNYA 3U82B 3DSNA 4OJAA 3T1FB 5AYUH 2WV3A 4X6FB 1Y0LA 3FT1A 5F44A 4FTVB 4E42A 1XHHA 1ZLUH 1URIA 3TZVB 3T6VA 1YNTF 1SDDA 1JUFA 1SY6L 2B39A 5DHXB 3IMWA 1WBYA 3EG9B 1J0HA 2DB8A 3ULAB 3TEZA 1OP3K 4ICXA 1PS3A 4Q2ZB 1IBHA 2GFBA 5CXPA 4CSPA 2CRZA 2VDRL 4FRWA 3MNVB 3MHZA 2D7NA 4JRYB 4MCZA 4OI8A 2VZTA 2CIKA 1NOLA 4LP4A 3SIKA 4BCYA 4KO7A 3UO1H 5KVGE 1XIWC 5DJCA 1HKLL 3ULUE 1H8NA 2PXYC 1A6PA 2XYBA 4IRSC 6CGTA 1TITA 1KN4H 4N8PA 4QXTB 5E03A 5DUMH 5EUOF 2KZKA 1CE1H 1COBA 1CDJA 1CF8L 2VCOA 2BNUA 4Q52A 1OAYH 2JMRA 1A6UH 3DO4A 2NNCA 3CUPB 2BSCA 3QRFM 3TO4C 1TZGL 4IIQA 3VFWA 3QUMH 4DCQA 2J88L 1DBMH 3QXWA 1JZJA 2W60A 5D5MA 3VXOA 4ORGA 4XN7A 3JWDH 2H9GB 1QWHA 3VQ2C 1U4EA 1SEBA 2YPLE 5JXEA 3LRLA 1J8HD 2FAUA 3OV6A 3PL6B 4L3EE 1ERNA 4N2MA 2DQDH 1MWAB 2EO1A 3MXWL 4FA7B 4UQEA 1ECZA 3V7AE 4WFFE 2Q2LA 3LX9A 2AXJA 2K6ZA 3CPUA 2AJXH 3MCLH 3L2LA 3ILQD 3I6SA 4LLMA 1DVQA 4OF7A 3BAJA 1RIVL 5DD0L 2ADIB 2IC2A 2QDVA 5AAMC 3WS6C 1IC7L 1VFAA 5GGVY 3ARGD 1AGCA 2F53D 4FTVE 3EKCA 1HHGA 4PWFA 3L08A 2GIXA 3X14A 2Z8WC 1LEGA 5JHAA 3VYNA 1MFEH 4UIMB 3BCFA 1KIUB 2DQMA 3H6JA 2HFEA 3IPEA 4ZUUB 4LLDB 5DEGA 3TWCH 2WB1A 2QPDB 3FFCD 3UTPD 4A7GA 4Y2NA 1NCGA 1ZE3C 4U1GC 3AB0B 2BSBA 4AQAB 2VN5A 5DI8B 3TA3C 1CZ8H 2HTLC 1JGDA 4H2AA 3TEYA 1O0VA 4JR9H 4J4PC 2VDKH 2YGOA 2J12B 2KYIA 2HPOA 1EUTA 5EEWA 4PRHD 4BQBA 4YDKL 5J13B 3O4LA 4JANA 4GG6E 2CK0L 2VXUL 4PGZA 3KS0J 1AXIB 3QGVA 4JG5A 3L3IB 3O2WH 2HX8A 5HYFA 1SJEA 1S8DA 3L5IA 1XF3B 2OFQA 5GS0L 3MV8A 5E1GA 5GJTH 3PWPE 2FQEA 5B1JA 1P4IL 1A9BB 1CJYA 4MHHG 4AJ0A 1JPGA 2ZWYA 4ZMWA 1RZQA 5D7JD 3X1BA 5ENWB 4KUZL 1OXYA 2UUDH 3I02B 5E5UB 2D3JA 1DJSA 3CFJB 1D9KD 2E74C 3ORJA 4EQ2A 3FHQA 3QULA 2FD6L 3QG6B 2FBOJ 2Y6SD 4G8GE 1GCYA 3GM8A 2IADA 4N9OB 2ATKA 4B97A 3IRPX 5J57B 5JIPA 5F7FA 4MXWL 3UZEC 1YPZA 2J5LC 1UM4L 2DLFL 1LO4L 1TVHB 2DWEB 3CSTA 4JQIA 4GINA 4OM0L 3T9WA 1TYRA 3UTZA 5TE7H 1DJIA 2GBUA 2ZXWB 4LOFA 5AW6B 5LXVA 3R4RA 3TN0C 4Z76A 1CK0L 3EF7A 1KJ2L 4JFUA 4G42A 3VXPA 4DHLA 4FHBD 4RNRA 4AK1A 3IVKA 4Z7OF 4AM0A 1BW8A 4RSVA 3L6FB 2E4TA 2Z1KA 2YD4A 1WHOA 2K1MA 3EYFA 5D96B 3S5LG 4Y5XB 3WI9A 4PREA 2R69H 1G4RA 1QPPA 2ZX8A 3V0JA 4I0CC 4DFHA 4U1JA 4N20A 3RIAK 3FXIC 4JVPA 1W16A 1YN6A 3AB0C 1AZZC 1DUYB 2DL9A 2PYEE 4JPWH 5K9QG 4F2EA 2OSLB 4GXFA 5B39B 3BZEA 3ZQXA 2FBJL 1EGJH 3EJPA 5DJ8A 4YHPB 2HVKB 3MZTA 2Z8RA 1SM3L 2OCCB 1EFQA 2B59B 4IKIA 2NY4C 5CKGA 1N2RA 5LBSH 3L3OB 2ZPKH 3WHE0 5HGBB 4ZMTA 2G0KA 4XZUB 4DK6A 2W9LA 2EYRA 2QLVB 4UQ2A 