3G7TA

Crystal structure of dengue virus type 1 envelope protein in the postfusion conformation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
397
structure length
379
Chain Sequence
MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVDRGWGNGCGLFGKGSLLTCAKFKCVTKLEGKIVQYENLKYSVIVTVTTEHGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGETWNRQDLLVTFKTAHAQEAVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGISYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLVTANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope protein
publication title Crystal structure of dengue virus type 1 envelope protein in the postfusion conformation and its implications for membrane fusion.
pubmed doi rcsb
source organism Dengue virus 1
total genus 56
structure length 379
sequence length 397
ec nomenclature
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3g7tA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 3g7tA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 3g7tA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 3g7tA03
3UZQB 5JHMA 3G7TA 5B1CA 4GT0A 2JV6A 3J2PA 4FFZA 5IREA 4AL8C 2R69A 2ALAA 5KVFE 5GZNA 1S6NA 1UZGA 5KVEE 2HG0A 3I50E 5KVDE 1Z66A 4AM0Q 3C6EA 4FG0A 2GG1A 5KVGE 1ZTXE 5LBVA 4UT9A 5LBSA 5AAWC 4UTBA 4ALAC 4BZ2A 3N43F 3UZEC 1TG8A 3UAJA 3N42F 4FFYA 4L5FE 4UT6A 1SVBA 4GSXA 1OK8A 1Z3RA 4UTCA 1URZA 3N41F 5LCVA 5H37A 3C5XA 2V33A 3IRCA 3WE1A 4X42A 4BZ1A 1PJWA 3P54A 4UTAA 3MUUA 2JQMA 5GZOA 2I69A 3N40F 5AAMC 5IZ7A 2JSFA 3J27A 3UYPB 2H0PA 1OKEA 2P5PA 3N44F 3UC0A 2R29A 3VTTA 5JHLA 1OANA 1RERA 3UZVA
chains in the Genus database with same CATH superfamily
2XXGA 3CU1A 3NRPA 4NT6A 1ORQB 2AV1B 1I9EA 2A1WL 3QR2A 4Z6AT 4LK4A 1AKJB 4XNQA 4XMLH 5ANMB 4FJ6A 5E2UH 3QDAA 2WQUA 1RZ8B 4ZMQA 1DBML 2CUIA 1MPAH 2OL3H 4OT1H 2Q76B 4QYAA 1B90A 4MQTB 4W6WB 3GXPA 4NHUA 4KUZL 3BLKA 3B1TA 1JV5A 1C5CL 2V9QA 4NKOB 1UZ8B 1U0QA 2HCZX 3PL6C 2FJUB 1ZVNA 2WSKA 1CD1A 2XA8H 3EF7A 2EP6A 1KCLA 4G43B 1EAQA 3V6FA 1OB1A 2CO1A 4GI8A 4GW4A 1UQSB 2ICCA 1AGDB 1A6WL 2OFQA 3FCSA 5F8RC 5JHLH 2F58H 4ANXA 3BPCB 2WUCL 1HEJC 4WFGE 1JN6B 2UZYA 4A66A 2V2WB 5CFAA 3S96A 4YJZL 2DD8L 2HH0L 4AE0A 3NBNA 3N06B 2PR9A 3QPXL 5AB1A 3L5IA 4ILDA 1JTPA 4ALAL 3MLYL 4L4VA 2X6UA 1EZUA 2YBRB 4XMUA 5LGHL 4OD3H 1E65A 3UERA 4X8GA 2LGNA 1ZA3B 4OFYA 4ZX4A 1FV1B 1V54B 1INEL 3W0WE 4RBPH 2KERA 2VERN 5EG6C 1X5ZA 1S5IH 4JO4H 2K78A 3ROOA 3ZL4L 3MRHB 5KANI 3A21A 3EOAB 5DJAA 1CGXA 2E27H 1KJ3L 4L2YA 3V5HA 1YDPB 4GQRA 2DQ6A 3GHBL 3N55A 1EZVX 3ILQC 3MUGB 3QIUA 3PWJA 4QOKD 2VLJB 4MMZB 3APMA 3OKKB 1CGSL 5DRNA 3MO1A 3PJNA 3T0VA 3G6DH 4IJ3B 4JM2B 2HRLA 3OXRA 1H6TA 4UDTB 4Q58C 4F7TA 1F00I 3KDMB 3O0LA 1M9WA 3FHAA 4P2CG 3HG1B 3V4PL 2Z1PA 1IUZA 2BZCA 1OF0A 3BKJH 4MNGE 1PG7W 3DOSB 4XODA 1HX0A 2PPAA 3PHQA 5DJCB 3ZT5A 1SQ2N 4UT6L 1U58A 5FX3A 4OLWL 