3G7TA

Crystal structure of dengue virus type 1 envelope protein in the postfusion conformation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
397
structure length
379
Chain Sequence
b'MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVDRGWGNGCGLFGKGSLLTCAKFKCVTKLEGKIVQYENLKYSVIVTVTTEHGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGETWNRQDLLVTFKTAHAQEAVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGISYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLVTANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein
publication title Crystal structure of dengue virus type 1 envelope protein in the postfusion conformation and its implications for membrane fusion.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
total genus 56
structure length 379
sequence length 397
ec nomenclature
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3g7tA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 3g7tA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 3g7tA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 3g7tA03
2R29A 2JV6A 4AL8C 1OK8A 3I50E 4UT9A 5H37A 3N41F 5IZ7A 4UTBA 3G7TA 3P54A 3N44F 3N42F 4FG0A 2P5PA 1Z3RA 4BZ1A 2GG1A 3UYPB 1UZGA 3IRCA 4AM0Q 5AAWC 3UZQB 5AAMC 1RERA 3N43F 5KVEE 1OKEA 3UZEC 2HG0A 4GT0A 1ZTXE 3N40F 2H0PA 4X42A 5B1CA 3C6EA 3UAJA 2V33A 4ALAC 2JSFA 5LBVA 3WE1A 4UTAA 3UZVA 5LCVA 4UTCA 5KVGE 2I69A 4GSXA 1SVBA 1Z66A 3J2PA 1OANA 5GZOA 5GZNA 2ALAA 5JHMA 1S6NA 4FFYA 2JQMA 1TG8A 3VTTA 5LBSA 5IREA 4FFZA 3J27A 3MUUA 4BZ2A 5KVDE 1URZA 5KVFE 4UT6A 3UC0A 2R69A 5JHLA 1PJWA 3C5XA 4L5FE
chains in the Genus database with same CATH superfamily
4OIIH 3QG7H 5IQOA 3FH8A 4JEGB 3SGKC 1LWRA 4KNSA 4L29B 1D5BB 1G6RH 4HQQL 2OMYA 2YBGA 3ENEA 1NFIB 4OZGE 4ZD3L 3BYYA 2X28A 2YEZA 2NNFA 2VQ1B 5DK0B 5ECJE 2X1PA 2A6KB 4Y2DC 4S11A 3VFOB 5E2VL 2ZQKA 2FL5B 4TRPL 1MREH 1U8JB 1MNNA 3ARED 4PJ8D 4OAWA 4FQHB 4N2CA 3PV6B 3I02A 4RH4A 2G30A 2JQZA 4P4KA 3IU3A 5E23A 1KTKE 2G2NA 2PETA 4ODHH 3MRQA 1CTOA 4Z7OF 5I9QC 3PNWB 1KGCD 3B7RL 1VZGA 1HK6A 4UNVA 4F15B 1CICD 1I3GH 5H37H 2YMXH 2GI7A 1KBKA 4BSVB 3VFNA 5E2UL 1R34A 4XCYB 4MQXC 2PO6B 5EF2A 2BDNH 2DTMH 1U8KA 3RKDC 1BOGA 1JL8A 3NCYP 2YAHA 4DPAX 2RR3A 5T3ZL 2ITDB 4U2YA 5JIMA 4MD4A 2E7HA 2HMID 1HXMA 1EO8H 1HIMH 1NCNA 1U8NB 2R2BB 1UOLA 5I73B 4R7DA 3DUSB 3VB9A 3DO7A 4Y16D 3ZKXC 2AV1B 2JSFA 2C9XA 1R6VA 1TSHA 1X5LA 5KYUB 1TENA 4WWID 3CVHH 4IBTA 3N42B 5DLML 5D4JA 5CEYB 1RAMA 1ZVNA 2AXFB 5HGAB 5H8DA 4IRSA 3MGTB 3L7EA 2B9BA 5C09E 3QEHB 4W6YB 1GTFA 3LIUA 2Y7MA 5I17A 4QRQB 1EPFA 4APXB 3QZWA 2AP2A 2UY6B 3GMPB 3BH8A 4NRXA 4PJXF 5JHMA 5CSZB 1QBML 4MSWB 3NJJA 2DLEA 4ZMNA 3DX6B 4MB3A 4Z18A 5EU6A 5KYNA 3R0NA 3IGLA 1LE9B 2CHDA 1NGXB 4MCYA 4PRIB 4HZAA 4L8SB 3FF7A 1FNFA 4OFIA 4BRJA 4MCZA 1V8HA 5FO9B 1R0AH 2R39A 1JI1A 2IFGA 4PJ5E 3DBXB 1HQ4B 2VDQB 3CK0L 4OM1H 4H2AA 4QLWA 2C7UB 4NT6B 5KEZA 1INEL 4XBEH 1IAOA 2XVBA 3EYUH 5DD3H 4HD5A 3D25A 5PAZA 3M1BB 5I28A 3L9EA 1R75A 5L4IA 3X3FH 4LDCA 3LPWA 3NSYA 4A68A 4LRIC 1G6RA 3LD8C 4E41A 1GCYA 3ECBB 3SD5A 4UDUB 4Q0XL 4TVSa 2BP5M 4KJWC 5E6SB 3HJ0A 4AIZB 4BFBD 3RDTD 2VLJB 2C3VA 4K3JH 1GS7A 1AD0B 2R2HA 3HRZA 3K91A 2UYLA 4DCQB 4MMYA 1IARB 3FO2A 1SM3L 4N86A 5C07E 4AG4H 2A73A 4QRPA 4S1DC 5DQJB 1RPKA 3VRLF 4X4KA 3T0EB 3B9KD 4FNPA 4XMKL 3WSQH 4BZ1H 3ERXA 3HZ3A 2XG4B 4Z3JA 3JYBA 1UCBH 2I7SA 3RYMA 4O2EB 1TZOA 3MPCA 1HKFA 4JN1H 4HK3J 3LS5H 3ET9F 3ARGB 3OJVC 1KYOJ 4KUZH 1V27A 1EXGA 1BA9A 4NQCA 3OB8A 3R19A 1XCWA 2FNWA 4J8RB 5IFJB 1IAII 1BZEA 1IL1A 2BMKA 2W1NA 4MAYB 1AD9B 1FZJA 1NIFA 1KCUH 4H26A 4F8OA 4WNJA 1IO4C 4HIJB 4FHBD 4KHTL 4KU1A 5L9DH 3PXJA 3H9ZA 3QDAA 2NZ9D 3Q1SH 1M6OA 4YHOL 5ECGA 5J1AB 1J1OL 3VSTA 4BSJA 1O9WA 1NFDB 3BDYH 3R4RA 1YUHA 3L3HA 1SOKA 4NZTL 2H0PA 1TCMA 3VTAA 4Z7UE 4EKXA 5GIRA 2NNAA 1M7IB 1X7QA 2EE3A 4WUUD 1ND0A 1QNIA 5A7EA 1IEHA 1A4JA 3ESOA 3G6DL 3IS1X 4Y2DB 4WO0A 5DJ2A 5J9PB 4AX3A 1HQRB 2EP6A 3FCBA 4PUBL 4KQ4L 3R8BB 3P40A 5KS9F 1KNOB 2VXTH 4NQDA 3B1UA 4CUCA 1WA1X 3P4OB 4G3YL 4PW4A 4HG4J 4LCYB 4TVPH 2VLKE 3CVHA 1ED3A 3FB6A 5I9QB 3PP3H 2E9WA 3MUHL 1HKLH 2O5YH 1ZS2A 2JB5L 3HC2A 1MCPL 3X1NA 2FQFA 5T5FL 1R3KA 2H5UA 2X4UA 4A6YH 1BAFL 3P9MB 5ANMA 3TO4D 2CUIA 3LKNB 1R3HA 4HXAL 5C71A 1MLCA 3JVFC 1THCA 2G5BA 4DP6X 2AAAA 1LE5A 4HBCL 5EPMB 4ZMXA 3T65B 1NEUA 3HFML 2FR4B 1J05B 5EC1B 3T3PB 3OJDA 3D0AA 2R1YA 4FNRA 3VGEA 1RUAH 3TTSA 1QWHA 2CRZA 5IQ7L 1INQA 1ZVSA 4N6QA 5IVZB 3GZOA 3KXFD 1ZGLP 1JD9A 1DE4A 1V7NL 2ZF8A 2UWEB 4GKLA 2YD8A 4XX5A 3U0PA 2G60H 3ULSA 3KCWA 1NDTA 1I7TB 5K1NA 3W0WD 2J8UF 2NQ3A 43C9B 1EZSA 2CGRL 1J8HE 4GMTH 4ZFGH 3ULUD 3SE3A 2OZ4L 4LLWA 2E7DA 1LO3H 3RB5A 4P3CH 2IDQA 3A4FA 3GEWB 5K59F 4WHCA 3JV5A 3IGAA 1OF2B 3GSRB 4F2EA 1JPFA 3BSZH 3MA7B 4MA3A 4RESB 5CJ5A 3SBQA 5IF0B 1UWXK 2CK2A 3NSJA 3IRPX 1D5MB 4FQ2L 3WS6C 2EILB 1FL5B 4CU8A 1PZCA 3K4ZA 3MODH 5C6WH 4LHQB 4XPGL 2HKFH 3NCCB 1DANT 4BZ1A 3S3CB 1P6FA 5HD8D 4M1CD 4XNAA 2V17L 2EECA 5ACZA 3SOBL 1J5HA 3NSDA 4ONFH 1TQBB 3QUYD 3E3QE 1EDHA 4PRAA 2FJGA 1CG9B 4TSAH 2QVMA 4LSTL 4NHCH 4V1DE 5IG7B 4PBWD 2PP8A 1DBJH 3BH9A 4L9DA 1EXUB 2JJSC 3AW5A 4QTHB 2NY7L 2HN7B 2SEBB 4BGDA 5HGHA 