5LBVA

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
403
structure length
390
Chain Sequence
b'IRCIGVSNRDFVEGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGDLYYLTMNNKHWLVHKEWFHDIPLPWHAGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein E
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein
total genus 85
structure length 390
sequence length 403
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5lbvA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 5lbvA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 5lbvA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 5lbvA03
2HG0A 3N43F 1S6NA 3UZQB 3I50E 5B1CA 3N42F 5JHLA 2GG1A 2JV6A 5KVEE 5GZOA 5KVGE 3C5XA 5AAMC 4BZ1A 4ALAC 4UTBA 4UTCA 4BZ2A 5IREA 3J27A 5JHMA 1URZA 1OK8A 3J2PA 5KVDE 4AL8C 1UZGA 3UAJA 4UT9A 5LBSA 4FG0A 1SVBA 2P5PA 4UT6A 5H37A 2H0PA 4X42A 2JQMA 4L5FE 2R69A 2JSFA 5KVFE 1OKEA 3VTTA 1PJWA 3UZVA 1RERA 3G7TA 4GSXA 5AAWC 4AM0Q 5GZNA 1ZTXE 5IZ7A 3IRCA 3C6EA 5LCVA 2R29A 4FFYA 1TG8A 4GT0A 2I69A 3MUUA 4FFZA 3N44F 2ALAA 2V33A 3P54A 1Z3RA 3N40F 3UYPB 1Z66A 5LBVA 3N41F 3WE1A 3UZEC 3UC0A 4UTAA 1OANA
chains in the Genus database with same CATH superfamily
3D39E 1XSKA 4ZBJA 4S1DC 1BOGA 3NZHH 2MQ3A 3QH3A 3SKOA 3NJGA 4S0TD 1EEUA 3M1BA 3O8XC 3QC6X 1A9BA 3ZIMA 3CFEA 2XN9D 4JNXA 4AYSA 2X7LB 2EH7H 3WXVL 3NFNA 1DSWA 5TDNA 3KPRB 5IQMA 1MJUH 3DIFA 1T5XB 5KSAD 3TVMA 3NJMA 3K6SA 3LN5A 5AAWA 2PWGA 3TXAA 3CVIH 4IJ3C 1HC1A 5C3TA 4U2YA 3FUIA 3OKOB 1VB9A 1ITBB 2CKBA 5DC2A 4HG4J 4ERSL 4FXKB 5F3FA 1PSKL 3FTVA 4Q4IA 5CINH 2EDHA 4UM9A 2XWJB 3MNVA 4JY5H 4EI6B 4NT6B 5EZLB 3F12B 1U8IB 5CILL 2C5DC 2UUDH 4M3HA 4F91B 5F1IA 2OSWA 1QFWH 3GZOA 2AXWA 4JUTA 5FM4A 1H3UA 2A6IA 2NY1C 2VB5A 3ISYA 1O5DT 3BWSA 3KR3L 2E7MA 4JQVA 2CNZA 4MNQB 4NAMA 3KPOA 1V7NL 1OSEA 3S7GA 2EVGA 2R2EA 1JHLL 3G5WA 3WFEL 5DUJA 4YSSA 2DH3A 2IH1A 2IVFC 4Y9BA 3M46A 3BAYA 2D0HA 1QYGH 4PS8A 5BS0B 2AQQA 1KIQB 3QI9B 4NB7A 2N1KA 2D9QB 3ZKXB 1PQZA 5CZXC 4Q0XL 4HJ0C 5KVFE 1FCCA 1CFQA 5JIHA 1B90A 1G7LB 2WXQA 3MHZA 4FQXB 1E4KC 3SJVE 2N7AA 1N59A 5CGBA 2AVGA 3UO1L 2FUTA 1NWOA 2AJUH 4NIKB 2J57A 5EWIH 3VD3A 4BBWA 3VXRD 4DFIA 5GISH 2H4EA 4PJXB 4M8VA 5IVXF 3RX5A 3VFOB 4R2GC 4KHTL 2HRHA 3JBG7 3QJXA 3OAYK 5CCGE 4QOKB 3C60C 3VQ2C 1FQ9C 2BSTB 3ARUA 4LB8A 4NZ8A 1YLBB 3VX0A 5IHUL 5DJDA 1ET5A 4GMTH 4S1SL 4LSPH 1YSOA 1T20A 2CGRL 1BVLA 5IB5B 2J44A 4Q7DA 3OZKA 3HZYA 4E41A 3QDGD 1AKJB 2GI0A 3KPLB 4JM2F 4R7DB 1L0XA 5F1NA 4DK6A 4OZIB 1RV6X 3L3IA 3VNZA 4L9LA 4JZJC 3D3VE 3Q6GL 4RMWA 1WIOA 2PYEE 2ZSWA 1ZVYA 3IU4H 1UM4L 2KL6A 3RWJB 1AG6A 3QZLA 2J55A 1ZPUA 2IADB 5D1XD 4ELMB 1G7MB 3DIVA 4ZYKB 5FX3A 2LQRA 1PEWA 1S5HB 2CSPA 1IEAA 1BV8A 4FI6A 2JJTC 5IVXE 5IMMA 5AD0A 2BVQA 1RH8A 3QCTL 1IGYA 5JOEA 1DEEB 3D39A 5DJ0A 1ZA6B 4JPVH 4XCCH 1R3HB 1YYLL 5D1ZI 4L1SA 1RZQA 3CPLA 2KUTA 4DP6X 1KYOK 4KNQA 3ZXAC 4R8WL 1I8IA 3F7PC 1HHHB 5HHQB 4AQ8C 2IJ0C 1QG3A 1IJ9A 2PKDA 4DKEL 2AV7A 3FB5B 4MJ6B 2Y24A 1EGJL 4XPTH 1EEZA 1P4UA 3WN6A 2PUQT 3NJHA 4PJIB 3RVTC 4Q9QH 1CZ8L 2GTZB 1DSFH 2V7HB 5CGYD 3CZGA 1NMCC 3LVEA 4NQDD 1S3KH 2ZKYA 4K7PX 2BIMA 2DQGL 2R4RL 3CTTA 3DRTA 3U0PB 3DX1A 4QRSB 4Z7UB 2F7PA 3I9AA 3FT3B 2P5PA 4MWFA 4YAQB 3ZKMC 1BQUA 4J6RL 3AGVA 1F4WH 2XFGB 1NMAL 3FBQA 3I6KA 4CU8A 1WD9A 1UVQB 2YMXH 5F7DA 1HXKA 1DCLA 3O2VL 4YL9A 5ALCH 1T7XA 1DN0A 4TVPE 3FQRA 5HI4C 3RFZB 4JVWA 5BQ7A 3MRLB 3ARGC 3W11C 4E0RA 2JI3A 3EYVA 1AIFB 1CICB 3F58H 3UIYA 4J4PC 4CGUB 2D7MA 4P23A 3P4NA 5GXBB 1KLGB 3FOLA 1M2VB 2UZYA 3BZFB 5HHXH 4MYWB 3WE6A 1R17A 3UG4A 5LNDA 5MEPA 1M3JA 4ZFQA 2DIJA 4HIQA 1QFWM 1JDCA 2C9VA 4PRNB 4BH7A 1H9DA 1WTGT 1ZEAH 2FLRT 1MJJA 2CKNA 4RGOH 4Y16B 3SJVA 5CNHA 1XIWD 5JOPE 4Z95L 4WDIB 1O9ZA 2VDNH 3TJEH 2AF2A 4XZ4A 5FDWB 4LSUL 4PGEB 3KH4A 4WENB 4PJGB 1OHZA 3BVNA 1EMTH 1HXYB 3F05A 4L1DA 4YO0A 2Z34A 4ATTA 1T3FA 5EF2A 4NN6B 1UFGA 1INEL 3C9NB 4Y5XB 4DKAA 3QXDB 5DS8A 1AQKL 3C6LA 4S10A 2ZOWA 3H54A 3HZVA 3WKPA 3O9WB 4KJPD 1RUPH 1XEDA 1RUQH 3QEHB 5AKTA 1NH6A 4ZW6A 2X70B 4HUWB 3BEVB 5HHOE 3ZZQA 1JYVA 3AS0A 2VR9A 4E42B 5ITFA 5C0AD 1GTFA 4KZDH 3RWHA 5C9JA 1HFUA 2WXPA 2X3CA 4HKXB 4X9GA 3MV7D 3D3VA 3GSVA 4JBSA 2MTPA 3L3GA 3FB7A 4HMCA 2PYEA 3MRQA 1X4XA 4TSCL 4OVVA 3TPUA 2Z6FA 3DVNA 4EOWL 4F8PA 5C0JB 2O6FA 1TNNA 3L7FB 3GZQA 1F6AB 4IGBB 5IIEA 1JWSB 3WEMA 5LDSA 1KACB 3WY3A 4PMFA 2EXYD 3IU3B 5B8CB 2V0AA 2YXFA 5FKPB 4E5XA 1KYDA 4PTTA 3SCMB 2DQJH 3CFCH 4FF9A 3O6LL 3UBHA 5C0GB 5IVXA 5KVDH 4WO4A 5KWYC 1TPXB 5IR1A 4IBUA 2BP0A 3VD0A 4KPHL 1UOLA 2JJUA 4HWBL 4IK6A 4XO5A 2HLAA 1J9TA 5AUMA 1BAGA 4HP5A 1EWHA 3FO2B 5IG7A 3KS0J 5ICXB 3GS0A 3NCWA 2HG5B 2BCKA 4QHMA 4Y19E 3QUYD 2UY6A 4WEUD 4JB9L 4JM2A 2YGVA 4YGVA 4FQJH 2WYHA 2D4FA 4HAFA 4LSDA 4MAUL 4WGVB 5LCVH 1ZT4B 1LXMA 2KQMA 3B2UC 3DUUA 4G8GB 2FYYB 3VU2A 3GUTA 3MGAA 2E4TA 4MQ7A 1J05B 4FZ8H 1T6BX 1DEDA 3GIVB 1P0SE 1SDDB 4Z0BH 5FAAA 3VD9A 3QAQA 5EUKA 4G42A 1OP5H 4X99A 3II2A 2UY7A 1FF5A 5JW5A 5IEKB 5D7HA 2XWCA 3RB5A 3EJZD 1V10A 2VXUH 2GJ6D 1JYXA 3KPMA 3ESOA 4QXTB 5AG8A 3MJ9A 3BD5A 1MAJA 3DI3B 1SJEA 4Y4FA 2Y69B 3WFDH 4Z3IA 1KYAA 5AOLA 1P7KB 4W81A 2HKHH 