5DJ6A 1Y6KR 4DQOL 1QSED 5CAYB 1RZKC 2H1PL 4XXDA 4PG9B 3UAFA 5FDWA 1HT6A 1OTSD 3ETBF 4UNUA 1W6WA 2X4PB 5EZJB 1A4BA 2VO5A 4JM2F 2UXVA 5EU5A 4NDMB 4ABUA 2AANA 2PR4L 5DCCA 5I1CH 3FT9A 4MASA 3CPLA 2HT4D 3G7TA 3KWWA 4UNVA 1MJ8L 3BIAX 1AIZA 3SBQA 5IK3B 4JY5L 2F5AH 3ZTJH 2VN6A 4FFVD 5IW3A 1H3VA 3E6HB 4LHUG 4U4BA 3EBIA 3C6LC 1DJHA 4PRBA 1L0YA 1K72A 2P5EB 4R4BB 2PXYC 1R1CA 4WHTB 3CFNA 1KCWA 1KIUA 5L0QC 3KH3A 1OAYH 3I75B 1YMMA 4YWGL 3ZE2B 1TKWB 4IKKA 3QUKB 1IEHA 3TT3L 2F53D 1N67A 3LS5H 4NP9A 3RWIA 4I2XE 5CP3A 4ZAKD 4B3EA 1ZSDA 1EEYA 5CILH 2ZOUA 2EIBA 3FUMA 3GMRB 1JRHI 1KXHA 4P3CH 4FULA 4AXWB 3K2KA 4NX0A 3QDGD 2MFNA 1KN4H 3GUFA 5EIIA 3EYSL 4HJSA 1MLCA 4QNPF 5IJBC 3MBWB 5FDYA 4I0PA 2HX7A 3ZE2F 4FYTA 5CKGA 2B1HH 3DVIA 1FIGL 3BD3A 1IM9D 1E4WH 3BAXA 2EC9T 1GKEA 1A8ZA 5D7LB 3UTZB 1JMXA 3WHXA 3C2AH 1Q9OA 2WPGA 3SGDI 1IGCL 1KCSL 1MHPH 4BDVA 1M57B 2XXCB 3S37H 5IY5B 1IX2A 3LS4H 1G5GA 3LXUX 2VZ3A 4TNVK 3QNYA 5C09E 3BAKA 1KTCA 1YJDC 1Z9LA 3NJXA 5E5UB 4RMVA 4YDVB 3N5AA 4G9FA 1FL6A 1MHEA 4P2QD 4EI5B 1G7QA 2R9HD 3T1WA 3OSKA 5DT1L 4JBSA 3LY6A 4M5SA 3GSUB 4PWJA 2MQGA 4IRJD 3CTTA 2VDLH 2VDQB 2NY0B 2FEEL 3HUJA 3LV3A 2FZ3B 5DUBA 4QYOA 1KIRB 4JJ5B 5J6GB 1MAMH 4HU2A 1XH3B 4X6CE 4L37A 4ZS7H 2LQRA 1M56B 5IFHH 2ZUQB 4ZX3A 1MAKA 4FTVE 5C2BL 1UM6L 2MOVA 3AG1B 3QQ4A 3O6FA 3ULUH 2QJDA 4R7LA 1T7VA 2G9HB 1BF5A 3G6JE 1NBYB 2FYYA 2ATPA 4N3TA 1IAOA 4AKOA 3ZTJG 2QVTA 5EB9A 3TO2B 2CO7B 3F6JA 3P0YH 4PWEA 2DLEA 2P5WD 1I4FB 3FU7A 5LXVA 1RPQA 4A2LA 4HIEB 2IPUG 1J8KA 2PLTA 5BS0A 3UC2A 1DBBH 1KC5L 2HVBA 4NHCL 5EZLA 1HE7A 2P1YA 4CN6A 3SDYL 3KEDA 4GINA 4XI5C 2FBJL 2A9CA 3TWCH 1P5UB 4Y5VC 3FCGA 1VRSA 1YEHL 5KVFE 4JHVA 4OF0A 1EFXD 3GSWA 3WHE1 3HN5A 2APWA 3OLDA 3KWUA 1JHLH 1L0XA 3F7RA 3HI1B 4QF1A 2AGJL 4UM8A 5CCKH 2CLZB 5TDPB 2HVKB 1RUQL 2YARA 1J10A 4G8FB 3LEYH 3GIZL 2OZ4L 1H5BB 4JKPL 5H94A 1OTUC 1VENA 4FHBD 4ANVA 4FXKC 5ADOH 1QACA 3L9YA 3B34A 3MBXH 2QGDA 2DRUA 4HMDA 1AXIB 3B2XA 4LBAA 4R5TA 3IMWA 3UJTL 3KPOB 3DMMC 4H20H 4IDJL 4AM0B 1CXLA 1S9KC 3ZW3A 5D1ZA 2FTAA 2J71A 5D6DA 1J9CT 1Z5LA 4J3WA 4NN5C 4JJOA 2CD0A 1HILA 4KUCF 1DUYB 4UWQB 1MHHB 4RAVB 3DPDA 5DZVA 4GAJH 4AIXA 1EAPB 3WO4C 3RZCD 5IB3A 2HT3D 2NUPA 2IOMA 3AY4A 4F3FB 5JPMC 4JKNA 2O5XH 1WLGA 1U8OB 2NY2D 5AENA 2ZXEB 4UV4L 3NIDB 4NZTL 3FQ1A 1B2WL 5DS8A 4KNUA 1OPGL 1I8KA 4HZ1A 5J6HB 2QLVB 5B3JE 4ZMXA 1CZ8L 4MJ5A 4BZ1A 1O7VA 5JHDA 1LILA 1A7QH 2Q3AA 4Y4HA 5B39B 3DX7B 4YE4L 1NLBL 4X4MA 3U4EA 1KJ2H 3QHTC 3QNXA 4KXBA 4JE0A 4RMRA 2VUKA 3BSZL 3U0PA 1N9PA 2KLRA 4G8GA 5HHME 4J23A 1VACA 3NCMA 2ITDB 3NIDF 1QPXA 1GZHC 1RUAL 4QHLA 4OV5B 4ZJ9A 1HOCA 2VDKL 2YA0A 3VVVA 1T7WA 4I9XA 5BV7L 4ONHA 4MNHA 4GKOA 4QRAA 4P3DA 1FDLL 4AIZB 2WKOA 4WFGD 5E8DL 2ARWA 4B9KC 3TNMA 3QJHA 2IWEA 1SJHA 2RCSH 2M8XA 3VFWB 1E3FA 1EJFA 3AG2B 2LTQC 4OZGE 3PWVA 1VFBB 3GXTA 5BO1L 4LASL 5BQDA 1X6LA 1YEDA 5HPOA 5JQIB 1V10A 