4IGBD 1QACA 3CZLA 4LCCC 4QHUB 1RVFL 3NK3A 2EDKA 4G6KH 3D48R 3TBCA 1JGUH 3WKNA 4ZO7A 4JHAH 4QHNA 3SO3B 1QP1A 2IWGA 3BN9C 1IBGH 3J07A 3SPCA 3SQBB 3UG3A 1ZT1B 4EOWL 5F3BB 4APQC 2LW3A 2ZKWA 5I0DA 2X1OA 2ADYA 2YD9A 5ERWA 2VDQL 4NPKA 4JAMB 4PRPD 5E03A 2XN9D 3KM1A 4AEIH 4FQCL 5D7LB 1BEYL 4GUQA 5K9OA 4A6YA 3RGVD 3M86A 4PJCA 3K8KA 4Z77A 1Y6KR 4TOYL 1CFSA 1U41A 1XD1A 3D69A 3N5AA 3TA3C 3O3EB 4D0CB 4KX7A 2CH8A 1PG7X 2QSVA 2DIJA 4GBXD 5D7JA 4M9PA 5L0QC 3N1PC 4IU2B 1CR9H 2PMZA 3ZGIA 2CM5A 1PKQB 3CXDH 4L3ED 1ZXKA 3CFBA 3CZEA 2ZPKH 4A7SA 5IB5A 2A6DA 1P1ZB 4I3SH 5SX5K 1MVYA 2F7OA 1KXQA 2K6WA 4K94L 3ZE0F 4LIQL 4G5ZH 1KBGH 5AUMB 3C5ZA 3CSBA 1AXTL 1AC0A 4M1GL 3GO1L 4FZ8H 1NCHA 3A22A 1MVFA 2QVFB 3DYPA 1EX0A 3UBHA 3HMWL 1AMXA 2X4NB 4XCFH 5D93C 4OLYH 3WEXB 5MENA 3OF6A 4Y5VB 1NLDH 5DEGA 1MFVA 3BW9A 3TYGL 2XQ0A 2JK5A 4LCUB 4YDJA 1BD2B 3BSZA 3KLAA 1OW0A 1DYZA 1GYUA 4LEXL 3WMPA 5GS0H 4IRJC 4BFOA 4R4ND 4N2MA 3JV0A 1WH0A 1DQJB 3BD4A 3C5SA 5DHYA 1B2WL 2Y72A 3UROR 3DHMA 1MHPH 1UACH 4PB9H 1MPAH 2VM3A 3CVIL 2CR6A 2YPLE 2WNWA 1OP9A 4H1LH 4NX0A 1CZ8H 4LOVA 4L37B 2XQYK 5I6PA 4Z7WF 4BFIB 2V7NB 3BQUB 1EVUA 4GI6A 1FNAA 2W60A 2BC4A 1B0RA 2BIHA 2ZT9C 4BSWB 1A6ZA 4YQXL 4ZODA 1MN4A 4XPHL 1DVSA 1VPOH 1YRKA 2L7EA 3BSHA 4JFQA 3IGFA 4N2FA 2YBRB 1N5AB 3MRDA 1RK0A 2DMHA 1I1CA 5HHXH 4PHXA 2WBWB 3UYRL 3KHOA 2MCPH 4KHXH 4A1RA 2YD5A 4WFHE 3QJRB 3ZMEA 3D9AH 4FYTA 1I1AD 3UTQB 2CHXA 1RZIB 5DJZB 2FEEL 4BK4A 5A40E 1A6UL 4P2OB 5T5NG 1EEYA 4N8CL 1ZT4B 4FQQA 3JQOB 4G9DA 4CMHC 2AXGA 4U1NB 2D7TL 5DEFB 1E40A 5EU5B 2GUOB 4F37F 3AS3A 2CKBH 3LB6C 3ROLB 3F7PC 3ZDWA 4YDKH 1T2JA 1CYWA 2OLDA 1KYOK 1IVLA 1NAKH 3G6JB 3SZKC 5B3JE 3PJSA 4RMUA 1MCQA 2X4OB 4YXHH 1JS4A 4PV9A 1RMFH 5BO1L 2WLIA 1TTGA 2QLYA 4NC1E 3UC2A 2BSTA 4I88A 4UZSA 2HJKB 5JHBA 3QEQB 2BERA 4X5LA 1L9NA 2R69H 3QNYA 3VFMB 2ZAIA 5FOBA 1PJWA 1XXDC 2AJUL 4RMWA 4BFJA 1HH9A 2ZE0A 3NJFA 2ICWA 1JNJA 1E4JA 4JPIB 3FSVA 2JLPA 3IMRA 4FCAA 2K6ZA 4MKMA 1FWXA 3MLRH 4HG4K 1OY3B 2IPKB 3APMA 4FFZL 1KGCE 2J88L 3WJLC 4AM0B 1L7IH 1O6TA 1UATA 4WEBL 3ZZLA 2HUHA 1IGJA 2VE6A 1AIFA 2ZJSL 3KBPA 4XN7A 3IDUA 4MJID 1TT6A 3DVNB 3ABMB 1N5YL 2JB6B 4GO9A 3RG1C 1NMAH 3BVWA 4NBXB 4AYEC 4NNYA 4JZNA 1LK3L 4JREB 4HKBA 5INCA 5DYOB 1A8JH 2JI3A 1KXTB 2D8KA 3BZDA 3QJUB 1AY1L 5BOPA 3GUFA 3ESNA 1D9KB 2D9CA 2I60L 2J4WL 4H1LA 1LO0L 4WFEE 1QWNA 1KIPB 4RETB 3L2LA 4ERSH 4KDTA 2V5RA 1RJZA 4N9GB 4MMXA 4XTRC 3MLXL 3FT4A 2F19L 4LU5L 1OLLA 4M4RB 3MRFB 1PFCA 1CLVA 3ZX1A 2PXYB 1DSYA 4WW2C 4XNXH 2Y23A 4UUJB 4EXPX 5EO1A 4F7CB 1CWVA 3WNLA 2NX5B 2DBJA 3FUJA 1ET8A 3U83A 1WFTA 2NNXA 5DHDA 1KDIA 3QULB 4ICXA 4UYPA 4YUEL 3D39D 5D93B 4QT5A 2B1HL 4YHKL 2HX8A 4PJ9D 1YPZA 4UV7L 3WTXA 4JY4B 2BWIA 1BIIA 3KWVA 3X11B 1AI1H 5C3TA 5TDNB 3TH4T 3SKOA 4L2YA 1HL4A 1RI8A 2GC4C 1S7XA 2CLRB 3GSVA 3IDIA 4G8GB 5T1KD 5HVHB 1P0SE 2X9ZA 3QUXC 3FN9A 3MNZB 3VSUA 5CAYB 4U3XA 1FG2A 2HT4C 3E6HB 1ORQB 1TXKA 3F7YB 2BZ7A 5E0QA 5C0BD 4EJ1C 4M7ZC 4ORGA 5F7BA 1PTZA 2CKBA 3OKNA 3V0VA 1CF1A 4PP1C 32C2B 3G5XA 2YUWA 3T2QA 3VGDA 1UA3A 4JJHA 3W5MA 5CEZD 1BZ7A 3FU5A 5B1AB 4ZPVA 3RWEA 4N20A 4S0SD 1QLEH 3PUCA 4LKCA 2NY4C 4OW6A 3MV9A 5HYJE 1UEMA 1M57B 2Y3AA 4UT6H 2XV3A 4HZLA 3MRGA 3UAJC 4Z0BL 3LVTA 2MQGA 2PTVA 1S7SB 5LAXB 1EEZB 2N56A 3JWDH 3AT9A 3P4NB 3GI8H 4LO9A 4QMEA 2R69A 4IKIA 1MELA 3U2IA 2HFTA 5FK9A 3CHQA 5ICXA 5E6ID 3O2DL 3WGUB 3S5LG 4GAYA 2DYPA 5DMIH 3V6OE 1CICC 4Z5RB 3ULVF 1J11A 2NSQA 3APDA 1CDCA 5BO0D 4P2RA 1HCFX 1MI5B 5BRPA 4L8BA 4ZO6A 4B41A 4I5BA 4AC4A 5ILTH 1QMUA 4OGXH 4X9GA 4BK5A 1KY6A 3Q05A 1FL6A 2KDGA 5DWUL 1ERNA 4PGEA 4IKJA 1HHHA 3KDMA 3WNNA 1FYTA 2L3BA 4ZS6D 1AP2A 2C9UA 1HEZB 2CXKA 3CNKA 1E3XA 3LTVA 3EBGA 1MFAH 5FUCE 3AS2A 2AQSA 2VQTA 5JA9A 3IPFA 1Z5LA 2YARA 2YAQA 3EH1A 3KVQA 3EJYC 1UXWB 1G7PB 4Y16C 4CU6A 2CHNA 2FIRT 3RWIA 4LL1A 1MCEA 2XXGA 4JQXC 3OM3B 5FWQA 3VG0L 2NUTB 1ZJBA 1RJLB 4DO4A 3VXSD 3L1OL 4ZYKB 1O9VA 3P9LA 4MZIA 1VENA 3S3JA 2AABH 4FQXB 2RIKA 4WUUE 4XCEA 4C56A 1ZGLM 1MCOH 2Q3XA 3OX8B 1RP9A 3AU1B 4L05A 1JYWA 1C5BL 1PNCA 3IJHA 4HKXA 2Z92B 4IOFC 3LJ3A 4NQED 5I6OA 3VFPB 5LQBL 2YD6A 2OR9L 5BZWA 4GJTB 2FT8A 3PHOA 4X6DB 5C7ZA 3FQXB 4JW3A 1FL3B 5SWZD 4OLZH 1HEHC 1I3RA 2J43A 3CDYA 3VNYA 3H54A 3SY0B 3QYMA 5JPMB 2FYYA 2CUMA 5C9KA 2IVFC 3B9VA 4JPSA 3L4YA 1FVDB 5E9DB 3QWNA 1SXAA 2B16A 2YUZA 4S1QH 3GJEB 1SHSA 3T9WA 2C9VA 3QJXA 3FO1B 4NP4H 4JRXB 2GCYB 2G4EA 2HRPH 3NQIA 3FFCB 2A9NH 3OZKA 1A64A 1IBFA 1CTMA 4OLXL 4FFYH 4LPCA 2EKJA 2BW4A 3BWAA 3QRGL 1BOYA 1CFQB 4X7SL 2ZOUA 2AV7B 3HFFA 3KXFE 4JO4L 2WINA 3KEHA 2IAMD 3QB7C 2X05A 1GAFH 4N0FA 1LLAA 1N59B 5DJXB 1WGOA 4FADA 2DJMA 4UT6A 5C2BH 4XN1A 1S9XB 1ZLSL 3ULUE 1DCEA 1KCVL 1OGAD 3LKRB 3DI3B 3B9KC 1E28B 1M4KA 1MW2A 2PWFA 4QAWA 4TTDD 1KGUA 1K5NA 2DJSA 5D2NB 4A2FA 2QDWA 4L0ZA 4HWEL 1IGCH 3TBVB 1IT9H 2O5ZL 3QZLA 4MB1A 3VD2A 3FU0A 3SYPA 2JKNA 4LASL 4MA8L 1A1MB 3MRMB 3ARBB 3ZQWA 2A1WH 3NEEA 5CBEB 2MKLC 3QXVA 1KXVA 3G5WA 1WICA 4R7XA 3LCYA 2Y25A 3IJEA 2PW1A 5FUCC 2X53A 2DRUA 1ZSDB 3QUXB 4P46A 3ECUA 3DJ9A 3ZL4H 5GRXG 3HE7D 4M7ZB 1KJVB 4F58L 1S9YB 1AS7A 2FWLB 4YSTA 2EIEA 2C1OB 3FAWA 2BS9A 4RMVA 1HEJC 1R24B 4MXVE 3VFTA 1F4YH 1JVKA 1U8PA 4NQDD 4R6UA 3VXTA 