3G7TA

Crystal structure of dengue virus type 1 envelope protein in the postfusion conformation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
397
structure length
379
Chain Sequence
MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVDRGWGNGCGLFGKGSLLTCAKFKCVTKLEGKIVQYENLKYSVIVTVTTEHGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGETWNRQDLLVTFKTAHAQEAVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGISYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLVTANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein
publication title Crystal structure of dengue virus type 1 envelope protein in the postfusion conformation and its implications for membrane fusion.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
total genus 56
structure length 379
sequence length 397
ec nomenclature
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3g7tA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 3g7tA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 3g7tA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 3g7tA03
5H37A 5IZ7A 5LBVA 5GZOA 3UZVA 5GZNA 3C6EA 3UZQB 1OK8A 1S6NA 4GSXA 1UZGA 5AAMC 4AL8C 4FFYA 4UT6A 3IRCA 5JHLA 2GG1A 4FG0A 5IREA 4X42A 2JV6A 3N44F 5KVEE 2I69A 4FFZA 1Z3RA 2JSFA 2ALAA 4UTBA 5JHMA 1RERA 3UAJA 5B1CA 4AM0Q 3J27A 1ZTXE 3MUUA 2V33A 1PJWA 3G7TA 5KVDE 2P5PA 3N40F 5AAWC 2H0PA 2R29A 2R69A 1SVBA 3WE1A 3N41F 3UZEC 5LCVA 3I50E 1URZA 3N43F 4UTAA 1OKEA 3UC0A 1Z66A 5KVGE 1TG8A 3J2PA 4UT9A 4BZ2A 3P54A 4BZ1A 5KVFE 3VTTA 2HG0A 3UYPB 5LBSA 4UTCA 4L5FE 1OANA 2JQMA 4ALAC 3C5XA 3N42F 4GT0A
chains in the Genus database with same CATH superfamily
5ILTL 5EBLA 2CSPA 2V6HA 4XP4L 4ENED 2HVJA 3QDHA 2APWA 4L8SB 3D51A 4FG4A 4JG1L 5SWSB 3VXMB 3LMJH 4GAJH 3CVHA 1MKFA 2V9UA 4E9XA 2V2XA 1AQMA 2CBTA 2XFXA 3L9RB 3LN4A 5DD1H 3SQOL 2UX7A 3VI3F 3CQFA 5E00B 1LQBC 4X4ZA 1L9OA 1I7TA 4NLAA 1F4XH 3DBXA 5ABAA 5BZWA 5I18H 5FYJD 1MRDH 5AVVB 3D0VA 1EEYA 1O9ZA 4F9LA 3OX8B 4YHPB 3D85A 4DPAX 1RCYA 1DANU 3I3BA 2XX1A 5D96B 5K39B 2CHZA 1VZIA 5DJCB 3TZVD 4DFIA 3SKOA 4FP8H 3MOQA 4AGPA 4TQEL 3ZJAA 1IGFL 2FYYA 2O5ZL 2P43B 4K2UH 4QKXB 4KV5E 4M9PA 2PF6A 4HU8A 1OP5K 4A7GA 5ESAB 4ABUA 1CBVH 2AQSA 1JOIA 2O61B 1HH6A 1DQKA 2WZPA 2UYLA 4C4KO 3IJSB 2YHGA 1HC1A 1QWHA 2GPZA 4QAMB 4X6CF 3RBSA 4QTHB 2LU4A 2Z7UA 4X99A 2VR8A 2V8LA 5IESH 3PABA 4L9LC 5EOCH 4U1IA 1QUNB 1N26A 2CLVA 3SGJC 4UCFA 3UAAA 3VGEA 6FABL 2VLRB 3AT9A 3S9DB 3Q44A 3N85L 3ECWA 1CT8B 4W4OA 3VA2C 4HKXA 3QZNA 1E9QA 2W60B 4AXWA 5EU4A 2B59A 1ZT1B 4AEEA 2R4RH 2I5YH 1IEBB 4HKBA 4LL1A 2C4XA 2UY6A 3ARDD 4Q89A 3BPNC 1MLBA 2ROXA 1BD2D 2XN9A 2CDFA 4I77H 1G9NH 4MX7A 3V10A 3MO1B 1F3JB 3ZZQA 4ODBD 3W37A 4W6WB 2DQHL 1H19A 1XCTB 3VE0A 1ZDQA 2VRQA 5EWIL 3EYSH 5GGTA 2M1KA 2PO6C 2YPKB 4NT6A 3ARVA 3PQYD 2IFFL 4OGQC 4LE8A 3KDPB 1AZRA 1WC7A 1M71B 4K5PA 4P2QE 5C09B 3NYKA 4Y16A 1JP5A 5ECGA 2X09A 2KPNA 1BXAA 1U3YA 2CZNA 1J0YA 2Q76B 2YRBA 2VLKD 1T5WB 4KO6A 1QSEB 2Q1EA 1IE5A 4Z3JA 5IT2H 1WBXA 1JHLH 2DMGA 4S0SD 5HI5D 1KIUB 4ONFH 5HHQB 4CJ0A 4Y4FC 3GEWB 1HESA 2BXZA 1CF1A 1IGJA 3TJPA 3FOLB 3VYPA 3U0WL 2AJ3B 3JTTA 2KMWA 1JGLL 5E70A 4GXUN 3H9SE 3CFQA 3L13A 2HJFB 3A23A 4P5MB 4JFTA 1TJXA 4MDJB 2N56A 3Q2VA 5FM8A 4KK8C 5IBUB 5IQ9A 1HZHL 5F9WC 4YXKL 4RA3A 35C8H 5A7BA 1TMCB 1IAOB 3FQNA 4ZQTA 2C34A 1VFAB 4ZUTB 2OCJA 4B0MM 4UM9B 4N8PA 4LVHB 2BW5A 3AXHA 5TQ0H 4HKJB 3UCQA 1BPLB 4OQTL 1CLOL 4FFYA 1SLWA 1V10A 2CLZA 1AQKL 1LE5B 3H8NA 1JZ4A 4X6BB 1TLKA 5HGDA 5EBMB 2E3VA 4FQLL 4GXVH 4IHOA 2XETA 4G8FA 3KPPB 1D9KC 2QR0A 3MHZA 4L2YA 1C16B 4J4PA 2F08A 4PJ5B 1GGCL 2QV4A 3TM6A 3NTCL 2NY2D 2VDRB 4NKQB 1NGPH 1HFUA 3CSPA 2ZOOA 1KDIA 1E28A 4ZZFA 2FGZA 3FMGH 3LKPB 2TRYA 4R96A 1VA9A 4X5XB 2X28A 2NSMA 3UROR 4FEMA 2FWSA 1I9RH 1XEDA 3H7LA 4KDVA 5HY9A 4ZMAT 1K4DA 2C9PA 4QUOA 5FKPA 1T4WA 2AJUL 4N8CL 3DXAB 3NJKA 1MW3A 3C2AL 2VZTA 1E6OH 4A2HA 1YUHA 3HC3H 4FMVA 1OWWA 2WLLB 2GHZA 1MPAL 3HUJA 4GQPH 5FLUA 1BA9A 2VZOA 4HAFA 4A6YB 1JTTA 1MFCH 2DTSA 3SKJL 1G7LA 1U9KA 4O02H 3EG9A 1MAJA 1U95B 1UWGH 4ZMZA 3S36L 2YAHA 4CN6A 2WZ0A 3NCMA 2GCYB 1NCAH 4FADA 3SYCA 2B1AH 3IDIA 3HR5B 2AV7A 2FRGP 4POYA 3I02B 4RMBA 2YD0A 4LDEB 4LIQL 5C2UB 1OSEA 3DHPA 3NJVA 1FYTA 1I8IA 4WI0A 4GMTL 4CVWA 3OXRA 1JD7A 4NQCA 3ASWA 5JW4N 4OZIE 4WFGE 2A6IB 4HX1A 1FP5A 4FS0A 3OLGA 2CAKA 3GKWL 2HWZL 1TVBA 4P2CG 4AGQA 1OF2B 2F19L 4CVUA 4BDVB 3QXDA 5IOPB 3FT3A 3CIQA 3X11B 3MLXL 1X5ZA 2WVTA 1JFHA 3BDBA 4JPQA 2EXSA 3D25B 2J8HA 1R3IL 1JNNH 1YDPB 3MODL 1P84K 2H9GB 4IEFA 4QHMB 2EVFA 4IGBB 1W8OA 2P24A 3T08A 5J11C 1S9VA 3C5XA 3BZEA 3KYOA 5INCA 2QKIB 2R15A 5L8KB 3KHQA 3QJFB 1N6QH 1OQXA 3VDBA 1PEWA 1NCTA 1T1XB 2CG9X 3G9VA 3FN3A 3H7BB 5FCUH 4XB3A 4YDJB 2YQ2A 4HEME 1DSYA 1FNAA 2ENQA 4HSQA 3V0FA 5JNYB 1W0VB 3EDFA 3T0EE 2NXZD 5HGHB 1IIIA 4GG6A 1MHEA 2WTRB 1I1AA 1ADQH 1DJXA 2CO7B 4FF9A 1UHVA 4H1LH 4WK0B 3RLSA 5CCGE 1U8IB 4MB5A 1CDYA 1JWMA 5DRNA 2XG4B 3EJJX 1QW9A 2WXQA 2BLFA 1NCCH 1Y18B 2KZ1B 2MTPA 3BD4A 3G6AB 3IDGB 4YDVA 1MFAH 2WMPA 1OAQH 5AW4B 4EBQH 2ZCKL 5AD0A 1J5OH 5HVWA 1WHOA 4RNRB 4HLEA 2AGJL 2O5NA 1WA1X 3ZTNH 3SEPA 1SDDA 1A6AA 3ARFA 3U4EA 1GGYA 3UTPE 1PY0A 3AS2A 