3WEBA 4KMLB 4N0FA 4X7EC 2P43B 2VDQL 4IBTA 4NWTH 5I1AB 2QQLH 3CQPA 2HKHH 2AMGA 1ZTXH 4RFNB 4DAGL 2APTA 3G6JA 5B22A 4O9HH 4NQSA 1OCCB 4F7PB 3FH5A 4XMLH 1B0WA 1TSHA 3GHEL 5BQDA 3CFQA 2N7BA 2VZ3A 1MHCA 3HG3A 3QDGE 4AX3A 5DQJB 1TYEB 1IO4C 2GTWB 2HKHL 4YHIA 3OC8A 4LFHG 5BO0D 3VACA 4JRXD 4EAEA 2IH9A 2R29A 1C16B 1OGAE 1UWXK 1WFNA 3P4MA 3TN0B 4L1HA 4KUCF 5F7BA 3RWDA 1I7ZA 2ZPKL 4O51B 5AOLA 3VWJC 1UUNA 4NUGL 4DESA 1R24B 2TSBA 3AGVA 4WHYH 3AQZA 1UVQA 5ERWA 4ZMPA 3HN5A 5B4MC 4CVXA 1EGJL 3C60A 1IGTA 3VFUB 5L88L 1BYPA 1IC4L 1QRNB 2UZIL 3FTVA 2FT6A 3JWNH 4MD0A 4OB5H 4EQ3A 4R7DB 3AITA 2A9AA 3OQRA 3JVGA 4NZFA 4PJ9B 2ZXAA 2DWTA 3LKRB 4KFZC 5HXMA 5KSBA 5CJOH 4F7CA 1IGML 4NZ8A 2BSEA 4AEHL 4B9PA 4RNRB 2VW6A 1EV2E 2R69L 3C08H 1H19A 2D4DA 5JHDE 3VQ1C 2DRUA 2GUYA 1ZHLA 3DDFA 5HJ3B 2R69A 3L7FA 2I27N 3GSQA 2N0KA 5EULV 2VIRA 5CD5D 1K4DA 2WXQA 5C07B 3MV7E 5IB4A 2KBGA 1CK0H 4QXVA 4U3SB 5ICYA 3FO1A 1OE2A 3VWJD 4LCUB 1XR9A 4ZOEA 2WOBA 2XZQL 1KCKA 2OR7A 2ZCHH 1ZJBA 5CU9A 3U46A 3J2PA 1KIRA 3DJSA 2MNWA 4Y1AE 2BHFA 4TKWA 4HJ1A 3L3JB 2FD6H 2CMRH 2IFGA 2FO4A 3QIUA 4OCSL 3TFKC 4OH2A 3D2UB 2I24N 1NKRA 3WBDA 1JPTL 4W9JC 1NDMB 2XN0A 3LMJL 2NY6D 4J3BA 2J1YA 1QOKA 2OW6A 1YNLH 1KCLA 3NTCH 4Z7VE 4LOVA 3RVWC 1KENH 3ARUA 2DPKA 3WEAA 2I9TA 4LK4A 2HH0H 4QT5B 4BV1A 5CLZA 3QUZD 4Z78B 4P46D 4X0KA 1QEWA 3OJMB 5T3XD 1KLGA 3S7GA 2H7WA 5ESAA 5ALBH 3ZPDA 3U2SB 3QS3A 5SWQB 4B95C 1BVKA 1UOWA 3CCHA 4LHUB 3FB6B 4UAHA 1LDSA 3KYNB 4M48L 4NIKB 4EDWH 6FABH 3S3DB 2ZOLB 1RZIB 5TQ2L 1AXTH 4OCMC 2XIBA 5DHVB 5IFHL 4XGZB 3H3PH 1ZVYA 5I5JA 3HN8A 4PRID 4UB0L 1A7OL 4WI3A 1KFAL 1SEQH 2VT0A 5TDOB 1Z5LA 1RAMA 1NINA 3KBFA 5KBMA 5TH2A 1ZHKB 5I15L 3RWJB 5EF2A 1I8IB 5DD1L 3RE0A 1GZQA 3O11B 3GXTA 5D6DC 2EAEA 1A3QA 1FQ9C 1Z0NA 1RIVH 1Z66A 3UAJC 1SLUA 5JW5A 3C09B 1TF4A 2JF1A 3HI6L 2P4AB 4UM9A 5AAMA 3WS6A 2DQDL 4UMSA 4ZXBC 4NPJA 3CXFA 1KPVB 5JQHC 3ARGA 5AUMA 1DANT 3BZ4A 3BUYA 3SE9H 3EH4B 4XPFH 4ZS6D 4ATWA 1HDMB 5AD0B 2B16A 3QUHA 4PJFF 1W6WA 2E7CA 1JRHH 3CZEA 4Y16B 5C7XL 4AJYV 2XKNB 2DQHL 1V3LA 5DVLA 3NCJH 2G3NA 4APQB 4NX0A 3ZYOA 1UA6L 4L4VD 1DQVA 5IEHA 2UV3A 4JGMA 1CF8H 2XC8A 5DUML 1KN4L 1X3DA 4ZSOB 2O5ZH 2GSMB 1HU8A 4N0YL 5CUSL 4Z9KB 3BPLB 1BQKA 5I24A 3C75A 4NAJA 4U7SA 5F88B 2FHCA 3TA3D 3ZJAA 4PEEA 4XO3A 4DTGH 5D1ZD 5INCA 3D0AA 3FFDB 3U0PA 5D5ME 1PG7L 3W9DB 1MELA 2EP6A 1HH9B 1XBDA 3JV6B 3V0IA 3AS1A 1PZ3A 4I1PA 4GKOA 1ILSA 3Q6GL 2Z7WA 4IRZH 1MW2A 5AZUA 4WNQA 2JQAA 3MACH 5FA3A 