1RZJH 1T5WA 1U3JA 3BZ4A 4ATTA 2CDEB 2PW2B 3MNWB 1EGJH 1VGKA 3K2IA 2AEPH 3EO9H 4RAUA 1RLWA 2DQJL 4F91B 2R0LL 2XZCH 1PLAA 5DJ8B 3H9SB 3IU4H 2XQBH 4NOBA 1KFAH 2UVEA 3K0YA 4MD5B 4DSYA 3U7AA 2JJTA 1XF4A 4LQFL 4TNFA 2H1PL 3UZQB 1CE1L 5CEXB 5KVEE 4KVPA 3JSSA 5ESVA 3TO4C 4PR5A 3IMTA 4KVNL 1U8QB 4QHLA 5L6YL 2YD2A 4IKNA 4DQOL 4L4JA 5MERB 5B1CA 3S88H 3O9WB 2VDRH 4PRPE 3WHE1 3L3OC 1U91B 3FUKA 4LARH 4W9DC 5IVXB 1XL6A 1I8IB 2FGWL 1FV1A 2XN9E 1MEXH 5AL0A 4NI6A 1R3IL 3B3IB 3UPCA 2Z35A 3APNA 3RX7A 3PG2A 2GFBB 4P2QB 4WHDA 5DEJA 5CCJA 2ZYIA 3PWPB 5FFGA 2RHEA 4POZD 3U1PA 4ELKB 2FT7A 1W9XA 3L1GA 3P2TA 1UB5A 2ERJC 4FFVC 4LOUD 4PLJD 3BRDA 3I6SA 1UADC 4M6NL 1TVBA 5DQ9A 4U1MB 4LLMA 4BK8A 2NY5H 1IQWH 4L3EE 1FE8H 1UEYA 3V0GA 4FFYA 3O2WL 2N0MA 5IB1B 3FO9B 1VERA 5FYLL 3VTTA 1A6WH 3IDJA 1A1NA 3A5VA 5FM5M 2EXWD 4CKQA 1OAKH 2DDQH 3P77A 2Z91B 3PWUA 4M43H 3GBEA 3GTTA 2G0KA 4CNIA 2Z7YA 4WKXA 1SBSH 2R29H 2VXUH 3KJ6H 1ZV2A 2D2OA 4X0NA 4B9CA 1QHPA 2VR9A 1FRGH 4PJEE 5DZOA 1E43A 4JG0L 1SUHA 4P5MA 4X0KA 5FGBA 5TQ0L 3F7VA 1TMQA 3ME0B 4L4VB 5D6DC 4LNVA 2N7SA 5FIEA 1U4FA 1YMHB 1IU1A 1QA9B 5MI0B 5KSBE 3CPLA 3KM2A 2DV6A 3GM8A 5LXGH 3FU6A 4N1EA 4UWQB 4RFOH 3SDYH 4KKCC 3BEVA 1U92A 3NJIA 3L7FB 5C08A 1IC5L 4XMUA 5F88B 1WV7T 4E9RA 2DJ4A 4EIZC 4G7QB 4I2XE 4L1DA 2DQTH 1S7VA 5I1LA 4JBSA 2FEDC 3U30B 4Z1PA 4IGBC 3VA2C 2Z1PA 2DEYX 3C6LC 5E4AA 5DHMC 5AW0B 3AROA 2WW8A 3RTQA 5A1AA 1JZ3A 4MNQE 2BVUA 4K8RH 5TK2A 4N5ED 4D2NA 1EGJA 3EO0A 3F7KA 2XCMC 4M7JH 2ARJA 2F8IA 3QIUB 3WIIH 3MUZ1 4G8EB 2YD7A 3UBXA 3FHAA 4MJJA 4Z7QF 3N06B 4LCWA 5KVFH 3ML8A 1F4HA 2YEQA 2YN5A 3KWWB 4MJ6A 4NOFA 4Q9CA 1HINH 3O4OB 1SYVB 4O2CA 3X3GH 4U1LA 1IZJA 4K7PY 5DD0H 3CDZB 1W0WA 4X42A 5A2AA 2XOTA 4QXGH 2VMFA 3PL6B 2E3VA 4EZMA 5B8CC 2H26A 2JCCB 1KLFA 1AIZA 1P4LA 1X5FA 5CUSH 5E5MA 3T04D 3VXMA 2G2RA 3LDBB 3BZ5A 4GOSA 4KTEH 5D1ZD 5IHUL 1FNSL 2ZX5A 4EVNB 4HU8A 3L3DA 4AYGA 3AXLA 3SCMA 5JIPA 3OGCA 5CBAA 2P5WA 3L9RA 4ZUUA 4M62L 4S1SL 4EDXB 1Z32X 1MWOA 2CBQA 4Z7NB 4MJ2A 1WITA 2OMBA 4XPTH 4A7UA 3ZJAA 3JT0A 1KJ3L 1UM4L 3MUJA 1A4BA 1WFOA 1M53A 1T66C 2N7AA 3IMVA 4M6OH 2IH1A 2WVVA 3S35L 3FT3A 5ABDE 3RPBA 1JGLL 2OCCB 2YO3A 1E4HA 4WV1B 2D03H 2N1KA 3NEXA 4Z9KB 2FJHB 4XZ4A 4YC2B 5D9SB 5IB2B 1A6AA 4UIKH 5GRVK 2XBTA 4HAFA 5HP5A 4IM8A 3RRQA 4ADGA 4KTGA 3EDEA 3DPDA 3HNTL 3ZO0A 3PWJB 4GKNA 3U7WL 5BV7B 4JJ5A 1VACA 1E8ZA 2YOCA 4IHBA 4UANA 4YE4H 4HX1B 4R7VA 2VTFA 2R29A 5AVVB 4J4PC 1OP4A 3CH1B 4HJGA 2W65B 4O58L 2K70A 1MCWW 1NMCC 1IC0A 4IW4C 4Y7MA 1MHEA 4M5YH 4MJIE 5I6KA 1P4BH 3QCTL 5D71L 2MNJB 2YXFA 1AKPA 5FECB 3VXRD 4K73A 1DBMH 2W80C 1OB1B 5E51A 3OMIB 1SDAB 2J20A 1MUJB 1FZOB 4MA7L 4PG2C 5ESQB 2XZAH 1E6OL 4Y5XA 5E1IA 2OSWA 1FG9C 1PEZA 3HG1A 5T1MA 1Y1UA 2WOYA 5INDB 4V2BA 3AG2B 2OJZH 1QSFD 1FGVL 4F1SA 1YC7A 2WQVA 1G84A 3KGUA 3LRGA 1XDTT 1I1RA 2ZXDA 4QGTA 2HZHA 2GJ6D 4NSKA 4QY8A 3V6FA 3L4UA 1NKGA 1ACXA 3RBSA 1JGDA 2I27N 1QSEB 5DJYB 3L4ZA 3K2MC 2RD0A 3MA9H 4IIZA 4ZTPL 5TE7H 3AITA 2EC9T 4NGHH 1TZIB 2LAGB 3QHZL 4Z8FH 5BUPA 3OXRB 2E74C 5CN2A 4G6FD 4PWKA 3OWEA 5MEPB 4TKWA 4KK9D 4YDLC 2VDLH 3D39E 2CDGA 2B3RA 4FAAB 5JUEH 4GY4A 3GK8H 1EFXB 4LPYA 4FMKA 3K5SA 3TYFB 4TQPA 1BHGA 4QLRA 1V3KA 2QHRL 1AQDA 1H9DA 1WBZA 1SPDA 1WFUA 3EGSB 2VAAA 3PRZA 4KQ3H 3HNSH 1AR1B 5C0BE 4FFWD 4PYHA 4UOZA 3QDMA 1T4KB 1WA0X 4JJOA 4JO8A 3UTZA 1SNRA 4PRHB 1CGTA 2K45A 1YYML 2NTSP 3D6GA 3QPQD 3QORC 4XP5H 2ZSVA 3IJ9A 4HKZB 3TWYA 1D6VH 2ZP9A 5KVGE 1CK0L 1D5XA 1F3DH 3RGHA 4DETA 5J06A 4GRLC 4DQAA 1WT5A 2IOOA 3C6LB 1IFRA 2ZZUT 2BNRB 4POUB 2MTAA 1NMBH 3TA4D 1JF1B 5HDQL 1ASOA 2JKXA 1VADA 1JG9A 1RP8A 5CZXD 2CJUH 2PCFB 3WE6A 4U1KB 3SJVD 3FYEB 1E6JH 4PY7A 1DO6A 3NT0A 1NUDA 4PJGB 1EEUA 4XO8A 3VFVA 3ULVD 5IQMA 3HCVA 4HLJA 4KTDL 4R3SB 3TN0B 1XF5A 4HJUA 3VRLE 2H8PB 1EHXA 1MVUB 2IADA 3LQAH 1FGNH 5T1LB 3BZFB 1CGXA 4MMZA 1HSAB 2R2EA 3B43A 1BFTA 1SXZA 2QDVA 1FIGH 4P23A 4R96A 5JOFA 2FYVA 3L48A 4FOMA 5E99H 2JCWA 1AVAA 4GRWB 2KL6A 4O02L 4EBQL 3SKNA 1EDYA 5E9AA 4F2MA 4DGVH 5D6CB 3EFDH 4UINL 1RZFH 3B83A 5GRYA 1IFHH 2YC1B 3N91A 2YAPA 5E8DL 3VXPA 3FH5A 2BOLA 4OFVA 3Q43A 4R7LA 5C6TH 5GZOC 4QPEA 5SWQA 5C3LD 1NBVH 4NUPA 1BVLA 5DMKB 3A4EA 5KBKA 1MRDH 1WF5A 5EB9A 5GS1A 1ML0A 2ZWYA 3D09A 3M17B 1ZWIB 2X6CA 2F08A 3POHA 3JTTB 4QOKD 4Y4KA 3KW7A 1JI2A 2MKWA 3RVWC 4BKTC 1R5WA 1M2OA 1AJ7L 4X7DC 4HGMA 4FXGA 3MSPA 5BRZB 1XR8B 5CIPH 1A2YA 2GG1A 3CX5K 1YJDC 3IGUA 2JF1A 5KS9E 2WUBH 2JXMB 5DRXA 4N68A 3HPJA 5I6LA 1OAXL 5EU6E 1CF8H 4AEHH 3VCLB 3DXAD 1J9QA 4FG2A 1GGYA 3HI1A 5IQ9A 4R2GB 2NQDA 1YECH 3C60B 4Q9QH 4AENB 2VR6A 4Z3FA 4GG6A 3I9GL 3CFJB 2WAHA 5HYSB 1ONQA 1R5VB 1SHMA 2GAZA 3MRCB 3RX8A 2CO6B 2VLRA 2BHFA 5SWZE 1BF5A 3MV9D 4UQ2A 3HC3H 4OCLC 3GTVA 1CLCA 1JHLL 3VI3A 1KWKA 3ZPDA 3O3BB 1Z0MA 4OUUB 4A7QA 3OAUL 3W5NA 4LLQA 3SYOA 4P4KC 4WKZA 3ZE1B 4OZ4B 1CXEA 5F7EL 5T1DL 2G2PA 1GHFH 1RURL 2EABA 4N6RB 1YNTB 4JO1L 3GXUB 2J8UE 4LF3B 2XG5A 4QRPE 2Q7YB 2CCLA 1JPEA 3DROA 1Y1DA 2AVGA 3RVTD 3GMQA 2DLHA 5ID0B 1S3RA 4HT1L 5K59E 3B2UD 3ZIMA 2WLYA 3H42L 5DRZB 1OGAE 2HH0H 3RNKA 3FFDA 2FX9H 4M7LT 3QDJD 4JFDB 3ZTEA 1H5BB 1JPTH 3MLYL 1G7QA 5J13C 2ZOWA 4KO5A 4E5XA 1JRHI 1L0PA 3OB0K 4PD4J 2FSDA 1N8OE 3D3VA 