1F5WA 3QEQB 2WB7A 2VO5A 4URKA 2OR7A 4YSRA 5JZ7D 4HLJA 1WQVT 2VW7A 2B08A 5AOZA 3BGFC 5AVRB 4LCIL 4JHWL 2DDQH 1V7ML 4EDXB 2J8UE 3PNWA 4QAWA 1OE2A 5C09D 1L9MA 3C09B 4NKDA 3DVIA 1UG9A 4HSCX 4NKOB 2H1XA 5FA3B 3VGHA 4DCQA 1PFOA 3L3DA 4U6HB 1M4KA 3AQZA 3F7YA 3QFDB 3IGAB 1Q38A 2EEAA 1T89A 3RB7A 1KPRB 2YGOA 4C56E 4Z76A 2LABA 3ABLB 3ZE1B 5JXED 1IAKB 2UV3A 4LCCC 3OXSB 4XNDA 5C8JB 1BZ9A 3DRQA 2EDJA 1KT2A 4NO0A 4X5WB 3REWA 4Q14A 5GRJH 3WEOA 3IDYB 5SWZA 1JPGA 1BIIB 1U3HD 1M6OB 5HGGS 4NQUA 5K1JA 3SE3A 2DQUL 1E67A 2WBJB 1JGUH 4HISA 4YK4B 3PGFH 1I9EA 4JPIB 4NNXB 4KQ3L 1MRFL 4KNTA 1I7ZA 3X17A 5HHOA 4PW9A 4G80B 5GGVY 4DEWA 4HHAA 5EBMB 4WQOA 1YEDA 1BM3L 1I3RB 1X4ZA 1XAUA 2TSAA 3MA7B 2D31B 5DHVH 2OMTB 1SQMA 1ES0A 4KNSA 4QY8B 5L2JA 1YMMB 3GT6A 3FMGL 1IBZA 1S8DA 4ZUWA 4O51B 2HT3C 2NUTB 4UT6A 1OB0A 1PZ2A 4Q8BA 5HYSA 5JIQA 1K8DA 3VXSD 3BSHA 2XYCA 3VXTA 4JHZA 5LNGA 3MODL 4RGNC 3A6OA 4GO8A 1R5WB 3K2UH 1TVBA 1K5NA 2BSDA 3NFPA 4PRHE 1G0XA 2PTTA 1NCNA 2X4RB 1THAA 2W65B 4XNQA 2CDGB 2E86A 4Y19A 3OHXB 1KTCA 3N91A 1HI6B 1WJ3A 5LWYH 5FYKD 3UTTB 2EIJB 1CE6B 2Q8BL 5ICYB 1OD7A 1KN4H 4HJTA 1SN0A 3KGRA 3C2SA 4PV9A 4RFEB 5EO9A 3SDDD 1E27B 5BV7B 2WGXA 4JAMA 1E4HA 4HBQA 3ABZA 4N20A 4Y4HA 5DJ2B 4FFYA 2DTML 2AK1L 2NYYC 1RZPA 3MLUH 5GJTH 4Z78B 2NR6C 4XBGB 3Q8EA 2HN7B 4H26A 3BCFA 3BT2H 1VRSA 2JJSA 4K3DH 3BISA 3PJLA 1SDAB 2OFQA 1A3LH 1PL3A 4GKNB 4I4WA 5DK0B 3MJGX 3BVVA 3RAJH 5K9OB 5M95B 3HG1D 5JO5B 5IFJA 3P54A 3VWJB 1RIVH 1Z3RA 2AQ1A 4OLUL 2Y3NA 3V7AG 3NJXA 4M5YH 4H25A 1JMZA 1ZLWH 1J1PH 2R8SL 5FGBA 4P2OC 3TEYA 4MLIA 4AT6A 3LQZB 1AXIB 2H9GA 4KV5E 3S8WA 4YPGB 3JSSA 2VQTA 1GRWA 2J8UA 3EDEA 3VXUD 1KB5B 5FUCE 4EN3D 1SXAA 4OF3A 4BRVA 4RMUA 4G9FD 4YWGH 3RVXC 3HKZA 1FA4A 1NCJA 4U1GB 3CBJB 4XHQA 3CZUB 4C56A 5TJWK 5EBLA 2CA4A 3QIBA 2LAGB 2UVEA 2E46A 2E8YA 3LQAC 3F2LA 3ZDZB 3N04A 2DWXA 2VISA 3BKYH 3UFIA 4LLQB 3B37A 4ZAKC 1PNDA 3C5XA 1SY6H 3RHWF 1IBBA 2I5YL 3RZWA 1AC6A 4NQDB 3E3QC 1K2DA 2ZXDA 3TOPA 5F3HA 3ZL4L 3ZDYE 5EOTA 4A2GA 2XWBB 4QHNA 3MRHB 1JBJA 1IIIA 4FXKC 3V5KA 4PJBB 1JV5A 1I7RB 2OQJB 5AW5B 1E6JH 4A7SA 4APQD 1Y6KR 3UPRB 1NC2D 2AJ3A 4G8EA 3H3KA 4ODBD 1J1OL 4R9HA 4GAJL 3WNKA 3S3DB 2X1XR 1NOFA 1IEBB 5IBTL 2QPEB 2FD6L 2XQBL 2ZWZA 1ROWA 3GI8L 3KYKH 3EHBD 4X6CE 4BFRA 1A4JB 2ADIB 1SHMA 1EDQA 1JS4A 4NGHH 3S4SG 2AJYL 3B7UX 3EH1A 4H8WH 4MJIE 1IM9B 5FHAH 2QGBA 3K4ZA 1UOWA 2AJZA 4WNQB 5MEND 5D7JB 1KNOA 3OC8A 3QI9C 3ZKXC 3PAYA 2M1KA 2BVPB 2IANB 2XFXA 5IOPA 1BZ7B 5IZ7A 1CCZA 2KDYA 5F1SA 3CDGB 3EYFB 1F11A 3POHA 2CHNA 2YKLH 5I15L 1X5YA 3TF7C 4PRHA 5I6LA 4NUPA 3APDA 5F1KC 4FQXC 4EIBA 3EH5B 5TDPB 1A6AA 1JWUB 5LGHL 2Z7ZA 2V9TA 2HFGL 1RSYA 2I7OA 2DLHA 3MBEA 1ZANL 1FAIH 4HJJH 3RVVC 4NO5B 4XNXH 1WZ1H 4CNIB 4EIGB 3ALPA 3A4DA 5C0ND 5GSRA 4MA3A 1FH5L 3MNWB 2WOYA 2AI0L 3U6RB 1HQRA 2XWTA 3VFUB 2XIBA 3P9MA 3AMLA 3CIQA 4F7TB 3TO2A 1FVDA 1RL1A 3LKOA 1KBBA 4L3ED 3SDCD 1FCGA 9CGTA 2RMNA 4I48A 5C0AB 3KBFA 1E4JA 5CD5C 5D4QA 1IFRA 5DFWH 2VLRA 3OPZH 3RX8A 4NPYA 2VUOA 3U2IA 1K3ZA 1DL7H 2F7QA 3K1KC 3PPEA 5EN2A 5SWQB 4AIEA 4TOYH 3CLFH 3PWVA 4M02A 5F89A 1S9VA 1IRAY 5CEXB 3FUMA 3EYOB 4UAOB 4EE2A 1CYXA 3R1GH 4HD5A 3LJ3A 1KTDA 1U42A 2YD5A 4AENB 1FLTX 5HHMB 5LN4A 2B4CH 3GZKA 3UDWA 1WISA 4Y89A 4QRAA 4BK8A 3N1FC 1JAEA 1NCWL 4HS3B 4QD2E 2HFEA 1TVHA 1P1ZB 2Q7YA 3NMEA 1USQA 3AQDA 5TE6H 4E68A 1PY4A 4G6KH 4D9QD 3CVDA 2FHFA 5GRXG 4PRIE 3GHEH 3WENA 5KANG 4BE5A 2VM4A 2NY3C 3FO1B 4ZFOB 3U9UB 4WJG3 4NZTL 4XVTL 1HSBB 4Y4KC 1OPGH 3RWEA 3WO3B 3QZWA 3Q2LA 3FBKA 4KDTA 4RWHA 4FG0A 4X83A 1LEIA 3DSFH 5AKVA 4IRSB 3DURA 1YEIL 2GFBA 1G6RB 2XACC 3F3HA 1MLCB 3V9FA 4LCYA 3G9AB 4QRRE 4PEEA 5DK2B 2X6AA 4TNGA 2QHRH 3FJTA 4JFVA 3QXAA 4DNLA 2VDKB 5KW9H 1M7UA 4KO7A 2VZVA 1AGDB 3H85A 3RX7A 2B3IA 3VFWA 4KGJA 1AD9A 1OT4A 3QFJE 3OKKA 4G6FD 4TTGA 1AMXA 2W0LA 3VWKB 5EU6B 5JQ6H 3OF6D 2F1AA 2FB4H 4FNLL 1WT5C 5D7IE 1DFBH 3RLSA 3MXVL 4JHBA 3U0WL 5GGUA 3TIDA 3WKML 3RFZC 4PJDB 3IRCA 4XH2B 2JXMB 1HHIB 1VAHA 1BP3B 2QV2A 4W9CC 3P02A 2ITCB 3ULSA 1CICC 2B15A 5C0CD 4UV7L 3LEYH 4MJIA 2CGYA 5J9PB 4KZEH 4KJQC 5B3NA 1HJBC 4ZO6A 3ZTEA 5DS2A 5T3ZD 1QA9B 2YWZA 4HIPA 1VFMA 2BH0A 2QMJA 5JW3H 1S9WB 2AEPL 3VSUA 1CT8B 3OVUB 4KY1H 1UATA 4TUOA 3X3GH 3SQOH 4KKBD 1U3JA 2VZTA 5D9SA 1ZGLP 4K3EL 5E9DB 1VZIA 1IM3B 2FGWL 2CO2A 2YKKA 4OLZL 4Y16C 5KSUA 4AM0B 4DAGL 4XPBL 3T3MB 1QSEE 1FO0L 2VXQH 3PP3K 2OYPA 1IQWL 1LEGA 4MB3A 4ZQKA 5ABAA 4J27A 5L4JA 1BAFL 3DECA 3OHMB 3DHJA 1YDPB 2VMEA 2X05A 2QBWA 1T5KA 25C8H 2VAJA 1QWUA 3ETBJ 4W6XB 4A6YA 4NN6C 4G82A 4X5QA 1AE6H 3VM5A 3RDTD 4AH2A 2EVJA 4Y5XC 2I85A 4AEIL 3HAEA 4BZ1H 3O9WC 4R0LB 2HX8A 4TSAL 2CHZA 1IB5A 1Z9LA 3ARFC 3KNBA 1WDAA 1MFMA 5SWSE 5GIRB 1NFDF 4MHHG 3UACA 2CO1A 4XE0A 4D9LL 2YAEA 2BDNL 1IAMA 1Y18B 1Z5LA 2HH0L 1I1FB 2A73B 4TS6A 4XHJD 5IB1A 4M9OA 4R97B 3HZMB 4TUKH 1WLGA 4M6NL 3MUY1 4YLQT 1TYRA 3KS0H 4LVOB 1FG2A 2I9LA 5K9KB 2E9BA 2Y1ZA 3HS9A 1OK8A 5B8CC 3O6FD 4ES8A 3SCMC 1J5OL 4RSVA 2APBA 1VGKA 1TPXC 5IEHB 1TZHA 2BVYA 3FCSA 4G6ML 1FC2D 3EGSB 3MJ9L 4POZC 1EERB 4OD3L 5FCUL 1KBPA 4TULH 3LB6D 4NKIH 4C59B 3L3OB 2F5AL 3ARBD 1WBYA 4PRIA 4QRUA 4HK0B 2W8CA 