4YR6B 2YARA 3K1KC 4NRXA 3T4YB 4CDHA 3WMSA 2ORBL 1VAHA 1LNUB 2P7TB 2W81C 4FXGB 3S3PA 4P59L 1TJIH 5KG9B 1U36A 2E9GA 1PZUB 4HLZG 2Q3ZA 2VRKA 4M7JL 4TNVF 3GXUB 2B15A 1QZNA 2B9AA 1GGBL 3B5GA 3TBVB 4NI6A 3RFRA 1XGQB 1U2CA 2WMPA 3QXAB 4LVNC 5DR5L 1V7ML 4QHNA 1A3RH 3ZSTA 3T4AA 2N01B 3FAXA 5C0GB 2JXMB 4LE8A 3P4OA 2K9UA 5KW9H 1QKZL 3L9RA 4H1LH 3KDMA 1KPRB 5E4OA 4MDIA 5KS9E 5I2IA 1T4KA 1EJ6A 4TQ8A 1Y6NR 4UQ3A 2W0FB 3U0WH 3QORA 1AH1A 2XWTA 1X5KA 2Y5EA 2ATPA 1EO7A 3ARFC 3GDCA 5ADOH 2DQEH 4FYQA 1EZVY 4JO5A 1XMEB 2EJ1A 1JP5A 4MAYA 5EC1B 3SY0B 3DK2A 3SOBH 3CMGA 4EI6B 1E0OB 2VM4A 3AM8C 3CQFA 2Z93B 3WDIA 4JFVA 4Z0BH 4FD0A 4IGBC 5TPWH 1OAXH 1AYRA 2X05A 3LQZA 3SQBA 4QRRA 1L5GA 3HNVL 3QVAA 1JPFB 5IJKA 2VLKD 1BQ5A 2MRYA 3N1FC 1KNOB 4Z8FH 2NYKA 4JDZA 5CJXA 3EJZD 2Y2YA 4OCRL 3IETA 4LLQA 3KHOA 4E36A 2CRIA 3BD5A 3TIEB 1ACYL 2XWCA 1FV1B 5F7KC 3QPQD 1AI1H 3GMQB 3WTUA 3O9WA 4NERA 3FKUS 5FKPB 5I8EB 1GXEA 4JPIA 4OAWB 4M03A 4X7SH 4F5CE 5LCVA 5SWZE 3GXDA 4YLQT 1CYXA 2YFNA 2FL5A 4BFKA 5CGTA 1H6EA 5DT1L 5EZOL 1TEGA 4KO6A 5BJTB 3MNZA 5CEXA 3UDWC 2WIMA 4ZW7A 4NS0A 1HH9A 1K5NB 4GKZA 4PAZA 4E9VA 1OCWL 1B90A 2DQCL 3KM1A 5IJKC 1MIEH 4AW4A 3KJ4C 1KT2A 2IGLA 2YGPA 4RGND 3TV8A 3QNYA 3V0AC 3VI4A 2DS4A 3ULVC 5JMOC 4PRAB 4X6DF 5L4IA 3RLSA 2FYYB 5HP5A 2NNXA 2VXQH 2CGRH 4GAJL 2GTQA 1I9EA 1UA7A 4TNWF 2NQDA 4M1CD 3ZL2A 5KVDL 5EOQH 1BGXH 15C8H 1OF2B 1WISA 4Y5VB 1F90L 1B4JH 3GIZH 4YGVB 3RBSA 3MLSH 4PJGB 4MGXA 1JF5A 3TXAA 1TQUA 3T09A 4Y89A 3O0RL 2XVBA 3MTRA 2GITA 3LHPH 4HWBH 5DEGB 5F9WB 4A2LA 1U21A 3SYOA 2EZ0C 3DI3B 3F00A 3K6DA 4BK8A 5BV7L 3UIYA 1ZTMA 2OV0A 4YHML 3FL7A 4S2SB 4N8CL 1VFBA 3CE1A 3MLTB 3GD1C 4P4KD 5IMLB 43C9A 1MIML 1YEGH 2A1WL 4P9HC 2D7OA 1I9RH 1E5BA 2VSMB 4E41A 5C0RH 2BFGA 3RB5A 1R3KB 3OAZH 1MCLA 3GJEB 3W39A 4NHUA 3VXMD 1E8XA 1HI6A 1WAAE 1JDCA 4TVUA 1BFTA 1EEQA 3DJRA 4KGJA 4JREC 4OV5B 3BXNB 3MA9L 1GAFL 5HD8D 1OT1A 2ZKHH 1QSFD 1MF2L 5TE4H 4BE5A 2ICEB 4KMTH 4NKDB 5IROD 1T83A 4X7CC 5C0NC 3MUGB 5E2WL 1ODUA 3WIHA 1K4CB 4B96A 4GG8B 5TF1L 5I1LA 5F89B 2X7LA 3LD8B 3VGEA 5IVXA 5D7LA 5GRVK 4HWEH 2GJJA 2E76C 3PREA 3V8OA 1MRCL 1X6NA 7CGTA 2G3XA 5BJTA 4YEEA 2DYPD 4J2XA 3NRFA 5HVHB 3LRMA 5E4EC 4QRAA 2XN1A 5DURD 2D3VA 2J7LA 4LSPH 2G3MA 2OYPA 5KBLA 4KHTL 5ACZA 2FEEI 1U8OA 2HRPH 2GIMA 5D7IA 1BJMA 1CUOA 1MJJA 4OZ4A 3VU2A 3DRQA 3CQQA 3SDXB 3CZGA 1WWWX 1QSZA 1RZ7L 1DSFH 2BRQA 1UH2A 2WXOA 5BXFA 1A4KB 1JUFB 2Y36L 1ZA3B 4PG2A 4KDTC 3B3IB 3F7KA 1J5OH 4OR1A 