2EKSA 2HFFB 3HCVA 3NN8B 4X0KB 1J1OL 3P2BA 1KFGA 2PO6B 7FABH 2MQ3A 3EJSA 3VAEA 2FQEA 4PJEE 4YHPB 3W0WD 4R97B 3Q5TA 4ODXB 1XT5A 3U79A 3UYPA 3BZ4A 4V11A 3ETTA 3CIQA 4TL4A 1A02N 4F15B 1EWHA 2B4CH 4HD5A 2WWKT 4K9EH 3ZU8A 3JTTA 1P6AB 3IJHA 1DVFD 2E5EA 3SD5A 3II2A 5JDJA 1DBAH 3BLPX 3K8KA 4PB0H 2FJSA 3P3RA 3MNVB 3RY4A 3RZWA 4F7KA 4MQSB 2X4NA 2PMZA 4RFEB 4MZ2A 1CDCA 1A3ZA 4D0BA 3FTSA 5E2UL 3PL6D 2YPLB 4KKLC 1PVHA 3U30C 5DVLA 1Y7VA 1KN2H 1R6VA 1MPAL 3BO8B 2OL3L 2Q0ZX 3IDGA 2C5DC 4OT1L 5ETUA 5GS2D 4YEFA 3F7KA 4HCRH 4OLEA 4MCYB 4TS6A 3ILPB 2BIOA 3ULVF 1UH3A 3NCBB 5CMAB 32C2A 2WVUA 3MCG1 4M02A 2XA8L 3FSVA 5C6TH 2HG5A 4GQPH 4FMKA 3P3SA 2P3YA 4UOJA 4NUJA 3SGKC 5L2KE 3LB6C 1RAMA 2WCGA 1U33A 2GEEA 4MMYA 4NPYB 4U2YA 3UO1H 3KVDD 3KVPA 2ZJSH 5JHLL 1O6TA 2F58L 3WFDH 2VLRB 3BT2H 4ZMVA 4X83A 3UMTA 2QZ5A 3KPSB 1WAAA 3UPRB 2DS4A 3ZHLA 1UUSA 4QHUA 2CUHA 4FZEH 5KN5B 5K5YA 5D70H 4KOBA 2O72A 3QARA 5T3XH 4UAOC 1G4RA 4IMLB 2PTUA 2IIJA 3SKNB 3CUPB 4A55A 1FI8C 2NQDA 2EDTA 2PNDA 3G9VA 4OD3L 3SPJA 4G7SB 5FO9A 3RY6C 4H25B 3S7GA 5IZ7A 4L05A 5KAQF 3KS0H 5I6NA 1U8PA 1OGTA 1I7RB 1RXLA 4ADGA 3O0RH 1S5IL 1BP3B 4JO4L 3I9PA 2OLDA 5T3ZE 1JRHH 4M8QB 3O41A 4XPAH 1S7RB 2NX5B 5SX4I 3CFIC 4X5QA 4UZUA 2E27L 1TZHA 3A6OA 1FFOB 2YD4A 3P2DA 4JY6A 4Y1AE 3O4LB 3DV6A 4U1LB 1OE2A 1QI3A 4QRTB 3MV8A 5INCA 4BYHA 1WDAA 3W11C 3ZDXB 3FQWB 4X6DB 2CBQA 3RTQB 2IADA 5FFGA 4R4FL 4FQQB 3NEEA 4N8UA 4TVPH 4CMHB 5KANG 3G6DL 1Y1DA 2HN7B 3SGDH 4Q14A 2YZ8A 1MCWW 3RDTC 1FH2A 5FO2A 3J07A 5LN4A 3BKJL 5CEZH 3Q2CA 4XBMA 3ZHNA 3VMPA 3L9RA 1FZJA 4J3UA 4HGWB 1PLBA 2UWEE 4OF3A 5CGYD 4X6DF 2BZ7A 2N3JA 5C09D 1B0RB 3T4YB 4X2UA 5H8DA 2GIXA 2VZVA 1CTMA 5IF0A 3WTXA 1N6QH 4JDTH 4LGPB 3V6OA 3IBOA 5HHVH 5H4ZA 1WG3A 1H9VA 3PPEA 4PPTA 2M2DA 1F2QA 3UGUA 5J1TC 5I1CL 2EDLA 5E9NA 1X3DA 5ID1B 3LKPA 2CO6A 4OJFH 2R1XA 2PWEA 5F3FA 4CVXB 5FLVA 1N7MH 4XN9A 4XN4A 5DZNA 1KJVA 3WTSA 1CFVH 2F5AL 3ATBA 3ECWA 5LDSA 5EBWB 1KTDA 3SDCC 3T1FB 3T4AB 3D5OF 4HH8A 4ZNEA 1HKLH 1NFDA 1OF2B 3AMLA 3BP5B 3CMOH 3VQMA 4ORGB 4DAGH 2PWFA 1S7XA 5IB4B 3V0JA 4FTVD 4J3BA 2OTWB 4XT1C 5MEPB 2M26A 4M4RB 4PJ9A 4EUPH 4N6RA 5E03A 1EZSA 2YXMA 2RFXB 2VR3A 4AOFA 1KY6A 2J6EA 3LS5L 4O2CA 5HGAA 3B8YA 3LQAH 4UT7H 5CJBA 5CILL 2ZSVA 4LVEA 3DHPA 4P3CL 1ETJA 1VFMA 4DP6X 5EBMA 4XO9A 1EXHA 1YPZA 1TNMA 2JJTA 1KN4L 2V0AA 2WSDA 4YBQC 5FHAH 2N0KA 5G5DB 1BIIA 2V37A 3MRQA 2VJ0A 4AQEA 1AHWC 3CXDH 4FEMA 5TK2A 2B1HL 1BAFH 2EZ0C 1E4WL 2OSXA 2X7LB 1MIEL 2VDOB 2D7NA 4M93C 3X11A 1KULA 3C2AL 3FT4B 4HUNB 4WNSA 2OR7A 3S37L 5IB5A 3LS4L 2QR0B 5I8EB 5IEKB 5CD3B 1Y0LA 1A64A 1KXVC 4YDMA 2UYLA 1MWOA 1AXTH 2VYRE 4S2SA 4Z0XB 2FEDC 2WXLA 5FCSH 5AOLA 3DTXB 5A2FA 4KQ3H 5HHOA 3FW6A 4WU5A 3KPRE 1IC5H 5MENE 3GYRA 4GAYB 4AENA 1B0WA 2VDLL 3TEXA 1NINA 3NCFB 2ADIA 4C4KO 4LBEA 3D85D 1GYCA 3HB3C 1MAML 3P77A 2VMDA 3ATDA 2G9KA 2HB0A 3VD4A 4HJUA 4ZS7L 1D7DA 