1T1ZA 3FL7A 1BFVH 4OIIL 5GGVH 4Y0GA 3HE6C 2J8UB 5KVFH 1OAKH 2B1OA 1UB6B 2MOVA 5IMMB 5I0DA 1X5AA 1BF8A 3QFDB 3FSWA 3ILDA 4M5TA 5C0CD 4MMYB 3P69A 1FLTX 5DMIL 1VZGA 5DQJA 3VNYA 3P9WB 1NAML 3TWCL 1O7SA 5I16B 1UOVA 4WFEE 3VXPB 3BMWA 1KJ2B 1QD0A 2F8IA 4KQ4L 1TJIL 4R7DB 4Z3GA 5I1KH 3QPXL 5DJ8A 1YN6B 3GBEA 4DTGL 1TQWA 2BRRL 1BXVA 3NIFE 3K4DA 5DUBB 1BZQK 1SJXA 4Y1AE 2BJMH 2FEEI 4MYWB 3S35H 1PZ5B 2ICWJ 1LL1A 1SYVB 3GSXB 3PWNA 5IW1A 2V9TA 2FH6A 4L0PB 1AP2B 4G7YH 4FKKA 3OQRA 1QBML 1F6AB 2PPEA 4X4XB 2AJVL 3AG3B 4RBPH 2CUMA 4GPVA 4PWGA 5KJ4A 5DZOA 4MFHA 4PRHD 3RJOA 5ISZE 2E27L 4KC3B 1FDLL 4OJFH 5ITFB 5F7UA 2EP6A 5F7KC 1SF5A 3CXFA 3OWEA 1J0JA 1ZWIB 4N3UA 4QF1B 4JPIA 2J4WH 4R26L 1F42A 1BQLH 4NKDB 2OR8A 4WWPA 3TA3B 3TEXA 3BIAX 1ETA1 1ZLVH 3BUYB 3V79C 3EHBD 3CQQA 3H53A 3Q6FB 1J1PH 4XCCL 1NMCC 4OGYH 3JV6A 3ZRCC 1KXTA 2C1OA 3R19A 1FZMA 1ILSA 2NY0B 3HB3C 4C83B 4JZJC 2BCKA 4OM1H 3MLTA 2R2HB 2WUCH 3D34A 3N1PC 4KXCA 3CX5J 2DAVA 2YARA 1ORSA 4QNPF 5F1IB 2BNRD 2OP4H 1P6WA 3O9WB 3GPEA 4PRBB 5FB8B 1ZLSL 4RMQA 2JNZA 4GO9A 3UL4A 5F7EH 5L7XH 1J9RA 4X9FA 3EYQD 1SOQA 4BKSC 1UXLA 5LAPA 5ALCH 3T5WA 4IIQB 3X3GH 1QMUA 4Y4HA 1X7SA 2IPUG 4N22A 5CKGA 4HMDA 3IKCB 1FF5A 1OWRM 3ZYIA 4BJLA 3KPRE 5ABZA 4LGRB 2XSKA 3S7GA 1RI8A 1IGCL 1AZBA 1KBGL 2I7SA 1DVUA 5E99L 3GSUA 3X2QB 4A7TA 4M56A 3L1FA 2F5BL 2K6WA 4XGZA 1TPXC 5IB1A 4LRIA 3MRKA 1DQJA 4HPYH 4ERSL 3CXDH 1JV5B 3DURB 3ZKXB 2FEEL 2V3DA 4J12A 3QR1A 4H13C 4QCIA 2DICA 4Z7QB 2Y69B 3ECUA 5JOPD 2CM6A 4XPAL 4XNQB 4XNUH 5J57B 4BKLB 4Z7UE 3LRMA 2Z65C 4JG5A 1JZIA 3EFOA 2BSEA 3D3VE 1TJHH 1M1XB 1XSOA 4GG8B 5JDSB 4P4KB 1EFXB 5T5FH 4P2OD 1BMZA 2HT4D 2BVTA 5HYJB 1RZKH 1YQ2A 2ED6A 1OB0A 3WY1A 2HX9A 5I8KH 5IBLC 1CDIA 5D7KD 4Q9RL 2Q8AH 1MVUA 3WBDA 3WJLA 4BWWA 4E41D 4FNQA 1F00I 1S5IL 4LAJH 2OV0A 3TNNA 3I84A 3QRGH 3HPLB 1DVYA 5F70A 3WDIA 4GIAA 4NKIH 4OJCA 4QJ3B 5I8OL 4J6RL 5H35B 1R46A 2ZSVB 3B83A 5FYJU 3VD5A 3BUQA 4S0TD 2E7BA 1OSPH 1RK0A 3FRPA 5FK9B 2RIKA 3P02A 5TE4H 3KWTA 4ILDA 3E1ZA 2ZT9C 4JANA 3CU7A 3ULSB 4LSUL 3SKUD 2I24N 3PGCB 2YA2A 4OVVA 1FPTH 4NZTL 4KGLA 3QUYB 4PJBA 3V8OA 1JGDA 2Q6WA 1T83A 2IDSA 3D6GA 4V11A 2X4SA 3CDCA 3MJWA 4ATTA 3L3HB 1SRDA 1FCCA 1UFUA 2G3MA 2X2UA 4Z7OF 4UV7L 5DJ0B 1XCWA 4XP5H 4P3WA 3FB6A 3BSZH 3AROA 3F05A 2WQWA 3RIFK 5KUKA 5C08B 2GI7A 1WS8A 5EC2B 4M43L 1IC4H 7PCYA 4MAUH 1ONQA 3WIHA 4GSDH 4LLYA 3SDCD 1PSKL 5E7BA 4TS6A 2Y1YA 4XPGL 5B8CC 2B20A 4QRRD 1IQDA 5ACZB 2BIQA 3MRLA 4XHJD 2LGNA 2Q7YB 2UZPA 5FGSA 1QRNE 4GKSB 4QRPD 1W6LA 4M7ZC 1MF2L 5CGTA 5T1KB 1B4JH 1IZKA 3Q7JA 4HLJA 3F58L 1I1FA 5HYIA 3S48A 3OKLB 1MW1A 1THAA 4EI5A 2SEBB 1MJJB 3MRBA 1JPTL 4TRPH 3K6DA 5FAAA 4N2AA 3FW6A 2AEPH 3QNFA 3T0BA 4LSPL 5BUGA 5FEBA 3KPMB 2Y22A 5EBLB 4YEFA 2QSCH 5AW9B 2HVJB 1DJSA 1SFDA 2XQYK 5I8EB 3SE9L 3CVHB 4JFWA 2V2XB 3WNLA 1UH4A 4BZ2L 3LN4B 1NCWL 3T0DA 3HAEA 2VLJE 1MCJA 3CPLA 4H25A 1QKZH 1MCQA 4P3DA 3IDXH 4WW2C 1I7TB 5TFSH 3DBXB 1CGUA 1GGUA 5BZWB 1Z3RA 3TO4A 3D0VB 1EEYB 5B3JF 5L2KD 2WOBA 3D85B 3HG4A 4G9DA 4PGBA 4HUWA 5K93A 2VDQH 3KLHC 3SKOB 3CZEA 5CEZE 3OSVA 2JKIS 5DZJA 2RH0A 3GSNL 4GLRH 3KPLA 4OZGA 2FYYB 4PGEB 5T33L 5CKAA 2F61A 4HCRA 1F41A 2DH3A 3VI3E 2NY7L 2K9UA 4QOKA 1U3HD 3QBTB 1YMMA 3ZMEA 2XQYA 1IC7H 2DF3A 4OLVL 4BFIA 1M53A 1L3NA 2RMNA 1M7XA 1XSKA 2Z31D 1HH6B 3Q8AA 5LBGA 4AIZA 2HFGH 3BE1L 2BNQD 3QQNA 4FABH 1OL0A 4X99B 3TXAA 1AOZA 2HJKA 1E4KC 4H44C 1NEZG 1JRHI 3NZHL 3PABB 2BP5M 3B7YA 1Z5LA 4U1IB 1QSVA 1RUQL 3KYMA 3BP6A 2CLVB 1NH6A 2YBRA 1DDHA 2NNFA 2XTSA 4WDIB 3HRPA 1F4YL 3JQOB 2FX7H 5B21A 4IRZL 3VVVA 2LV4A 1SBSH 4JO4L 4LSTL 1EK3A 4J7RA 4AYGA 5CZVL 4YE4L 4HKXB 5SX5H 1E9QB 4AXWB 3G5ZA 4HV8A 5EU4B 1Q9OA 2B59B 3GHEH 1B0RA 4HKBB 4JPVH 3SYOA 2ZXWB 2UY6B 4KX7A 6PAZA 4GRMA 1MLBB 3QVAA 2XN9B 5DUJA 2CDFB 4MX7B 3KHOA 2AHIA 2VUOA 3QUGA 1S8DA 3C6LD 1I75A 2KKQA 4RDBA 3VE0B 3NDZE 1MHPL 1IGTA 1CGVA 1WP6A 3EUUA 4NT6B 4TVUA 1UOWA 3G6DH 5C8JA 1T66D 5CHNA 1WC7B 5FW6A 2Y0SA 4Y16B 1Z1WA 4RCAA 5ERWA 2BM3A 1CDHA 4L5FL 2AZAA 2R8SH 1YNLH 3LRGA 2KQMA 5IROA 5ADPH 2QQKH 4FOMA 1IIKA 2ADFH 3U79A 4ZMOA 1WBXB 1ZSHA 1G9MH 2WKGA 5IHUH 3G5WA 3DSNA 3Q01A 1LD9A 1A6VL 1BEXA 2PWDA 2OLDA 1IGJB 3OZ9L 1XGYH 1A3ZA 4PS4H 1QP1A 3JTTB 5C0EB 3SBWA 4MBRA 1VSCA 1WCBA 3WNKA 3HLKA 3TFKC 1BZ9A 1T7ZA 4HJTA 5IQ9B 3QG6A 3H3PL 3MJ6A 2WYIA 4E9TA 2QZ5A 1U41A 3FQNB 4JKPH 2GJZA 1JRHL 2XX0A 4D3CH 1C8PA 1MRCH 4GRWF 4M8RA 4EQ3A 1J5HA 5MEQA 1L3WA 4HF5L 1Z9PA 4PLJD 5EH1A 1INDH 2YXFA 5LBSL 3WDHA 2CLZB 1QSFE 43CAA 2AXGA 5DGRA 3STLA 1HHHA 4OTXH 2VDPH 5HGDB 3KGUA 5FO9B 4PRAA 4PLKD 4RQQA 1XH3A 3BKMH 4IHOB 5GZND 4G8FB 1CFVH 3DGGA 2BVOA 2QR0B 3QDAA 4IW4C 3WELA 1DBMH 4WNJA 1WAEA 3GSOA 4HJ0D 4RESB 3QCUH 5SX4H 1A7PL 4QXVA 3H6AA 5FYLH 2OAAA 4AIOA 4XX1G 4R96B 3ZTEA 1FZOB 1RIUL 3EO0A 4DN3H 2PXYD 2VW7A 4OD3H 5HY9B 3GMNA 3K6FA 1K4DB 5HI3D 5FKPB 3OZLA 3KPSA 1FFOA 4NXSA 3ARUA 1IILE 3LEVL 1OAXH 4UU9A 3U83A 4MS8D 1Q1PA 1YUHB 2BY3A 3D87B 3N55A 1KUMA 3HUJB 3IAQA 1N5YL 5A1AA 2W95A 4YHLL 3FU0A 1S7VA 5DFTA 3ECVA 2ZWNA 1E2VA 1G7LB 2UWEF 2WQXA 3RVXC 3GSQA 4BSJA 3EG9B 3K74B 5I6OA 4H8WL 2NY1B 3WNMA 5KSBF 3U2HA 3FN0H 3DJRA 3SDDA 3PHSA 2COVD 4ZW5A 3VXOA 3DUSA 2DM3A 1JUFA 3IDIB 1BD2E 