2E7LC 4AEEA 4OI7A 1CFBA 2JQMA 5ETUB 2RA1A 1MCWM 4XXDA 2IDTA 4KK6C 3SKNA 5IW1A 1RURH 1NDGA 4V1DB 3L4CA 2FIKB 3QORB 3KW8A 4HGWB 3WJJA 4LARH 3JQOB 1NEZA 3BP6B 3DX9B 4RZCA 1P7QB 1OSZB 4JQIH 1OL0A 1UWXH 3NEEA 4HWNA 4QRRA 2ENQA 4WKZB 3T0ED 3CFBA 3DWTA 3TTYA 3HG1B 1U8NA 3DBXA 1A1MB 1GZPB 4KXDA 4JK0D 3CK0H 3V55A 1QHOA 3QFJA 1RJZA 2D8KA 2D9CA 3OAZK 5INDB 4Y8AA 4JO8A 1SXCA 5KS9E 2DBLH 4ZS7H 5D7IA 3QWRD 5ERWA 1IMHC 1Q9WA 4DEPC 3EFDH 4GI9A 3DVGA 2A9CA 5DQ9B 3KWVA 5DVLA 2VDOB 3BGMA 2WO3B 1GYUA 3D18B 4CN6A 4NQCB 3VXUB 2O5YL 2QHLA 3B9EA 1DBKH 4UV4L 2BMKA 3MNMA 4IRJA 4TVUA 4ZW5A 3MUGB 4MXWH 5IT2H 2CWRA 3FO0H 3IF1B 4CRPA 3QGVA 2WYIA 2J8OA 3C09C 3MLYH 1N26A 1IO4C 3GS7A 3ROOB 1NDMA 3K72B 3FT2B 3WNPA 4DOHE 1X5XA 1YECH 2VGLM 1QSEA 3H3PH 5IFAH 3QS2A 1JNNL 3IWUA 5I18H 5CKAA 1ZAGA 3D51A 4JN1L 2HFTA 3VH8A 2BS8A 1EAQA 1B2WH 2EYTA 2Z92B 3CZJA 3LIZH 4FXGB 3VFPA 4OLXH 3CH8A 4PRDB 5I0XA 1I3VA 1ASQA 2BOBA 4JJ5B 4F57L 4UB0L 4ANKA 4UT6L 5JHLA 2AGJL 3BUQA 5E24E 4JO3H 5AZ2H 3IDYC 3SE4A 2IFGA 5DJZB 3D2UD 1FORH 2W80C 2FX9L 2WBJC 3EYQD 3HC3L 4L29A 1CLZH 1W8OA 4U6XB 5A16A 4YUEL 1UD5A 2AQSA 3ZKQD 3FU7B 1TQBB 1KV3A 1X9QA 4X5XB 1F56A 5SWSA 3TEUA 1NC2B 5LVEA 3V9CA 4GEIA 2ICEA 4H13C 5E1AA 3F8UB 1MHEB 3BAXA 4TKWA 3MLTA 4U6YB 1S7RA 3J8F7 1CN4A 5I30H 1E3XA 1KEMH 1L7IL 4I85A 1MCLA 1LK3H 4I2XE 4AIOA 5FKAA 3RU8H 1TITA 3UBFA 1CXEA 5C2BH 5CJXA 5MENB 5DMGD 1BMGA 4AZ8A 3MRNB 5FPIA 4WI5A 3U46B 3QHZL 3VFVB 5D55A 1RZKC 3CQFA 3HS0B 5GGVL 3S35H 3BRFA 3NIFB 1RP8A 2OMBA 4F7KA 1VEMA 3CXHK 1YEGL 2ORBL 3TT1L 2YD4A 3QE5A 3SE9L 3GBEA 4MD5B 4HUVA 5C3IA 4BSJA 3PWUB 1Z5HA 4U7KA 4A2FA 1S9YA 5E56A 2NXYD 4W9DC 5GZNA 1TUPA 1D9KD 4P46A 4NCC1 3OHXC 3QEGL 3RPIB 2R0LH 5FUZL 1MCEA 5F72S 2OZNA 5HYSG 5FK9A 1NFKA 2P80D 3IJHA 1O9WA 2EXSA 1DBJH 3LPWA 5BV7C 3P4MA 4FJZA 1NPUA 1A6VH 1AGEB 1T83A 4L3EB 3IYLW 3ZO0A 3SDCB 3AREB 4XRCA 2OXHB 5JIDA 1TSHA 3TV8A 1MEXL 3F7VA 5ECJE 5EU3B 1UURA 2J21A 4IK7A 4NRZA 5TF1H 3FCUB 5HPMB 5KS9A 4HUUB 3UYPB 4WU5B 3VWJC 2R4SH 5DJ6A 1Q9KB 1Z9SA 1U93B 1ZV5A 5LNEA 1DJHA 2APTA 4BV1A 4MASA 4NHCL 2V5TA 3GO1H 1KN2H 5AKSA 4DTGL 5FB8A 1XBRA 3L2LA 1VEPA 1QPXA 1J8HD 4OFYD 3BD3A 4X0KB 4JFTA 4YDLB 1L0QA 2BRRL 1SXZA 4IM8A 2BY3A 5D2LE 1NAMA 5D4IA 4I77L 3EFFB 2C3GA 3JWNC 3P9WB 3N42F 3BWAA 4ZQTA 1A7RH 5CBAB 4U1GC 1KGCD 2OMVB 3AG1B 3GMMB 1OARL 1DBBL 3O3BA 2CA3A 3CCHA 1ORSA 2EO1A 1HS6A 2UZPA 4HUCA 1Y7VA 4UM8B 5IKCA 5C08D 3IB4A 4NQSB 2FATH 2DEYX 2OAAA 4RMSA 3U9PL 5CGYC 3K2KA 4NKQB 1MCQA 4AQAA 2D3VA 3FCBA 4KX7A 1DUZA 1IFHL 1OF2B 2H3NA 5DMIL 1WEJL 4L4TE 4DO5A 2CXGA 3TO4B 5KZCB 2L4OA 1KFAL 2GAZB 3BCDA 3R06A 5BV7H 3E9UA 2DI8A 3ZN6A 5AW9B 2GUOB 4L4VD 1EJFA 2Y06H 1FV1A 4EI5A 1ZHNB 4RAVA 2X44D 3K8KA 4MXQC 1A4CA 1KPUA 2DKUA 4WI9A 4XPHH 5DRWB 5JUEL 5K1VA 2R29H 3SDXF 1NM4A 4DWHA 4NNPH 3FK3A 7PCYA 4XO3A 5EZJB 4LPCA 1G9NH 4ZW3A 2DJMA 3ARWA 2R2CA 4ODVH 3MBXH 4YHZH 5SX5K 3RWCB 5JHBA 5TFSL 1DLHA 1EZVX 2CRMA 4GS7C 5E1GA 1KWKA 1LO2H 2YN3A 3HE7D 4FQIL 3IE4A 2MH4A 4JANA 2Q6WB 4X5PA 2A9NH 5EC2B 3BPNB 1TEGA 1F58H 1YYCA 4JJHA 4Y8DC 2N7SA 5LDUA 3CZFA 1D7DA 1RUMH 3K2IA 3R0MA 5D5MB 1GAFH 3BP4B 3HG3A 1CURA 1ILUA 5B1BB 5TE4L 4EBQL 1ZV2A 4NUGH 1XD0A 2MKLC 4OT1L 2FIRT 3LXCA 1CB4A 1KLUA 2VL5A 2WINA 4D9RE 2OK0H 1IKNC 1N2RA 3ARPA 5JMOC 4AK1A 5HSFA 4JW3A 4QTIL 1G9MH 2WQVA 4EZMA 3IKKA 1CE1H 3S37X 3LS5H 1GSMA 1ZS8A 2XG5A 4I5BB 4OLYL 4WUUE 2QDWA 3ZE0B 1KTLB 4L23A 4KJPC 3SDXE 1JF6A 1IGIH 1DLFL 2BIQA 4HMEA 1JPFA 5JQHC 1BX2A 5DFTA 4WFFD 1XSOA 4IU2B 8PAZA 2PPFA 3VYNA 1VFUA 4LVHB 4YIQA 2FH8A 3APNA 4GAFB 1B0RB 1JDAA 1WFUA 2FK9A 2A5UA 3NCJH 4JEGB 4UUJA 1F6LL 4EUPB 2NX5E 3NQIA 5T3ZE 5LGKA 4YDJB 4AG4H 1AXTL 3BAKA 4DJMA 3GM0A 5C97A 1I1YA 1SMDA 3O4LE 3U7AA 3LPOA 3VI3F 2FH6A 15C8H 3T8XB 2Y5TB 1JPEA 1CFMA 2WUBL 3Q01A 2CIIA 4OD2B 3GMQB 4YR6B 1F41A 4XC3H 5F7LB 2B39A 2K78A 3ULVF 1I3GL 3NGBB 2EXYC 2ID5A 2ITDA 4UAOC 3O45A 5CWSA 2G5BA 3CFJB 5FV2A 1CF1A 5F7EL 5D2LA 3HCVB 3LRSA 4AYEC 3GRGA 3RNQB 3GC3A 3WUWB 2HUEA 3CZSA 4QHPA 5TPWH 1DQTA 1MCCA 4E9YA 3VYPA 1Q8MA 1A25A 3ES6A 2X9YA 3HHMA 1U8OA 4QHUA 4DESA 4KK5D 4PJFB 1J0YA 4HXAH 1JHKL 2RR3A 4Z7QF 3MC0A 1COBA 1OCOB 4UIKH 3V6OE 3RUGF 3OR7A 1Q72L 1UT1A 4D2NA 5DF0A 1E5ZA 1Z7JA 3PS6A 4X7TA 3PWPD 2B14A 4ZMLA 1Y6MR 2X89A 2MOGA 3JV6B 3NSFA 2WLZA 4LP4A 3VI3E 1VADB 1FPTH 4L4TA 2FBOJ 3ATEA 3E2HB 4LRNL 2WQ8A 1ZMYA 2OX5B 4IRSC 3CFIC 1NBZB 3ILEA 3O3UN 5J06A 2MPAH 4JGNA 4M1CD 3D2TA 3OKYA 2CLZB 4MCMA 3UZVA 3GGWA 2F7IA 4LHUA 2J6WA 1MHHB 2CLVA 4XNBA 1TMQA 2YFNA 1G94A 4LOFA 5DRZB 5E8DL 1BQHA 1YEKL 5EIVA 3ARDD 2NUPB 1FGNH 2HFFA 5DD0L 1X5ZA 3CVHB 1CYWA 5KYUB 3R4RA 4JFDA 2O6DA 2HRLA 3I6LE 2DJ4A 1EEYB 3PFUA 4HWEL 5J3HD 3APCA 5JZ7C 3V0VA 2ZE0A 3JVGC 1QFUL 1CL7I 2VO8A 4TLSA 4Z7QE 3E1F1 1IAIH 1VLXA 1BFOB 1W72A 5CXPA 4FEIA 5I2IB 1QZNA 1UQSA 3OGCA 2A9MH 4G1MA 3VRIA 4F2MB 4QKXB 9PCYA 3NIDF 5EIIA 1TZIA 2UUDK 3GPEA 3PV6B 5DLML 4A7QA 1HH9A 2JMRA 4UINH 2VN3A 1A6UH 5FYJD 2ESVE 1MY7A 5JXEC 2IBZX 3TFKD 1MHPH 5I74B 3OKDA 3PL6A 1ZLVH 3MV9B 4FFTA 5CGMA 3MRCA 1PYWB 3QQXA 4LKCB 1G1KA 3BP5A 1I85C 4KKZA 4TPRL 1N9PA 4NWTH 2X1WL 3CN2A 4UYPA 4WUUA 5DD3H 