5IFHL 2F0CA 1I8MB 5BOJA 4RWHA 4KXAA 5A7BA 3ULUL 3B43A 3FHQA 3H2PA 4F8TA 1JPGB 1JGIA 2IG2H 1FVEB 1QKZH 5F7HA 1RSYA 2J1ZA 4XI5D 3GLDA 4N22A 2DQIH 4GT7A 3P0YL 4GSQA 4HFWB 4IBZA 1K8DA 5DO8A 1BSIA 2HMIC 4ONFH 2IPKB 3MU3A 5DJZB 1DUZB 4PRIA 3ARUA 2NDGA 4X98B 3TBTA 1IC1A 1DBBL 2DLHA 3GUTA 1PY9A 5HHMD 4KTYA 4PHZA 2QQKH 2ZUXA 4EUPG 3BSGA 1DVTA 4HOZA 2JKJA 1L9PA 4UTBA 2ROXA 1G0XA 2E7HA 4BJLA 1OTUD 3MPCA 3TWCL 4YK4B 1J8HA 3AB0B 4QRQB 5HGDB 1VIWA 2XPGA 1PZ5B 1P1ZB 4W4OA 1JHLL 1GC1H 3K1KC 5CCKL 1XF3A 4GKSA 2C9AA 2ESVB 1UYWH 3DMMD 4CU6A 1FFNA 2W38A 5LNGA 3VRLE 3VFVB 4YBLC 3LEYL 5A2IH 5IVNA 2D31B 2R0LH 3BUQA 5GGRB 5I19H 1NCHA 3MNMA 3S48A 3VXOB 2XACC 3C60C 4ZTPH 1DEDA 3IN2A 5ADOL 1EMTL 3L2NA 3MBXL 1U92A 4HUWA 4G42B 4I18A 3BKYH 4X7CC 1EDYA 1X5YA 1EEQA 2AK4B 4KMLB 4H20L 4LSUH 2CIKA 2VL4A 5SWSB 2DOCA 4NN7C 1OP9A 2VRKA 5EC2B 4Z7UE 2M1KA 4N9GA 4TNGA 1KY7A 2YEZB 4G80B 4MJIE 5A16B 4Y2OA 1JFQH 3LDBC 4GAJL 4LAJH 3UAEA 1U93B 3H54A 1N12A 1AHMA 2Z7ZA 3QVAA 4LPVA 5AG9A 2H3KA 3ZTNH 2O5XL 4O2FA 4ISVB 1PAMA 3OZLA 2NSXA 4S1SL 2L4OA 4KTGA 4U1SA 2Q1EA 1MHCA 3FTGB 1A7QL 1UURA 2I9LB 2LAGB 4E9RA 3ZJAA 1R0AH 2XXFA 1MCHA 1SOKA 1HZHH 1KJ2L 1LO2H 1OCZB 2B5IC 3LKSA 4CW1B 4Z7VA 4HCGA 1I85A 2FT8A 1JZIA 2IDSA 1Z32X 4O4YH 3BAWA 3EADA 2ED6A 5IVZA 2GFBA 3EFFB 3GHEH 1JYWA 3CFBB 4MLSA 3IB4A 2JKWA 4Q7DA 2HT2D 4AQ1A 1BXUA 4C56E 3LQMA 2FX7H 3EBHA 5L2KD 4YSEA 3GLZA 3BZEA 4KROB 3UYOD 4YE0A 5GS1A 3UACA 3O3DB 5F21B 1XL4A 5E1GA 2RCSL 5DVMA 4Y19D 4MCZB 1EXUB 1A6UH 2C1OB 4N25A 3U6XS 4UDUB 1AZVA 1RJLA 2I26N 5F7LB 3DPBA 2UVEA 2AEQH 4PJCE 2WJ5A 2YUWA 1KZYA 3WE6A 2EIZA 1G94A 5G4NA 4TLUA 4KQ0A 1XAUA 2NY4C 7FABL 3DVGB 4LEOB 2ZD0A 2JQAA 3D25B 2C7UA 1E67A 5EU3A 1U3HA 3MRDA 2AERT 4AE1A 4F20A 4CSSA 5C0CB 4PR5B 5SX4H 1L0PA 1E9PA 4KKLD 5GQBA 5T3ZD 1UXWA 2B4CL 2GK0A 2O1AA 1DANU 3BXNA 4K9EL 4KNSA 5TH2A 2YMTA 3TT1H 4AH2A 4Y1AD 4DGIH 1G7MB 3ALPA 1FZMA 1TQBC 4HK0A 1DBAL 2A9NL 2C9PA 2ZOOA 4HDIB 4PB0L 3W1ZA 3GJEB 5DJ8A 3VXPA 3B2PA 3L9EA 4ZPVA 4K3DH 3OKOB 1X5FA 5KSAB 4KWUA 1ZWIB 5CD5C 1KN2L 2OS7A 3REVA 4G6JH 2BC4A 1M1SA 4NENB 5B8CB 2JQZA 1YNTA 2ZZUT 3LB6D 4HCRL 4AJ0A 2R2EB 2CRMA 1U91B 3IETB 1M1XB 1WGOA 1XCQA 1AQDB 4F37K 1XF4A 3IKCB 4JO5A 4Z7WE 4MX7B 3VXMD 5IT2H 2V7HB 1JWMB 2BS9A 3FQNA 4P06A 1P0SE 1DJYA 4A37A 3QI9C 4BFBD 4MJ6A 5C6TL 1ACXA 4OGAC 1SDAB 4XO4A 2G75A 4I48B 4LLWB 4JHWH 3CDCA 1S9XA 2OZNA 3UO1L 1F18A 1NGWA 1MIML 1BQHB 2I85A 3U0WH 2ZJSL 3WFDL 3BT2L 2DYPB 4F7PB 4WTQA 1RZJH 2GTQA 3BP6B 3WGVB 4CVZA 4KRNA 3B6SA 3QNZA 3RIKA 5MEOB 2AITA 3MRGA 4AX3A 4FZEL 5F3HA 4AEFA 1YMHB 1KNOA 2WLYA 4LVNB 5D70L 1O6SA 1FA4A 2WWMC 4QRPE 5T3XL 3K5RA 4UQAA 4E36A 5C70A 4AVKA 5ES4B 2CSPA 4GG8A 2WVSA 3GMPA 1YAZA 4Z8FH 4EZMA 2V9TA 2CRZA 1UB5B 5C7ZA 1N70A 3CSPA 1H3PH 1IAKA 3D4GA 3W11D 3U0TB 3O0RL 4YDLC 2VAAB 4KGJA 3DBXA 4ZXBC 1JRHL 3CXFA 2B16A 2OMVA 4XPAL 1YHPA 2BVOB 5DD1H 