2AV7B 3OC8A 4WUKH 4LZKA 2FBRA 2OQJA 4U3XA 5FOBB 4QWWC 2VKXA 1NGXA 3DJZA 2DW5A 4ZSOE 1FYTB 1I8IB 1JFQL 4WI0B 3OXRB 4NQCB 2RBLA 3CSGA 1T2XA 5GRUL 3SN6N 4CVZA 5JQHC 5IBTH 4HBCH 2A83B 5C92A 4HX1B 4P2RE 1NCUA 3ESUF 4EUPH 4LU5L 4JFFA 3MLWL 5AL0A 1TVBB 2FIKA 4ELKA 2CK0L 2P8MA 4PBWD 1T3FA 2VLKE 3QXDB 3VG0H 3T0WA 3FT3B 4S2SA 4K7FA 4HOZA 1OE2A 4BFFA 2ZIDA 3KJ4C 4IEFB 2BZDA 3H56A 5I19L 2P24B 2C9UA 1W72B 1S9VB 2QBWA 4EI0A 1S7TA 3A6CL 3GJEA 3KYOB 1J8HA 3PUUA 5INCB 5E2VL 4PIBA 2WXLA 1X3DA 2VDRH 4PH8A 1ORQA 3MUZ1 2QDWA 3VXUD 2ZF9A 4J3OH 3WENA 2XZZA 1U8MA 1YQVH 1U93A 2ZXGA 5CNHA 4EO5A 3CVDA 4PJ7E 1V05A 4E9QA 1MHEB 4GG6B 1I1AB 4HALA 3LHPH 4QJ4B 3AU1B 1JWMB 5DRNB 1M42A 4MJ5A 4YSSA 3AREC 2EVIA 4GRLC 4XRCA 2X70A 3LH2L 3WMQA 1J0ZA 4M93C 1ZV5A 4KDWA 3ULVH 5DR5L 4YDVB 1HYRC 2WLHA 2EKJA 5KEZA 4L9LA 5K9QG 5HHMD 5DK0A 4KUZL 2Y36L 4ZTEA 3SGJA 1C5CL 4PJXF 4YFLF 4PCKA 1SDDB 1NSNH 1A6AB 3ARFB 2ZKYA 1L7TH 3LRLA 1T1ZB 4JFDE 2NUTA 2DMKA 4XN9A 4XPHH 3CG8A 4UQ2A 1F02I 1NUDA 5I1IH 2AI0L 4XP6H 5L4JA 1CMOA 4HS8H 2W94A 4LESA 5DWPA 3KWVA 4YXHH 3QAZC 1R5VA 2RJMA 5EIQA 4NCDA 4OQTA 1JXKA 2IFGA 3MLPA 4MCMA 5B1KA 3U4BH 1MFDL 3VA6A 1WA2X 4X83A 4UDTA 5DJ8B 1Y6MR 2QDVA 3MUHL 3OKNA 2DQUH 4OJAA 1TVDA 3AAZA 2GK0A 2AEQH 2DDQH 3WKML 2IQ9L 4TUKH 1AXTL 2COQA 4I3SL 4FNRA 3ZQ9A 2NY4D 1LQSR 5E1HB 5EFIA 4LVOC 5I15H 2KH2B 3PWNB 3QIWC 2DYPA 4KTDL 4IJ3C 5IW1B 4AJWA 3AQYA 2X6AA 4DP4X 3B6SA 1M1SA 1VADA 2AJXL 4WHYG 3ME0A 5EPMA 4ETQA 2ICEC 2DI8A 3WIIL 1QR1A 4Y4FA 4ODTH 3D39A 4KGJA 4CVZB 4GQ9H 4JPIB 1S9XA 4NQXA 4NCC1 2JLLA 5E2WL 2QADD 2RGSA 1GZHC 3DHJA 2EO7A 2FAUA 2C4FT 3SKMA 2PCFA 3EO9L 3WTWA 4KKLD 1HKFA 3Q8EA 3JV6B 4M6NL 1KXTB 2C1OB 2DJUA 3KM2A 1FJ1A 1FZMB 3P0VH 1R3JA 4ZMXA 4WI9A 2BCKB 3MLTB 4NUQA 3U9PH 3PRZA 2VSMB 1ZPUA 5ITBH 3GDCA 2RCSH 1ORSB 4ORGA 5AVRB 2OA9A 4JRYA 4PIRF 3U7AA 2P28B 1COBA 4HIHA 1X4ZA 4Y4HB 4RMWA 2CPCA 1SEQH 1P0SE 5MENA 4B9JA 5DHMC 3WHE1 1F86A 1M9SA 3R4RA 2E9IA 4X4YA 4PJAA 2ZX8A 4QHKI 4QNPE 1IB5A 1JE6A 4OLEA 4FQXA 1NOAA 2CCLA 3CVIH 1MFBL 4WF7A 4XGZB 3TJEL 4HS3A 5IB1B 3BSHA 1P4UA 3KPNA 4NN7B 4D9LL 2AERT 3L9EA 4GW4A 3MRKB 1DQJB 4KOBA 2P45B 1ZSDB 4CDGC 4FQHA 1SJEA 4LP8A 4QCIB 1S7SA 5ICXA 1EHLL 4BK5C 1IAKA 2PETA 1KBPA 1DHKA 4Z7IA 3EFOB 5BV7H 3VXRE 2B4CL 4XNXH 5C0CE 3DUHA 3K8MA 1Z9SB 1CGXA 2WINA 2Q2EB 4KJPC 5E51A 1ZLUK 3ZE0B 1QHQA 3OMIB 4Y2DD 2FX8H 3QWOA 3HI5L 2JXMA 3O4OC 3RTQD 2Z1PA 1QQDA 1FWXA 2DB8A 2ZUXA 4UT6L 2OZNA 1CB4A 4L3EE 1JXGA 3TA4D 5I1DA 5E08L 1MVUB 2J88L 4RFOH 3TZVC 2ZOTA 1XH2A 2J6EH 3NJFA 2WQUA 3BKYH 3TNNB 1KOAA 2H6PA 1DLFL 4MJIA 2IQAA 1IBZA 2IWKA 1XF4A 4OJYA 3PREA 2EH8L 4MDRA 3VG9B 5HYSG 2BIOA 4DERA 1RK0B 1YAZA 3BD5A 1D6VL 2QVKA 4PRHE 2NZIA 4EZJA 3TBWA 1F58L 1KB9J 2Z0UA 5LNEA 2BX5A 2R0WH 4JG9A 3TFBA 4ZUWA 5LGHH 2JJTC 4RX4D 3F7VA 4PJBB 4BZ1H 1JGDB 3VI4A 2Q6WB 1HCYA 4AJYV 2X4SB 1FO0L 3BHBA 1BV8A 5HHVL 3KAAA 2IPKA 3WJMA 2GBUA 4Z77B 4GKNA 3FB6B 2JKLA 1YG9A 3K91A 3NK4A 5JQIB 1MJ8H 5J0BA 5TQ2L 1KMGA 1NLDL 1ONQB 1Z3GH 3T3PF 1W0YT 2LAGB 3VSQA 2P52A 2N3JA 4LLYB 1KN4L 1RPQA 2JKSA 4U6TA 5FYJL 2E7LC 4YN3A 1IQDB 3FBKA 3MRLB 5DVNA 1A0QL 4Z7OE 4S1RH 2N4IA 4AQ8C 4NN5B 2QQNH 3ATDA 2Z34A 4A1RA 4EXPX 1I1FB 2W9EH 4GKOA 3TT3L 3B56A 4S0HA 3MV7D 3WTYA 4NAJA 3EOTH 4QRBA 4EI5B 1CL7L 3ZK0A 3MRBB 3EBAA 3HE6A 4IBSA 4AX3A 3WFCL 2OMTA 3W0WD 1PX4A 2Q86A 2X4UA 4HFUL 3VRJA 3PGFH 2A74C 1ZHNA 2X88A 4F8OA 3OZKA 1Z9NA 5F7LB 5L6YH 5HI5C 2V2TA 3I2CL 5JHDD 4S1QL 2JB5H 3KR3H 2VGLM 3HAEB 1BG9A 3CPLB 4H25B 2ERJB 5F88A 4P3DB 5LQBL 2YD7A 2EZ0C 2YAPA 3EYUL 2FSEA 2LQRA 5EIIG 5AW8B 3V4VH 3TO4B 3VM5A 1KPVA 1DEEA 1Z5YD 4XNYL 1I3UA 4G5ZH 2EDWA 3QG7L 1K85A 4G9DB 4PGBB 4F8TA 2DQEH 1QO3A 1FFNA 3KLAA 2DQGH 4FKHA 3Q8BA 1MREL 1OP3K 3JUYA 1HEZA 2TSBA 3DTXA 3MJ7A 3UTTD 4R8WH 3V2AR 4EMZA 4S11A 5I1EL 4OZGB 3KPLB 5FUOH 5T1MA 1OTSD 3ZL2A 3ZYJA 5IB4B 1FGNL 3RHWF 3EXLA 3EH4B 1DFXA 4QOKB 4M7LH 2GSIB 4E41E 1YMMB 3CN1A 4FL4C 1A6WH 4K73A 1OM3L 3VD3A 4YQXL 4ZO7A 4BFIB 3BVUA 4W9CC 1Z0NA 4OQ1A 1XGUA 4WWNA 4AIZB 5B3JE 2G5UA 1XB6A 4FN0A 3B7TA 1UD5A 3R1GH 4GFXA 2AQTA 2HJKB 5F9OH 5DMKA 3L5HA 1V7NL 4N2EA 3I85A 4ZW6A 1Z5LB 4JZJA 3D05A 3KYMB 3W9DA 3BP6B 2H3KA 2YBRB 1SN0A 1DDHB 3CFBA 4OT1H 2VYRE 2Y06H 3V0IA 5C6PB 5E6ZA 3B5TA 2P1YA 2EDXA 2XTJD 1NFAA 2GAZA 3RU8L 4G6FD 3GS0A 3QYCA 3M1CA 2WKOF 4HV8B 4I7ZC 3HNSH 1IC5H 4JO2H 4TLSA 4Z95H 1B0RB 4L1DA 4XWGL 1DJWA 3LZFH 4Y2NA 2FIRT 4XBEL 4KKCD 1IVLA 4GRMB 4F57L 4OZFG 3JVGC 2R0KH 3VMPA 3FHEA 3O6MH 1AI1L 2HA1A 1S8DB 3CVHH 4ZW7A 3U2GA 4AMWA 1IGTB 5BS0D 2AFNA 4GAAA 4UWQB 5C8JB 5CHNB 2I9LA 4QRPE 3GB7A 4JR9H 3AC0A 5ERWB 4FQCL 3H2QA 1SBBA 2W81C 1E3XA 1AZVA 5IVXA 1HE7A 1WCQA 3HG2A 1N8ZA 1EEUA 2NT1A 2WLMA 4GY4A 5TD4A 3DSNB 2IGFH 1LD9B 1RERA 1MFNA 5HDOA 2CHXA 1D2OA 1KWGA 1ANUA 4JPSA 1H6EA 2LAAA 4Y5VA 2VDKB 1D5IL 4FA6A 3NUKA 2M26A 1PYWA 1MCOH 5I1GL 4HISA 1WCBB 3NCBB 1BZ9B 2Q2LA 3O2DA 1SNRA 1YEFH 3O8XD 4RGNC 2DWXA 3QG6B 4C4UA 2HLFC 1Q0YL 2GJZB 5H2BA 1VGEH 3UGEA 5MEQB 1AXSA 2VMCA 2OTPA 4QY8A 3KLSA 4HCFA 5FM5O 2NXZC 3IK2A 43CAB 2AXGB 2JLPA 4PBVC 1YLBB 4UILH 3STLB 4RGMC 1HHHB 4DVBA 1HVXA 1JVKA 4PRAB 4RQQB 4G42A 3OLIA 3NJLA 1OP5H 3DGGB 2BVOB 5CJ5A 2CMRH 4OF5A 2L7EA 2JKTM 