4YJZL 1OARL 4ETQB 1GA2A 2R4SL 2BSSA 3ARRA 4W6WB 1M7DB 3HHMA 3WNMA 4UQBA 1HYSD 4YMPA 1ZTXH 3CSYA 3U4BL 3D12B 4E9LA 2WBJB 1S9VA 2Z31D 1OTSC 4URKA 4QTIL 2H3NA 1IRAY 3LAFA 3GD1C 4IRSC 1QYGH 4JDEA 2L4OA 1ICTA 2OSLB 2JMRA 2DEXX 1NCWL 3IKCB 4OFQA 1Z7JA 3GS0A 4HC1L 5IZ7A 3CXFA 3RX5A 3GSXB 1T89A 2NR6D 2QSQA 5FB8A 3AWEA 1YMMA 2FWOB 1E27B 4NQDE 4PYGA 3RZCA 3HMXH 4E9YA 3MBXL 1QSZA 2C9SA 2LU3A 3O11A 4JFSA 2G4GA 4YAQB 2OXGB 4EUPH 2BNUA 3AM8A 2EYSB 2FX7L 3EYVB 4TM9A 4RQQB 1DVXA 1KG0A 3QUKB 5CIPA 5ANME 5FUOH 3RI5F 1WHPA 5IV2A 3OV6A 1WVZA 3NIDF 4OZFG 2AK4A 2Y07L 4OD1H 1MWAH 1E4XI 2D31A 4WY7H 3NCYS 3EH3B 4WHTB 2K9FB 3GSOA 1G9HA 1WFJA 3EFFA 1UWGL 4LESA 2IMMA 4X80H 3C87A 3T3MB 3L4XA 4C47A 5D72H 3RA7L 3BD3A 3TBSA 1SN2A 3INOA 1SEBA 2XN1A 3E6FB 4F93B 5CXPA 3V0AC 4M61A 2PCPB 3TEZA 3HRZC 3MROB 2Z7UA 3MCLL 1JXDA 4X50A 1RH8A 1J8SA 2VR3A 2EVJA 5EC2B 1XF3A 3ARSA 3O6LH 3UTTD 5KJ7E 3PPSA 4PJDB 4HCRH 1XGYH 1DBKL 3WUWA 2YKKA 4A04A 5K9JH 5ALBH 4ZTOH 4JO2L 1F11B 2ED6A 2CPCA 3I6GA 3IXTA 5F3HA 4GEIA 4TTDC 1LO2H 4U3SB 1SJHB 4XE0A 1SF3A 1UVQA 2HX9A 2Y06H 4ZFFA 4XN9A 3VQMA 2LABA 3WIAA 1EANA 1MLBB 5TPWL 5ICYB 4ZFZB 1KEML 2VNCA 2WLLB 4LPWA 1WUNT 2W07A 1B6UA 4NO5A 2OMYB 2WV3A 1C08A 1WK0A 1SYSB 3UAEA 1ZK9A 2EDEA 2YEZB 4D9LL 4FFTA 2WJ5A 3HG0A 1U3ZA 4N8VG 1A66A 4I3RH 1PIGA 3GXIA 3S37X 3VFGH 2ZCHL 4J12A 1OPGH 3B2MA 1A14H 5JO5B 4Z7WE 1FFOA 1PPIA 2Q7NA 2XKUA 3H6AA 2DAVA 3BEWA 4OIAA 3GSNH 4OZHA 1DL7L 2OBGA 1HHIA 4HEPA 3O8XD 4NO3A 3RFRA 2JI1A 4KKBC 5FFOA 5TE4H 2BO0A 2F54B 3D2UA 5MP6L 4KKNA 5CZVH 3E80A 4HWBH 1NEZB 3HMXA 5E8OA 1Q1JH 1XIWA 4TVPE 3QJFA 4UIMA 2C1PA 1T1XB 3H7BA 3QIWD 5E6ZA 5FYJL 1T7VA 4EUPA 3ABLB 3QFJB 5SV3A 3ZHFA 5D1XA 5D7SL 3CJJA 3FYIB 3MJ8B 1NCCH 1ACCA 1ADQL 1A5FL 1DANU 2PLTA 4IBVA 1HZLA 3CH8A 5LUMA 3LZPA 3QRBA 2BCMA 4QXWA 2QVTA 1LMKA 4YSOA 3Q2LA 1HU8A 3ZTJG 4RDBA 4ODVL 2F58H 3I50L 4AT6A 4ODWB 3DO7B 1MFMA 3SE3C 5CFHA 4AYBA 4ACPA 1JXFA 2O61A 4Z78B 4PLJC 1ZLUH 5GRZA 4XNDA 1P84K 4IRSB 4IOIA 2WZAA 2IPUK 2J1ZA 4F9LA 4YSCA 4DUXA 4M8RA 1U4EA 2JIXB 3MV11 4Q4IA 3ZSSA 3WN5B 4FMVA 4ZW6A 4KTYA 2E7BA 3A4DA 4HCIA 3BH8B 4NRXB 4P0DA 4ZQKB 4PRDB 3SY6A 3L54A 2Z64C 1GS8A 4L3CB 4KY2A 1ZLVH 1RK1B 5JIHA 3UPRA 4WWPA 3DBSA 1A4CA 4FE9A 3TBYA 3GIZH 1YG9A 1QFWL 3DYMA 1T3FA 4G9FB 4MCZB 2FH8A 1USZA 4GSXA 1CXIA 4RSYA 2E9BA 2YFOA 5LDSA 2V2WB 3OG4B 4XAWL 2BPBA 5DUPH 4D3CH 3ZE2F 4RX4D 3CFCH 3BMVA 4UM8A 4X98A 2ICEA 1K2DA 2Q2EB 2V2TA 4K71B 5HHMD 1I9JL 3MBWB 5LDUA 4ELMA 2Y2TA 3ZRFC 3S8GB 4NNXA 4ANVA 3LXBA 1MFBL 3P0YH 2E56A 5ETUB 1XR9A 2HWZL 4G42A 4E41B 4NC0B 1MFEH 3VW3H 1CLYH 1DVFD 5F6HJ 4B5EA 1E7VA 4PJIB 4AK2A 2XU9A 2CLVA 2EDHA 2R2HB 4EIGB 5AOIA 3MFFA 4FHJA 4MMYB 3VXRE 4GYBA 2EXYC 2Y5TB 3PAVA 4OQ1A 4MNGE 1OAQL 5B1KA 4D0BA 1L7TH 2PYFA 4K23L 4MA1B 4N5EC 4ODSL 5BS0B 4NERA 3HB3D 2F61A 3GSNA 1MCIA 2EE6A 2F7PA 2IEPA 2VDOH 1QSFE 5TTRA 2P4AB 3BMWA 1SJEB 1V3MA 4CL7A 1EZLA 4JCMA 1ZXQA 1CL7I 4AJWA 3DTUB 1CDBA 1DQML 4DN3L 2IOIA 3V0JA 4HWBA 3US9A 5D7JC 3ZDYB 2ORBH 3GJFB 5EBGA 12E8L 2JELL 3GIVA 4DGYH 2WUCH 4UZGA 4IOSA 2I25N 4MXQC 1KELH 2V2XA 2XWTA 3JV6A 5DURD 1EUTA 4WO4A 3MNDA 3ZMNA 2FAUA 4AXWA 3PNRB 5JQ6H 2X2IA 3UCQA 1OZTG 1X7QB 3C5ZC 2SODB 5CM1A 1KSRA 1JK9A 4N8PA 1OCWL 4KJPC 3VJ6A 5I71C 1A4JB 1PLGL 5EOTB 3U0TB 1MF2L 3HW7A 3BPOC 5IMOA 1ZV9A 2GSMB 2RCSL 5AAPA 5T3XH 4JCLA 4O2FA 1RIHL 2MSPA 4HHAA 1YJDL 3BN3B 1ED3B 1NWPA 3UYPA 4QRBA 5L88H 3VDAA 1HXYA 1M05A 5E6UB 1PNDA 1Q0YH 2X4UB 1X5JA 3FQUB 3WFBL 4MJHA 1P5UA 2YGOA 4ZNEA 4G1MA 2L7QA 3LH2H 4B3VA 4A7GF 1MLCB 4S10A 1TEFA 1AQKL 5E00A 3AABA 2Q8BH 1LE5B 4MD0A 3CV5A 4WSGA 4Z7VB 2DIBA 2HTKD 3SJVE 3ULVE 1T0NB 4N2LA 3I6KA 3PDGA 3KPMA 1UM5H 2ZICA 3EJSA 1BM3L 2J71A 4H0LC 3S9DB 3Q2WA 2ADIA 1NC2A 1ZVSB 2A9MH 3B7TA 4K7PH 4N4YB 3A21A 2ICCA 4XPBH 1DE4B 1HYRC 2AI0H 3U0PB 2XT1B 3GMOA 4U6XB 3ULSB 1AR2A 1CTNA 2QHLA 4G80B 4QJ4B 4BZ2H 4RZKA 3PGFH 1Z3GH 4NJAL 3GGWB 2Y7LA 3FOLB 3EIFA 3IT8D 1BQHG 1GY1A 2XI9A 2OMTA 4I3GA 4OZGB 1KTRL 3IETA 4WDIB 5I8CB 3P73B 3IFLH 4MA3B 4ZAKA 2WO4A 2MTPA 4PI0A 3ZDZF 2OMZB 1P69B 3EYSH 4WU5B 5IJVA 1S78C 2GJJA 3DX8A 4FTDA 5I66A 4E0RB 4QOKE 3VAEA 1FFPA 1AZBA 3TASA 3A0OA 4L1LA 3P0VH 5JMOC 2GBAA 4XCCH 5BZDB 3ARDB 3Q6FB 4RFNB 3KPRA 3U79A 3FTZA 3MUGB 1EXHA 4JZJA 4WK2B 3X1BA 4IBZA 1GGIL 1KEGL 5D8JH 2XTJD 1NAMB 1VFUA 2OJEA 2V7HB 5ABZA 2FUTA 4JDTL 1I3VA 1T03L 4GIAA 3DXAE 2QADC 3AUVA 3BH9B 3QIBA 5DDHB 5DT1L 5F96L 4LAQH 1UM6H 4QKTA 2WNGA 1G9NC 4OGAD 2EIKB 3O4LD 1CGWA 5FO7B 3MV7D 3KGRA 4XHJD 3U6XA 4TNWK 5I15L 2C34A 1T7ZA 2DQHL 3KPLB 1I8UA 4FD0A 4JFEA 4TL4A 2J2ZB 2BFVL 3MV9E 2EXSA 4WENB 5FKPB 3LHAA 4RBPK 2IAND 1KF9B 2HJFB 4NQVA 4BFNA 3LKOB 3DX1A 5CJQL 5GGQH 43CAB 3FUDA 4HXBH 3IAPA 1SXCA 1Y0LA 4F7PA 3AU0A 4PEEA 3AQXA 1VFBA 3IJ8A 4P06A 3LPGA 1WLGA 3TBWA 3UG5A 1S5HB 3C8KA 4JR9L 4P2RE 5K9OB 1LEIB 4OIIL 1CFBA 5GS0C 4OZIF 3QG7L 2GBVA 5I1CH 1PZ2A 1YDPB 4HWUA 2P8LA 1G6RL 1ZHLB 1MAMH 1IAKA 1FDLH 4BHUA 4C4BA 2V3EA 1MOEA 4AYID 1FYTE 4D0DA 4E9TA 5EMYA 1LP9A 2X3BA 5J7CC 5C0NC 4G6AD 1MREL 3L08A 4FZEH 2NZIA 5IB5B 5ISZA 4XMZA 4KDTC 4MMXC 4PJ5B 1P2CB 1A65A 3T0WA 1MW1A 2M2DA 3T1FB 2BZDA 4ODHL 4F7EA 3C5ZB 4JM2A 3OKMB 3B2DC 1OSYA 2GEQA 4OLWH 4BZ2A 