1X4XA 4AGPA 3IMVA 3RDTD 3UJIH 1TU2B 2AMUA 1AIFB 3MOQA 1PBYA 3VXSA 1O6VA 3II3A 2XHNA 4DUXA 1FYTA 4JPIA 1AI1H 4B97A 2YA1A 5LGYA 4HIHB 3T0EE 3IJYA 1W0VB 4TVPL 5JXED 1JZEA 2NCEA 2WC7A 3N85H 5B21A 3VFNA 5IMOA 1NGZA 4U1GB 1HJCA 1A7PH 2O30A 1U41A 1C1EH 2YBGA 1J0ZA 5CEZL 2ADFH 4P99A 2G60H 3QRFM 1PD0A 5E56A 2PWDA 2BLFA 3TA3C 3WN5C 1N6QL 4MMXC 3M1BA 3MRIB 4IIQA 5AYQA 4IU2B 3CLWA 1IEBA 2VN3A 4JDTL 5HHVL 3SDCD 1BYPA 5HXMA 1IL1A 1R5IA 2D4DA 5I2IA 2JI1A 3KPRD 4N6QA 3WEBA 4KDTA 5IHZB 1LMIA 5MEND 4OJFL 3I6GB 3WJMA 3K6NA 3QS2A 4RGNC 1F1GA 1N7ML 4HU8A 3ULAB 1PGRB 3AQZA 1J5DA 3BZ5A 1CFVL 4J3TA 5IJVA 3DX9A 4MNQA 5ENWA 3U6RB 1HKLL 3CMOL 3EJRA 5I15H 4DAGL 1HI6B 2WP3O 4W6YB 3ARZA 4Y1TA 2OYKA 3WNJA 2OMWA 4LU5H 4MAZA 4Q89A 1XX9C 1NMCC 3BUYB 3QEHB 4KK8C 2FL5A 1QR1B 3SQOH 4KI5F 1FPTH 5I0WA 4Z7IA 4B5ZA 1J88A 2H0FA 2BCKB 3GNMH 5DK0A 1YYMH 2EZ0D 2DJUA 3DX3A 3LQAL 4FFYH 2BNUB 5AW7B 4A1RA 4AGQA 2FWOA 2Z65C 5L4JA 4EZKA 4XRCB 4NQEE 3OKLB 1C08B 5FHAL 3VYPA 1OCCB 3QEQA 2X2JA 3GBNH 3LQZA 5LAXB 5I1LA 1ESOA 5JOEA 3BH9B 1MSPA 3CXDL 4LSSH 5TPWH 5T1JA 1BAFL 4EDXA 2VR9A 4OIAA 4RZCA 5SWZD 3F8UB 3LIZA 2VAJA 1S7SA 2WK2A 4QJ4B 1FO0B 1OO2A 1D6EB 1REIA 3T2OA 4N2OA 3BJ91 3OAWA 4FDWA 2ZIDA 2FT7A 3PE9A 4J8QA 4CU8A 4PRAA 4MBOA 1NSNL 4RGNE 2XV3A 1FHGA 1J0KA 2GI0A 3DV4A 4X5PA 3ZMNA 1AXTL 1S7UB 4JGMA 3FO9A 1P1VA 2C3HA 2O6FA 3C5ZD 4KQ3L 1ZE3H 2DZEA 4ENEC 1SXNA 4ZUVA 5BZZA 5I75C 1JK9B 1IC5L 3K8MA 2X4UB 1EHKB 5LG6A 3QIUC 1AGBA 4PJDE 1LO0H 4N2KA 4AJWA 4A04A 4Y7MA 5F6IC 3KLAB 2Q86A 1MOEA 4MJID 2IXQB 4KNQA 4PAZA 3WKQA 1OCOB 3CDGA 3QJUB 1XGPB 5GSVB 4PJBB 4GQZA 4K23H 2FB4H 4W9HC 4WI8A 2HMID 4TNEA 4ZSOA 5KSUB 1NCJA 3PNWA 4FQXA 4LPTA 3TEZA 4LRIA 4XCEA 4CNIB 2GITA 1OEZW 1MFVA 3DARA 2IG2L 3S5YA 5ISZE 2WIIA 1QKZL 1E9OB 3T2QA 1NEZB 4O02A 2DQIL 4W9EC 5AUMA 2H1LM 1E0OB 3IXAB 3QJZA 1HYSC 2MNUA 4PJBF 4DUWA 4ONFL 1HL8A 1MCFA 4ZQKB 4L8BA 2FUTA 3IMTA 3FNKA 2D7TH 4JFYA 2QQKL 5A2AA 3GSOB 4IRZH 4C56D 1UXSA 1CU4L 4K9EC 5EULV 4BIKA 5IB2B 1QVOB 1IBZA 1XR9A 4DO6A 4UF7C 5K69A 3C60D 3D2UB 4QXTB 1JNLH 5HYJE 2ZX7A 1IE4A 2D7PA 1OHZA 3CZFA 4XN1A 4UV7H 1GC1L 6CGTA 4HD9A 1XGUB 1UYWL 2WLIB 2P9RA 4FNRA 2VLMD 1ZA6B 1QSEB 4WK2B 5C0JA 2R0LL 1P7KB 4LHUD 5CN1A 3CLEH 5I19L 4IHOA 4BRJA 4X8XA 1JFHA 1F4XH 4ZTPL 2MCG1 2F15A 1BX2A 1RKRA 2IOIA 1XCTB 3C6SB 3GT6A 3UADA 3DXAA 3BKYL 4LSUL 1NWPA 2IBZY 5EF2A 5FOJA 5DEGA 4QTHB 5C0AA 2I07B 4I0PC 4LQ1A 4DETA 2ZTBA 5CSBA 1G0YR 4BFIB 1IBYA 1JFQL 2CR6A 4F27A 2GBVA 2UXGA 4BD4A 3FSAA 5EOCJ 1G9NL 5DLLA 1UOLA 2V3DA 2E56A 3INOA 3M7OA 2ZXGA 1W72B 1W8NA 1CLVA 2AJZA 3ZTNL 4N0FA 5KS9B 1PEWA 2J2ZA 3QFDA 4GYBA 4J4PC 1JG9A 4J2XA 2WY3B 5ACZB 2H32H 1KPUA 3MA7B 4ZAKB 3D39A 1ZXKA 4EI6B 1C8QA 1R0AL 2DQMA 2XBDA 4GRWB 1HZHL 1I1AA 1LO2L 5KBLA 2P7TB 4LVHB 4RFNB 4O4YL 5C3TA 3HMXA 3QDGB 4YHLH 2R27A 3O3AA 3GHEL 5F7MC 5KS9F 3X1EA 1N10A 3AXIA 1YMME 1DL7L 1GSMA 