1JHKL 3GI9L 2AAAA 2BWQA 4GRWE 4BZ2A 3GSOB 1ZA3B 4OSUL 4UZUA 3TN0C 5BVJB 1XL6A 4LLMA 4AYDC 4RETB 1I85A 2E56A 2OS7A 2VISA 3EO0B 4UQCA 5GGTH 1KCRH 3GMNB 1FFOB 4LBEA 5BVPL 3J7HA 5HJ3A 4UU9B 1EBAA 3PHQA 4ADJA 3BAEL 1IU1A 2FL5A 1GKOA 1WWBX 5E2UH 4J3TA 4UDUA 2ZUTA 1T6WA 2YS4A 4XH2A 4JQIL 2X3CA 3GSNA 4MHHG 1A3RH 2FDBP 1I9JH 1LDPH 1S7VB 2O6EA 2WWNA 1NDTA 2Y2WA 5IZ7A 3S96A 1DVFC 3GSQB 4ZBJA 3WG7B 4F37F 5IJDC 4NQEE 3OGOE 2WWKO 3SDDB 1THCA 3VXOB 3DUSB 4PRNA 1JUFB 2APSA 1TQUA 5EB9A 2YA0A 3WY3A 5C2BH 3LNGA 2OQJB 4JRWA 1Z9OA 4TPRH 1AAJA 5AOLA 2EDHA 4OZIA 1I7UA 4GEJA 1SEBA 1NGXB 5G4NA 2VDOL 3FTSA 1WRFA 4IBVA 4OCWH 3POHA 5B39G 4KFZC 4HS6B 3BEVA 4WEBH 3DWTA 3MV9A 1QI5A 4Q9QH 2XZQH 4OD1L 4A66A 1OCCB 3MDJA 1AGCA 4JFFB 5KSBE 4IRZA 1GSKA 1RULH 1KYDA 2FIKB 3FONA 3IAPA 4N6QA 4ELKB 3OVUB 2P8MB 5D4IA 2ADYA 1T3FB 4TSAH 5FKAA 2WLIA 4WW2A 5IOKA 3IMTA 4FFYH 2PYED 4S2SB 3MGTA 4K7FB 5J1SC 3MBWA 4M1GL 4NIYE 4Y19D 3EHBC 1KFGA 3GKZA 3S34H 3BN3B 2WWMC 4ZFGL 1YUKB 4CU6A 4BFEA 1H15A 5FGCE 3RAJL 3GJEB 2F53E 4HSAC 3R7RA 1J8HB 2R29H 4MD0A 2RD0A 2X1OA 2V7NA 2ZONA 4ZD3H 1IFHL 1ORQB 3V0GA 4AENA 4KJYA 1SUJA 3GM8A 5DFAA 3V8CA 1NMAL 1U8MB 1U93B 3U46A 3DJSA 4JY5L 3G9AB 3ZL4H 1R4XA 4WWOA 2BOCA 3EYQC 4LEBA 1CD0A 5I0YA 1WIPA 3GBDA 2W80C 3S5LG 1JXFA 2GITA 4KMQA 1A9EA 4MJ5B 3LDBC 4CC1A 1SHWA 2HUHA 4HWZA 2X70B 3T1FA 2EE3A 5KAQG 1S3KH 3DX2A 5FDWA 4NNPH 3LZPA 3G04A 1U8KA 4DO5A 4L9LB 3VGBA 4KHXH 3MRGA 4UANA 1I8KA 1U92A 1NUGA 3L17A 5I23A 4U1MA 3TYGL 1QX1A 3EXJA 3SGDH 4DAGH 5JORA 2NUTB 1ASOA 3M7FB 4UQ2B 3ZDZE 2XLLA 4QPEA 5B7EA 1IE4A 3MRRA 4AYEC 4BINA 2WWKT 3CZJA 1ESOA 1SXBA 3GBLA 4FFZL 4LKCA 3EO1A 3VB9A 5JIMA 4UBDD 2DEXX 4A2GA 3QJZA 2EQDA 4LSSH 5F6IC 1R5VB 2KC0A 3BPNB 4KFMA 4KTEL 1XF5A 5FM4A 5LBSA 3N43B 2VAJA 1PLGH 3FUDA 1FHGA 2IC2A 4LHJB 1UGKA 4PJXE 4Y1AA 3WE6A 3WEXA 4FZEH 4PHZA 2NCMA 3ZIMA 2PO6B 4UDTB 1T0NA 3CD4A 2HT4C 3OKNB 5AZ2H 3RBGA 3AAZB 1DCLA 3CFIC 1ROCA 2CE6A 3ZZ1A 1MCWM 1E4WL 2MH4A 1OW0C 1XMEB 1INEH 1BGXL 2EICA 3SDYL 5EFIB 3DIFA 1UASA 3C12A 3DJ9A 3L08A 4OCYL 4LLUA 5D1XD 2DYPB 5T3ZE 4KBPA 4J3OF 3A47A 3B6SB 1VADB 3ILQD 4M7KH 5EPMB 3ME0B 1RAMA 4ETQB 1LHZA 3GMPA 3ARGD 1KJMA 3NSJA 4Y4FB 1QR1B 3NJMA 3D39B 1TJGL 3GHBH 4NGHH 3OSKA 1S9XB 4NQXB 2JJUA 4QO1A 1ZPLA 3QNZA 2A3TA 3F64A 2FO1A 3N1MC 2DBLL 1M2VA 2F54B 2P5EA 4NX0A 3SKMB 2PCFB 3JZ7A 1G5GA 2EKSA 5F9WB 2J20A 1FJ1B 5IHHA 1R3JB 1TQBC 2WCPA 3RUGA 3GMMA 1QFUL 4XXDA 5AWNL 3VU2A 4GUOA 4TKWA 4AOFA 4ORGB 4Z7WA 5CM1A 1G1CA 1ZEAH 1OCZB 1KJ3H 4MA7H 1IARB 4JRYB 3MTRA 4OLXL 1EXGA 4K94C 3LXCA 3SDCC 2HG5B 3KPRA 5MENB 2J5WA 4QHNA 4FI7A 1WEJH 4G6KH 3IGLA 1URIA 4XHJC 5TF1H 4A67A 2OMVA 4JG0H 3HZKA 4OR1A 4X4YB 1FH5L 4PJAB 4WV1C 4ZO6A 5BMFL 3B7SA 2DS4A 1GMIA 3JWNE 1HIMH 5C0DA 5DC0A 4CDHA 3KLLA 4LEOA 2OXGA 1WH0A 2R56L 3A4DA 3KDMA 3MOBL 3ZY7A 2EINB 1QEWA 1DANT 3NFNA 3VXSA 4HS3B 1KYFA 4OB5L 3KPNB 3TESA 1E50A 4NZJA 4YIQA 1Q9KA 3TA3D 4FQHB 5I5JA 1SJEB 3UYRH 1TLMA 3DX8A 3D0LB 1S7SB 5ICXB 1H8NA 4ICWA 5C70A 1IAKB 4HCIA 4JVPA 1JPST 1V3LA 3TJHD 3IT8D 3O6FD 3FU3A 1SN2A 2QSQA 3QR2A 3HI6L 1KIRA 1TO5A 3R18A 5BO0D 1H8SA 3QWOB 2JXMB 1H6TA 3CPUA 3NP3A 4M6OH 4D7PA 4LGSB 2ATAA 1M57B 5DRZA 1QQDB 3PWPD 3FQTA 3QUZA 1Y6KR 1QPPA 2R1WA 2BCMA 5KJRL 4J8QA 4K94L 1URLA 1PBYA 1E7VA 2OMNA 1WAPA 4MJIB 2ENYA 1YAIA 2IQAB 2YAOA 4AUUA 1XF4B 3JTSA 5KS9A 1ACYL 3BISA 3KYAA 1U3HC 1PX3A 1VDGA 2E9BA 5DHVH 2J8UF 3B2VL 3ULUH 2Z31C 7FABH 4JFYA 2Y6SD 3TBWB 5IR1A 2FWOA 4OLWL 5AKRA 5FYKH 1F6FB 3PUCA 5T3XD 1YMHA 4ZUWB 5E6ID 3TBYA 3F7VB 1GGBL 3VI4B 5J11B 4G6MH 3BHBB 5LKNA 3BFWA 1Q1JH 4MNGE 1P7HL 1HWWA 2IPKB 4LVEA 3WJMB 2C7FA 2BY2A 4FNLL 5F72S 4GKNB 3CWGA 3RVUD 5F3BA 5KBDA 3DYPA 2A4ZA 1EJOL 1JMXA 3EGXA 5D71H 1UWEL 3SSGA 4N3TA 2OI9C 1AG0A 1WFTA 4F20A 1EFXD 4GO6B 1YEKH 2W88A 1QRNA 2OMUA 1E4XH 4XPBH 2IIJA 1ID2A 3AREA 3L8QA 4GRLA 2D9CA 2UZXA 2YGNA 3B37A 2UV3A 4JGUA 4QYAA 3P11L 3C6LC 2IEPA 3QORD 4LPXA 4WI6A 4BA0A 2XN0A 5AEAA 3ML8A 3U4KA 1SJMA 5KSAD 3VFSA 3CFEB 3CSTA 1JG9A 1T66C 4MA8L 1OAZH 2VXVH 1DZBA 3A5VA 3K1KC 3T3PE 4X7FC 5DURB 1FNGA 3HE6B 2X4QA 1YEJH 2OMTB 3WE1A 2Q86B 2X4UB 3BP4A 5GQBA 1CE1L 4UT9H 3VRJB 1DP0A 4YDLC 3C09C 1ZHNB 4LFHD 2VLJA 3SO3C 2XZCH 4ZXBD 1JIBA 2O1AA 2WZAA 3BLBA 4FG2A 5ADOL 5B4MC 2V2TB 3DJTA 5F3FA 3QUYD 3HS9A 1DVTA 2AQ3A 1GR7A 4K9JA 2R1XA 4TSCH 1E7UA 5F88B 4F5CE 2HT2D 1F1GA 1WPCA 4GSRA 4PB9H 1WK0A 3AT0A 1UCBH 2FSEB 5KVGH 3T9WA 5J3HD 4E68A 1KTCA 1UOLA 1HH9A 2K7PA 3LS4L 4LMQE 3M8OL 1KPVB 1DEEB 4G7VH 1KBVA 3P3YA 4WAFA 4IMLA 1G4MA 5KVGL 1V8HA 1BVZA 1QO3B 1FFNB 4RMTA 1DFBL 3KLAB 5DS1A 3QIWA 3HKZA 3JV5A 1HEZB 3DTXB 3MJ7B 4I18C 4PY8J 2HFTA 5T1MB 1QBLL 4FYQA 3O6KL 4PLJC 3D09A 4N2DA 4JLRA 4WWKC 5T1KD 1L7IL 1YYCA 1EAPA 2C8NA 1XGUB 1BVLA 1GZHA 2D03L 2VN3A 1A7NL 1N3NA 3M1OA 5E24E 5GZNC 2CK2A 2YK1H 4Z7QF 2Y7QA 1MOEA 1NMCB 2QQLL 4YFLI 4JAMA 5DMKB 4EI6B 2DWYA 1B4LA 5DT1H 3HB3B 4HJ0C 5LCVL 3FUFA 3MUJA 4JZJB 1RUKH 4ODHH 3NMEA 2I07A 3W9DB 2JB6A 3U82B 2DQDH 5IJVA 1RIHL 1JZ7A 2A0LD 5DO2C 1QATA 3IWVA 1NPNA 2HB0A 4UT6A 4FXTA 2GAZB 3AY2A 4U6HA 5C6TH 2QVTA 2YJLA 4MS8C 4QEGA 3U9WA 5E2TL 4ORZC 1G6RH 1UZ8A 4ADIA 3CMOH 3NACL 3L3OA 2YOAA 3O2WH 2BIIA 3K7UA 4G5AA 2DM4A 