5AB1A 5SX5K 3ZDWA 2NY5L 2FO1A 4Y5VA 4OKVA 4KZ0A 4A7GF 1R17A 2FIKA 4N25A 1MHHB 5A2JH 1IM9B 4Y7OC 2W38A 3PP4L 4ZSOE 5I9QB 1G9HA 4WV1B 4QCIA 1UZ8A 4YDLC 3S37L 5KVFH 4XPHH 4HVBA 3QZOA 4FP8L 1OW0A 2J6WA 1Q0EA 4CU6A 2D0FA 1N2RB 1RULH 4X5RA 5GHWH 5D1QC 1TKWA 2DKMA 4G71B 4PPTA 3VH8B 3M07A 4GQRA 3VRIA 5AKRA 4U1IB 3ZDYF 3NK4A 1ROWA 5KVEL 4JY6A 3HZYB 5BRZE 3FFOA 3MRMA 5JORB 3B83A 4GBXC 5TK2A 4WFHE 4LO9A 2EEBA 4I5BA 3QARA 5HHVH 4GIOA 3ECBB 4QJ5B 3EYQC 1Q8MA 5GZND 1V10A 4IU2B 4ZT1A 1TTFA 4OD2A 2DDQL 2EO7A 4GKSA 2CSPA 2GBAA 3QR2A 1BQLH 5I73B 3WXWL 2VH5H 4HIHA 4QHKJ 2WBJD 1XZ0B 4H8VA 3U4EA 3VM5A 3IPFA 4W4OC 4Y5YB 5FA3B 5EZJA 5CBAA 3G5YB 3QORC 2AKRB 4L4VA 1YQVH 5DJYB 2WAHA 3ERXA 1FZJA 5H4YA 3RVXC 3RJOA 5H4ZA 1S9KC 4BKSC 4OY9A 4KKAC 1MWAL 2FNBA 2TRYA 3H9SB 1QYGL 5IESL 2JQZA 3S8WA 2ADIA 4LLUB 2FJUB 3K2UH 2A0LD 2K3TA 4A39A 4Q9RL 1DJHA 3IFOB 4BFRA 4OIAA 5EN3A 2NXYB 2ESVA 4FQHB 5EOTA 3U2JA 4LCVA 4XE0A 2E59A 2V3EA 5DUBA 2VDPL 2X9XA 3HS8A 3QO0A 4LKCA 3IKCB 3OLEA 4PJ9A 1BQLL 2OYKA 1AE6L 4HF5H 2XU9A 3E2HC 5D7IB 3VRJA 1P7QA 1UYWH 4OF5A 3GGWA 3TT1H 1MXGA 2DM7A 5HHVL 3QJHA 1SHWA 2WLZA 4R4FH 5A16A 4YDJA 3ALWA 4X4XA 3GWJA 5EEZA 2MPAL 1H3PH 1T0MB 2NZ9C 4HFUL 1OSYA 3FZUC 3N44F 5EU3B 5FKAA 1F11B 2E9WA 3JV5A 3QQNA 4BUQA 3PLYA 1S7RB 4JHAH 4MMYA 1BVZA 1KBGL 1FYTD 1G0YR 1N59A 1FJ1B 1IV8A 1YZZA 3UTQB 3PHAA 1S7UA 3HCVA 1IJ9A 4XCYA 3FU7A 3N04A 1E50A 1Z3GH 1G1OA 1Q72L 1PX3A 5ANMA 4JM2A 1OAUH 4BELD 5I8OL 3BKMH 1W72B 3L1OH 4ZQKA 1WEJH 4RX4A 5DRZB 2GSIA 4OLXL 5A43C 5CJXC 1I8UA 5J1TC 4HOWA 3ROLB 4PUBL 1VEPA 1KIPA 4U1NA 4YGAB 4AE1A 5DD5L 4BZ1A 4HV8A 5TDNA 2YWZA 4HJJL 4LF3B 3WLBB 1LO0L 2JKXA 2EUXA 1PYWB 1XB6A 2OYMA 4PR5B 5IMKA 4YXKL 2JKNA 4NFBA 5CGYC 3RA7H 1NFKA 2Y22A 3RWDB 1QFOA 4HXAH 1BBDL 4HIHB 4JO4L 3NSDA 4UMGA 1T22A 2VISB 3FONB 4LSPL 5KSVB 3SGKA 3U1SH 5M94B 4JLRB 1BF2A 4ZDHB 2AEQL 2D7MA 2O5YL 3W56A 3L1FA 4F1SA 3BLPX 1I9IL 1U8PB 2ZE0A 1VACB 3GK8H 2FDBP 3CD4A 1EGJA 5JZ7D 3VE0B 4GXUN 5F6IB 5IB2B 2Z91A 4APQD 1E4JA 2PKDA 2D0GA 5C0IA 5KSAA 3CVIH 5J11B 1QRND 3LB6C 1JK8A 3AABA 1KTCA 3KPQB 3FK3A 1IZKA 1ASOA 4LIQE 1UT9A 2W07A 4YBQC 5KVGL 4TQIA 5IROA 2PF6A 3CV5A 1FL5B 3QO1B 1JNLL 2CLZA 2FZ3A 3MVSA 2YS4A 4TUOB 3DVNB 4EI5D 3AQDA 4U1KB 1GGUA 2NY2B 2PWEA 5C9JA 4I48A 1KXQE 2CD0A 1O6SB 2LV4A 3CVDA 3QEQE 4JFWA 3AJ7A 4HBCL 5ITFB 1TQSA 3NFSL 1SUJA 1I9RL 4NQVA 2A6JB 2HG5A 4WV1C 3VO0A 3K6OA 4JHVA 3IJSB 4E5XA 1E30A 1HKFA 5EBMB 3B7SA 5GJSH 3KPOA 4YHNB 1PZ2A 