1IM9B 2FX7L 5HY9B 4G11A 2GVYA 1QYGL 5DDHA 4GRWF 1BBJB 1QRNA 4JG1H 4GKZA 5I17B 2V2XA 4R7DB 1VFUA 3U46B 5FB8A 3O6FC 5IB1B 1MLBB 2RD0A 1J48A 3OVUB 1A6UL 4GFXA 1WUZA 4DUVA 4GSUA 1U8NA 4QRPD 1BXXA 2AEQL 2GTZB 4NZDA 2QMJA 2X4RB 1IVLA 5DQJB 3IU3A 5DHDA 4QR7A 4P2QB 5IUCA 3NDYE 4U1NA 5C0EA 1DQDH 3WLBB 4K7PX 3NIGB 4IRJB 5JA9A 1I3RA 1PJWA 3UTQB 4JK0D 3ZHKA 1HEZA 3RPKA 4KX7A 4O51A 1MZYA 2C34A 4GS7B 2IGTA 1B6UA 5CD5D 3VDAA 4MA1B 3RQ3A 3TT1L 3GRWA 5K1JA 4DGIL 3HFML 3RJQB 1O5DT 3BISA 4G9FE 3ZRCC 3CQFA 2DEXX 3T3ME 3EH2A 3GSNB 3VFUB 5J11B 2YUZA 3NIGF 1Q90A 2Y0SA 3QEGH 4K55A 4ZFFA 3DSFH 1JF1A 3LN5A 4W81A 3T0ED 2WAHA 3QI9D 1KLGA 3M7FB 1H3TA 1A4JA 4G6JL 4LMQI 4FEIA 4OGAD 4C59B 4LOVA 4DZBA 3MRLB 1CB4A 3QUZA 2DIAA 4ANUA 4KH2A 4ODUA 5FWRA 3L3KA 3S34H 4JN1H 2CK0L 4E42A 4LLAA 5IT2L 1CFTB 2C4XA 2V3FA 4JB9H 5IBLC 4JFPB 4Q2ZA 3B7UX 3UBXG 5D1ZC 5EU7C 2AW2A 3Q0HA 4JFTA 5D6DC 3WTUA 1A5FH 5FKPB 3T0BA 4XX1G 4POUB 3SY0A 5I73C 3OAZK 4X50A 1WISA 2WWMD 2GY5A 3U0WL 3AQXA 5SWQB 2F2HA 1R3IH 2EYSA 1AVAA 2QPEB 4XNBA 1VGEH 4WENB 4E5XB 3V0AC 2V2TA 1RZJL 1V05A 1EFXB 2HJFB 5CEZE 3KCPA 4WUUE 3AY4C 3K3QA 5AD0A 2HVJB 4IIZA 4EN2A 4GO8A 3VXRA 5BS0E 3APFA 1QTPA 3WFBH 1BVNT 3OMAB 4B96A 2A6KB 4ZXBD 1T80A 3NGBB 4Y4HC 4FG0A 2WLJA 4Z8FL 5C0NC 1N0XH 2BSEA 2YUXA 3UTPD 3S98A 1GY1A 3VI4A 4DK5A 1QZNA 4Q4EA 1ZLSH 1RJYB 3I6LE 2LW3A 5D2NA 5IMLA 4PTUB 3ETBJ 2XKNA 3QO0B 4NWTH 4M9PA 1QLRB 5FGBA 1OSEA 4YO0A 1G7JA 3WFHB 1NGYB 4MA7H 3FRUA 1KFAH 3VD1A 4ZT1A 5DD1L 1BLNA 3UJIL 3IFOA 3NRFA 4X6BA 3RZCB 4EE2A 5KBKA 3W37A 4NQED 5DWPA 4E9TA 2Y1AA 2ZSWA 3QUMB 4IRSA 3I9GH 2B59A 1ZLVH 43C9B 4CGUB 5DJYB 3VH8B 1AI1L 2VERA 1BVNP 2VW7A 4YSOA 3TA3D 2NY2B 4JREC 5EU7E 5MEQA 3N85L 3OAUH 1FLRH 3LMJL 2B9BA 4GP4B 4ZFZB 5BW7A 3I3DA 3RWCB 1A7PL 1M7DB 3UZVB 4J3OC 1X9QA 2G5BA 2JI3A 1C1EL 2GJJA 3AREA 4W6XB 3E0GA 1DFXA 2G60L 5KYUA 4JE4B 1IQDA 4HS6B 4JCMA 1FGNH 3TN0D 2CNYA 4G2AA 5E9DA 4RGND 1EHAA 1BM3H 2DQFB 5DEJA 3Q44A 1MZZA 4XPBH 4PRNB 5FA3A 1T1ZB 2GHZA 5FM4A 5T5FA 5LNDA 3MLUH 1G6VK 3LZNA 1RURH 1AXSB 3L3OB 1BMZA 1GAFH 2XJKA 5K9OB 3GWJA 4X4ME 3MGOA 2CLVB 2ODHA 1F0LA 5EEUA 1T5XB 4PTTA 3MRRB 4NQCE 4G8GE 5DYOA 1XZ0A 2N01B 3HG5A 3V5DB 1OSYA 4IGBA 5I15L 1ZLDA 2NNAB 4PJHA 3X3GH 3D0LA 1N3NB 1SXAA 4LU5L 3HBPA 4LLUB 3CFKA 4KKBC 4RNRA 2DMCA 2LLNA 5DU7A 1E8YA 1AD0A 3SQOL 1FPTL 2Z91A 2FJHA 4FQHA 3E6FA 4JEGB 4OLXH 3BUIA 5ISZD 3GNML 5EDSA 3RUGA 1YYML 2CDEB 1X5LA 4JMXA 3BWAA 3H2WA 4KX9A 2W5PA 1UOVA 2V17H 4X6EB 3Q9QA 4F8QA 1QBMH 4WQOA 2ZX8A 4PY7A 3QCTH 2CO2A 3WNIA 3G9AB 3R0MA 4WEBH 4G83A 2W60B 4XGZB 3BE1H 2X9ZA 3GBNL 4OFYD 1PKQA 4JO8A 1NGXB 1YEGH 4Q8BA 1SQMA 4LSSL 3S4SA 1JK8B 2APFA 2APXA 3DIVA 2DMHA 3IGAA 2UY7B 2X88A 3AXLB 3PL6B 4LLMB 4P2RE 3ARFC 4FQ1H 5DJXB 1G7HB 4YOKA 5DA0B 4JN2B 5IQ9B 3H6JA 4JRXA 3TWYA 4ENED 1T1XB 3JUYA 1K9TA 3FT3B 4KK9C 1G9NC 4UMGA 3X13A 5AW8B 4MNGB 2WNWA 1BOYA 4YH6A 