3UTZA 2E0PA 1S7QA 2VUKA 1YQVH 5F44A 1QX1A 3C5ZA 3THML 3OG6B 5ELIA 3SDXA 1U3HC 4GQRA 1LO5B 3KLHC 3LN4A 1MIEL 2H6PA 2P24B 1OAKL 3VFMB 2WBXA 2ARJB 5KYWA 4HT1H 1CFSB 2NX5A 3NDYE 4F8LA 2P8LA 5HJGA 1G6RH 1NBYB 2NSMA 3BSZL 5E70A 2A7BA 3O4LA 1GC1L 2APWA 5GS0L 1QLRB 4WZ9A 1K4CB 2IMMA 5HHVH 3ATBA 4ALAL 1XR8B 2YAQA 3NIDE 2ADYA 4JJOA 2OZ4L 4I9WE 3HAEG 4FQQA 1N6QL 4XZUA 3GSRB 4GB9A 4HMDA 2W95A 4I1NB 4R97C 3W81A 1I7TB 1X5HA 5ICYA 5D4HA 4BKSC 2VLJE 3GS4A 4KUZH 5CLWA 1TJMA 2Y2WA 3QUZA 4LVOC 3TFBA 5EZIH 5HYEA 5JHAA 1CGSL 2WVUA 5FO8A 1EO5A 3L5WA 4K55A 4Y2DB 3S34L 4XMPL 3WKQA 2ED7A 3Q6FB 4LBEB 4FG4A 1BQLH 4YHIB 3LH9A 3LV3B 5EO0A 5EU4A 1JVLA 1F3DH 1QBLL 2WNWA 4WTXA 5HD8D 2VXSH 4MBOA 2NXYB 3MRPA 3LKNA 3B7TA 3DOSB 4OSUL 4Y88A 1MJ7H 2X4SB 3UTSE 3L3HB 1RIHH 3BUTA 1D5XA 2AABL 2EDDA 3V6OA 3F83A 4OM0L 2Z93A 5D70L 4LRIC 1QEWA 3PY9A 4M6OH 1A2YA 1RFDL 2HUHA 1AGCB 1FWXA 2ZX7A 4LCWE 3EJUA 4O2CB 3VI3A 1Q9OB 3SQBB 3JWOL 3ZX1A 2CO7A 5KBNC 4YDIL 1FRGH 3GSNA 4GUOA 2XPGA 2HVJA 4YZWA 5C6TH 4D7BA 2EDFA 3QORC 3CXDH 4I87A 3IKCB 3QJVB 2ZCKL 3BAJA 3AB0C 3E6FA 3G5ZB 1VACA 2IDQA 5IBLD 2RACA 3MRIB 4MZIA 2DM3A 4NPJA 5AB9A 2VKXA 3LYRA 2F53E 2MOQA 2KI6A 1CLOL 2DIEA 1ONQB 4QCIA 1PJ9A 4IMLB 4X6FB 4YE4H 1W0WB 5EDXA 5KN5B 1SOSA 4KKAD 5HY9B 2ZZUT 4FFZA 3NA4A 5KVGL 4GG8B 2VSCA 1BVOA 1GGYA 3FULA 2NSQA 1XF4A 3FN0H 2NQ3A 2H8PB 2YMTA 4IIQB 2L3BA 3V8OA 2DM7A 3MROA 3OR6A 4D3CH 1BF5A 1DBML 1NEZG 1TZOA 1WFMA 5IW6B 2WSDA 3K74B 2G0LA 3I9GL 2VABB 3N41F 4PQXA 5EF3A 4NQXB 4P9HC 4OF8A 3UGXA 2V9QA 3O2WL 3OMAB 2AK4A 3C8DA 2VERA 2IDCA 4TLKA 4JDZB 4KVNH 5F0JB 3N1MC 3UZQA 1V5JA 4G5ZH 5DK3A 2VR6A 3T2LA 1IILE 1QTYT 3FTGB 2P47B 2ZPKH 2DV6A 4JFED 2ESVA 4OIBA 2IF7A 5EU5B 3ZTNH 2OYLA 4B0MB 1IAIM 4HEME 1CGXA 2EILB 4MAZA 1GZQB 3F00A 3QSKB 4FXGC 1T03L 3W37A 1KTBA 1ODUA 4N6RA 4PRBA 3T4AA 4XP5H 4V2BA 3BUBA 1LE5B 3B1TA 2QTVA 2CR0A 3OG4B 2F58L 5DRXA 2VLME 3OJMB 5HHPA 4UTCA 2YAFA 2PTVA 5BUGA 1EO8L 5C0IB 3T08A 4IU3B 3VW3H 4Y7OC 1L5GB 4UQ9A 1XL6A 5B7MA 3VH8G 5CJQH 5A6IA 3REVA 3V4PL 3A6BL 2VDQL 1FL5B 4C8XA 1RZGA 3SY0A 1G1OA 1Z9NA 3SPVA 4P5MA 5ABZA 1NAKL 2B7DT 5T3XH 1R3KB 3II3A 4ZTPH 5K9JH 3CGTA 1G7QB 3RNKB 4R7NB 1BYNA 1XL4A 4MMZB 2JFCA 2VLJA 2BHFA 3SD5A 4OCXH 4LLVB 5I1LB 1OGAB 1HWWA 4PS4L 1WCQA 2OJ1A 1YEFH 3T5WA 1R4XA 2RJMA 3NP4A 2DYPA 1HHKB 2W91A 2VDOH 2FT8A 4TL4A 4WFHD 2NQDA 2BSED 3AY4C 5AW4B 4YMPA 1PMYA 2VUYA 1JWMB 1OAZH 4J3TA 1OAJA 32C2B 5DMKA 1NBVH 2A3TA 3CDZB 3B2VL 1UACH 4KBPA 1DO6A 3AADB 3HN8A 4OKVA 4WSJA 4AY0A 1QNIA 2VZUA 4P2QE 4UU9B 4J39A 2FCBA 1RXLA 5KYYA 4KJYA 3HG4A 4HPOL 4KJWC 2W88A 4XNMA 2UZXA 3W82A 2WIIA 3WEXA 2VM3A 1NAML 4G59C 3RA7L 1RKRA 2AJSL 2DICA 1A7QH 4BSVA 1EFXD 1ZHBA 2NW3B 4U3SB 5DYOB 3AREC 3SDCC 4D0DB 2F53A 3AS1A 5BZDB 4HJSA 1TXKA 2ENPA 3P4OB 3PGCA 2ZP9A 2IGFH 5E6RB 1LK2A 2L7UA 5DZJA 5LKNA 2HP4A 4M6AA 4ANXA 2RCSH 3WXWH 3GHBL 3P3UA 5EORH 1OO2A 1DVZA 1NSNL 2WTRA 1QI4A 4HS8H 5JDSB 3P30H 2A1WH 1GMIA 1RK0B 4WTZA 1IQDA 4R7LA 3UYOD 1T0NA 5JR1H 1KXQE 5GS1A 2ED6A 1E9PB 3CFNA 3VXPA 1MH5B 4W70A 3UJTL 1OP5K 4P4RA 1YPZB 2X4TA 3GSQB 4YDLC 2R0ZL 1NANI 4GNKB 4QF1A 1ASPA 3VSQA 5GZOA 2NOYA 5ALBL 4UT9H 3UTPE 4NN5C 2P5WE 4WI0B 2O5XH 4FP8H 1J0ZA 2ZF8A 4KTDH 3RL2A 4UTBA 4NM8H 3B7YA 3X13B 1KJ2A 1G0YR 4HEMA 2JKXA 2R1XB 5ANME 1N8OE 1QBML 3BQUB 4L8BA 1URZA 3PWPB 1BGXL 1JV2B 2IALA 2ICWA 5HDQL 2DS4A 4I8DA 3HPLA 3VGGA 5D1ZD 4GSDL 3UAJA 1ZSDB 2O61B 2YPVA 2WWKO 4R5XA 3LH8A 1M1SA 2EH8L 1PG7X 1BEXA 4JFOA 3ABGA 3IJYA 4NUQA 4PI0A 3TO4C 5C70A 2ZG1A 1N8ZA 1FVEB 4N0CC 4OB5L 2JELL 1IVTA 2JB6B 1BD2B 4X7FC 3ARDB 4LSQH 4YDZA 1Y6NR 1MCKA 1YEHL 3IMUA 1YNKH 2ZKWA 1KEGL 4HK3J 3QG7H 4LBAA 3LXBA 3NCMA 4WK0B 5CD3B 1N67A 1S7SA 3B2MA 4FQPA 4OTXL 4IRZH 4HETA 1U8CA 2DI9A 4QLWA 1Q0YH 3TVMD 1FGVH 3PP4H 3MCLH 1MI5E 1R0AH 4XBEL 5DD5H 4ZMZA 4M3JA 2P8PB 2CUIA 2FUQA 4O5LH 1XV8A 3V0AC 3WOVA 4CADB 5JIMA 5FA4B 1AJ7H 1ND0A 2VTFA 3HI5H 3TWCH 4WU7A 4DEUA 4UM9D 5DI8B 3BPNC 4YSOA 3BXNB 1M56B 1KG0A 3OL2A 2LVEA 4R26L 1Q1JH 5G2NA 2GJJA 2ALAA 2UWEE 3A4FA 2JF1A 1EXUA 6CGTA 1OW0A 3EH3B 1NUDA 3IE9A 1WA0X 5E0FA 3FQNB 4P2QA 5EC1B 3HC4H 3U83A 3TBTA 3ZDXF 1C1EL 1GZHA 3ULUC 2ZXAA 5H35A 1GJWA 1RU9L 1MLBB 2HWZL 4GSRA 4LAJH 4B9CA 1YAIA 2CZNA 1RZFH 4FTVD 4PUBL 1HXMB 2FTAA 3HE6B 4KVCH 4HV8A 4OJFL 5MERA 5D7SH 3C2AL 4EXPX 1WCBA 1DQMH 4ZO8A 2FR4B 1CDUA 4L18A 4IKJA 4JRLA 2JIXB 4LVHC 5I1EL 1B4JL 2XC8A 2NXZD 5KSBE 3ERXA 3V10A 1N6UA 4YL4A 4YHPA 4BZYA 3GLDA 2CHDA 4MMXA 3D25A 5E5MA 2Y7QA 2AJVH 2QQQA 1HH6B 2VN6A 2HVKA 4HYTB 3EJPA 4NFDA 4ONFH 1KXQA 5L4MA 4XWGL 4HZLA 5IBUG 3NH7L 5KAQF 2UXGA 5IQ7L 4I1PA 1EJOL 1GYWA 3NGBC 4BH8A 3K1DA 3ZDXE 3KLLA 3FQTB 3F6IA 5JIKA 2XG4B 3DX8A 4K8RD 2P5WA 4QRPE 1FVCB 4XMVA 4JRXA 5D7LA 2MCMA 3SEPA 4F8TA 5BVJA 4ODHL 7FABL 3U9WA 1D5ZA 3G04B 4GXVH 1NKGA 2G3ZA 4JRYE 4N2KA 4WW1B 1XZ0B 2EADA 3LB6C 5DJ8B 5F70A 3KVDD 4RA0C 1ZLWK 3HI1A 3KWTA 3AS2A 3ME0A 1CU4H 1LGVA 1ZE3C 2PYFA 4XAWH 3B5TA 3H7BA 3NP3A 2N1TE 1KTRL 3DX7A 4K5OA 4TUUA 2A2QT 3T8MA 1P7BA 3BC9A 3O0RH 2ZT9C 1URLA 1C5BH 4K3HA 1M7IB 4HWZB 2H1PH 4O58L 3TURA 3AXLA 2FL5B 1SN2A 4XP6H 1HE7A 4KO5A 2D7QA 4O9HH 1JNLL 