2N01B 1U2HA 1KTLA 3D85D 3KPOA 2EXWD 1ASPA 4JHBA 1CLZL 1OTTD 3FN9A 1TITA 2VIRA 3FQ1A 1BWMA 2A9BA 4G8GA 3LKQA 1S7RA 3HAEH 4JPWH 3I74A 2WYZA 5DQDL 2ZNXA 5BNXD 5JR1H 1SYSA 2EDJA 2C9XA 4OCRH 4LHUG 2QVFB 2WUBL 2I9LB 5FV1L 2APXA 4Q0XH 3GB7B 3MZTA 2EE2A 3IRZA 1BYPA 4P49A 1FO0A 4WO4A 2FWUA 3K2UH 1TTFA 3Q2CA 4XC1H 4XBGA 5EZLA 2CO3A 5IVXB 4JO3L 2WZPD 4HD5A 1N8ZB 3DVFA 1Q94A 2QPSA 2GJ6D 2VL5A 4XMVA 1KTKE 4BK5A 4FAAB 3W0WE 3L1OL 2AC0A 4K71C 5TF0A 3MXVH 3IGUA 4G82A 2EXYD 2JE8A 1OE3A 2FGWH 4Y5VB 4HT1L 2ZX7A 5AW3B 9CGTA 2ENPA 5FUCE 1OARL 1ZRUA 2WO4A 4GI6A 1PYWB 2D3LA 3GTNA 3ES6A 5F7NC 2NCEA 5JHDE 3R8QA 1GOFA 1EXHA 5I1JH 1FIGL 25C8H 2W07A 1P6AB 2BIMA 1CLCA 3FQYA 1LEKA 1LEIB 1PFOA 5IFHH 1XSIA 1BAFL 3DPBA 4F91B 3TZVA 3LRHA 2XZAH 2DPKA 5H2BB 4ZFZA 1G9EA 3RWHA 2YPLE 1XXDC 4PEEA 3KVPA 5DEZA 1EGJH 1AXSB 3P54A 4PBDA 4R2GC 3SDAD 4N86A 4QGYA 2EXTA 2G2NA 3BH4A 3IS0X 3QRLA 4YK4C 3I3DA 4NP4H 4WFFD 5CU9A 3RY6A 5I1HL 3BKJH 4M4PA 3UTTE 5AVUB 4XXWC 5SWQA 4DVBB 3TURA 3PP3K 3BUBA 2VABA 4ANWA 2OJZL 3WLWD 1NGQL 3MLYL 3Q5YA 2AW2A 2BY1A 4G42B 1L9NA 3IGFA 2JJTA 3OJ2C 2VXSH 3EGSA 3MJ9H 4FCAA 3HR6A 1A7QL 3PS6A 2M8XA 3F84A 1PPIA 3ZHDA 3VGFA 4LLMB 5EF2A 2J1XA 1FVCA 2MCAA 2VISB 1TZ8A 1SXSA 2IG2L 1BQHG 4LBEB 1FA4A 5HJ3B 4HIEA 3FHAA 2DMHA 3PHQB 2ZCZA 3HA0A 4LOFA 2E6QA 2FL5B 4FQQA 4UDUB 1Y6NR 4L0ZA 3WEMA 1NJ9A 3HZYA 4XH2B 3GSNB 3ARDA 1MI5D 3CDGA 3ZGHA 3ORJA 2E7LA 2IWEA 4ZG1A 4G43A 1DJYA 4MZIA 5KTEL 2HN7A 1G1KA 4AQ8A 1GYCA 3O0LA 4M7ZB 1OT4A 4A7GF 2QHRH 4QYOA 4PRNB 5E0QA 3H9YA 3PQYA 3L4UA 3OPUA 4Q52A 1I7UB 3EIFA 1SEBB 2NY4C 2OFQA 4KXZI 1DUZA 3QHFH 4OCMC 2YBGA 1JPEA 3BEVB 2Y5TA 4IRSD 4YSOA 3MV9B 1NFIA 2A74A 1YC7A 2VLKA 4FNSA 5D7JC 5I82A 3AWEA 2FJGA 1TTUA 1HQ4A 3K6NA 4TULL 5AG8A 1CC3A 1AGCB 1LNUA 2GB2A 1ZV2A 2EDMA 4KU1A 2NXYD 1FRGH 4HP5A 4J4PD 3MLRL 1QYGH 3DK2A 4NJAL 1R0AL 1AS8A 1SDAB 5FKAB 5E5RB 4PRID 2WLIB 4WW2B 4EKJA 1AGBA 1RJCA 1N0XH 4C57C 2DIAA 3MGTB 2QADC 1UURA 1RK1A 3MBWB 4V33A 4HHGA 4KKLC 2DLIA 1H15B 4MKMA 2O93L 2YD1A 5I8CA 4MD0B 2V7NB 5LN4A 1TCRA 2KZBA 4PJ7A 5GS0D 2MNWA 2VLRE 3QWNA 4AENB 4KJYB 4N8VA 3D4GA 4TL5A 2YGVA 1NC2D 4JRLA 3U46B 4CMHC 4K55A 2BOCB 4YSEA 1P4LA 5EO9A 4MHHI 2GITB 1A9EB 2LW5A 1NCGA 1K6QL 2WY3B 4Y4KD 3T1FB 2FJUB 3EDDA 4N2OA 5FDWB 1YHPA 3ETSA 2WQ8A 4TQEH 3G04B 3LPWA 1FYTD 2E6JA 4JBSA 4UV4L 1U8KB 2A99A 3U2JA 4AW4A 4JM4L 3MRGB 1I8KB 4OCLC 1U92B 3QQ3A 5C09E 4LMQI 4KHTL 4U1MB 4I89A 1LGVA 1NPUA 3VCLA 1I8MA 5IQOA 5JORB 2NW3A 5B7FA 1ZVHA 3VFGL 5I0VA 1KC5H 1QSEE 3BVXA 2HX7A 1QTPA 3MRRB 4JUTA 4NC1E 4N1CA 3LZQA 4QRTA 2ID5A 4LKCB 3EO1B 3MACH 1XGRA 2GIYA 2Y6TE 3RPIA 3JVGA 1XF5B 3PWJA 6FABH 3WE6B 1OGAD 3QS3A 4Y1AB 5JIIA 4N2NA 1DQML 3GMLA 3N85H 5I30H 2YMXL 1G1OA 4LSVL 4J3XA 4XAWL 3QZPA 3BO8A 3WL9A 1T0NB 4Y2DC 3ILPA 2EUVA 2MOQA 3DVGA 3GBMH 3II3A 4U3CA 3RTQC 3WO4C 2OJ1A 1ZDSA 1XAUA 3FNKA 3DIFB 4V2BA 1MUJA 2VC2B 4R0LA 4LLUB 2ZZUT 4U7KA 3B9KD 4KXAA 1TSHA 2DQHH 5AYTA 3APFA 2EE9A 3AS3A 5IB5B 4TUUA 5JPMC 2PP9A 5EWIH 1YRKA 1U6AL 2XY1A 3KBFA 4M62L 1J86A 3SBRA 1KJMB 1S5HA 1RH8A 3P40A 1CQYA 2VCOA 4LXFA 5HVFB 2QFPA 5EOQH 3GZPA 2W0KA 4YNYA 4MA1C 4QO1B 1B2WL 5TPWL 1GS6X 2R27A 5D70L 3NFSL 3QNZB 4TXVB 4XMUA 1DBAH 3CFNA 1MCPL 1M2VB 2DM2A 2P5EB 1F18A 3HUJF 4PJ5E 5D7HA 3UGUA 1GCFA 4L2LA 3IPBA 2AP2A 1FCGA 2CRMA 2EKSB 5ACLA 3QDMB 3RYMA 1KFAH 4XVJL 4UQBA 4Y19E 3RUGB 1EAJA 3GMMB 4XXDB 3U0WH 1DBBH 5DSCA 1JGLH 4OLUL 3K1DA 4Z7WB 3CZGA 3KVQA 4GW1A 3I50E 2GKIA 4G3YH 1IL1A 4KK5D 4XO3A 1J1XL 4JJHA 1LTXA 3D12B 1HZHH 1JV2A 1KENL 1YO4A 2HCZX 3KLDA 4FEIA 1ZJBA 3WAKA 2A6JA 5GIRA 4L4TD 2DTML 3KPRB 1IKFL 1FC2D 3VFTA 1Y7VA 4QHNB 4E5XG 4OFPA 4AWJC 2OMVB 4AEHH 3HZKB 4ZW3A 4FFTA 1GW6A 2PN5A 2EJ1A 1PKQA 2H1XA 3UAJD 5C0DB 4AIEA 1AQKH 1AJ7L 4LEOB 1RKRA 1SY6L 2OXGB 3N41B 3KDMB 1QEWB 4AVJA 3VXSB 3GJFA 4FQLH 4B9IA 1YEIL 2XNAA 4M29A 3ARXA 4YIQB 1LK3L 1Q9KB 1GGCH 2F1EA 4P59H 4GQQA 1JERA 1GA2A 3NTCH 2P80D 4DO6A 2MFNA 3DX8B 4HUMB 4DGVL 5C0CA 5FUCC 1EMTH 4HIPA 1O0VA 5LBVA 4EDWL 2FT6A 3QPKA 4BFBD 1DVFA 1PKOA 2X4OA 3BVDB 2WN3A 3CLWA 3IFPA 4GG6F 5LXGL 4RZCA 2AJUH 1IKNC 3A6BL 2X41A 3AMKA 4AYFA 1U33A 2OCCB 2JI3A 2H32B 4ZPTA 3ZOAA 1FG2A 4K3EL 3NCYS 1TZAA 5DRZB 4NO0D 3FQTB 3QUZB 3WXVL 5DWUL 3ZSTA 4IBYA 2R1WB 4NIKB 4JHAL 4JFHD 3SKJH 3QB7C 3CFCL 4GMSL 5CBEB 1K9TA 4JCLA 1ET7A 1VPOL 3FQUA 4FGMA 4OGAC 4LVNC 3RVWD 2AS5M 4W1TA 3SOBH 2LVCA 3S36H 2KL6A 5D1ZI 3UTSD 4PRHA 1LILA 4LEXL 3JTSB 5KS9B 5D1XE 3TWYA 4N90D 5DD0L 2AJSH 2E9GA 2EIMB 1OCRB 1T22A 4LIQH 5AW5B 1RL1A 4G8EA 4M3HA 1WZAA 4FFZA 4PGJA 2GC4C 5IR1B 2FWOB 4MRBA 1YMHB 3KJ4B 3TBYB 3GINA 5PCYA 2N1TE 3UBXG 1JWUA 1J8KA 4P48A 1QASA 2HWZH 5D1ZC 4F3FA 2F19H 3RY5A 1NIBA 1RLBA 4HUKB 1BJMA 1UM5L 2FSDA 2J8UE 2BNRA 1WG3A 2XTJC 2J1YA 5F3BB 1PZDA 4JFZL 4X4ME 3DI2B 3EGXB 3MODH 4YAQA 2AABH 3VWKC 1WFJA 1FSKC 2BC4A 4ZUUA 1QRNB 2FB4L 2OMUB 4BELD 4HPHA 2G0KA 4ZYKA 5FECB 5C9JA 3FU6A 2LU7A 3WO3B 3AREB 3IFNL 4KKCC 1CI5A 1AIZA 4GRLB 4DKEL 2UZXB 3EH5B 4M93B 1LWHA 1QZ1A 3TEUA 2UZYA 3SBPA 4LOUC 4LPYA 4FD0A 3VFSB 1CGSL 3UCRA 2BVQB 2DD8L 3FUJA 1T21A 3NAAH 4P07A 1Y07A 5A3ID 4XCYA 1RJLA 2D7NA 1FNGB 4J8RA 1CD1A 2X4QB 5H4ZA 3BP4B 4JE0A 2XJLA 5G55A 3GEFA 1YEHL 2ITFA 3GXMA 