3VWKB 2WXLA 2QGCA 1I3GL 4NHUB 2V6HA 4F7MA 4LPVA 2UZXA 5J0BA 3MJ7B 4JY6A 5MENB 3QNZA 3H2QA 1X5IA 2XV6B 5DEGB 3BW9B 2TRYA 5KYWB 2JK5B 2BDNL 3QXUA 2DTML 4Y9EA 2OM5A 4YDJB 5AW9B 3FTYA 1C5CH 5LB1A 5DUBA 1PBYA 2QKSA 3KLAB 3RWFA 4DAGH 2ZX6A 4NUQA 2MCG1 3LKPB 1AKJD 3EGDA 3U1QA 4KX9A 2WXQA 1JUFB 1PS3A 2X7LA 4FTVA 2ZSWA 5DUML 5C07B 1I3UA 3JUZA 2ENYA 3B8YA 4AKQA 2RFXB 3DO3A 1EO8L 2YA1A 4PV8B 3I2CH 1BVOA 1KGXA 3VM7A 3DHUA 2PYEB 2BOCB 4NO0A 3S4SA 3NFNB 4XBGB 3MXVH 5GISH 5I5RA 4N2IA 4EDWH 1E3FA 1QW9A 3W81A 3RFZA 1JMXA 4L1SA 4PGZA 3QQ4B 2NY2C 4WI8A 4H8VA 4CADA 3BT2H 3CVHL 3DETD 3US1A 1R3LA 4U1JB 4XNMB 4FLQA 3DTXB 5I1JH 4OQTH 5IMKA 2WQUA 1RK0B 2CIIA 4NCC1 1EQWA 4JVUA 5JR1H 5DJDB 2QVKA 4JKKA 2LVCA 4MJ5B 5IP4A 4LBEA 5EF1A 1Q94A 1DN2A 4FN0A 2FSEA 3V8OA 4GKSA 5E9NA 5FLVA 4O5LL 3DOHA 4YFDB 1TQCC 3UTSB 3MRNB 2X0UA 4GXVH 2W38A 2CNYA 2AMUA 1EEYB 1G6VK 3UTTE 3GB7A 4CDHA 3U9WA 4KXBA 1XGPA 3FN0H 3CZGA 2EIZA 4KROD 4BK5C 4AV0A 4OM1L 2H3XC 3AWGA 4MS8D 4TMPA 2WCSA 4XBEL 5GRUH 3DGCR 1I7ZB 4ZK8A 3EYUL 5DD3L 1V3JA 4B6ZA 1KTCA 2J57A 4HPYH 1NCAH 4WWKA 3X3FL 3KAAA 3ESMA 5D2LF 4NYLA 2QFRA 1H6TA 2WLIB 3EJUA 4MQSB 3Q2CA 5D7IA 1EV2E 3S36X 1QQDA 4NI3A 3IS0X 2QADB 4A55A 5I0VA 4A7VA 2A4EA 2E7LA 1UCTA 3L3IA 4AG4L 2YPVH 3AJ7A 3DMMD 5DI8B 3DOIA 3PAZA 1JPSH 1KIQA 4ABVA 5IFAH 4ZDHA 3WSQL 4BZ1L 2DYRB 1TF4A 2ICWB 1UCBL 4J5VA 3VMOA 3ALPA 4G6JH 5JHDA 1HC1A 2ZUWA 3H3PH 3KLQA 4P2CG 3TVMD 4JN1L 4JHWH 3BCDA 2MQ0A 3LS5L 1ET5A 1J8HB 4QYAA 3V0HA 3V79C 3BUYA 2IWFA 2EIJB 3HI5H 3MV8A 4HYTB 4U1SA 1J5DA 2BSEA 5B21A 3FC8A 4AWJC 1IGJB 3V8CA 1KCUL 4YXKH 1DFBH 4P5TA 3HPLB 3QQDA 2MH4A 3RAJL 4JN2A 4W9EC 5L9DL 3B7SA 1UWFA 3G5YA 2CBMA 1S7TA 3FTWA 4GUCA 2VYRE 3NK4A 4E68A 4IIQC 3SDAD 2A5UA 4Y1AB 3FCTB 1HCZA 3RPIA 5EG6C 1QRND 1M7UA 5J56B 2WVTA 4KKQA 5D1QD 4PH8A 3SGJA 2VXTL 3RGBA 5HHOB 3HHSB 3OAYK 4Z77B 4TVPL 5E1AA 2BNQA 5K93A 4LEOA 4V1DB 1HKLL 2O5YL 1KV7A 2VL5B 3LKSB 4DFIA 4LVNC 2YKLH 1M7XA 1CT8A 4OQTA 5DLLA 4OLVH 1MJ7H 2V9TA 1H15A 4A6YL 3JWDC 5IR1B 1Z9SA 4W9GC 3T8XB 4GQPH 1X6NA 9CGTA 4ILDA 1E9PA 1LDPH 3II1A 2AKRA 3S96A 5BW7A 3O6KL 3NAAH 1YPZB 2O72A 1AE6H 4KZDL 1KXVC 1P4IH 1JN6A 1BLNA 3G5VA 3BJLA 1E5BA 3HUJF 4L8DA 1QI3A 4DKEH 3GSVB 3IDIB 5AOMA 5F1NA 1RUAL 2IQAB 2HG0A 3NIGE 4ZXBB 3MRKA 3VG9C 1OP3K 4QNPF 1IKNA 1AGBA 1RUKL 1LNUB 4GW4B 2FEJA 4AQAA 3OKNB 2HT3C 2PABA 3RL2B 1KYAA 3FUHA 1VEOA 1SMOA 2G60L 4HK0B 2X4SA 3ZQXA 5KSAD 4D7BA 1ROWA 4GMTL 1CGSH 4DFHA 4ZFGL 2QQKH 4ZPVB 4NFDA 4OV5A 1FN4A 4GSQA 3FU7A 1NQBA 3AWFA 4HUKB 4IHOA 4UQEA 3QA3A 3FQWA 3SKMA 1LO3L 1UD4A 4P3CL 5HHME 3SDXF 3T77A 1ECYA 2GC7C 4HZLB 2RJMA 4TQ8A 2Y1YA 5CS7A 1IAIH 5AVQB 3CLWA 4OBSA 5CP7B 3UJTL 2JJTC 4JDZB 3V10A 5ICXB 2YPVA 4IDLA 1NSNH 3MODL 5H35A 2DYPB 2HKFL 3SPJA 5LBSH 1UD2A 1TZHA 1MRCH 5B22A 3U82B 3KBEA 5EU7E 3QS2A 4L8BB 3GHEH 4I5BB 2A83B 4L9LB 4ONFL 3TIEB 3BKYH 4PGDB 4F7TA 1MZZA 4Y4HB 3L3JB 4MZ3A 4PJAF 4TSAL 5IIEA 3Q1EA 1HHHB 4NHCL 3DK2A 1D5BA 1DBJL 1AP2B 2UUDH 2EIBA 1OAUL 1A7PH 1F42A 1YEHH 1Z5LB 2YPKB 2ZUTA 2VQ1A 5DK0A 2A6KA 5FW8A 2LLGA 1AACA 3P1VA 2BY0A 3VFOA 1XMWA 4CMMA 2FL5A 3GXMA 3BSGA 4KWUA 1U8JA 4Y19D 5HPMB 2P42B 4G6KL 1TJMA 1JGUL 4BUHA 2YPLB 3GLDA 2P5WE 5FKAA 1YZZA 4NUJA 4JHAL 5E8EA 4KRMB 3M6DA 1IBGL 2D7QA 2NXYB 2DMKA 3PNWA 1W91A 2CZNA 3UG4A 1UXSB 3POCA 4BCZA 1D5RA 2W91A 1JPGB 1KN2H 2EDBA 4XWOC 2ITEA 4BDVB 1OXYA 1TIUA 4AEIL 2BP8A 3CFDB 4BSVA 3LXCA 3TZVB 4XCYA 4XI5C 5FGRA 4HP5A 1KC5H 4PB0H 1U6AL 4U6HB 4ZUSA 4RMTA 3PHOB 5KSVA 4G43A 5FGBC 5FV2A 1RHHB 3V7MA 2J21A 4JQIH 1TTRA 2QZQA 1ZHBA 5LJYH 2XTSA 3QR1A 1CR9L 1ZA3B 4F8TA 2R59A 2WXIA 3CLEH 1G9NL 3CXDL 1U8NA 2V0AA 1GC1H 2ZPKL 2R2BA 3AT8A 3L5XH 1X7TA 3IFOB 3B2VH 3OR6B 4I3SL 4ANUA 4E9QA 1OE1A 3WHXA 2APXA 1JWUA 3FSAA 4G5ZL 1GZQB 1KBGL 2AV1A 1D7DA 5DU7A 4FLSA 2GT9B 5KYUA 4FZ8L 2PUQT 5SWSD 1F1GA 3I3DA 1MCJA 1FUNA 3RTQC 1KT2B 4PJ7E 2XBZA 1RZJC 1ODAA 1PZSA 5HGAA 3NRQA 3U46A 1O6VA 1HOCB 2VDKB 3QEHA 4YO0B 3MMEB 1QLEB 3HNVL 4XCFL 4BUQA 1N0LB 4QRQA 2ED9A 4OLYL 1BYOA 4APXA 5IBUG 1NLDL 5CN1A 1IM9D 2C8NA 2EZ0C 3EJQA 3GMPA 1N3NA 4FLHA 2ZKYA 4I7ZC 5CSZA 1K5NB 2DM4A 2ZAGA 5D5MF 2WXPA 4MSWA 5I8OL 4HFWB 5GS0L 3HB3C 1LE9A 4FNLH 1NGXA 1F5WA 2ALAA 3K2KA 1A1OA 4PRIA 1CD0A 2WSKA 3QAZC 5IOKA 2B0SL 4L8SA 1MKFA 5KW9H 1CDHA 5I75B 5LBSA 2EC8A 4J27A 5FO9A 1MHPL 1UACL 4PB9L 3ESVF 1MPAL 4GFTB 4GIPD 3ZDXE 1CMOA 3AREB 4WK0B 3DBXA 1HQ4A 4PJ8B 3NCXA 3P9WB 3LXUX 2GITA 1PD1A 2YD4A 1EZUA 5KVFE 1CZ8L 2QLVB 2C7UA 3VGFA 3F85A 3PE9A 4P46B 5DC4B 3SCMC 3MJ6A 1IBYA 3LHPH 5TFSH 1LDSA 4DN4H 1VPOL 3MN8A 1U8HB 3B37A 4DOHB 4MAZA 2XTJE 3ECBA 4GQZA 1NA8A 4G72B 5I1AA 1U8PB 2ROXA 1SQMA 5HHXL 5JXED 4AIZA 1T5WB 5CJXA 4TL5A 3BRGC 2VLJA 2KT6A 2MCPL 2J7LA 4KHXL 4DCQA 2VJ8A 3FUFA 2NY5C 3O4LE 5DQJA 3ALXA 3MV7E 1BGXL 3QFGA 3QR0A 3T0EA 1NIEA 4LE8A 5HDBE 3BKJH 3MRBB 1NBYB 3M07A 4OF8A 1C9SA 1XF4B 2X2UA 4I48B 4O2EA 2ZX9A 1OGSA 2IANE 1E90A 2X6MA 3MLZH 1JZ6A 3ARGA 2EH7H 4PR5B 2CKBL 4AQEB 2B20A 5EIQA 3T6ZA 4YDKL 4J8RA 5IFJA 1NAKL 4GW1B 1EHKB 4MAYA 1NBZB 3PYCA 3JWOC 1I8LA 3NN8A 2AXJA 4XXWA 3FBKA 5L2KD 4HIJA 3DSNA 4YXHL 5T1JA 2H4EA 2ITFA 1RMFL 2N59A 2EC9U 5ITFA 3WO3B 3S98A 3LNDA 3HZKB 3DRQB 4JQIA 4XNYH 2R0ZH 