3ULUH 1S7VA 4MD0B 1TTRA 3E2HC 1SHXA 1EQWA 4UQ2A 4NQQA 3T0VA 3MGTA 2EVHA 4GBXA 5AZEL 1QNZH 1YRKA 3H42H 3V6ZB 1O6SB 3D39D 1U8HA 2ICWI 2ODHA 1ZTXE 1RJYB 4GFXA 4GW4A 3GMPA 1FNHA 2XIIA 3TT3H 4Y5YA 4X6DB 3C87A 4J7RA 4P5TA 4QNPF 4F5CA 1Q90A 3JV4A 2YPKA 1Z6JT 1ORQA 1TJGL 1XR9B 4QRBA 2KMWA 4HVBA 4HQQH 1AP2B 2ZKMX 1XX9C 3B8YA 1C5DA 1F1GA 3V4UH 3IMWA 2PO6B 4CVZB 4ZMWA 1P7HL 4Y1TA 3WFBH 1MI5A 3VXRE 4UTAH 1NIEA 1I7UB 4LMQE 4I0KA 43CAB 4CU6A 3FHAA 3LRHA 4KKLC 3BO8B 3BPCA 4X8JB 5T3ZL 1PU0A 4LHUG 3BRGC 5IVNA 5HDBF 5IQNA 4MDJA 3U0TA 3WFHB 1NLDH 2WSPA 2CMRH 1BZQK 2G2PA 1BQHG 5LXGH 3I9PA 3FTXA 3B43A 2UWEA 3X14A 3FF8A 1MVUA 1ZA3A 3WNMA 4DGIH 1X6NA 5GPRA 2A6KB 4HLZH 2QGCA 2O6EA 4K23H 5I74C 1ID2A 5JOFB 3N1QC 2XVGA 5L88L 3UAAA 5C0RH 5LG1A 1ZE3H 1PDKA 4L8SA 4P23D 3BWZA 3FRPB 5F9AC 2J25A 3VD5A 2H5UA 4NQVA 1R3JB 3MKKA 1E5CA 5D1XE 5E2VH 1H8NA 3EYQC 4J3OC 5EIIG 3UJIL 1YN7A 2EVFA 3QHTC 2E5EA 2XY2A 4LDOB 3WMQA 3QNYA 3RIAF 1G43A 2Q20A 1GW0A 2H41A 3GMNB 3U2HA 1KCUL 4MS6A 2XXMB 3AM8C 1E40A 1FL3B 2ENYA 3LKSA 1LQBC 2VWEE 4BSWA 4XVJH 3MLRL 5B21A 3HG5A 4AL8C 1YY9C 4MVBD 2EDTA 3TNMB 4YNYB 4AZUA 4NYLB 2OR9L 4HJGB 2BIIA 1B0WA 2J7LA 3V4VL 4HJEA 4DVBA 2MNWA 4WI4A 3C6LD 3HC0A 5I8OL 1G7IA 3QIWA 4RQQB 5DMGC 4OIAA 5GGTH 2OTWA 3ETTA 1QMUA 1BEYL 3ASOB 2J12B 4JFQA 3UG3A 4Y2DC 4WI3A 4QRPA 4NBYB 2IXQB 4JRYA 3NAAL 4J3WA 1KYOJ 3ZLQC 1AANA 2FO8A 2NXYC 3FB6A 4QO1A 1WV7T 3D3VD 1P4LA 1JPSH 2B2XH 3LKRB 2PYED 4YDVA 4KMTH 1AFVH 2G4EA 3KPNB 3B1UA 4NRYB 4KAQL 3MV8A 4UOW0 4N0UA 4NN7B 1FZMA 2VDPL 4KUCF 4OGQC 2MRYA 3RGVA 2DD8H 1BPVA 4DQOL 1XEUA 4N8CH 4WO4D 3ET9F 3MLVL 5H2BB 3GJEB 1I8MB 1XDTT 4ISVB 2W0FB 3SBWA 1FFOB 1CDCA 3KL0A 3N44F 5HJ3B 1PAZA 1HKLH 4GRMA 5CMAA 2AJXH 2C9RA 3VFGH 2KERA 4K7PL 3BESR 4FL4B 1H3PH 4IIQC 3HA0A 4A55A 1EPFA 4JM2D 2D73A 2PPDA 3VXRA 1A7NL 1OQXA 5KOVC 5DJYB 1RMFL 2WZ6A 2J4WL 2P28B 3FCTA 1N5AA 1Z5YD 4GLRH 1E9OA 1IL1B 4LDLB 1KTJA 2QSTA 2RH0A 2IH8A 3CSGA 3W2DH 4OQTH 3RL1A 1RK1B 2ZOKB 4AQ1A 1N64L 1KTKE 4PJAB 4TVPD 4M4PA 4OLVH 1RZIA 1WICA 2VXTL 1QBBA 3C8KA 2XCMC 4G72B 1ZHLB 4ZNCD 2KLSA 4Y4FD 3D0VB 5KUMA 1WBXA 3OQ3B 3UJJH 4JLRB 4AGPA 2G2RA 5D1ZB 4ZMQA 1L0YA 4YXHL 3MV7E 1UEMA 1S7UB 1RZ7H 3AY2A 3IDNB 3SYCA 4POYA 3BX7C 2VMDA 2JK5B 4FFVC 4CILA 4U05A 5K69A 2WXGA 4HIXH 2I9TB 4KI5C 4GG6F 5D1XA 3H9YA 2E6JA 5I1GL 3OJ2C 5I1AA 1U36A 2FQGA 2COQA 2RHEA 2DYRB 3O3AB 2A4ZA 1G9HA 3IDMA 5KJ7E 4Z7NF 5A2JH 1BOGB 3SKOB 4YSTA 4LPXA 3M1BB 3WI9A 1A9BB 3CFEB 3UC0L 1L7TL 2KLTA 3TEXA 5B3JF 5DJCA 2UXTA 3PDGA 4GINA 2VJXA 2FJGB 1JUFA 3NFNB 5BJTA 1ZVHA 2FT7A 4A67A 4G9DB 3K6SB 3CSYA 3L95B 3LN5B 3NN8A 4P0DA 5DC9B 4AJ0A 4NO0D 4MMZC 1P4IL 1E5BA 1GMEA 2C4XA 2YPLB 4WAFA 3SE8H 2AQ3A 5SWZD 3RQ3A 2NY0D 1WUNT 5EU7C 3FU5A 4WFGE 2VQ4A 4U1NA 3VI4B 1A6TA 3MNVB 1CXHA 3S96A 5HHOD 5EUOF 3DSNB 4JDVB 3CFQA 4LEXH 1NGZB 1QRNB 2QQLL 4YHYB 3STBA 3NABL 3BYTA 1W9XA 5JQIB 4ONGH 3MRFA 5DC0A 4Z7NE 3KPOB 3P0GB 4PGBB 3BEWA 4JFZH 1P5UA 2PETA 4UOZA 4PREB 3W5NA 3CLEL 1NBCA 3MX0A 1T22A 2HT2D 2IH1B 3QWOB 2A9BA 2G75A 3DLQR 1FE8H 3RWDA 3K0WA 1EHLL 2J88H 4FQ2L 3TBVA 2HJFA 4YHKH 3OWEA 1S7WA 4KNUA 4FLHA 1CFQB 1RPKA 1CC3A 5D7EA 5BRPA 2BJML 3S3PA 3ZGIA 4UTBL 4GAGH 3RBSA 1KJ2L 1SPDA 2X2UA 1E6OH 4UWQB 5C09E 1RVFH 1FNSL 5BRZA 4HGKC 3AU1A 4CU7A 3WJMB 1RUAL 2WXKA 5EUOE 3S9DB 5CUSL 3L5XH 4J12A 4GMSL 5T1JA 2R0KH 1LEKA 2YPVL 5AYUH 5D2NB 1PLGH 3FO9A 5IESL 4EIZC 1OSYA 1W0VB 2G9HA 4YXLL 5DJDB 1LD9B 2IBBA 3SYAA 4PJ9A 1UWXK 4Y4HD 2XV6B 2XZCL 4FCAA 1XGQA 4YHOL 1T20B 4IKIA 3DGDA 1BVLB 5JNYB 1T66C 3RVUD 3HZYB 4E41B 2XETA 4FG2A 4XPAL 3QULB 3GRBA 2V8MA 3BUDA 4LMQI 5AW3B 4KK5C 4L9LB 4LSRL 5GSVA 3QR1A 5F9OL 2DW5A 1T0MB 4WTZG 3NIGB 5EULV 2C9XA 4EI0A 4AGNA 1JGLL 3S5LB 4W9LC 4Z7WE 5B38A 5CP3A 1NIDA 3PFQA 2EICA 2PR4L 2XX1A 1MHCA 3D87B 1IEAB 1YEEL 3WNLA 4AGQA 1AXSA 1M05B 5CIPA 4AMKL 4JN2A 5IMMB 5AD0B 3WDJA 1KCSL 3UYRL 3MLZL 1U21A 2Y72A 1DYZA 5DJ0B 3V0EA 2W0PA 4GI8A 4HC1A 2YD0A 4H44C 2PXYD 1CUOA 4JFXA 4C56D 3HNSL 3QIBD 1I8IB 1HDMA 4LL4A 1K4DB 1G7PA 3ARDC 1KGWA 3W9DA 1TU2A 1AIZA 1LL1A 2YBRB 4HH9A 4YVUA 5EF1A 1EEZB 3G6AA 4Z7OF 3Q9PA 5J3HC 3QUYA 3W38A 1XTLA 2ZKHH 2Q3ZA 5EEXA 3DRTB 2BSRA 5EOCL 2P44B 1XWVA 2KZKA 3BMWA 2ZUQB 1OZUA 2W9LA 4Y1AA 3ZT6A 5C6WH 3RZCA 2XOTA 4MWFB 2A77L 2FJFA 2XKNB 3QEUA 4P2RD 1AZUA 3GK8L 3I6KB 5IMOA 4GG6A 1KLFB 5LN8A 5F7DB 3WFEH 4PJHF 2AEQL 4HIEA 3FB8A 1JL8A 2XA8L 3FQRB 3GJFH 2BIOA 1QFOA 3E1ZA 4XP9L 1GW6A 4YDKL 4Q0XH 2NNRA 5HYFA 3EYVB 1J18A 3H4FA 3WY4A 1ZTMA 1FG9C 2OL3H 5FHBL 1V27A 3FOLB 2BINA 2XVLA 4OCYH 4E9VA 1JF1A 1UYWL 3UO1H 3WE6B 4ZO9A 2IAAC 3BIAX 3NPSC 1G5AA 3KPPB 2VR8A 4BWWA 1P84K 4HPYH 4BH7B 3HE6C 4OCWL 1CQKA 4Z7OE 5D72H 4YN3A 4Z77A 4YBQD 3SJVB 2EACA 5C09A 3QCVH 2XPZA 1KGJA 4B9FA 4DPBX 4PRHD 5A2CA 5IHUH 3SO3C 5IJDC 4PU2A 4AJYV 4B0MM 4N2FA 3DROA 3KD4A 3BVNB 5EUOA 4GRLD 4S1SH 2WB1A 2ATPA 2OBGA 1N5YL 1BA9A 2CGRH 1UB5A 3EGXB 1OK0A 3IJ9A 4PJHE 5J7CC 3C6LB 4KRNA 3BOVA 5IMLA 3HZVB 2BNQE 5JLZA 1GCYA 1J1XL 2BFVL 4NZRL 4YQXL 3WJLA 5E6UB 4CAGA 1BBDL 3Q6GH 3WSQL 1BECA 1ZLDA 3NCXA 5A3ID 2YD9A 1I1CA 3E8UL 3LMJL 1UXMA 2BSCA 4UIMA 5ITFB 3BH9B 3K6OA 1JNJA 