4CNIA 3C2SA 4AK2A 3MRFA 3V7AE 2G30A 3JT0A 3WIAA 3QAZB 1MQKL 3PNWA 2FUQA 4P5TC 3QC6X 4NZ8A 2EECA 4KZDH 4CW1A 1RPKA 4KI5F 4R4NC 3ULUF 3RX7A 1N4XH 1K72A 4OIIH 2HPTA 4CGUB 4M8QA 2EACA 1ZIBA 4J5VA 2D2CC 2YKLH 3DRQA 1HH9B 5IVOA 1UXMA 2Q20A 1VFMA 3UZVA 1WVZA 2DMCA 4MJ4A 1OW0A 3O8XC 4IMLB 4LHQB 1X5KA 2QMJA 1HTYA 1ZLUH 1J87A 1MXGA 2P5WD 1NAMH 4I8DA 1UT2A 4LVOB 4N87A 3QIWB 4IJ3B 1LYQA 2GYSA 2H0FA 2ZWLT 4MB4A 4XO4A 5IEKA 3HG3A 1TJIH 4KQ4H 1A8ZA 3AG4B 3QPXH 1RZIA 1RURH 4DTGH 2ICEB 2K8QA 3H9HA 1FVEA 1DBJH 3JWOC 4I9WD 3BZEB 3ABZA 3DX0A 4MTMA 4JLRB 5J5EA 1L4IA 3S2CA 3SZ6A 1ZOXA 1EAPB 4B97A 1OTUC 1PLBA 2XWRA 4TSBH 1NUNB 3CN0A 1N3NB 5AOJA 4P2YA 2FJHA 3VB8A 3KGSA 6PCYA 4LK4A 2Y7QB 1TJMA 4RFNC 2AJVH 2DQCL 2NY5C 4ZUSA 3INUL 4JAMB 2GTWA 2WNGA 2WYTA 3C8HA 2KPWA 4Y1SA 4W9LC 2X3BA 3OMNB 1KY6A 1E67A 3FUKA 3QARA 3PU7A 5T3XE 5HDQL 2WBXA 2I07B 2X1PA 2JB6B 5G4MA 2VN6A 5IJVB 4R26H 2Z8RA 3K2MC 2NQDA 3HHMA 1ZTXE 4U6HB 3CX2A 3SOTA 4F7KA 2OMZA 3S2AA 1BZ8A 3WEAA 4P06A 1KXHA 1UZ8B 3SDCA 2R23A 3EOBA 3GK8H 4XNAA 5KOMC 1BOYA 1VJSA 1KCVL 2M2DA 2WWOA 2DI9A 4QRRA 1Z2KA 2CIIA 3M1BA 1KGCD 4JRXD 1KTLB 3KPOB 1IAIL 2AXFA 1GL4B 1TYRA 3IMRA 2VIRB 4QRPA 4WV1A 5HYJE 5HHNA 4G8GB 2V9QA 2NYYC 1S7RB 3LKQB 2C7UA 3QHZL 3KJ6H 4ANXA 1EX0A 2ZE0A 4K7PL 2O6CA 3VYNA 4I1PA 3JWOL 5E7FA 1A5FL 4QOKD 1KGWA 5I26A 4PJBF 3H4FA 1C08A 4A63A 4B27A 2RQ8A 3ZU8A 1FO0B 4XBGB 1TEYA 4R84A 5EZLB 3DOSA 1GJWA 2MEJB 3QWQB 1I9IL 1NL0L 1Q94B 2VL5B 2ZJSL 2BS9A 3ASNB 3QS2A 3ALPA 2F6AA 1BQ5A 3PWUA 1A4BA 4RMRA 2NY5L 2CKNA 5E99H 3GI8H 3SDXE 1E3FA 2F5BH 3UG4A 1S7QA 1AHWC 3CE1A 6CGTA 3BRFA 3ES6B 4TF4A 3O4OB 1IGIL 4NNXA 5JIQA 5C0JB 5GRJL 3FB7A 2W07B 3Q8FA 3QXAB 4WTWA 5L2KA 5AAMA 3ELQA 4MNHA 3X3FL 1LEKB 4XPAH 4ALAC 2E7DA 2FH8A 3MA9H 3DPBB 1V3JA 1H3XA 3TZVB 5T1DL 4H2CA 1I8LA 1ZANL 4ZFZB 3RFRA 4MWFA 1RUPL 4TUJA 3PHOA 5E0FA 5C08E 3ZZLA 3VAEA 4PUBL 4K8RD 1U3HA 1OP3H 3W11C 3CDZA 1CYXA 1MJUL 1U91A 2Z31A 5SWQB 5F7FA 3WNPA 2D2OA 2F5AL 2VABB 5L8LB 5F9DC 2Z8SA 2BNQA 1S5IH 3UIYA 1FH2A 3ZO9A 1JGEA 5EU3A 1PNCA 3OLEA 2WANA 3EGSB 3HPJA 4BHUI 5BRZD 1OEZW 2VE6A 2UY7A 5HJGA 5I8OH 3S3SA 3DYOA 3K81A 5JHLA 1DCEA 1CIUA 4CA4A 5ANHA 3O6LH 1FVCB 2V3EA 3ZZSA 2WJ5A 2BWDA 3W82A 3UYOD 2IH1A 3VX0A 4HIEB 3UG3A 4Q6IC 3ZMNA 4NZTH 3NJHA 2FR4B 4FQQB 1FBIL 3CZFA 1KTDA 1C7TA 3BKCL 4UBDC 3HZYB 4NPKA 4LCUA 3ARDB 1P1ZA 3CDGB 4OZGF 3E3QE 5DZ9A 2HN7B 3L4ZA 1PJWA 5C7XH 2L8AA 2Z7ZA 4ALAL 1IT9L 3LN9A 3C6LA 4I88A 3V0EA 1WDAA 4IU3B 5HDBB 4QYOB 4HD9A 2J6WA 4ELDA 3S4SG 3PQYB 3VTAA 2YQ3A 1P7QA 5GS2D 3HJEA 4NUGH 1OB1A 3VFUA 4KK6C 1WUZA 7PAZA 1BF5A 1DUZB 1CR9H 4TUOA 5D1XC 5LCVA 3MI6A 2C9VA 5A2AA 2Y5TB 4CSPA 1NFIB 2A74B 3B3IA 2EDOA 3UGXA 3IN2A 1MF2H 2FJGB 4LPCA 5G5DA 1HQ4B 3ILQC 1LNUB 2H47C 3F58H 1RQ5A 1DR9A 3ARGC 3EFFA 4O9HL 2P7TA 1KV3A 2WIMA 3TBSA 3UIZA 1AGBB 3O0RH 2GJ6E 1JPTH 2UX6A 2R0ZL 1UENA 4POZC 1CTMA 1RK1B 2VXQH 3RJDA 3S37L 2WXGA 4HPOL 2C3XA 4YL9A 4LSPH 3LS5H 4F2EA 2R59A 4G9FB 1DJHA 4HUNB 5I8CB 2D7TL 4Y2OA 4MVBD 5F9AC 1TCRB 5HXMA 1ML0A 4PJ7B 4BZ2H 3KGRA 3MYZA 4GSQA 4ZOCA 4I18A 2J1WA 3DX1A 3MGAA 4N8VB 5F0LB 1XGZA 2O6PA 3W5MA 2ZYHA 4FL4B 4W9JC 3GUTA 3D0AA 1MFEH 1FE8H 3H42H 4WWKA 1GTNA 1M7UA 1P4LB 1Q0XH 3TEZA 2FECI 2GTQA 4IDLA 1EQWA 1HN1A 1NAKH 2XN9E 3DARA 4KXBA 2DJSA 2YD6A 2ZD0A 4N0UA 4TVSa 5GZNA 2LE9A 2PTUA 2OKMA 5F0JB 1YJDL 4ZFFA 3QNYA 4F8NA 1GIGH 2VDLB 2NY7H 2EDNA 2G4GA 5A6LA 3QQ3B 3WYRA 4QHUA 1I8MB 4JFFD 3MRDA 3VCLB 5BCAA 2NW3B 1J05A 4H1LG 2DEYX 4LCIL 3U6RA 1YNKH 1VB9A 4QXGL 4WRLA 4QTFA 2ZUVA 4QRTB 4AMKH 1U4EA 3AZUA 2ED9A 2E7MA 2ZAIA 1RUQH 1XGRB 2MRYA 1BG1A 1UA7A 1W0WA 3FUEA 4N2FA 4UQEA 3RPIB 2E76C 3O6FC 3PWJB 3UEQA 4IRZH 1OE1A 2Q7AA 4MJJA 1KCBA 1DUYA 4JO4H 1E9OA 3GMLB 4LSTH 1U42A 3EJPA 3OJMB 4GS7C 3JV4A 5CZVH 3BO8B 4YE4H 3WL9B 3ILPB 3DVGB 5IKCA 1XF2A 2R9HC 3AVEA 4OCXL 1FNEA 2I60H 4NYLA 2VDNL 1KJ2L 3RPBA 2OULB 4OFIA 3S3PA 3TF4A 2OK0L 1MUJB 4R0LB 4B6ZA 2DN7A 1QFWH 4HEPA 4TVPD 1R24A 4NHUA 1IBYA 3UC0H 4XVTL 3RIAK 5EZIL 3BVWA 1T03L 2AZUA 5EIIA 4HAGA 1S5HB 3NT0A 3L3DA 4WTXA 1U2YA 2MSPA 5JW5A 3ASOB 2X10A 1T6BX 2CBPA 2IAND 4YNYB 3FQWA 4HDIA 2HVBA 1RUMH 2LU3A 3FF8A 2Y6SC 3BWUF 2O5XL 1JGUH 5GRWA 5E6IC 2MPVA 3QWRD 1O7VA 4RGNB 3SPVA 3TT1L 3B2UC 3Q2NA 1A6VH 3OZ9H 4XMKL 2VQ4A 3MAWA 4N9OB 5DSCB 2AV1A 3MV8D 4I0CC 3VXUA 3FFCD 2A9ML 1G4RA 3ZKSD 4GW1B 3RVUC 3AACA 2GUOA 1F90H 4LSQH 5A16A 2NXZB 1IL1B 1MWAH 5E23A 2VDOB 2YGOA 1CK0L 5IUSA 3HUJE 4XXWA 2KDGA 4M6MH 4RGMB 1JV2B 1MY7A 4MYPA 3VX1A 3PXJA 2PO6D 2A6JB 1C7SA 5GIRB 3U0PA 1J9CT 5C0FA 1XIWD 2V3FA 1UEMA 3IJHB 5D4QA 3VFTB 1JRHH 5TDOA 3S5ZA 4L4JA 3HG5A 3MVSA 2ORBL 4Y8AA 3WTVA 4HF5H 4AQ1C 3QORC 4A55A 2VB5A 1PKQB 4H88H 5IUCA 4KY1H 3IMVA 1DQDL 3MN8A 5BQDA 3VO0A 5KSAC 4ELME 1WWWX 1GAFL 1T1YA 2QPFA 4PB0H 4NZRL 4I1RA 1FYTE 1HJCA 1KN2H 3P0YH 3GJFB 2YPVA 2XNAB 4NQCE 4OZFA 3EFDH 4X8XA 3T2NL 1SOKA 2VZ1A 3WFDL 3BESR 4GAGL 2LT9A 2IPTL 1AKPA 4ZXBC 1A7PH 2F54D 2OXHA 1S7UA 1MCSA 5GGQH 3PF2A 3WTSA 4KK8D 3L81A 1DVFB 3CNKA 2K45A 3O3AA 2X4OB 2X4TA 3IFPB 5DVKA 2HT2C 2JK5B 1ZTXL 1V3KA 1M7DA 3AADB 4RZCB 3BLPX 5KYWA 3LRKA 3Q06A 1ZVNA 2BFVH 4AYFB 5J3HC 4JFVA 1J8RA 4ZPTB 1FG2B 4PREA 4RVBA 1NCBL 1UXSA 3QJTB 3JTBA 