1X9LA 4E9TA 4PRPB 5DZNA 3BT2L 5KUMA 3JTTB 4Q97A 1DVUA 1S5IL 3O0RH 2P44B 3VQLA 1X7TA 1LEKB 4Y2DD 3B2VL 1PKOA 2XQYG 5E2TL 4JFEA 2EEFA 4GW5B 3MLSL 1WE5A 1G7MB 3MBEA 4R26H 3K80A 4XAWH 4WEUD 5CJQL 3VA2C 3UZVA 3QDGB 3WIFA 4BINA 4LBEA 3MLPA 4XNMA 1S7SA 4L2YA 1P4LA 3WN5C 5KVDH 1GGTA 5TK4A 1ADWA 1TVDA 4PV8A 3FT9A 3THMH 3DX3A 4RA0C 5ABAA 1AZCA 2BW5A 3Q2CA 3IMTA 3OR6B 3T71A 2QLYA 3K8KA 3WTVA 5HVFB 5E1AA 2P8LA 4YC2B 3DTDA 2AJSH 1L4IA 1TU2A 3HC0B 3ALPA 1I1AB 5F1IA 1UT1A 2VLJB 1ZE3H 5MEQB 2PN5A 2RIKA 4Y4HC 1D7CA 4Z3IA 4JY5L 1SMAA 2H1PL 2P1YA 3CDGA 1IKFH 1T5XA 3LKQB 3TV3L 5CLYA 2G5RA 1JXDA 3MO1A 5HJBA 4X9FA 4U0QB 1N70A 4Y19E 1UHVA 3TIDA 4JFDE 4G1MA 2H2SD 5KYWA 2XIIA 3D85D 4NDMB 1NCNA 3KBPA 1QBMH 1FFRA 1AI1L 1K6QL 1YA5A 2MCPH 3FCTB 4LCUA 1NSNL 4PBXA 3RWHA 2BS9A 2X53A 1BOGA 1YNTA 1XD0A 1D5MB 4MJIB 4HUMB 1BEYH 3U46B 3DIDA 1WD8A 2OXHB 3Q8EA 4OCRH 1TZHA 5LGHH 1E27A 1H6FA 2BSRA 4WI5A 1I4FA 1VFUA 2CA3A 3GJFH 2YWYA 2DJSA 2YXMA 1C5DA 4P2QA 5C6PB 4L18A 2V7HB 4NI3A 4WU7A 3O6FC 5D1XE 3NJVA 1RIHL 4CVWA 2HMIC 4N90E 5J6GA 3D39D 5I0VA 3R7RA 1XD1A 4TUKL 2CNZA 3FU9A 4BFOA 2GK2A 1HT6A 2ZP8A 5K1NA 1HILB 1OD7A 3CSYB 5GGQL 3KWWA 2HVJB 4WUKH 4I5BB 1KIQA 3MPCA 3BUPA 4BSWA 1FCGA 4L5FE 1PU0A 3L3DB 2EO9A 5F97E 3WEOA 1S6NA 5C0BD 3WUWG 1KLFB 2ZWLT 2ZUWA 4LLVB 3GBNH 1VHPA 1F1AA 4F7MB 3MCYA 3IF1B 4XCEA 3VFNB 2XT1B 4PLJD 3HBGA 2H3NA 4U1LA 3W9EB 1E90A 2FGWL 3H3KA 1KCRL 4N1CA 5JIQA 4X2UA 1NL0L 4XOBA 3RY5A 1AHWA 3OSVA 1TJIL 3MNDA 1L7TL 3RWGA 4R7VA 2EINB 5CEXB 4PJIB 1PJ9A 4HHAA 1VF5C 1FFOA 1SJHB 5D4IA 2YRZA 1AO7A 2EH7H 3MACL 3IAGC 3C6LA 1AIZA 3CNKA 1MH5A 3F7RA 1TNMA 2XSKA 3NCEB 4H44C 4WWNA 4OZIB 5EU7C 3AXIA 4A38A 3G6DH 2YXFA 1YAZA 2LU4A 3CFMA 3T08A 1SYVA 4KTDH 3BZDA 4Z7QF 2YJQA 3A6BL 1X9QA 4TVPH 3FOLB 4N0YH 5CUSH 1H3WM 1J8HB 2KUTA 1M1XB 1QNZH 1XGYL 4ABQA 2JB5L 4BH8B 2ESVE 2IVFC 4LMQI 1NDGB 1IAIM 4LQFH 2ZUUA 3RGHA 3NT0A 2DD8H 3N43F 4U1MB 4JFQA 4UINH 5HGAA 3V4VB 4JZJB 3AY2A 3NCJL 5HVWA 4U6VL 1INQA 1ZXKA 4G59C 3HHMA 2G75B 1YUKB 3F6IA 2WXJA 3KEDA 3D5OF 4LQ1A 1TJGH 3LVEA 4H26A 4YO0A 4ZXBA 3PJSA 4N8VA 1GZPB 3C5ZA 1ETJA 1PFCA 2VERN 3OKNA 4I0PA 4TOYH 1XB3A 4F8LA 4PTUB 4DO5A 2W95A 5JDSB 1BREA 2EYTA 4GAFB 2PPFA 4N87A 1V3JA 4QHMA 4Y1AD 3HZ3A 4Z7VF 2G4GA 4HHWA 2D03L 3HR5B 2IFFL 3H4HA 1FO0B 3Q2VA 4GO9A 4NHUB 3I85A 3HI6H 4JZOB 5E5LA 3O6KH 3RZWA 2YA0A 5DYOB 1MFNA 3MBWA 3FRUB 3OAWA 4PJXB 4YHLH 1UGKA 2F74A 1T1XB 2C4FU 4XNXL 1WSST 5B1CA 4ZX3A 1DVSA 3AVEA 1NUGA 