4K9EL 5HD8C 2Y7OA 3D3VB 3H2QA 2VLRD 3T77B 1P6AB 3F6JA 4BK5A 2PYEB 4Y9EA 3TPUB 5J6GB 1IKFH 1FO0B 1X7SA 3HNTH 4Z7WA 3KYMA 2Z31A 3AWGA 5IIEB 2V5RA 1MREL 3FT0A 2MEJB 4H7VA 2G5UA 4QTFA 4ORGA 2IQAB 2J1YA 2XZAL 4E5XB 3DX2A 3AS3A 4PTTB 4S11A 1FHGA 1QW9A 1UD3A 1T2JA 4EIUA 5IR1B 1HWGB 2I27N 3ZVVA 2BP0B 4X80L 4HCGA 2OS7A 4DKEH 2Y9RT 5HPOA 2HKAA 3JT2A 1EGJH 5HYIA 2HLAB 1CZ8H 5EF0A 1K6QL 5IB2A 5AUMB 1DZ0A 1X44A 1KGXA 1U92A 2RD0A 2ZUSA 4KKAC 3ZU8A 3KBEA 1VKXA 3A6CH 2BCKB 4ODXB 2F68X 2VH5H 3F5WA 2C7UA 4RETB 2GTWB 2PO6C 3DUUB 3GUTB 1XGUA 3CHOA 1NC4B 1MQKH 3F7LA 3FU8A 4LP8A 3TYGH 3O8XA 3NA9L 4G42B 5EUKB 4UQAA 2H2PC 2UY7B 4RMVA 2PN5A 1UCBL 2FSEB 4JO2L 3DTXA 4BRJA 3KPMB 4DW2L 4IKLA 3X12A 4DKFL 3UEQA 5ADOH 3ZYJA 1SJEB 4ZXBB 4JM4L 4GKOA 3QAZB 3CMOL 1NJ9A 5E23A 3QIUA 1X5IA 1QSFB 2H2SD 2X9XA 3F7RA 3MV11 1EBAA 1GVIA 3QZMA 3UO8B 1H6EA 2HTKD 2XTJD 3WIFA 3GDBA 4Z95H 1R9FA 3PWLA 3IPFA 1YG9A 1I75A 3LNHA 3QRGL 4RDQF 3DKHA 4HDIA 4LSUH 2XZZA 3T8VA 2H32B 4Y2OB 2XQYK 3PNWB 4CBZA 5AAMC 3MGOA 4M6ML 5LG6A 1ANUA 1INEH 1SM3H 2ZWKA 3L3DB 4DCQB 4EN3A 2XXFA 3F7YB 5DQJA 1AQKH 2AZAA 2K6ZA 2WGNB 3EYSL 4Z76B 2IG2L 3EJYD 4AKQA 5KVDE 1IBGL 2WW8A 1UZGA 3Q2CA 5BW7A 2V7NB 1YO4A 1AG0A 2WAQA 4D9QE 2PP8A 4PJHA 1SFHA 3DRQB 2YXWA 3GI9L 1P4BH 3LNGA 4NO0B 3QJZA 5E6IB 3REWB 5GS2H 4N8UA 5C92A 2BNQA 4IDLA 4M4RA 5I6OA 1OE1A 4JDEB 2AAAA 2FZ3A 2QKIB 1U33A 4DZBB 3V6FA 1EUTA 2CNYA 3PXLA 4TSCH 1U8MA 4AYGA 5AW7B 4EOWH 2YFOA 1JD7A 1I7ZB 4DGUA 4JE4B 5BPPA 5HHOB 4K94C 2HJLA 4XXCC 2R27A 4TQEL 3QJTB 4NRXA 4TL5A 5IHZB 3U79A 2GC7C 5CF3A 1YEDB 1GGTA 3JTSA 3NSDA 4DZ8A 1PZCA 1WZMA 4APQA 4QRQA 3BMVA 4IJTA 4KPHH 3UIZA 3G6JE 1RLWA 4P9ML 2EZ0C 5I1DB 1NGWA 2QL1A 2H26A 1UZ6F 3P4LA 2DMBA 5E2WL 4FQCL 4RWYL 2HRGA 4GPVA 3FH8A 3Q2NA 4WCYL 2E9WA 2DQTL 3L4WA 1IFGA 4NN7C 1CXLA 3A47A 1SEQL 4RIRA 5C0CE 4PRPE 5LAXA 1JTTA 2DBJA 4HS6A 2CIKB 2PP7A 1J9RA 4ODTH 4PWKA 2K7QA 3VXTB 3QR0A 3EDFA 3IMVA 2Y0SA 4FNTA 1QFWI 2ZIDA 1TVBB 2CE6A 3FUJA 3NFPB 4HCRH 3I3DA 1H15A 3QPKA 1HHJA 2WXFA 4ONHA 4Y19B 2CO3A 3HMXH 1KCKA 1FN4A 5K39A 1YUHA 4PRID 2JJTA 1UB6A 1XZWA 1B3JA 1KSRA 3SN6N 4FL4C 2YZ8A 3ZJAA 3MJ7B 4PV9B 4HCFA 5EO9B 4L3FA 3LRKA 5F9JA 2XPYA 4JAMB 2G3XA 4H1LB 1NKOA 1WFOA 2LU7A 4EMZA 5DR5L 2DQIH 4N26A 4J8RA 3L6FA 1UD2A 1WAAE 1KB5L 4QRRD 4I3RL 3AT0A 1SJHA 4ZMYA 3BKCL 3ML8A 3PLYA 5L6YH 1VENA 4B7IA 5IFJB 3CC5A 2YOCA 1CD0A 4LCIH 4JHWH 4ZMTA 1V7MH 1AAJA 2H0EA 3IPEA 3QFJD 5A2KH 5L9DL 2WCSA 4M5ZL 1F3JA 4AT6B 1KBWA 4EVNB 5D1ZC 4N5UA 1F2QA 2ZCZA 3AU0A 5E4EB 5BOZG 2J8UB 4ODUA 2WZ0A 4FI7A 2V5MA 4F7EB 2OSLB 2XT1B 3A5VA 3KL3A 4FS0A 5FXCH 4IRJD 4XP4L 4PJ5E 3L9RA 3MVSA 4K9JA 1YY8B 3ARYA 3D69A 1KENH 2AVFA 2CG9X 3O11A 3G5XB 3S6CA 3L13A 1JZIA 3E0GA 5EBLB 4J4PA 1IT9L 1TTGA 5JTWA 1E2VA 4GQZA 4FNUA 1OTSC 1QSED 2VM9A 4N2AA 3GPSA 5CSZA 2DQUH 2R9HD 4CDHA 4OBRA 5HDOA 1ZLVK 3KXFB 4KQ3H 4OV6F 1TJIL 4LF3B 5I28A 1MRFH 1U8PB 2JTYA 3T2NL 5J0BA 3DGCR 1OCZB 2LW3A 2ATKA 2LVCA 1WITA 2ZWYA 2WNKA 1K2DB 4CSTA 4Z8FH 5F3HB 5AAWC 2LAAA 1BM3H 3K6NA 1IBYA 4F8QA 5EOTB 3T71A 3FSWA 4L1HA 4NC1E 1T1YA 5ISZD 5E00A 3SBQA 1N0LA 5LCVA 4YSDA 2QDVA 3IDGA 4UQDA 3V5KB 3UTQB 4BKTC 8FABA 5SWSD 4BZ2L 4FHBD 4TNVK 2C3HA 1S9XA 1KJMA 4JKLA 1N7ML 1SYVB 5DUPL 4MAYA 2LLLA 3T0EE 3N0AA 2WNXA 4ENED 4XN7A 2WYZA 1FFNB 2WV3A 3G6JA 2XX0A 1SBSH 2I25N 4KX8A 4JFPA 5BZXA 4JQVC 4AXWB 3RWFB 4PM1A 3MODH 4KOCA 1E8XA 2NY2B 3OF6A 4ZUSB 3D05A 3NCYP 1A3QA 3ALXA 4FDWA 4X4XB 3V6BR 5C0CA 1QI3A 2OMZA 4PRPA 1JZHA 3CDFA 2PMZA 3IJEB 5IOPB 2XFXB 3K71A 1T1ZB 3KDMA 3NPZB 3GSWA 2Y36L 1F11B 4BCZA 5T1KD 3MR9A 4I0CC 4A7GA 4FLSA 1X5KA 3IGUA 4ETQA 3PE9A 2NXZC 1N18A 2PPCA 1A6AB 4ABVA 1KYUA 1O5PA 3HUJE 4PTUB 4FQLH 2HZHA 1FYTE 2AK1H 3PU7A 3GXMA 2DL2A 4L5FL 5GZND 1UM5L 3MBEB 4H88L 1DVTA 3VMOA 4ZUVA 4P46D 4BQ6A 4PB0H 1AGBB 3CXFA 4N9GB 3LHPL 4PY7B 3QZBA 5GSRB 4MA3B 1NGPL 1TKWA 3S5YA 3ATFA 3WIIH 2XWTB 5JW4Q 5D2NC 4J2QA 3P9MB 3QDMD 2W94A 4X9HA 4PIRF 3TO2B 1WAAA 1FVDB 3OAUH 3T04D 3LKOB 3AGWA 3RDTA 4CSZA 3TBSA 3TNNA 3ULVH 1CFTA 1DQIA 2V6HA 4I48B 4K8RC 2ICCA 3VDAA 4PP1D 4DP0X 4W9FC 4NPYB 5D96C 2W9EH 5IJVB 3DPBA 3HHSA 4L9LC 4U49A 5EN2B 4MD4A 3HNVH 4F20A 4FA8A 3ALWA 4C58B 3SDYL 5ESVB 1TIUA 1S9VB 4G43B 2EDOA 1OAUL 3V5HB 3ILQD 2C1PB 4RISL 1J87A 3ELAT 4JCMA 4J3XA 5DHVA 2B1AL 2ICES 4PJ5A 4XMKL 3FU9A 1JZGA 3GHPA 1UJTA 1SHWA 1BZOA 3AT8A 3UROR 1TVHB 5DQDH 4LEOA 2I5YH 3SKJH 2WN2A 2DQMA 2P5EB 4JFUA 4N68A 1MFBL 2RQEA 4PG9A 2EC8A 1F1AA 3S98A 4F24A 1PGRB 2Y1AA 3MRKA 4GW1A 5E2UH 3KPTA 1J88A 4LIQH 5B38G 2IWGA 4BQCA 5MP6L 2GI7A 3W0WE 2EYRB 3ARBA 3QZWB 1LEIB 5F7YC 3ZDYB 3KPSE 4TVSa 2GFBB 1CIUA 4GAJH 2GK2A 2VXVL 2FHCA 3P0YL 1LTXA 4OFQA 1VSCA 1NGQH 2XQBH 2ZUQC 2WD0A 1E9QA 1NCGA 3FPYA 1BXVA 3CXHJ 4GKSA 4K3JL 4M8RA 2KPWA 3QXAB 1WBZA 3V0HA 1TFPA 5F0PB 4NLHA 1EHKB 1TQWA 3ZY7A 3O0LA 1JZ4A 1PZ5A 3TZVB 1JF5A 2HLFD 4EI5D 2HB0A 3NZHL 2R69L 3UG5A 4X6CB 5G4MA 3ISWA 5GGUB 4B5EA 1OCWL 3C12A 3ULSB 4MJIB 2J6EH 4P23C 2N7BA 2OPCA 3T2OA 2H6OA 3FN3A 1ADQH 2WHVA 4H8HA 4JE0A 2HFGH 3DHUA 4PJXF 4OGZA 3ESUF 5B7EA 1H3TA 5CCKL 4TUOB 2PCXA 4LT7A 3UCQA 1SVZA 2QZ5A 4LLMA 4RSYA 5D9SB 3TJPA 1A3ZA 