3FU9A 3EW3B 1N59A 1RP9A 1FZKA 2R0LH 4MS6A 2F7PA 1GHFH 3IRPX 1N5YH 1IGML 1RHFA 4DP2X 2YJQA 1HKLL 1J1OL 3NESA 4JRYD 4JRFA 2XKUA 1EXUA 4YDZA 3ZKQD 2CRZA 1T2JA 5L0QC 3FQUB 5D7JA 5C97A 1HU8A 4H8WH 2VT0A 2J43A 3O45A 4HWNA 4UIKH 4PRHB 3MRJB 4GG6E 1D9KD 4DFHA 2JKRM 1CYGA 4UQDA 4ACTA 4IMKC 4ZAKD 1JK8A 1T22B 4G8EB 2QTEA 3DYMA 3ZHKA 3CLEH 3UADA 4U33A 4YDMA 3EHBB 5I1CL 5GRUH 2E5EA 1K2DA 2CGZA 1WYJA 3UEZA 1JWUB 3N43F 4HZLA 2NY3D 5EBWA 2CK0H 4F3FB 3AJ7A 2ZXQA 1JVLA 2OR9L 3U7WH 4YLCA 3NH7L 4X80H 2A0LC 2XN1A 2BNRB 1OAUL 4CKVX 3VXTA 3V5DA 1AY1H 1NEUA 4YAQB 1OCWL 3BP7A 2ZG2A 3ZXAC 5BOPA 2BC4B 3A6CH 4ZUUB 4ZYKB 1GYWA 3OKEA 2J21A 5C9JB 3LDBB 5DUMH 2APFA 3US1A 3CK0H 3WSQL 3ZIYA 1R19A 3TU6A 3VD0A 3QZMA 1QLRA 2YSTA 4URTB 2EXWC 2UZYB 2Y07L 4ZTPL 2GQHA 4F80A 3SGKC 3Q13A 4JDVA 4DN4L 2ZXAA 1JI2A 2VQTA 3ALXA 3P9LA 4DK3A 1TTCA 3T2OA 4ZO8A 5H37A 4KKBC 1G7IA 5K59E 4XCYB 1RJLB 4J8RB 3ULVD 3WAJA 1CD1B 4ATWA 3HJ0A 3LH2H 4S1SL 3DLQR 2CJ3A 5DR5H 4CNIB 5JYMA 1MNNA 4UNIA 5J9PA 1TZHA 3QZBA 2Z6FA 5DFVD 4YPJA 4KUZH 2Y36H 1NOLA 3MREB 5F6IB 1SGKA 2WXIA 4CW1B 4E9VA 2Y5EA 1CZ8L 3GBNL 3FU5A 3FCSA 1C9SA 5JW4M 5EG6C 3BAWA 3RHWK 1UTDA 4KKZA 4Y2DA 5L2JA 3WFBL 1C5DA 2BSRA 3DRQB 5B39A 5JHAA 3RTQA 1N0LB 4CVXA 5JW4R 1PZCA 1FAIL 4KITB 4JK0D 4BEIA 5CIPA 2AQ2A 3LNDA 5F1NA 1CXIA 1FNFA 4PJAF 3S6CA 3V0DA 3IE9A 1MHHB 5I73C 5K9JL 1SQ2N 4XAKE 3CHSA 2Y7OA 4KI5E 5IEKB 1SY6A 3V0JA 5JPMA 1NBYA 2ED7A 1RZIB 4L1TA 2OMYA 3SDAC 3H9HB 1FVEB 4JFHE 4K3HA 3ESOA 1A1OA 4M9OA 4JB9L 4I3SH 4YDNA 4M4RA 3LPGA 1HWHB 5L88H 2JELL 3WLWC 2WXMA 4OZ4A 1ODUA 4KTDH 3W2DL 2FJHB 2KHAA 3PG2A 5I66A 4RX4A 5DURD 4CMMA 4ZUSB 1M4KA 2AJXH 2GTWB 3HE6D 2K3TA 1TQBB 3UJTL 2MHAA 3V4LA 4U2ZA 2QPEB 4DZ8A 4LASL 1V5JA 5JMRA 3AXIA 1KELL 3RVTD 2XBDA 1J18A 1T7XA 3TO2A 2O5YL 4N0CD 2K7QA 5F89A 2EUWA 4KKAD 2OMZB 1HE8A 3HKFA 4WVRA 3LQZA 3SDCB 2R23B 3EOBB 4FTVD 5BZXA 4EOWH 4RRPA 3D7PA 4I0PD 4LF3A 4QRRB 2CIIB 2QGDA 4EKXA 3M1BB 4NDMA 1EDYA 1GSMA 2Y1AA 2AXFB 2X9XA 4QRPB 1Z6JT 3SKNA 2EVJA 4WV1B 4YH6A 2KZKA 2C7UB 3IAGC 3REWA 2XBTA 1CF8L 1B0GA 1OF0A 2BS71 3MV7A 5E8PB 2Z3FA 4G6JL 2EO1A 3M45A 5CEZH 1C08B 4CJ1A 3CZNA 1UYWH 2HKFL 3VI4F 4LLQA 3DOSB 4IRSC 4AGMA 1ZCRA 2KDYA 1BBDL 1XCXA 3OJVC 3SODB 4I87A 2NXYC 4N4YB 3F6JA 5AVTB 1MFBH 2NQ3A 1S7QB 3LSOA 1PG7L 4K0OA 1IKNA 1MCDA 4F58L 4D9LH 4NSKA 3EOAA 3ATFA 3NCWA 4PJBE 3MLUL 4NNXB 2J72A 3FB7B 5L2KB 2FZ3A 1JZ6A 4MNHB 1MRFH 3WKYA 3CFDA 3WNIA 3PAYA 1SF3A 3WD5L 5BUPA 3AS1A 2PUQT 1XQ4A 2WGXA 2GHWB 5JIKA 5GS0C 2Z0BA 2B4CH 1CTOA 1JN6A 4MWFB 4TUJB 1REIA 3PHOB 4KRPC 1WTGT 2YFOA 1IBGL 4NO2A 3SYAA 3UAEA 1GMEA 5CMAA 4X9HA 3HI5H 3SD2A 3D33A 1U3HB 3O2VL 4ODSH 3MLSL 1FLRH 3CDZB 3C08L 1U91B 2Z31B 3RZCD 4XCEA 2CALA 4XOBA 2BNQB 2CO4A 3V4PH 3B34A 2AXHA 3NSYA 1JGEB 3T65B 5EU3B 4Y4KC 1ZVYA 4XN5A 3UPCA 3MOAH 3PJSA 4I2XA 1DLFH 1O7DC 3HPJB 4RGOH 2CR0A 3ABGA 5ALBL 2VE6B 2UY7B 2EH8H 5D1ZA 2XWBA 4FMKA 2K0RA 2QZQA 1LK2A 3BVTA 4XI5C 1D6VH 4H8QA 4F37K 1U8PA 3QXVA 2IH1B 2QSVA 2IBBA 1EV2E 2FQDA 2WXFA 3BFOA 1IQWL 3FT1A 2KUTA 3VWKA 2A9NL 2OI9B 3CZFB 4G71B 5FA3A 1KTDB 1FO0H 3UZEC 2R51A 5HHVH 4AZUA 1P4IL 1SLUA 1DVQA 3JV0A 3VFPA 4LCUB 1P1ZB 2IV8A 3LMJL 2RQEA 4GAJL 3T4AC 1O6VA 5A2KH 1HWGB 4BFNA 1FGVL 2H1PH 3C6LB 3F2LA 3FSZA 5DD1L 4XR8C 2HLAA 5FFLA 5GS0L 5TQ2H 3F00A 5BS0A 2Y3NA 1WJ3A 2C26A 4GYBA 4Y5XC 4BCZA 2UZIH 1P7QB 4C56D 4JRXE 1BJ1H 2WKLA 1E6JH 4B9FA 5I18L 1MNUL 1OB1B 4JN1H 4U0RC 3VFUB 1MH5A 3KS0H 1G9NC 5IMOA 3PLYA 4TUOB 5ESAA 4OZGE 2G5RA 1U8LA 3TVMD 1SOSA 3B3IB 4YDLB 3C09B 5G5DB 3HG1D 4QOKE 3TT3H 2ICES 1UADC 4K2UL 3MLZH 3EFFB 2P7TB 2ZWYA 1B3IA 3TBSB 4R4BA 4W4NA 4PJ8D 1WWAX 3VRIA 4M48L 5B1JC 2XPGA 2P49B 2AMUA 4OKVB 3UPRA 3P3SA 3D50A 5ETUA 5FR3A 2DZEA 5IBUG 3O8XA 5IESL 4XO9A 2XWXA 2VN7A 2FVNA 1EH9A 3NCEB 5F97E 4FULA 4QDGA 4Y2OB 1UKSA 5LGKA 4S1QH 2P8LA 4EUPG 1E5BA 4I18B 1GZPB 4R5VA 2GEQA 5LQBH 4QXUH 1JS4A 4TQPA 4IM8A 1W72L 4QLRA 2FJFA 1PZBA 4KK5C 2IAMD 4W70A 5JOFA 3ECQA 4KUCD 3QYNA 3GUTB 4WWKB 4XNYH 1S46A 1VRSA 2XICA 2Y2YA 4ENZA 5IVXF 4DGIH 2I5YL 5H94A 5J8OA 4N0UB 3MCG1 4U4BA 1HNYA 4UUJA 3J07A 4I77L 1G9NL 2XOTA 3PP3H 3SB3A 4ZFFB 3QNYB 3IU3A 4JFOB 1FGNH 1ZXQA 4P5KA 1OM3H 3EYSL 3ZDZB 2ICWI 4J3OG 4XWOC 2H2PD 1PG7W 2OMBA 2J3SA 4PSPA 3DX3A 4QHUB 5E6YA 3HG0A 3MRDB 4Y9BA 3IDYC 1J05B 1XBRA 5DYFA 4WTZG 3U6RB 3M17B 2CHNA 2JIXD 1V7NH 2CO6A 1OHQA 2YD8A 3WLBA 4D9RD 1W2KT 1R3HA 5IT2L 1JHLL 2X0VA 4LLWA 4ZOEA 1O6SA 4YXLH 1M6OA 1W0WB 2EC9U 1DUYB 3WEOA 1E9OB 2ODIA 5AVSB 3RU8H 2DLGA 1WQVT 2IVFC 2DQIH 4HOMA 3VWJD 1CQKA 1XF2B 5IGXL 5E5MA 2FNWA 4NYLB 2XXGA 2H7WA 4JQXC 3WY2A 1LXMA 1IUZA 1ICTA 4F57H 3L9BA 2X6CA 4NM8H 1Q38A 4GP8B 5FDYA 1B0WA 4LDCA 2ISDA 2C3GA 5HPOA 2QPUA 1AI1H 1II4E 1R24B 3RVWC 3D69A 4NHUB 4P9ML 4CBPA 1NFKA 5EIIB 4PSRA 4K71B 3L3DB 1QPXA 3FUNA 3D2UD 4M3KB 4D0BA 3GZQA 5JW5B 3FQWB 1AHWA 2PYEA 1CGYA 4HDIB 1LMKA 4QTIL 3LKPA 5IMLA 3ELAT 3TONA 1YEWA 2GSGA 4Y19A 3DETD 2A6KA 1QBBA 3S36X 2BNUA 1N7ML 3IF1A 3UP1A 5LNDA 3SPVB 3RDTD 1KULA 4FCHA 3NRPA 5CWSA 2IAAC 5E03A 4Z0BL 2YR3A 1RD6A 4QLWA 2EYTA 5DDHA 4PP2A 1ZE3H 2LABA 2AV1B 3VXUB 4Y2LA 2VR3A 2ZUUA 4R2GB 2FJSA 4YK4B 3U7YL 2GUOB 4JZOA 5A16B 1GRWA 5IB2A 1JZJA 1AG6A 3DOHA 