1FO0H 4X7TA 3VH8G 1GIGH 4GUPB 5K33A 4YNYB 2BFGA 4Y5XC 1M7IA 2R69L 2VLLB 4X4YB 4OI7A 1UB5B 4NWUH 4IBQA 5J9PA 5FGCE 1HQRA 4G59C 1L6XA 4GLRI 4LLMB 1QLFB 1KNOA 2FATH 3BGFB 5TE6L 3CBKB 3P4OA 2W9DH 3MGAA 4LCYA 4J6IA 4K3DH 2K7QA 3S97C 3MLRL 2AGJH 4K8RC 1KN4H 5DZ9A 2WLNA 1OOAA 1HESA 1L7IL 2O6CA 3VACA 5TDPA 3LKNA 2LE9A 2W8CA 3BT0A 5F6IC 1XEUA 4XWGH 5IEHA 4J3VA 3CMOH 3GFUA 3LNIA 3SOTA 4NPJA 3JZ7A 1PZDA 2HKHH 2ICWJ 2PPAA 2FR4A 2QBWA 3MNVB 3RDTB 2VQ4A 3F7VB 1BZQK 2P8MB 3APCA 5D55A 2M83A 5F9OL 3VGBA 4N0UE 2I5YH 5B39G 1TJHH 4YDVB 4H25B 5IVZA 3KJ4B 4NKMB 3NIDE 2UWEA 2DW5A 2NSMA 1I7TA 4KOBA 43C9A 1G0YR 1TDQA 3L3KB 2A7BA 3T2LA 3IVKB 2QR0B 1WWCA 1ZCRA 2NCEA 4XNXL 1XB8A 3S5LB 4Y2OB 4DEUA 1WT5C 4OFKA 1OF2A 1L0XA 3GSRA 2VKXA 2DKSA 4HEMA 3T2PA 3T0VA 2ATAA 3EO0B 3QPXH 3PQYD 1ITBB 1HL5A 2NCMA 1FL5A 4FKKA 5KBMA 2HLAB 2DJUA 3V2AR 1UXLA 3V4UH 1AI1L 4M5SA 4MJ6B 4NIYE 4NZUH 2W9EL 3BLPX 3WN6A 4FP8H 3D50A 4GPVA 4PJBF 4WUUB 2BIPA 3QAZB 4O9HH 1GH7A 4U1LB 1A3QA 3LQZA 2N1TE 4P23C 1KWGA 1CD8A 1MIMH 1H6EA 4PS4H 3DIVA 2H3KA 5IUSA 3UL4A 2EYTB 4HIIB 3VI4B 1SDYA 5JIIA 3NG5A 3VXMB 2VDRB 1L9QA 5IG7A 3ILDA 5DZNA 25C8H 4J3OH 2EDQA 1EXUA 1H3VA 2ZWNA 1ESOA 4QTHA 1QLEL 2SEBA 3N9GH 3RIFK 3SCMB 1D5IH 4UT6L 5CBAB 2KUTA 3HZVB 3ZKMD 5GS1C 5DC9B 1FO0A 4HJ1A 4MCMA 3O0LA 4Y4KC 4QHUA 3JWDL 5E56A 3GI8L 3MCKB 3OKLB 5HBBA 1QTYT 3GLEA 1OQOA 4X5XA 3NIFB 3SQBA 5F3BA 1ZT1A 4FABH 4I77H 1ZLWK 1U3YA 3DVGB 3KL5A 4I8DA 3FRUB 4JAMA 4N1CA 4ADJA 5JPNB 4JNXA 1C12B 3ZKNC 3AB0B 4OGXL 5DWPA 3HG2A 4B9YA 5D7LA 1CCZA 4HAKA 1AAJA 1RU9H 2J55A 4L1BA 2C3WA 3W0WB 2F6AA 3TV8A 1HILB 2A9CA 4D0CA 4XVSH 5DA4A 1KUMA 2HFGH 3B2XA 1MFAL 3BFWA 1K72A 4WTZG 3LEVH 3MKKA 4LLVA 4IU2A 1PKQA 3WIFA 1AGFB 1JGEA 1Q9WB 1N0XH 3WUWG 5DZJA 3H2WA 1DQDL 2GTZA 1P1ZA 4QRUB 3UGUA 1K3ZA 2D3NA 2MPAH 4XODA 3TIDB 4HFUH 4RGMC 5AUMA 4YN3A 2DWSA 1M6UA 5HHQA 2AABL 3PFQA 1MCOL 4GSDH 3VGHA 3N04A 3S0PA 5CHNB 4KMTH 2AHIA 4LOEA 4E9WA 1UB6A 2X4NA 4XVTH 3AQZA 4M9OA 2VZSA 2Y7QB 2GK2A 5D1QE 4RLDA 1GY2A 3WEXA 4LHUD 4Y5VA 3N40P 4G8IA 3DPBB 4GP5B 4MCNA 2XC8A 1JGDB 4LCUA 4DTGH 3NRFA 4OFYD 5HJDA 3EZJB 2YJLA 3L1EA 5DD1H 4PTTA 1DQJA 2AQTA 4MAUH 4B0MB 3ZRSA 3LQAC 3VNZA 5CF3A 2VKWA 1U2HA 1OP5H 5T3ZD 3TS8A 4PM1A 4JRYD 4NP4L 1MCCA 2NOYA 5IJDC 5CZKA 4BFIA 2A9NL 2V7NA 2VAAB 2GIYA 5I1DB 2ZXGA 4FFYL 4XMXA 1LHZA 4BSWA 1DJIA 2JVUA 3L9BA 3GMNB 4PRPB 4AQ1B 1KOAA 2XN9B 3ZE2E 4ZMZA 2A0LD 3UTZB 2AFNA 2YBRA 4RMSA 3WNJA 4K7FB 1GAFL 1T89C 3RGVB 5C2BL 1CO1A 3L4VA 4LDEB 1ZTXE 1HZHH 1X4XA 3EJJX 4L8CB 3WJJA 1YC8A 3UTQA 3O6MH 1IT9L 1AH1A 4S1RH 1RZIA 4X5WB 2GHWB 5EZOH 4XN5A 3AM8C 5DJZA 4FNSA 2NNRA 1NOFA 5IFHH 1GOFA 4P2OA 3SDDA 3WE6B 1I8MB 2A1WL 4TULH 2B5IC 4R0LB 5HVFB 1FFTB 1U8CA 1CXKA 4UV4H 4L3EB 5DEFA 4FXTA 2V37A 1XF5B 2D3LA 5B38G 2AQQA 2PNDA 1UC6A 3PIQB 4N1HB 1G9EA 3FRPG 1OTUC 3ROLA 4MMZB 2BVOB 3N55A 1Z66A 2DQDH 2W92A 1CXHA 3NA9H 3ZL4L 4MNHA 4DP8X 3IDGB 1L0QA 3MOAH 3WLBA 5AZ2H 3VXUA 2X4OA 4LKXA 1WD8A 4WI7A 4WEEA 3DX4A 4YPJA 4F2MB 4WI0A 1F4YL 3OJMB 3ZHDA 1RZJL 1U3HA 4GT7A 4TLSA 3UEQA 3K4DA 2WWMD 3VXPB 4DZ8B 1EGJL 2AEPL 3EO9L 4JFZH 1G87A 2J44A 1BVLB 4G11A 3VFMA 4K4KA 5KSBB 1X7SA 2NY0C 2BSDA 4BCYA 5GS1B 3IU4L 2XQBL 2O26U 1KFAL 2WQXA 5CLXA 2B1OA 1JF5A 1R5WB 2NXZC 3RLSA 1LMIA 2WKOF 4Y19E 3TEUA 4JPIA 4M5TA 1IUZA 2MHAA 2CWRA 4JZOB 1U8IB 4FXGB 4XC3L 1JXGA 1I7RA 1A2YB 4I2XB 4JK0D 1AMYA 4A2GA 2Y69B 2FJUB 1CI3M 2X87A 2YD3A 3T71A 3O45B 4AM0A 2R83A 3S88L 3HPJB 3LPPA 1N6VA 4WZ9A 1P7BA 1NDGA 4LARL 4OCSH 2XRAH 1MEXL 3DVNA 3HI1B 2JB6A 3UTPD 3ZQ9A 4HUXB 4OJEH 4MQ7B 5EOCH 1H8OA 5A2BA 3O3AB 2JKRM 3L4WA 1ONQB 4XNUH 5IMMB 4ONGH 4HSAC 4ALAH 1C1EH 4EQ3A 2XV2A 5DYOA 3SPIA 3AZUA 2VLRB 1VF5C 1KBVA 1KXTA 3BIBX 4GAJL 1JCKA 4KXCA 4UQ2B 4QHKI 4WJ5B 3SQOH 1D9KA 3DX2A 1I1AB 2XFXB 4ELME 4PBVC 1UD6A 3IDYB 1XB3A 4F8LA 1BZ8A 5AALA 1KIPA 1Q9OB 2NY5L 1RIUH 2WZPA 1T7YA 3US0A 1M3JA 4N9GA 4WKZB 4K9EH 2MIZA 4M4RA 4PJHA 3MRFA 4RGND 3EG9B 1A6WL 2P49B 2PXYA 1AG6A 1D2PA 4UUJA 1ETA1 1LJMA 3IAQA 4OIFA 4F7CA 2NX5A 1VB9A 2YWZA 5F7LB 2DDQL 5SWSE 1F41A 2EJ1A 1RZPA 2XG5B 3QUZA 4OI8A 4M43L 3Q5YA 2KQNA 5HGDA 3VFWA 3QULA 3DROB 3DIFB 4OD2B 1XIWC 3TFKC 2ZUYA 1SBSL 4ZFQA 2R29L 2VXUL 3KJ6L 2VITA 3JWOL 4JY4A 5IOPB 1J9SA 2X2JA 5D1XC 1MFCH 4PIRF 3RURA 3X11A 4Z7UF 2YA2A 5TDNA 4G8GA 1RY7B 4M02A 2CLRA 1EIBA 2DB8A 2OMUB 3DLQR 1G7QB 1KJMB 4E5XB 3D4CA 3F7YA 1ORQA 2NY3C 3DJZA 5LXGL 4OCYH 1JGVH 3KBFA 3I85A 4RFOL 5TK4A 3D3VB 1VHPA 2ZF9A 3PF2A 3SDYL 4Z7OB 1NC4D 1UKTA 2BSSB 2GKIA 5E2TH 2Q3AA 4MWFA 2R0WH 5JA8B 3VX0A 3CSYB 2DQTL 5DZPA 1F02I 2X9YA 4NN6C 3GMLB 2DMBA 4IQHA 4NN5C 2WWKT 4NKIH 2KZ1B 2CO7B 4YFLI 4ZRGA 4RIRB 1JFQH 2F74B 5CILH 1D5ZA 4HLZG 4F9LC 5AQ0A 4K8RL 3QC5X 3D06A 3D4ZA 1S7SA 5LAXA 1EEZA 2OTUB 1YMMB 3R7RA 1DVQA 3WIIL 4FLRA 3RZCB 1CIDA 3B9DA 3WXWH 2PO6D 3F00A 1N67A 5KVFL 4Z5RA 1TSRA 4RSVA 1VFAA 3LZFH 2XICA 3ZZSA 3QYNA 3LNFA 2WKGA 2XWBB 3NPZB 1WA2X 1KG0B 2B5IB 5DD0L 4BH7B 3BJ91 1OTTC 2F7IA 1FZKA 2WO3B 3RUGE 5AAWA 5F9WC 1IGFH 5IV2B 4QXGL 4RZCA 1YNLH 3DURA 2D4FA 5K1VA 2ICEC 4QRRD 5FW7A 5CUSL 5I76B 1BAWA 2VAJA 4KTEL 3C9NB 3D7PA 3TURA 1HEZA 4KOCA 1U30A 3LH9A 5FF6B 5IROD 1JNLH 2ZXWB 4N2OA 5C3IA 3ESUF 2K9UA 3TBSB 