2UXFA 4MDIA 5IB4A 5ICZA 3VD7A 4MNQE 1FH5H 3HUJA 4JY5L 5ANHA 2F8OA 1FYTA 1ZRUA 3BQVA 3VVWA 1IGJA 2UYLA 5E0QA 3WY1A 2X2HA 5IV2B 4XCFL 3S36X 1WPCA 3PWJB 4JHVA 2YN5A 1TCRA 3MFFA 5BS0E 2RQ8A 4AW7A 1TOXA 3Q48A 4MVBC 5FEBA 4ZOCA 4BA8A 3EW3B 2YSTA 4CMMA 2V17H 2CALA 4OZIF 4AH2B 2GUYA 2PW1A 3BHBA 3C6LC 1PEZA 3QNZA 5EFIA 1PY9A 4DVRL 1SY6A 2P7TA 1JIBA 5C08E 1QYGL 3FXIC 1U2HA 5HGAA 5I8KL 4B50A 4ELMF 3KNBB 4Z3GA 4L2LA 3D2UA 2QSQA 1XVSA 5EPMB 2BZ7A 4HAKA 1UXWB 3A4EA 1H3XA 1MUJA 3U7YH 2Z4QB 1UXSA 5FECA 3FFCB 4NENB 1N3NB 3STLA 5IB1B 5ENWA 1NCWH 1FZJA 3QUML 4OZHE 3NK3A 5FYKL 2GITA 5GISL 1J5IA 1FG2B 1WD8A 2I9LB 2ALWA 4I18A 5DJAA 5E9AA 1KZYA 3DETD 4AE1A 2NMSA 2WXLA 3TYFB 1K8IA 4AUUA 1AR1B 7TAAA 3PREA 4P5KB 3UABA 2HVBA 4Z5RA 4GAYA 4CN1A 1VGKB 1LDSA 2A4EA 4OF7A 4WO4C 3LX9A 4PJIF 4GMTL 1CR9H 4NZTH 3FCSB 4XVTH 4GKZA 5IW3A 1L9RA 3FT1A 2CGZA 4LSPL 3MRMA 4HA1A 1RZJL 1F4YH 3ML9A 4Z7UF 4JFWA 2TRYA 1YEIH 1WBYB 4PRIB 4QRUB 4RMQA 3W0WA 4ELME 2EE9A 3CU1A 1OAYL 2FX8H 4XXDB 1U8KA 3SKNB 1MFCH 3QJHB 4JGUA 4U1MA 1NDGB 3EXJA 3KPSA 1DDTA 1TEFA 1BJ1J 3WELA 3EF7A 4DERA 4LOUD 3EOTL 4PJEE 4P9HL 4FNLH 4PFEA 4QRRB 4ABUA 3BFOA 2MNJB 2P80A 3WKMH 3GBDA 1MG3C 4B27A 2X7LA 3DBXB 3OWRA 4B53A 2CO4A 1RQ5A 1FNAA 3DX4A 4LHUD 4KWUA 4MA1B 3KPRA 5D71L 4XCCL 3DHMA 4YDMA 4HJUA 4EO5A 1E8ZA 4RMTA 5D7IB 5ERWB 5F6IB 1Q9WB 5D8JL 4MGXA 4Q74A 1A8ZA 2AEPH 3I6SA 4GP4B 4Y4FC 4ZXBC 3DVGB 3QAZC 1RAMA 2L0DA 4JFDD 3BGMB 2HCZX 1RUKH 2LR4A 1TZAA 4M62L 2ZCHL 2FGWH 4OLZH 2Q86A 2BMKB 3D5OF 4XPBH 4EI6A 1FO0H 4PJGF 3F12A 5EZLA 1U8IA 3KWUA 3T1WA 4UYQA 1BAFH 1B4TA 4CL7A 2E76C 4LNRA 4W9HC 2WZAA 1DQKA 1KYFA 5HHNB 4HGMA 5AW8B 5DHYA 4BWUA 1NDMB 4E9WA 1SXSA 4E9XA 4MNQA 4PV8A 1QSEB 1UGKA 3GXFA 4AEIH 2GHWB 2WBKA 2FLBT 4FABL 4EF3A 1T89C 3VH8B 1JPTL 5ALCL 2EYTB 4D9RD 2AAVA 5AW6B 5L2KE 5BS0A 1KIQA 4FADA 2BOBB 1H6TA 3NJJA 4NNYA 4Q58C 4WUUD 5E6IC 3F58L 3QW9A 3C5ZD 4WUKL 2BDNH 3BW9B 2NY0C 2CPUA 4DUXA 2HH0H 2VRAA 1SQ2N 3SE3C 3GSUB 1S4IA 3GBLA 4L29B 4URTB 5DUML 2E75C 3OKEA 2DYSB 5KJ4A 4DF9A 5ITBL 3S8GB 3K6IA 1MFEL 4M6NH 3CE1A 4RESB 2ICEB 2E9JA 2L7JA 1PD0A 4MCNA 2ZNWA 2NX5D 4WGWB 5E1AB 1USZA 1ZEAL 2DWSA 3QPQD 7PAZA 1PZ3A 4JKWA 5T5NF 2J8HA 3MLTB 2XKUA 4A63A 4Z3HA 1EVTC 5EEWA 4B9PA 2Z91B 2RTTA 5HGHB 2Y7MA 2BSTA 3W9EB 3GD1C 1J5OH 1AH1A 1IC5H 3RIKA 2H45A 4WEEA 4RBPH 1KB9K 2ZOOA 2Y6TE 1T1WB 5EEUA 4G6MH 5F7WC 4A66A 4MB4A 4OD3H 3VRLE 4OF0A 3SGDI 1ADWA 3QUZD 1OM9A 2ZYSA 43C9A 3KPLA 4R7DA 4IBSA 3TBWB 1WHOA 1LMIA 4DP7X 5MI0B 5LBVA 2F54E 2C8NA 2H32H 3JT0A 5CLYA 3W56A 3SO5A 1JZ7A 1HWHB 2VE6B 1G6VK 1S9YB 2IADA 4MX7A 1TLKA 4ELMA 1G7MA 5AW0B 3V4PB 2ED8A 2VDQB 4OCRL 3U4BH 4P46B 2VR5A 2ZAIA 4C83A 4CJ1A 4RAHA 4LVNB 4PB9H 2VXQA 4Q6YA 2IGLA 1I31A 2PWHA 4Y0GA 4B96A 1DEEA 1IX2A 3DXAE 3SPCA 4BIKA 2RB8A 3OSVA 3U4EB 3HMWL 4PJEA 3P4MB 4U3CA 2OXGB 4PP2A 4AJVA 2PLTA 4IBWA 2VIRA 4Y4HC 3LKPB 4ZS6D 3VQ1C 2DPKA 2DQJL 5KVDL 3ULVD 5HHQA 3F7VB 3RVUC 2NY4D 4NRZB 1MFVA 2QVTA 2O5YH 5KS9B 4BZ1A 2Z0UA 6TAAA 1JGVH 3S2AA 5LQBL 4NC2B 5J4MA 4PJIA 1MY5A 2GTZA 2NYKA 2V7HA 4WHCA 5DJ6B 4U4IA 4XXWC 2BERA 2X4PB 3CJJA 4HFWA 3FKUS 3X11B 3I6LD 2NCMA 3LZNA 4QRSA 5FGBC 7CGTA 4HCIA 1S7XA 5FB8B 4AYBA 4YAQA 1HT6A 3ZE1F 1NM9A 4FQJL 3BKJL 1KBGL 4PY8J 3C60B 4FZ8L 1NAMB 2D3LA 2AK4D 1M2OA 4UQ3B 1IVLA 3WFZA 4Q4EA 3O4OB 4DOHB 1MFAL 2VC2L 3RFZA 2WMPB 3MRLA 4F57H 4UB0H 3V0IA 5H8DA 2JSFA 1G84A 1HL9A 3QIBC 1X5GA 2XY1A 2YK1H 3QEQE 1KLGA 1OE3A 5BO1L 3O3BB 5L2KA 4W9IC 3BZFA 4LHJB 1ORSB 3SYOA 2FX9H 1SJMA 1W6LA 1AO7E 1Q94A 4J3VA 4QXUL 3M6DA 1U8LB 2IWKA 3DV6B 3D85D 2GK0B 4H40A 3WFDL 4PRNA 2FECL 5TE7H 2JE8A 4AQAB 2JJWA 1DUYA 1NL0H 2XRAL 1N68A 3QJRB 4WDIA 4YGAB 1LDPH 1BFVL 1WS7A 1T0OA 2PR9A 5IOKA 3E6HB 3SGEH 2AXFA 2DDQL 5FDWA 2HMID 3L81A 4J3UA 3R06B 1INDL 1UFUA 4H1LH 3HPJA 1HXYA 3JZ7A 4NHUB 5I8CA 4IBLT 4JQIA 3C9NA 4EI5B 3QXDA 1PX4A 1KPUB 3N40F 2C3VA 4HU2A 5GGVH 4BKLA 3D7PA 4I2XB 3ZE2F 4N87A 1HZHL 2WQWA 1YEGH 2R1YB 3FN9A 3TT1H 5IM7A 3SE9H 2NW2B 3KGSA 3OAZH 4B3VA 1MXDA 2C9QA 2ITEA 2L8AA 4NWUL 2YSSA 4L0ZA 2VLJD 2F18A 1RJLB 2ZJSH 2F1BA 2BVEA 3HTLX 4JVPA 4K2UH 5GRJL 4JANB 1P1VA 5ACZB 5F2FA 1PW3A 4N8VB 1FHNA 1T7ZA 3PHQB 4PD4J 2BNUB 5DT1H 1JGUL 3CAFA 3QEGH 3HN3A 3FFDB 4YBQC 3HB3B 2F54A 5FUZH 2JB5H 2FEDC 4PV1C 4NSKB 5DC4B 1WE5A 2BS9A 4B3EA 1VCAA 1XH0A 4OQ1A 1F6AA 3L4UA 1OAQH 3L4ZA 3N40P 4IGBA 3TONA 3Q0HA 1CXFA 3PHOB 1KLUB 2VL5B 2OW7A 2WINB 1YMME 3ZL1A 5B8CA 1CGUA 5HDWA 4U1IA 4AJWA 1MEXH 3MBEC 3DTDA 5PCYA 4C4UA 2X4OB 2AFNA 1ZS8B 3P40A 1PIGA 3DXAA 3ARGB 4N9OB 1MJ8L 1NOLA 4K5PA 2BLFA 3OMZA 5GGSY 3LIZA 3V79C 2EJ1A 3ZE2E 3B2DC 2F0CA 1C12A 1JPFB 2WK2A 2WCGA 3PXHA 4JPKL 4JKNA 3DYMA 3FO2A 1BXUA 4FNSA 3R7QA 5A3IC 3EGDB 5ICXA 3MNZB 1HJCA 4P07A 4UUJB 4CC4A 4PJ7B 5DGRA 2F53D 3AWEA 4JFHE 1MCJA 4M7ZB 5DZPA 3QNFA 1WK0A 2Y6SC 3G6DH 1ZT4A 3P0VH 1PFCA 2X0VA 4AIZB 2BRRH 1J05A 2CIIB 2FSDA 4TUJB 3F01A 1SDDA 5FYLD 4M8UA 4MDRA 3C6SA 1VGEL 2YD6A 2X5PA 3CZNA 3HFMH 1DHKA 4FX5A 5IEKA 2ITDB 3ZDZF 1KN4L 3O45B 5CWSB 1V3LA 3O41A 4X6EB 5FUCC 3FTYA 5D2LB 1DBBH 1NIAA 3LRSB 2Z7YA 4QXTA 4XVUD 3UDWC 3V9EA 2WP3T 4L1TA 5L8LB 3A24A 5GJTL 2NSXA 