2IBZY 4OF8A 5JYLA 3QUML 5AKVA 4U1KA 2H3NA 3EYFA 3WFEH 3LXAA 3KWWA 5C0FB 4CRPA 2VM3A 2BDNL 4ZZKA 5TDOB 1F97A 2VERA 4F8QA 1T5XA 1BXUA 5A2IH 4Z7AA 2ATKA 4O02L 4KNTA 3D08A 1UWGL 5HHMB 4WW2F 1ZK5A 3NEEA 2CPUA 1E5ZA 1NCAL 3O41A 2B1AL 1CYWA 1T1YB 1K8IA 1OAYH 3NCFB 5CEYA 5CZRA 5DC9B 5PAZA 5A3IC 4JN2A 2OTWA 4OZFB 1MAML 4NRXA 1JHKH 3X11A 1ZLWK 3ZL1A 4JFFE 5AALA 1ACXA 3D25A 4AYSA 2Z64C 3KVDD 1U8JA 4OSUH 4BHUA 5JOEA 1XEUA 2OXHB 1S7UB 3ZR6A 4KXDA 1KIQA 3CDYA 4NPJA 4LHUA 3EJCA 3O3AB 4KVCH 2AK1H 1DYZA 2X4TB 3QDMD 1M7DB 4JHVA 5KYWB 1X5XA 2JFCA 2PABA 5IY5B 1Z5HA 1ZS2A 2ODHA 3BAEH 4KVNL 4PREB 1E27A 3FDWA 1UXSB 1PZ3A 2VSDA 1J8HE 4PAZA 1Q0EA 1N59B 1FZKB 4JQIH 2NY4B 1T2QL 5D1XA 1EXUB 4FXGC 1N6QL 5FCUL 1AC6A 4R5XA 5D7JB 3V0WH 1K5NA 3O45B 1X6LA 4X50A 4B3VA 3TPKA 4NOBA 3G6AA 3ARGA 5JA8B 5B3SB 3J2PA 1JK8B 5TE6L 1U3ZA 1WT5C 2J1ZA 2VDOH 3APDA 2QADB 4JFED 1HAWA 4QXWA 4TOYL 4F33A 1KB5L 1N6UA 4KJWC 4AEIH 3POCA 3VXSD 3LNEA 1K2DB 2IANE 3BQUC 5I74C 4HZLB 5EBWB 2VJXA 1J5OL 4K5LA 4YHIA 2CKBH 3QRBA 5IJCC 5CSBA 3ZTNL 1K3ZA 2W92A 4BRJA 4XN7A 4JDEA 2D0HA 2GJRA 4KOCA 5GGVL 4M6AA 3VXTB 2VL4A 3CXHK 3NPSC 3V5DB 4CMHB 5KVFL 1KJ2A 1JAEA 2DKSA 3BP7B 2E8YA 1KG0A 5EC1A 2XBZA 3BRDA 3OKEB 1H3UA 1NIAA 4NQDD 5GSRA 3DHMA 4FNPA 5FGBC 1I3RA 3L4YA 3KWUA 1EAOA 1D7BA 1IFHH 2NW2A 1QLRB 4QWWD 1KEGH 4R7LA 1PZ5A 5J56B 5CGMA 4JDVB 2PNDA 3NGBC 1CLYL 3DUUA 5I1KL 4JY5H 4X4XA 5FO9A 3P9LB 4OM0H 3HNTL 3ZDXB 4MB3A 1NINA 5AB1A 2CXKA 1X5JA 2A4CA 3NJNA 1G7IB 4AJ0A 2XXFA 3S35L 4X7EC 3E6HA 4OF3A 3O81A 4G7YL 2NTFA 3FCGA 3RUGF 5J9PB 1RXLA 1TZHB 1NZRA 1KBWA 4X42A 4XP1L 1AQ8A 2YQBA 3UFIA 3D39E 2A4EA 4Z7WF 2X4RA 5AOIA 4JDZB 3INOA 3O6FA 1UD8A 2VN4A 1K3IA 3VD1A 3FCSB 1AS7A 2F54E 4IKLA 4MASA 4U1LA 1F1AA 2RACA 4Y2DB 1C5DB 2BSRB 5EZOH 5B39B 5IG7A 5L2JB 3RTQB 2YEZA 5DMJB 4CVXB 1B6UA 1O9WA 3WO4B 3L7FA 3PWPA 4PRBA 2YUVA 5CIPB 2XWZA 2ZNWA 1TNNA 2CM5A 2ZAHA 4JJOA 5F1NB 4I4WA 4KTEH 1DQLL 3VW3H 4OM1L 2YO3A 1H3PH 1LO3L 3PFUA 4PWJA 1NTDA 3JUZA 4YHZL 5JPMB 3ARED 1NBYB 2ESVD 5GHWL 2OP4L 3N41F 2OMYB 4JRYE 3VFOA 1YCSA 4K8RC 3KXFD 3BAYA 4HH8A 1A1OB 5F7EL 1TTBA 1BQRA 1E4WH 4M4RB 2DI7A 1QABA 4GJTB 3X3GL 1BGXH 4MA1B 2UUDK 3L3KA 1CVSC 3SDYH 1FFRA 3B3BA 4OZ4B 4N85A 1JHTA 2J12B 3LHAA 1CU4H 4F2MA 5E6IA 2BSSB 1MFVA 4HH9A 1NCNA 2K4WA 2VJ8A 4PJAE 4CMMB 1IBHA 5I66B 2ZYRA 5B38G 2XUWA 2GBVA 4JZNA 1O5PA 4O00A 1BQSA 4PGDA 2MHAB 3FU8A 1CFMA 4DZ8B 5SWZD 4PJCA 1WHPA 1X9LA 2KLTA 3TO2B 4BKLA 3K3QA 2DBLH 4DK5A 3TH2T 3F83A 4MNQA 5F89B 2FTAA 1JCKA 5LN8A 3TPUA 3ISRA 4HPYL 4HOXA 3LQZB 3WHXA 3LKNA 1R3LA 5GS1C 4ZNEA 1QFUH 4XNUL 2MNJB 4LF3B 3E2HC 4RFEA 4XVSL 1D5RA 2CWRA 4NDMB 5KS9F 3SKNB 1DBKH 3CLFH 1MFUA 3QORA 4N0YL 3V95A 4AQ1A 5T5FL 4FE9A 5KSAA 3HEIB 3REWB 4LP4A 2UXTA 5CAYB 4HIXL 1B0GB 1LWRA 3MV7B 4LEEA 4DNLA 4GKZA 4K8RL 2WLYA 5E1IA 3HBPA 4OFKA 1SLVA 2Q8AL 2QFRA 4LLQB 4UMSA 2ARJA 4MJIE 4YWGL 3SDXA 4WI2A 1FH5H 3L4VA 4ZOBA 4EIZC 4ZXBA 5BMFH 4NKMA 3GXNA 4I3RL 2JMRA 2DM7A 3L6FA 4HAKA 3AUWB 5KW9H 3IEAA 3V4PA 2V5RA 1OSPL 4P9HL 1VGKA 4Z7NB 3LSOB 3BC9A 1QHPA 3PAUA 4NSKB 3EOAB 3IVKA 4BSVA 3IDJA 1H8OA 4MMXC 2HRPL 5A43C 2D0FA 1FPTL 3LV3A 3PPEA 2F68X 2FZ3B 3WNJA 4I85A 2X53A 4ODWA 3CFDB 4GLRI 5FX3A 2IALA 1MDTA 4O2FA 4HWUA 4MVBC 2HAZA 4QRUA 5EHFA 4LVNB 1JN6B 3B2PA 1QZNA 4HJSA 4XP5L 1HK6A 3HI6H 4MJ2A 5GRVL 4NO2B 1OZUA 2X87A 1X4XA 5CMAB 4G70B 3BN9D 3DBSA 4IMKA 4RIRA 2G5BA 1RIVH 4MAUL 3UMNA 4G8GD 4IOFD 4PJDB 4GSDL 2V2WA 1M9WA 4XCEB 1J0IA 4KQ0A 4LCVA 3UJJH 3PJSB 4I2XB 5FV2A 1P1VA 3O3UN 2ENSA 3LVTA 2J56A 5KBMA 1B4JL 1ACYH 3FOMA 4G11A 5D1ZB 1MCWW 2XWBB 3OAUL 3R0MA 2VMFA 1LK2B 3B2VH 4DKFH 5I8EA 2XTJB 2BIPA 1U8PB 3LRSB 4OLWH 4URKA 1I7ZB 3UP6A 3FT9A 4TRPL 5FA4A 4G6FB 4E5XA 4OI8A 3VWKB 5DJXA 1FSKB 1HCVA 2AEPL 4KJPD 2PTTA 5FA3B 1EDQA 5D1QD 5EMYA 4U2YA 4AV0A 1UM4L 3TIEB 1UG9A 2DIJA 4PCSA 3VFPB 1WO2A 2XACC 2G2PA 4K23H 3SGKA 1BBJB 2HLAB 4ICXA 5FO7A 5AOMA 5G4OA 3BDYH 5TFSL 1G0DA 5BS0B 4IOSD 2CA4A 4PGEA 5IQMA 1NMBH 1QHOA 3GWJA 3NJIA 4OUUA 1DO5A 2YGPA 3MNDA 4HJGA 1MH5B 3IJYA 5IMOB 1RLWA 2PWHA 2X6BA 2VDQL 4X8CA 1VAHA 1U8LB 1FIEA 2AK4A 1D5BA 4L29A 4H5SA 3OR7A 5F96L 4ANVA 2GJ6A 3PAZA 1AO7D 4IKNA 3X1GA 1BEYL 2EIZA 4B9PA 5MERA 1IC7L 4A7VA 4GBXD 4R4BB 1X5YA 4XN4A 3VRIB 4DGWC 5K1JA 2XPGB 4H0IA 2L04A 4ONGL 3ARBD 4WDIA 4BSWA 3UPRB 1CE1H 1UFGA 4FABL 1G9MC 4GRWH 5ETUB 3N9GH 2IOIA 5EORH 4B9YA 3O8XB 4JHWH 3LAFA 4CL7A 1D6EA 2P8LB 4ZMWA 4A37A 4ZS7H 3IXAB 2FX7L 4KK9D 4WEUD 1SBSL 1U8QA 3SDAA 2XQBL 3G5VA 1KEMH 2FJFB 1RUAL 4XCNA 3M8OH 5JOFB 5KVEL 1W16A 4JY6A 1RZFH 2VXUL 1BM3H 1QFHA 3GHEL 4JPVL 5H94B 1DFBH 2PKDA 4UUJB 1XIWC 4XE0A 5SX4I 4AG4H 4DUXA 1KZQA 1ERNA 3O3EA 4GI9A 1DSFH 3IU3B 1QBLH 3KM1A 3LTVA 1YNTA 3FYIB 4I5BA 4AI7A 1SVBA 4P5KB 4TVPL 2FATH 4IKIA 3BXNA 4FFVD 4XOCA 5GJTH 4UIMA 4L8DB 3G6DL 5C0BD 4HWBL 5IQ7L 2D03H 5KVMC 1A7NH 4L18A 4XP9L 5IVXE 3AG1B 2FYVA 1ULVA 5C0EA 1YNLL 2CO6B 2EZ0D 2QQKL 4HJUA 3ZO0A 3WLBB 2ADFL 1JZ3A 1R3HB 4YHMH 1G9ML 2Q7NA 3NEOA 1DJIA 1HNGA 4LLWB 1MI5A 1O6SB 5D5MA 3SE8H 1M6OB 3CIAA 4MAYD 4G9FD 1PZAA 4WK4B 5ENWA 5DTFA 3NSXA 4K7PY 4WEMB 4PS4L 5JXED 3D30A 1DE4A 5H4YA 4C4KT 4AVKA 3NABL 2X5PA 4M7JH 5E5MB 1A4AA 3THMH 1OANA 3OAZK 2OL3H