4F1ZA 1SEBB 1UXWA 5L2KE 4LB8A 5CKAA 1CLOH 1G7PA 2H2PC 3N85H 3VD3A 3D39B 4M61B 4PJXB 4ABQA 4F92B 2PR4H 4PJ9B 5GRWA 2EUXA 2CM6A 3QQ9C 4M6OL 2NUTA 1RJLA 3NPSC 2R1XB 5A2FA 4ZYKA 4KXZI 3PV7A 1XF3B 4FQXA 2EVIA 2D03L 4YGAB 1T21A 5T1KB 4OJAA 1CB4A 4TXVB 2OI9C 3KPNB 5C0BB 2FWSA 1Y07A 4XNZC 4UIKL 1U8LA 2NXZB 3AU1A 2OQJB 5F3HB 1JZEA 1TZGH 2Z92A 4I87A 3TNNB 2I07B 5IQLA 5FM8A 3VFPA 4ACTA 4W9LC 3UO1H 1OCRB 2KLTA 4KJYB 3DJRA 2FD6H 4X6DA 5F7AA 3FQXA 3QWRD 3S48A 1F00I 4YE4L 3OPZH 1FL3A 1LILA 5EIVA 3B6SB 4FYSA 3EFOA 2C7FA 1F3RB 4PQXA 3KVPA 2LAAA 2EAEA 3SY0A 3DHJA 3GXPA 5JPMA 2I9TB 2E27H 2W07B 3C75A 4NO5B 4M5YL 1P4BL 4WO4C 5E9DA 4KRPD 1WTGT 1EMTH 2LT9A 1DBML 5D4HA 5E6IB 1P9MA 4NEHB 2EEFA 5K39A 2OK0H 5F0MB 3FKUS 3MLSL 2IH9A 3FFCA 1R5IB 4YK4B 1H3WM 3ARVA 4ZMQA 3GUTB 3IFPB 4J3SA 1XH0A 5JXEC 2YJQA 3SDCD 4NAJA 4O4YH 1H6UA 2AV7A 2VCOA 2I32A 5KSUB 4JKMA 2XLLA 2JQMA 3BEWB 3FB5B 5EFIB 1NCDH 5AVXB 1NPUA 5DHVH 1WZ1H 5DJAB 1N59A 3ARFD 5DJXA 4BXVA 5E08H 1RZ7H 5DVOA 4QHMB 1S9XA 3BUTA 3LKRA 1LXMA 1P5UC 1E28A 3M8OH 1DTUA 3MA9L 5TE7L 3S3DB 4ZPTA 4DGIH 4YWGH 3DJSA 4D9QD 3U4EA 4E42A 1A1MA 1Z9NA 2VABA 3ARBA 2NMSA 3MRMA 2C1PB 4JG1H 2YD1A 2WXMA 1PG7H 2VDLL 3PQYE 4FI6A 3ZIYA 3BUBA 1G1YA 2O6DA 5JUEL 4M8QB 3GK8L 4UT9H 1H8LA 3IBOA 3N2JA 2H1XA 3VXSB 3AFLA 2XETA 1ZSDA 5KS9B 4KQ3L 4NZDA 3HNSL 2ZXBA 1MDTA 3I9PA 3QJVB 2K3TA 1MWAB 2ZONA 1KJVA 2XQYG 3LRSB 2OL3B 1S9YA 4Y2DD 3KLKA 3TCTA 2WXOA 2C1OA 2HXAA 2X0WA 5HJ3B 3WY2A 5EF3A 1UWXH 1TTUA 1R24A 2MEJB 3OHXB 2D3VA 4Y8DC 4J3UA 4XP5L 4NXSA 3H2PA 4NQEB 9PCYA 1ZHNB 2BH0A 1IAMA 1D6VL 1KB5B 2CDEA 2Z8VC 1YQVH 4IJTA 3MNWA 4JE0A 4NN5B 6FABH 2P26A 4IOIB 4ZAKC 2Z8SA 3MI6A 1NMBL 1OAYH 1Z0NA 2BSBA 2CJUL 5DJ8A 4GINA 2XVKA 4JG5A 2B77A 3OMNB 4MD5A 4Y5YA 1E6JL 2AXWA 2GW5A 3OR7B 3VGAB 4LEBA 1I53A 3UZQA 5C0CD 1E9OB 4MQXD 4OCXH 3UFIA 4XPAH 3RKDD 3APFA 4WWNA 2EACA 1N70A 3TBYB 3EF4A 3LQAL 1U8QA 4JZJC 1FGNL 3WTSA 3G04A 4OJFH 3D8MA 4LCVA 2OTWA 4JY5H 2YFNA 5MERA 3N40F 3HHRB 1OB0A 3LIZH 3O9WA 1FIGL 1U91A 5IVXA 2P24A 1NOLA 1I8IA 2WOBA 5E99L 5F9WB 2WD0A 4DW2H 2MNWA 4QDGA 3TJHC 4B96A 3B3IA 2X4PA 3QIBC 5BPPA 4U1GC 2ICEB 1IVTA 3D85A 3FCUB 4DGVL 3EFDL 5EEVA 5K5YA 1RZFL 1IE5A 3CXHK 1BYNA 2GFBA 3BPNB 4P2QA 3KPSA 1OGAB 3PWPA 1G5AA 2IALB 5C6TL 4MDJB 1NBVL 1XR9B 4ELKA 2OKMA 2MCMA 3W11C 3SYQA 3IRZA 2D7OA 4LP4A 1UQSA 3C12A 3KCPB 2ZCKH 2ENPA 4WW2F 3UMNA 4U1MA 3A6CH 3DARA 3FO0H 4UM9D 2YEVB 4LHUG 2DQIH 4KGLA 4LSPH 3FO9A 1WBXB 3CN0A 5IGXH 5AG9A 3GZPA 1J0ZA 3AADB 1ZOXA 3RNQB 2MFNA 4IBUA 3VRIB 2VUYA 2WUBL 1FLRH 1NEPA 5DHVA 2Z91A 4EZLA 5BV7H 3OVUB 4AEHL 3HE7B 1N64H 4F8PA 5B3JF 1PZ3A 4NZRH 3ZXAC 4TLKA 4MASA 2O5XH 3WYRA 5J3HD 2J6EA 3RHWK 2CHZA 3OZ9H 3HBZA 1YECL 2DWDB 4Q9QL 1I8AA 2CJSA 4KI1A 1I9IL 2VXVH 1WAAA 5SX5H 1YQ2A 3KWTA 3Q3GB 2EDYA 1WJ3A 4L4VA 2XA8L 3ME0A 3WJMB 4HPOH 1E2VA 1HDMB 2Q0ZX 1YMHA 1QA9A 2Y7SA 1ETJA 3HC3L 1OK8A 4UT9A 3HUJE 5FS5A 3FCSA 4QF1B 4JFVA 5HHVH 2HLEB 1RULL 4JM2C 5AOJA 4WI4A 1JERA 1JK9B 5F88A 5T3ZE 3WFDH 5BUAA 1WFNA 3QUMH 4F8QA 1QFHA 3IFNH 1GHFL 1VESA 4P99A 3ZTNH 4NN7B 1QHQA 2Q86B 2XDHA 1A8ZA 4S1DD 3SKJH 1S8DB 3FBQA 4O2FB 4HHAB 1V55B 1RQ5A 3A6BH 3UYPB 5FYKU 3K8LA 2CJ3A 2WXNA 3Q9QA 3L5IA 2TAAA 3EOAB 4UAOB 1M05B 3QIUA 3V5HA 2EVHA 3Q8BA 4OZFB 1P5UB 3EDJA 3TM6A 5IJKA 4KI5C 3FT1A 4GS7C 3JWNG 3KWWA 2FX9L 2Y5QA 1JPTL 3HG5A 4XOCA 5E00B 2G3MA 4OSUH 1LEGA 3ZE0B 1OD7A 1UYWH 3CDZA 1QKZH 1H3GA 3PL6A 1HWGB 3I6KB 1CDUA 3LY6A 1F3DJ 5KZCB 3RFZC 2JCCA 4GI9A 2WP3T 3LIZA 1PD0A 1QRKA 4NC2B 3UADA 1B4JH 1DFXA 1ZTXL 3BKMH 3HS0B 3QJQB 3FONB 3ZRCC 1MJJB 3C6EA 4EVNA 2A38A 5C09D 1G9MC 4PGBA 4PP2A 2DIAA 1QYGL 3GMOB 3JWNE 2W5PA 4PJAE 3RY5A 3ZY7A 1QUNB 1Z9PA 4EDXA 2QQQA 2VL4A 1QEXA 1XSOA 4HGWB 5I8KH 1N68A 5ACLA 2DLTA 3HMXL 2CO1A 5HI3C 1B3IA 3MYJA 1BD2D 4GMSL 1ZAGA 2D7PA 3MO1B 2CGZA 4WV1A 3CDGB 4HQQH 5GZNA 2FJHA 1KYFA 1T5XB 5CR1A 4N0YH 1RKRA 1JZ5A 1SXBA 4PWHA 3QHTC 4GNKB 3WTUA 1FFPB 1P53A 2CMRH 4K3EH 2W0LA 3PWJA 1N2RA 1QPXA 4I0PA 4WY7L 1QFOA 4GRWH 3C08H 4WWKC 4CW1B 4HX1A 4XBMA 1O7DE 1BPVA 3BQUD 4X80L 4HOMA 4N8VB 1CFVH 3CH1A 5D72L 1M56B 2W65A 3PHQB 5EIIG 5GHWH 4S2SB 5EWIL 3RBGA 2ATKB 4ZBJA 3UTPE 5FECA 1K4CB 1XGUA 2E7LC 2P7TA 1OB1A 2YAMA 4N90D 3T0DA 4OLEA 1MUJA 1FZOA 4W1TA 3Q5TA 4JM4H 5ESQA 4A66A 4CGUB 3U1SH 1LL1A 2EDTA 1ZPUA 3O6LL 1E0OB 3WTVA 1JD7A 3ES6B 4XH2B 5INDA 5EEZA 3W37A 2NDGA 4Q6KA 3VVVA 1KLUA 2HKAA 4ZUWB 5FFLA 5K9JL 3CHOA 5DJ0A 2AC0A 3QUMA 5ALBL 1IILE 4ZTOL 1JRHH 3GT6A 1LO2L 5C0IB 4QTFA 2Y06L 4RGNE 1QSEA 5LN4A 4NENB 1GSKA 5DJYA 4UILH 5D1ZB 2FECI 2VW6A 5D2LA 1USQA 3KYOA 1RZGB 4P5TC 5FDWB 2WXHA 4Y2NA 1TZIA 5F7UA 4H7VA 1VAHA 2MOVA 5LNDA 3OXRA 1GGCH 4LXFA 2WYIA 3WAKA 1F45A 5D5ME 5G4MA 5H2BB 2QGDA 1EFXA 3JWNC 3V0WH 3TYFA 3N43F 1A7OH 5H4YA 4QXTB 3QEQD 3EGSA 4I3RL 1OCOB 1ZKAA 3VFGL 5ISZB 3SGJC 3KMDA 2VLKD 5CZRA 2Y24A 2Y9RT 2GSIB 1AOHA 1OPGL 1T4KA 1A14L 3WEAA 2V33A 1NGZB 3MRIB 3GSNL 3NFPB 3GBMH 3CZUB 4HKZA 4YLCA 1JZ8A 1NCGA 5LNGA 3BN9D 2BSRB 4GQ9H 1SFDA 4P2AA 4GAFB 2J1KA 1LK2B 1NUFA 4TNWF 5LCVA 1E9QB 4APQD 4B7IA 1E4XH 3M7OA 2BNRA 4BWTA 3T08A 4M3JA 5TE4L 3TU6A 1JF1A 3T2NH 5CZVL 5BW7C 4HWBL 1FHGA 2CA3A 1Q1JL 1B0WA 2PCFA 4LMQE 4U1KA 2ZOKB 1UT1A 