4ZPVB 4DN3H 2UXVA 4ZPTA 1NCTA 5GXBB 3M45A 4DP8X 4UQ9A 3OF6A 4RAUA 5I15H 2IOOA 5IY5B 5D1QA 1EHKB 2E47A 5DS8A 1MI5D 1OWWA 1XSIA 2Q3XA 4FG0A 2PP9A 1SEQL 4MZ2A 3VU1A 2BIOA 2RB8A 3LXAA 5EFIA 1ETZA 5TQ2H 1MZZA 3RUGA 5T3XH 1AMXA 2OK0H 3LV3A 1K2DA 1ET5A 1QLRB 3B43A 2K45A 4TVPL 3BIKB 1WICA 1P5UB 3PWUA 4KTDL 5AAWA 3ESOA 4I0KA 1T89A 1HINH 4LGPB 4Z1PA 3DV6B 5E99L 1QX1A 4Y5VC 3MRRB 2X9YA 3SQOL 4C83B 2EKSA 4QXUH 5B7FA 2X42A 2HH0L 2F7OA 4MX7A 2AK4D 5DI8A 5KSUA 5E6RB 3X12A 1RK0B 3QIWD 5DJZB 3UJIL 1UXSB 2FJGA 1YEJL 1L7TH 1M7XA 4U4BA 3MJ9L 5EMYA 4CMHC 5DC2A 4BBWA 1N7MH 2DI7A 3IEAA 4JMXA 3ZSSA 4PIBA 4JG9A 4ZD3L 2X2YA 1KCRH 3B4NA 3P3RA 4ODTH 4B9JA 4ZMYA 4BRJA 1IC5L 1WLHA 2YD5A 1CDHA 3D3VD 3QIUB 3IU3B 1SFHA 4I9WE 1FAIH 5E1IA 1PY0A 4J3OG 3O41A 5DVKA 2OMTA 1BA9A 3PGCB 3WSQH 2F54E 3MUUA 2Y69B 4XNQA 5BMFL 2VR8A 2FLBT 4PGDB 2YAOA 1NMCB 5FKPA 3NAAH 5H8DA 3FC8A 4LRIC 3S88L 2IMNA 4XP1H 3T0EE 1MCWW 1TQCC 4GI6A 4KI5C 4ICWA 4Q6IA 4S1QL 4WUKL 5EC2B 3O2VH 3NFNB 1AGEA 4WTZG 4F7TA 4FI7A 3RTQB 1HNFA 1KTBA 3HC0A 4OD2B 4N3TA 5CJOL 4Y4FB 3WIHL 1A14H 1V8HA 4N2OA 5J9PA 2DYPB 1NKGA 1GY1A 1T7ZA 3Q8AA 4HS3B 5DHDA 4R97B 2VC2B 3AXLA 4D3CH 5IK3A 4HJGB 2P5EA 5I1HL 2NY2D 5EF0A 3TBYB 3RTQC 3SDYL 4POZC 4IGBD 3EYOA 3RPIA 4OD3L 3EYFB 3IE4A 4KRLB 5GGRY 1BEXA 3C5JA 1KG0A 1UZ6E 2Y1ZA 1ETZB 2AVGA 2MHAB 3T2QA 2R2EB 5F6HJ 3WNKA 1K6QH 5EEUA 1LP9B 4M6ML 1QBML 5D9SA 5GQBA 5L2KE 4NQCB 4KXZI 1TVBA 4KH2A 2Z4QB 1RUPL 4ENEC 5D2NE 1F4WL 5C2BL 5K93A 1DVFA 3SN6N 1BDYA 4YHYB 1NBYB 3FULA 4P5MA 2IWKA 3NA9L 2Q86B 1AHMA 3UTPE 4N5EC 3T4AC 3GBEA 3BPOC 2QVMA 1NIAA 3UTSA 3RWCB 2W5PA 4ANUA 4E9WA 4KTEL 5IOPA 1F4YL 1JXJA 1YC8A 1XBRA 5F9WC 4DAGH 2JWYA 1WT5A 2DJ4A 3EG9A 2XFXA 4MCMA 2AEIT 2YAPA 4NWTL 5T1DH 2FGZA 1CD1B 1J87A 1P0SE 4G43A 1T1ZA 1WD9A 3BEWB 3D05A 3EZJB 1T5WB 4OSUH 2VWEC 3ATFA 5E8OB 2P3YA 1AIFA 1T0PB 2I9LB 3G6JE 2XFGB 4WEMB 1A02N 3ILDA 5DRWA 1FPTL 1SM3H 3C6LC 4XBGB 4XCYB 1XL4A 4AJWA 2EYSA 4IBWA 1P7HL 3IDMA 5CWSB 4HYTB 4XCEB 4NZUH 1LMKA 3B2VH 3BAIA 3WUZA 3NIDE 3GPSA 3QZLA 2JCWA 4UIKL 2P42B 3BW9B 4UZGA 2W92A 1RZJC 3HJEA 4OIIL 1GC1H 1T0OA 1NMAL 1E4HA 4I4WB 4L37B 3RDTD 4EIBA 4I9WD 1ZWIA 3GO1H 3NFNA 3PWVB 2YD0A 4HW6A 1O9WA 5LCVL 1WIUA 1WLGA 4MD4B 1DJWA 4IBVA 4CMMB 1QSED 4JW3A 4Y4FA 3QQDB 2FLMA 1MY5A 2JKRM 1LM8V 4Y1AA 1UM4H 2DLFH 3MNVA 3Q43A 1JPEA 3DRQB 4MXWH 3TVMA 3OPZH 2MOVA 5D2NB 5HJGA 4NAQA 3QT2A 1FC1A 1CTNA 3CDZA 5EIVA 4DEUA 3QDGD 1J86A 2XA3A 1ZSDB 5IHUL 3FJTA 4AQ1A 