5GZOD 3U9PH 5DYFA 3ES6B 4BGLA 4K3DL 4QHUB 3QEQA 1I8KA 2MKWA 3RAJL 1A3LL 1C5CL 1EA9C 1IFHH 3TN0B 3M17A 2HA1A 4OM1L 3LHAA 3I2CL 5DMIH 4F9LC 3JV0A 1AO7A 4M43H 4L3CB 1KFAH 4M5YL 1OGSA 4PJBF 4RFOL 3WS6A 4EDXA 4G71B 3W39B 1G87A 2YLHA 4DH2A 4YSQA 3KW7A 4AIXA 2Y4SA 1BXAA 1UZ8B 2FQDA 3R4DA 3RPBA 3N9GL 4L4TB 4U6HA 1D5MA 1ICTA 1AHMA 2V5SA 3QFDA 4PI2A 1F86A 3IGAA 3BDYL 1KPRA 5JUEH 2WTOA 3S88H 1IAKA 3DJTA 3LVTA 3QARA 2RGSA 3GGWB 2WNGA 4QXGL 2IAMD 3OKNB 4YWGL 2CLVB 1XSIA 3TEZA 1N70A 1ID5I 3QHFL 5TFSH 1LO3L 4EZLA 4FQIH 4X5WA 1BLNA 2ODIA 1BIIA 4K4KA 1D3CA 1GIGH 3BI9X 2HTKC 3BKYL 4JPIA 2KS0A 3V0VB 5JHDE 4P5SA 4JL1A 2BWQA 4HPHA 1SY6L 5TE4H 5K33A 5EBMA 1UA3A 1H19A 3OGCB 4G1MB 3VRIB 2EIMB 2LFEA 3MA7A 2D7OA 3HLAB 3QXUA 1TZIB 3KJ6L 5EIIB 4GKLA 2GSGA 1HH9B 3IFLH 4YFLF 3OJVC 4HUKB 1E6JL 1GHFH 1G7JA 2D4DA 5IJKA 1AHKA 2DLEA 4AMWA 1DLFH 1YMMA 1OOAA 1HOCB 4NO2A 3MCKA 3PL6B 5AYQA 1QLFB 4P2QD 4O51A 3BP5B 5BOPA 4WUUB 3KYKL 1S7QB 2RBLA 2HRPH 4U1JB 4ZFZB 1AXTH 1WO2A 3LN4B 2H6PB 4NBZB 5I1IH 5C0FA 1DR9A 2B77A 2X4RA 2CDGA 2IPKA 4MQSB 2NX5B 4DIXA 5FM8A 2JKRM 4E9SA 1HI6A 1JK9A 1JZEA 2VR7A 4Q9RL 3IFNH 3O4LB 4ORZC 1CE6A 2WVVA 5KOMC 1E4XI 1EUUA 5F7EH 4FQQB 4XZUB 2IH9A 3N43B 3NDZE 3SD2A 1YYMH 1FAIL 4XBGA 3I50L 3PQYD 1LO0L 3LQMA 5LGJB 4XNXL 1WZ1L 2R0WH 3BIKA 4GKNA 2R29A 4XMZA 2DMGA 5DK0A 3L5WB 1AR1C 3U82B 5JO5A 3VWJA 2I32A 4PCKA 2B9AA 1ED3A 4XMLH 5J1SC 3K8MA 4ANWA 5J5EA 2RAMA 4XMTA 5JW4R 5CCJA 5D7LD 5EU4B 3UTPD 2P5WD 5FCSH 4JRXD 4AOFA 3Q7JA 2XQYA 3MRPB 3LKNB 3PABA 4TNVF 5J6SA 2NDGA 4LRNH 1MWOA 3EFOB 3NFSL 3IJ8A 4O4YH 1LO4L 1ZLSL 4KTEH 1S3RA 2FT6A 1KCWA 5EOQL 4J5VA 4XB7A 2GT9A 4JQXA 1A2YB 1GC1C 5GS0C 4R4ND 1A8JH 1AS8A 4WHDA 3NZ8A 1B6UA 3EBIA 1WWAX 4JPSA 4TOYL 4LESA 3S97C 1OD9A 3ZUNC 4ZX6A 3IVKA 3HR5B 5E8DH 1YEKH 1UGNA 3WJJC 4GUQA 5DO8A 2HKFL 5DD0H 4PJDF 3APFA 1F97A 1TSRA 3QO0B 4ES9A 3KLKA 4WHYH 1MCPL 3NYKA 1IBFA 3RFRA 4HWEH 4FTVE 2BVUA 3P3TA 4QCIB 1QFUH 4AGMA 4YXKH 1M57B 1N19A 4MA1C 5TE6L 4LAQL 5J56B 4RGNB 1IC0A 3VFRA 4M7LT 2E74C 2VAAB 5F71A 4YBLB 4ONOA 5F6IC 2CDFA 4WJ5A 3SPJA 2QSVA 2XWBA 2F08A 4F7MB 5JHDA 3OR6B 3GHEL 3OSKA 2AXGB 1G5GA 2DLFL 4PBVC 1XF1A 4S1QL 2Y5QA 4JZOA 1OPGL 2GPZA 2D03H 2OQJA 5DEZA 3UPRA 4EKXA 4UT7H 3DSFL 3IEAA 4ZUUB 1MWAL 3VAEA 2VDPB 1YMHB 3JWOC 4IRJC 2YAOA 4LPTA 2WLLB 2R1WB 3ARZA 2MQ0A 4H0GA 4LLDB 3MRDB 1J5DA 5EU6E 4KQ4H 2ESVB 1A4JA 2ADIA 5DDHA 1OM3H 5AOJA 4N2DA 4PJDE 3GJFK 1MIEH 1OTTD 2R9HC 2Z8RA 3L4YA 4WNQA 2E9IA 2K0RA 2QPDB 5JQ6L 5D7JA 2FB4L 3TBYA 2ZP8A 1DFBL 3DGGB 2Z8WC 2DQFA 3T4AB 3V52L 3QDJB 4PWIA 3BSZH 1F3RB 1BZ7A 1GC1H 3CDGA 3EYFA 5DRXB 5GS0H 1MCNA 3LEYL 1HEHC 3VFSA 4N0RA 5HHPB 5E9DE 3SE4C 5DSCB 4ALAH 3ZYOA 5F7HA 4U4BA 5TDPA 3FYIB 2EDBA 4YLCA 2OZ4H 5FDYA 2VDLL 1IKNA 2J2ZB 1CF8L 2MMXA 4Z3EA 3REVB 4KY1L 3CHPA 4NO5A 2ICEC 3SQOL 3VX1A 2LU5A 3U6XA 3AACA 3ZSSA 1LE9A 3JTTA 3SY0B 1FZKA 4GO6B 5E51A 2H3XC 3S34H 3FQ1A 4XMPH 1BWMA 3NIDB 4ENEC 4P5MB 1ZLEA 3U6RA 1K72A 3VFUA 5DFVD 2VXQL 3DX3A 2OTUB 2CRYA 1HQ4A 1CO1A 5K93A 3VFTA 4Q9CA 1BREA 1QBLH 2IO5A 2XNAB 5L0QB 4IOSA 3ZKND 2DQDL 4OSUH 1FFRA 3MMEA 4ZAKB 4ZMNA 2VKWA 3ZRCC 2K9FB 5CJXC 3QIWD 5IMKB 5KBLA 2DYPB 3CSFA 3MRJB 4N2BA 1G7HA 5C0BB 5J1AA 2XWZA 4F7CA 1RFDH 2V2XB 4QRPD 4JO1L 2ZXCA 3S4SA 4YDIH 1IBHA 5MI0C 4JRYD 3RIFF 1UCTA 1W8EA 3UTSB 4M1DL 4IDJL 1BVKB 3HRZB 2WBWB 3V4LA 1RIUL 4P3DA 3ZMEA 1C9SA 5GZNC 4LCWB 5F7UA 1U6AH 4P46C 2XI9A 3CZLA 5CEZH 2UZXB 4JFSA 1TO5A 1OPOA 3CSPA 4GIOA 4ODSL 5BCAA 1Q9LB 4LLAA 4LVNC 3OLIA 2X9WA 4TUKL 5EBGA 3UGUA 3WEXB 3MV8D 5KVGH 3RDJA 3ZQWA 3FTSA 4BSVB 4FD0A 3L1GA 1XCWA 5EN3A 3RGVD 1MIML 1YZZA 5GRVL 1KFGA 4FTVA 1R34A 2EIBA 4O02L 2Y7LA 1NUFA 2ADJB 1J9SA 1DBMH 3PGCB 3N85L 3FO1A 4PP1C 1LK2B 1J0IA 4B9KC 3PHAA 4KK8D 4JM0A 2FE0A 5C9KA 3O2WH 1JXFA 4DKTA 3RKDD 1E5UI 4IRSA 4YSAA 2APXA 5E1IA 1G6RA 2F74B 4LU5L 4WFEE 3U7WL 3ILQC 4Z6AT 1RHHB 4DO6A 1RURL 2XIDA 4WW2A 4QRFA 1FFQA 3BGAA 4DP1X 5CJ5A 4FQ1H 4P4RB 3DYPA 3UEZA 5T3XE 3ZRSA 4LKXB 1T5WA 4LARL 1HNYA 4CW1B 1YJDC 4QF1B 1QFHA 1XCXA 4IS6B 4LQFL 3VWKA 1ILSA 5EU6A 4DP5X 1MAMH 1AGFB 1IAOA 1ECZA 5IGXH 4A2LA 5FW8A 3O4OC 2AW2A 4PJDA 1NEPA 1AVAA 1FSKB 4XH2A 3T0DA 1HHIA 3RL2B 1GGIL 3ECWA 2F58H 2ITCA 3VGEA 1KJ2B 3CK0L 1GYCA 1P5VA 5J9PA 1A4BA 3IM1A 2YR3A 5I6PA 2DBLL 4HBCH 4ZS7L 3TIEA 1QA9A 2ICWB 3HPLB 3EFDL 3Q43A 4G8IA 1CT8A 4R90H 2MCAA 3V4PH 2VDQH 4MKMA 3T09A 2CBOA 3QP3A 5JORB 1ZY9A 3FQUB 5E9DA 1VDGA 1A22B 2Q7AA 4JFOB 3IJYB 2Y7NA 1NAKH 5BZWA 5KG9A 1QACA 4FQHA 1WIPA 1YDPA 3KCPA 3US0A 4PIBA 2K7PA 4DO4A 4PR5A 2HLFC 3NIFF 5FYJL 4EI5C 2BVOA 1YECL 2Q10A 5IFAL 4ZFFA 3WHXB 12E8L 4GEJA 1HCZA 1S7SB 3ECBB 3PHSA 4R0LA 1DJIA 1OLLA 1U8CB 3LIZL 2DWDA 5DLLA 3UTOA 1E4XL 2EXWC 1WC7A 1WWBX 1P9MA 2NY3B 3Q8FA 3VMPA 4Y4KB 1EHXA 2HJKA 4OIFA 4KKCC 4QR7A 5SX4I 3FW6A 1ND0B 1OB1A 1AQDA 2X4UB 2ZKXA 1Y18A 5HJBA 4WU7B 4HPOH 4YFLI 3BVUA 1TMCB 2EDWA 4MA7L 2A73A 1DBAH 4CN4A 3GINA 1CLZL 1TEYA 3PUUA 3HB3C 4FN0A 3ZQXA 4NX0A 5I17B 2DLGA 1EXUB 4LGRB 2AJSH 1QHPA 5K9KA 1Q4NX 1D5BB 3ILPB 1A7PH 1B88A 1KCVL 1JZFA 5FW7A 2OP4L 3C5SA 4P2CG 5I30L 1KEML 2P8MA 3MV01 1KJ3L 3KBHE 5CS7A 2GSIB 1DO5A </