4XP1H 2IBBA 5T1MB 4PJGA 5DUBB 5EO9A 1L5GA 2VR8A 1O7DC 4FQIH 3ASNB 4R3SA 3EGDB 3TN0A 2LFGA 3LPOA 2ZSWB 1IE4A 2DD8L 2H8PA 3CX2A 4GAAA 1NCCL 4MNGB 5T1LA 4HAGA 3GRBA 1IKNC 3BZFA 1PX4A 4H8HA 4YBQC 1FNGA 4AJYV 1BQLH 5D1ZI 4ZZFA 2AERT 4KQ0A 4NO0B 2NY6C 2F58L 2YQ2A 1QSFB 2XXMB 4XMKH 4ANKA 3BP4B 4PG9B 3MRLA 4H88H 5D6CA 2GJ6B 4R84A 3BVTA 4QRRE 4UQIM 1QOKA 4N2KA 1Q72L 3UJJH 1IGIH 2AZAA 5JW5A 1ZDQA 3K0WA 4UOJA 5IMKB 3EYFB 2PR9A 4UMGA 5HYIA 1KLGB 4L2LA 4RWYH 2CIIB 1EAOA 4EQ2A 1YVLA 1RZ8B 3ARTA 4RA3A 3M17A 1FVCA 1ZWIA 5AG8A 5E7FA 3JTTA 3WFHB 1Q94B 1Q9LB 3CU7A 1KPRA 4GKSB 4YHOH 2UXFA 5BRZA 1XR8A 1WGVA 3NGBC 4EO5A 5C1MB 4OCMC 4P9MH 2DS4A 4D9RE 2EE9A 3GIZL 2RBLA 3GB7B 3W2DL 3F05A 4IRJD 2C4FT 4K15A 1XGPB 2OMNA 4LAJH 4AVHA 2ZWSA 2EIZB 3IKKA 3VCLA 4FG6C 4PRIE 3Q0HA 5DUPL 4D3CL 1DEDA 1W72L 3ZK0A 3CFCL 4F57H 4TF4A 4XB7A 4AENA 5DVMA 3PGCB 2BCKB 3T6XA 1KBBA 3CFJA 5HYSA 1R5VA 2E47A 2VJXA 1U8OB 3MRCA 3P3UA 3K2UH 5DJ6A 2CO6A 3P0YL 4N2BA 3X2QB 4R5XA 2IDFA 1MCPH 1MFEL 3CQFA 3VW3L 1CLYL 2ZP0T 3O3BA 1J0IA 4DK6A 4OUUA 2C5DC 3F3HA 4PJ6A 4A2MA 1D7CA 2P1YA 4IRZL 3MLUH 5B7MA 1Z1WA 5J6HB 4G82A 4YDNA 2HVJB 2QZ5A 4OZ4A 2KHAA 1TUPA 4F15C 5AD0B 2OULB 2YGVA 1M9WA 3UXFA 1L7TL 1DLHB 4ZDHB 5FM4A 1LEKA 3WMSA 4GH7B 4F9PC 4HGKC 1YNTA 1IBDA 7CGTA 4LF3A 1MI5D 2Q7YA 5FYLD 2VDOL 4UTCA 4HCFA 3VXNB 3BVXA 2GPZA 1DZBA 1KMGA 4FJ6A 1GSMA 1T7XA 1RXLA 4XT1C 4D8PB 5ID0A 2G0LA 3MV8B 4M29A 4MVBC 1GZHA 4U1SB 3QJZA 4U3CA 3E2HC 2RALA 3L5WB 1UZ8B 2OV0A 3LB6D 3N1GC 2OMVB 2ORBL 4JFOB 5G4OA 1FVEA 3GTNA 3S7GA 4JFDA 1H5BA 4DGYL 2WUCL 1S7WA 3RVXC 4GKOA 1JBJA 3V4VB 5I6XB 4NP9A 4D9QE 5JW3L 1NGPH 5FHAH 1KELL 1LD9A 2FVNA 4ZW7A 1ZGLB 1F56A 2EE2A 1FLTX 2DM3A 4ETQA 5EUOF 5JQ6L 4NCC2 1VCAA 1BMZA 1II4E 4FQ2H 1R4XA 3BLKA 1BQHB 3RPIB 1NFDE 1PZUB 2QGBA 4YSSA 2WBJA 4C59B 2VR4A 4EZJA 4KNTA 5T3XL 2V17H 2GK0B 2NYKA 5C97A 5E1AB 1TU2B 2CDFB 3DXAB 3GSXA 4EN3A 5L88L 2FWOA 4ZS7H 1E27A 3C8HA 1Q0YL 4PJEF 1VLXA 1N4XH 3LH2L 4H0HB 4YAQA 1E9PB 2OXGA 4L8SC 2AKRB 1EBPA 1WS7A 2J72A 5CWSB 2DZEA 3HAEH 1UOKA 2DTSA 2EYSA 3AG3B 3EYVA 2V4LA 4WTQA 2Q8BL 3IDXH 4RQQA 4OV6F 3G5VB 3WNOA 2WY3B 2A3TA 1AG0A 3QUKA 1UWEH 1FI8C 4Q8BA 5JORB 4I9XA 3QFDA 5C0CE 1PLCA 1UM5L 5I1IL 1ZHKA 1SLUA 3E0GA 4L4TB 2KDYA 4WHTA 4X7FC 3PREA 2A9ML 4K7PL 2X41A 4G7RB 4JRXD 1AGBB 5EUKA 3VFUB 3T3PE 2XWDA 2WMPA 4UU9B 1HWHB 2BWQA 4JFFB 4XPBL 2AI0L 3HOGA 3KDPB 5CLWA 4R97B 5JXAL 3EH5B 1YYLH 4BZ2L 1MAKA 3E6FA 5CJXC 1Z3GL 3FU7B 2PCPA 1LO5A 3K80A 4IHOB 3MROA 4XTRD 1CBVH 4EI6A 1BEYH 2ODHA 1CL7H 1TETH 4OFDA 5IM7A 3T0EC 5EC2A 3IFLL 4ZQTA 3QDGD 3RWHA 3QDJB 1F2XK 4PJDA 1KULA 3GDCA 5LGHL 1J5CA 3EYSL 5E7BA 2EICA 5H35B 4O00A 1M9SA 2NNCA 3ARBD 3DV4B 3ARGC 2VM4A 3KPTA 1M1XB 1TZHB 4UTAH 3ALWA 4IBYA 3P0VL 4U3SA 4XCCL 2BP3A 3ECVA 3F62A 1UG9A 5CKGA 2J5WA 2XJKA 4K94H 2VSCA 4G7VH 4MAYC 4LIQH 2Z31B 4XXWC 1I8LC 4XP6H 5C0AA 4F7TB 3QUXD 5D8JL 2EINB 3BPLB 1MLBA 2HT4D 5ICYA 2DKUA 4PWIA 4ZFZA 5ID1B 1X5MA 5IIEB 2DYSB 3GDBA 2WLLA 1OPOA 1QFWM 2AQPA 1G9ML 3L8QA 1JXJA 4JGJA 4XMLH 4Y9GA 3SGDI 1YEJH 4PP1D 4MB5A 4LAQL 4XVUD 1UM6L 5GJTL 1SYSA 5GS2H 3RWGB 1YEEH 2O6EA 4R26H 1GC1C 3B1TA 2H9GB 3GS4A 4JHVA 3AXIA 4QR7A 2NY4D 4CMMB 2X3AA 1DQLH 2ZG1A 3UAJD 4H0GA 4HV8B 3WNPA 2MRYA 1GKOA 5FKAB 3H9SD 4N2HA 4NUJB 3WO4B 5E8EB 5JO5A 4ZFOA 1U58B 3GNMH 4X6CF 4RISH 5GGQL 4HXBL 1WO2A 2LLNA 4B9ZA 1JFHA 4AL8C 3TESA 2L04A 5J89A 2IV9A 4J23A 4WI6A 2BP8B 3QR2A 4FI8A 2F54A 3UGXA 1BF8A 3U4KA 1NEZA 1WBYB 4PJFF 5I1CL 4FEIA 1T1XA 3GJFH 4ZUSB 5F89A 4PY8I 4DP9X 1TQWA 4G43B 5KSVB 4YLQT 1VFMA 3LH8A 5I1GH 1MAML 3QFJA 2YAFA 5D7LE 2EDLA 1FDLL 3E2HB 3HAEA 3SPHA 2O5NA 3K72B 3MX0B 4FG0A 2P5ED 3MJ8A 2CRIA 3CFQA 1ZHBB 3DX7A 1ZLEA 4P2QD 3RIAK 3GXDA 4WFED 2FNBA 1Z3RA 1IBZA 3UYRH 1SY6H 3PCYA 2ITCA 3ATDA 2WSPA 3BKCH 4FZEL 1UUNA 3EJYD 3QWOB 4W9FC 3KR3H 3OSKA 1URLA 4ODWA 3WHXB 1A25A 1JWUB 3EH2A 1PKQE 1WAPA 5CGYC 1FJ1A 1HFUA 4U4BA 5FCUH 4Z78A 2YHGA 3DX0A 1QSVA 3LRKA 4C4UA 2GJPA 4OLWL 2BX5A 1E65A 3PAYA 2XTLA 1EDQA 1CDYA 3U46B 1QTPA 1RERA 1L6ZA 5D70H 1EWHA 5GSVB 2JIXA 2XVGA 1BIHA 3WN5A 2N0KA 1N3NB 3HI6H 2ZWKA 2I85A 4IOFD 2H1LM 1C5CL 4ZQKA 5JZ7C 1E50A 4PRDA 4DAGL 1E2WA 1OK0A 3FNKA 4M8UA 4L3CA 1RK1A 5AKRA 3BRFA 1A1OB 2GQHA 3V95A 2R7EB 1G7HA 1XGRA 1BD2E 2D7NA 1DHKA 3QGVA 4MZRA 3I2CL 4G9FA 4JL2A 5KVDH 2F8OA 4UTAA 5J3HC 1TQBC 2KZWA 4GW5B 2WTPA 1PFOA 1TVDA 4GG8B 2V2WA 1U42A 1Q8MA 3QRFM 4K0OA 2GITB 3MXVL 1XTLA 1AO7D 3EOBB 5GISL 2FBRA 4EDWL 4OF5A 1MH5A 5CLTA 5HYJD 1JZ2A 4L5FH 4LDOB 3TEYA 3MBWA 3A67H 5DGQA 1XH2A 3BT2L 1UHVA 1AFVH 3L5HA 5KANG 1SFHA 1J87A 3O8XB 4PLKC 4ZX4A 2R2CA 5ETUA 5I1JL 4OQTL 3D05A 4FFZH 3H4FA 5I1AB 4F33B 4PJIA 2QL1A 1YYCA 3A24A 4Z7QB 3SO3C 4FI7A 4FX5A 2O6FA 3EH4B 1N5YH 1EJOH 1A9EB 2Y5TA 3QQXA 4N90E 4H2CA 5BS0A 5E24E 3WMQA 1LK3H 5JW5B 5K9QG 4L1TA 4AMWA 4KK5C 4JL1A 2VO8A 4JGUA 3QPKA 2J4WH 1SJEA 2VDPB 5H37A 5TH2A 1NAMH 2CALA 4NUMA 5JNYB 5GRUL 4ZOCA 4HALA 3S3SA 3MJGX 3Q44A 4LU5H 1R46A 4HPYL 1NCAL 3GSUB 3NN8B 2DWEB 3GJFA 3NEOA 3DSNB 3SODB 1AGEB 3EHBC 5DF0A 2FQEA 5ITFB 1HSBB 1AQMA 3KVDD 3G6JE 3H9HB 3F64A 3OL2A 4X7TB 5E5RB 3Q2VA 1WFIA 2WYZA 1GVIA 4HS6B 5F7KC 2B1HH 1SY6A 3KWUA 5BZZA 4B9IA 2YPVL 3M88A 5EOTA