4YOKA 3ARFB 5KYUA 4HMEA 3LNIA 2IGTA 4P9MH 4IRSD 4XZ4A 1VGEL 1DCEA 5IHZA 1BV8A 3VXME 1HQRA 4HK3N 4B5EA 1X4XA 3DTXA 3QSKB 1FL6B 1NBQA 3UL4A 1BYOA 2AK4B 5C0BA 3E7JA 2W60B 4NHCH 1N64H 1OIOA 5T3ZH 2CG9X 2F58L 4GSDL 4HLJA 3VM7A 4O02A 2CK0H 2O6FA 3QZMA 2FWLB 4KOCA 4XC3H 4G6MH 5G5DA 2R0LL 2A74C 2H2PC 4KO9A 4YPGA 4ZX6A 1W6LA 1DJZA 4A67A 1F6AA 1JN6B 1YEIH 5JW4Q 3P9LB 4GMTL 1ZLSH 3N6YA 2BOCB 2FH6A 5D6CA 1DZBA 2UWEF 2BMKB 4Q8BA 1FYTE 2R83A 4OLWH 4FZ8H 3DJTA 1NCUA 2FK9A 4OFYD 4TULH 1WTLA 4J3SA 2VXVH 4G5ZL 3TNNA 3E38A 1TTRA 2XG5B 3KGSA 5T5FA 4AG4H 4OLXH 2WLYA 4TVPD 4WFED 3SJVD 4K3DH 1CLCA 4KKCD 2JKTM 2XG4B 1OAUL 3EGDA 4EEEA 1U42A 2YOCA 1UB6B 3CPLB 5D55A 5I74C 2F54A 4GI9A 1BBJA 2ITCA 4LPYA 2P24A 4LSQL 1OQOA 1H3XA 4U7MA 3HS0B 5MHSE 1A2YB 2PXYB 4ZUWB 3W1ZA 4AIOA 1NEZG 1WBZA 4DZ8A 3DVIA 4RISH 5IVZB 2Z4TA 1JIBA 5JXEC 5HDOA 1P7KB 3LTVA 2VLKA 4HFUH 1M3IA 4J6RH 3WFEH 4P5TA 1MQKH 3SKMB 1IEAA 1XCXA 3BC9A 2WCSA 3PDOA 3PXHA 3QQ9C 5IT2L 3MOAH 5D1QE 3ZDXF 3MFGB 3DUSA 4Y1AB 5IWLA 1C08B 1VESA 4L9DA 2BOBA 3AWEA 3HB3D 4OT1H 1QFWM 2HJKA 6PAZA 3SCMD 2XXFA 3RGVD 2I69A 2IAMA 4HG4J 1YEDB 4G6FB 1DBML 5L2KA 2GEQA 1TQWA 3N9GH 2MQ3A 4JRFA 3ULVL 1MREH 1HSAB 2FIRT 1FO0H 1OSPL 4P3DB 1NGXA 3N91A 4Q9RH 1ORQB 4FQIL 5IG7B 1NFDB 5MI0C 2OTWA 2P80A 5HHOB 1YEFL 5EB9A 4TUJA 2UY7A 4M61B 4HBQA 4A37A 3JWOL 2IDSA 4LDEB 5DJ0B 5ABZA 2DYRB 3I6LD 1ODAA 1Q4NX 4XOEA 3M17B 4P07A 4XPBH 3VFOB 2DLTA 3WXWH 4V2CB 1AQDA 1BVNT 5DZJA 1JD7A 1I75A 4DQOH 2JCCB 1TZIA 4OGZA 1LD9B 4P5RA 3WLWC 2V5MA 3CSGA 4FHKA 2F8IA 3UP6A 4ANWA 5IBLC 1JWSB 2O1AA 3IU4H 2BP8B 1NCDL 1BG9A 3HMWL 4X6EA 3W9DA 2BSSA 4I88A 3VGAC 3WFHB 5C0DB 5E24E 3L13A 4P46C 3DVGB 2OQJB 2Q8AH 1N5YL 4AEIH 5JTWA 3V4PA 5FW7A 5A6MA 1WZAA 2F54B 1UEMA 3CDYA 4YSOA 3V8CA 4O2EA 3T0EA 4YHPA 1ZLDA 2OMNA 5D1XC 4JKKA 5HY9A 2C3VA 2K70A 3N85H 3HKZA 1NPUA 3QDMB 3LS4L 4QRBA 5GRWA 4RIRA 4Y1TA 4JKPH 2YEZA 5DZ9A 4YJZL 4NN7C 1YN7A 4NQEE 2QGBA 3TNMA 2R29L 5F71A 3UBXG 4LVOC 5H2BB 4N26A 3T2OA 2SODB 5EV7A 4OCNC 2CBTA 4S1RL 1DEDA 3ABZA 3V52H 4HC1H 5F9OH 2DTMH 3HZVB 4JFYB 3GJEA 3FTWA 1DSFL 2BCMA 2JJUA 3G5WA 5AW0B 1KIUA 2IO5A 4X4YB 5I6KA 3RNQA 1JNJA 4HGWB 3FQNB 2ZKMX 4A68A 2HRPL 1ZJAA 4KKPA 5I0YA 1YEDA 4TSCL 3GSUA 2B2XL 4IMKA 5IB1A 3AT8A 4YBQD 3LVTA 4R7LA 4JPVH 1MCRA 2OMWB 4G80A 5GISH 1YJDH 1C1EL 2ED6A 3PUCA 1XF2B 5IFAL 5T1JA 3MKGA 2Y72A 3I84A 5E6IB 2VITB 1MRCH 3LQZB 3GTVA 4G7YH 3SQBB 4F58H 4Q0XL 3U9WA 3VSUA 4F33B 2JKJA 5C08E 4KK9D 1HL4A 3O3DB 