4BELD 1JNJA 2W07A 5DK3A 5E8EA 1DLHA 2V5TA 1CGVA 3EYOA 4EQ2A 5I1GH 3PABA 3WGUB 2Y7OA 4B9CA 3JVGA 4QAWA 4EVNA 2X42A 4U33A 1T2QH 3KGSA 2R69H 3FQXA 5GS0C 1VFOA 3RTLA 4UU9A 3LPPA 3LH2H 5J89A 4PVMA 4BE6A 4NO3B 3FQUB 1LO0L 2XVKA 1DVUA 1G7LA 5F9JA 4BGLA 4AL8H 3NAAH 5DMYA 3DI3B 1WQVT 4WTZA 1K3IA 3U25A 4C83A 1HU8A 4AZ8B 4B0MM 2BCMA 5EUOA 1HYSD 2V5SA 2IGFH 1UENA 4K23L 1CUOA 2FB4L 4XC3H 5EZPA 1FZKA 4EIGB 1WO2A 1G7IB 2ZF8A 4JFUA 1H0DB 2XICA 1CS6A 1WAAE 4GBXA 2H2PC 2ZYSA 5KUKA 2F6AA 1AGFA 2K3HA 2Q7YA 1KGWA 4I77H 5CM1A 5M95B 3CFUA 3QG7H 2JJUA 3WNLA 1P5VB 1E40A 3V6OC 4I2XB 3ZL1A 1WE5A 4TL5A 3PWLA 4CADB 1ZV2A 4M7JH 5MI0C 3VXTB 2VC2B 3AXHA 5HYSB 2D7TL 5IGXH 5JIPA 3OQRA 4IRZL 4X9GA 2VITB 1YMMD 1NCTA 2WHVA 4JO1H 3GSXA 4AGLA 4IOSD 1HAWA 4LGSB 3KM2A 2VSKB 2WXJA 3CJJA 2W81C 4ODWA 4CILA 2HP4A 3L5WA 3STLA 1BREA 3H85A 5B3SB 1JNLL 1DANT 1C5DB 3V0IA 1JBJA 3S2CA 2Q6WB 3ZYOA 4UV7L 1FBIH 3HRZA 1TTRA 3WELA 4PJ9C 3UTSA 1EJ8A 3MV8E 3O2WH 4E0RA 5JW4Q 2FWSA 3FHEA 1MCQA 1BEYH 3CLEL 4I0PD 3BGAA 4NLAA 1IAMA 2GUOA 1RK7A 2R51A 2XWTA 3UL4A 4PJAE 4AC4A 3P9LA 1K4DB 3OD3A 5HGBA 2E6QA 2X9XA 2A6IB 5EIVA 4AQAA 5BJTB 1QZ1A 3C6LB 1KZQA 3OMNB 3WAKA 2ZKHH 4XCFH 2JJTC 5LAPA 4D7BA 1KG0A 2PXYB 4F58H 3UJTH 1HQ4B 3GSVA 5L0QB 2VMCA 1P7QA 4J4PD 3GJFB 3TFKD 3VSUA 3V6OE 3FJTA 4X6CB 4G9FD 2P24B 2OJEA 1IEAA 4FTVB 5DRXB 1E90A 3VTMA 5AW9B 3EH3B 3V95A 2PYEA 1KIQA 1YUHB 3LNIA 2AKRA 4CC1A 3PDOB 2PCFB 1YVLA 4A2MA 1NAMA 4MDIB 3OX8A 2V7NB 1IT9H 1NFDE 4W9LC 3B3IA 1WWWX 4X6CF 1W0WB 4MYWB 3CSYA 4YHLL 4MXVE 5K39B 2NY1C 5AB2A 3O6FD 2HUHA 1BWWA 5EUKB 1U4FA 2JNZA 5B38A 1B88A 3ZL2A 1LWHA 1BVZA 3MJWA 3QWNA 4WI5A 3HMWH 4Y4FD 5C0BE 1OT1A 5EO9B 1S3KH 4ZUTA 4DVBA 1TZAA 4K71C 2AHIA 3CMGA 2EE3A 1MXDA 3QJTB 4Z3HA 2W65B 2IALA 2YEVB 3F7YB 4S0SD 5L4FA 4JG1L 5E08H 3HPJB 4QGTA 5DD6B 4F8PA 4DOHE 2BMKA 3L54A 1JYVA 5TF1H 1QEWB 5IVXA 5BS0D 4L0YA 3OXSA 1NGQH 4PVNA 4JM4H 3HC0A 3GI8L 4K8RH 4UQ2A 2HKHH 1W16A 5DRWB 5E5MB 2R29A 4JRYA 2NZ1A 2ZWKA 1DQDL 1QNIA 5CHNB 5I76B 4PGBA 1ITCA 1DCLA 1FJ1B 3QORA 2VLLA 1CDIA 3I6LD 2J57A 2CDFA 4WI0A 4D0DB 5DD3H 3BGFC 2GK2A 1KCVH 3QPQD 2AXGA 3D85B 1Z9SA 2JMRA 4PRDA 5E94A 3K6FA 5IFJB 3B7RL 2JV6A 1A14H 3BC9A 1YCSA 3BSHA 2H26A 2PN5A 3V0EA 5HHPB 3QQDA 1L9NA 4PW4A 3RDJA 4KBPA 3A4FA 3NZ8A 1A6AB 3WU1A 4HEPG 1Q0YH 2NNRA 4W4OC 3QPKA 1NPJA 3QEGL 5GRJH 4OU3A 5TGBA 1O7DC 4PGEA 3H6AA 3DSFL 5E6RB 3MRNA 3IDYC 5IBLD 1M71A 4MQXC 3ECBA 1ML0A 4ZFOB 4A2EA 5KVEH 4L8CB 1YEJH 3QQ3A 4N90E 4Y5VB 4BSVA 3NG5A 3S34L 5C0GA 1GS8A 3S5LG 4I18C 2ITEA 2EDWA 3TZVA 4B9YA 5IIEA 4JN1L 9PCYA 1FCCA 4JB9L 1ZT7A 1LO5A 2KL6A 43CAA 5E23A 5HHMB 1V8HA 4L8DB 1A5FL 1FFPA 4UQEA 5LBVA 4KK5C 4CC0A 4GG6E 1XGRB 4Q6IA 3CN0A 3KEHA 4R5XA 2DAVA 3LIZL 5B3JF 2OMNA 3L3DB 1H6FA 1RL1A 4FXKB 3JWDH 1R3IL 3SPVB 3VJ6B 3ZT6A 5C9JA 2NY6D 4WJG3 1JGEA 3KGTA 2V3EA 4Y4HD 5C0ND 5E0QA 3ZKSD 3ESUF 5FYLH 1KIPA 