3HLKA 3HMXL 4F8TA 4D0DB 1NANI 3BKJH 3L4YA 1HWGB 2C9VA 4GOSA 1CDBA 5BQ7A 4R2GC 4WHDA 4XNDA 3LNHA 2GABA 5MERA 2DBJA 4GQPH 1MDAA 4LVHC 5TE6L 2ZSVA 4F91B 1FV1A 1JZ6A 4DGUA 5I82A 4K3EH 4K9EL 3O3UN 5K9JH 5T1MB 3ZYJA 2ZXCA 3I02A 4XMZA 4ZTEA 5I6LA 3TCTA 4PP2A 2GBTA 3WDHA 4D2NA 5GZOC 3MZGB 3R06A 4GRWB 5CF3A 3DUUB 5HGGS 2E86A 1UEYA 3ZKXC 2LLLA 3NPZB 3PQYA 2A4ZA 5HHNB 4AQEB 4ZMOA 5F3BB 3VVVA 2VDOB 3PCYA 4XXWA 1KLGB 1YEGL 2ZD0A 2JIXA 4Y0GA 1RERA 3FQRB 3SKNB 3BLKA 3HRZC 3H9HA 1F86A 4P8QA 2J72A 2WN3A 4WENB 3EJYC 3SPCA 4RZCA 3OMZA 1EQWA 2Y07L 2G0LA 1NCOA 2CO1A 2FNWA 4HJSA 3UAJA 3NZ8A 2Z1PA 2AXFA 1WUZA 2MTPA 5FYLH 2Y3NA 4PD4K 3TEXA 3MRKA 5D7IF 3FT2B 4XMVA 4E0RB 4Y4HD 15C8L 5KYUB 3EIFA 3ARQA 3ETBF 4KRPB 4GLRH 2KS0A 1OW0C 4Q74A 4L3EA 1M05B 1UD8A 1OK8A 1HQRB 2FWSA 1A1MB 4CADA 3O11A 3QFJD 2F53E 4FTVD 4DWHA 3MGTB 4Q14A 2WXMA 4KJQC 3O2DL 2ERJC 4F80A 4YSSA 4BHUI 1YMHB 3MJ6A 1CTMA 1Z9MA 2Y7SA 3IFLL 4AY0A 2CJTA 5IW1B 4XMWA 1FLRH 4A1RA 3O2DA 2VL5B 1EAJA 3K4DA 3UTTA 5EF1A 4TLSA 3MLVL 2KDYA 3C09C 3P77B 1XTLA 1II4E 3QJUB 5I1AA 3WKML 2WXIA 3UZEA 5EU3A 5FKAB 2OI9B 1PSKL 4JRXE 4PMEA 4DO4A 1VEOA 1RJYB 1N59B 1J0YA 1YY8A 1JNNH 1SOKA 2R23B 4F8QA 1ECYA 2J8HA 4X5QA 3VA6A 5L8JB 2DQFA 1GIGH 1QQDA 3MGOA 1ACZA 1Z1WA 2WWKT 4JDVA 1ADQA 1BZ7B 1CVSC 4FQ1H 2OMVB 3IGAB 3PHOB 5E23A 4APQA 3Q2WA 4LKCB 2YLKA 4NOBA 2FJFA 4JN1L 1U3HC 3VXPB 5KYXA 2W9DL 4V1DB 1NBCA 1DL7L 2NY0B 4UT7L 1TDQA 1WCBA 2IJ0C 4GBXD 4G11A 4K7PL 1JV5B 4JVWA 4RFEA 3RTQA 5AVVB 3U0PB 4ZZFA 2YIHA 2W80C 2AAAA 4EUPB 1NOAA 2R7EB 4XBEH 3U4BL 3DURB 1QTSA 1BIIA 2IAAC 4LHUG 5JPMC 1U8LA 2DQIH 1NKOA 3M1BA 4LARH 3N85L 3WHXA 1PL3A 2IWGA 1A6ZB 5K5YA 2H0FA 5LKNA 3NDYE 4AVKA 1THAA 4I3SH 4AEIL 1KGXA 4NZRH 1PNCA 5BCAA 3ATEA 1NBZA 1QSFA 5PCYA 2W9EL 1WP6A 4WEBH 2YUVA 1IMHC 4NP4H 1CGSH 2FATL 3U9UA 3INOA 5KN5A 1Z5YD 4UDTA 3VD0A 1NFDE 3RY4A 5HYIA 5LHDA 1JZ7A 4DQOL 2OMXB 1G9NL 1E2WA 1DANU 1KGIA 2A5UA 4IRZL 4AVIA 4ESKA 5A6LA 1WWAX 1OK0A 4OLVH 1M7IA 4XPBL 1G7HA 3SDDD 3VXNA 5CZVL 1WK0A 2ZAGA 2NOYA 3MRJA 3OKDB 3MV7A 5FUCE 3T4YA 3X1GA 3BDYL 2OJZH 4IOIB 3PNWA 2UZXA 2MQCA 3I9GL 4MQTB 3RVXD 4F7KA 4LU5L 4N22A 3WN5B 2PYED 2F8VA 2RJMA 1J9QA 5FFLA 2AXWA 3I9IA 3D30A 3SO3C 5EBWB 5C08A 2IQ9H 5K69A 4O4YH 1P2CA 4NXSA 3HBQA 3MRPA 3QCVL 2DQHH 1Q0YH 1MREL 1MVFA 4P2QE 3U2IA 3D2UD 4ZTOL 3JUZA 4U31A 25C8H 2VJ8A 1MAKA 4NP9A 2Q10A 1RP9A 2FJFB 3HI1A 4NNXA 4XPFL 4Y9EA 4S0HA 4X4ME 2WOYA 2PW1A 5B4MD 4JN2B 2YD2A 1OTUD 2FR4B 3HI5L