3K71B 1HH6B 5B1KA 3SKOA 4EXPX 4HF5H 3DMMB 3LKQA 4QJ5B 2X4QA 4NQCD 4G8GD 3WFBL 2BOBB 4NN5B 3OPUA 1ZTXH 3QXDB 3ZRSA 2ZP8A 2RQ8A 3BP4A 4X99A 1J8HE 1N0XL 3NFPB 1KPRA 3BEVB 3VXUE 2J44A 3WO4B 4PS8A 4YLQT 4CJ0A 1KT2B 1I85C 3CBRA 1ZLSL 5EO0A 4PJEB 4PBDA 3V55A 2VGLM 3B8SA 1SJEB 2VXUH 3FBQA 1UEYA 4LRNH 5JPMB 3AU1A 5AVTB 4NWTL 1CFQA 2ZF9A 4AYID 4AQ1C 4MA7L 2MSPA 1ZE3C 1R75A 1Z6JT 3WUWG 1N5AB 5LBSH 4ELMB 1GL4B 3PHOA 4C58B 3CVIH 4BWWA 3STZA 5GS1C 1A3RH 3I9GL 5AAWA 1ASPA 1FL5A 2AZAA 2A38A 4RX4A 2I9TB 4PJEF 4JGJA 4KAQH 4WO4A 3GQFA 2BNQA 1S5HA 4WNQA 3OAUL 1PCSA 3LZRA 4P2RD 5DC4B 2HA1A 1FLRL 1ED3B 2H3NA 2NDFA 2AAAA 2QV2A 3FOMA 3L1OH 1ACYH 3FOLB 3NCYP 4ELMF 5DD5H 4FNTA 5E6IA 3FB8A 4IOIA 2AC0A 2CGYA 1CI5A 1FGNL 2Y1YA 1ASOA 1BM3L 1ES0B 1BQKA 3GM8A 4A6YA 4H5SA 1U3HC 4PREA 2NY3C 4GP8B 4NN6C 3MYZA 2LTQB 4KVPA 2XQYK 1UD6A 2SODB 2NUTB 3MLUL 4E9YA 5L2KB 5PAZA 4YAQB 3L7FA 2CXKA 3S3JA 3LEXB 3QXAA 1IC7H 3NJNA 1RURL 1XSOA 4LKXB 4HLZH 4M6MH 1NL0H 2COVD 1GAFL 3AW5A 5EFIA 3OWRA 4POYA 3M17B 4KKBD 1AZZC 1FNEA 1LWRA 1MJJB 4Y19B 2Z8VC 3DYOA 2EQDA 2H0EA 5FV2A 2XY2A 1HWWA 2F7OA 2GIYA 2HAZA 4NO5A 4RWYH 5C0DB 1I53A 2NQCA 1RMFH 3GEWB 3X3GL 1HCZA 2NTSP 2JB6B 2C26A 4B27A 3FO0H 3DURB 1T1YB 3NEXA 1TF4A 3SD2A 1FF5A 1RP8A 2WQWA 3L3IB 1YY8A 5C0RH 1HHKB 5LNEA 2MHAA 5F70A 4OLXL 3IE9A 4OV6F 1CYGA 3VB8A 2F19H 2CIIB 4PCSA 3U30B 3ARFD 2V17L 1S8DA 4Y1AB 1T0OA 1QBML 4OZHA 3BH8B 3QCTL 2YAQA 2H8PB 3EO0B 3FONA 4HAFA 4KK9D 2XOTA 4WEBL 2OSLA 2J8UB 3BE1L 4MKTA 2V8MA 3BUTA 4Q0XL 1MQKH 4GUOA 2QZQA 3V6ZA 2O61B 1YEGL 3RL1A 5J5EA 3X3FH 2ZE0A 3PCYA 2D0FA 3Q1EA 4OBRA 3MCKB 2WVVA 2YQ3A 3BIBX 4FQ1L 4PJFB 3HZKB 2A4EA 5GS0D 1GYVA 2R1YA 3P4OA 2WBJA 2H7WA 5I1JH 3SJVA 2EABA 3U9UB 2J8UF 4Y2DA 5TDNB 4YHNB 4WO0A 4GO9A 2DF3A 3MV8D 2ZUYA 2IH3B 3JTBA 1FAKT 3EJCA 4U1JA 4RQQB 3UGEA 1JE6A 2AXJA 5I1GL 4O58L 2WXMA 1T2QL 4PJFF 2O6DA 2R69L 3ZBMA 3X17A 1F3JB 4HKZA 3R1GH 4UAOB 2I27N 1A3QA 3BMVA 1E6JH 3HNTL 1KSRA 3LH2L 3KYKH 4QCIA 4F1SA 2J4WH 2KQMA 1SHXA 15C8H 3OWEA 4IMKA 1BVKA 2H2PD 4AL8L 1NDMB 5C7XH 2WKLA 5ICXB 4BSWA 3FB6A 3BGMB 4JFOB 3TPUA 2WBXA 5F8QC 4JQIA 2F54A 2IGFL 2XLLA 3CHQA 4XPFH 1MCCA 1XF5B 2XFGB 1JXDA 5E6UB 4HLZG 5DFTA 5D2LA 4EI0A 3O2DH 3PWNA 1RZGA 5DEFB 1ZVSB 3J2PA 5J1AA 3HG3A 1ZY9A 4O5LH 5AW2B 2VZTA 4B9FA 3FU8A 4I77L 3FSOA 3T5WA 3QG7L 4IIQC 4KQ4H 3L3JB 1ZT1B 3B5GA 1F45A 4FNSA 3QAZC 4HS3A 3MJ9A 5C3IA 1VKXB 4F33B 1JZ5A 4KDTC 3RDTB 2YJLA 3OLIA 4M7JL 4XPTL 1GMIA 4G6FD 5IGXL 1M05A 3J7HA 1EO5A 1JNHA 4PJ9D 1ET5A 5E2JA 2VM4A 2VXTH 2ZOWA 4JO1L 5FYKU 1MCSA 3KPPB 2WN2A 1HXYA 4XX1E 5C0BD 3RA7H 1HSBA 4M5YL 5KVGH 4M6OH 2ENYA 4PGDB 5DO2C 4XO5A 2VJ8A 3A24A 2ETWA 1X7TA 3H55A 2YQ2A 1FBIL 1BZEA 2WCPA 1I31A 1MG3C 2GQHA 2IANB 2HFGH 4X4XA 3O2WL 4GW5A 5JW5B 3G5YB 3V5KB 1BEYL 4JFXB 3PIQA 1W15A 1GW0A 4A68A 3SDCB 1QFOA 5F7AA 3T04D 1T6BX 3WKPA 2F5BL 2UZIH 3QEUB 4JR9H 5CIPH 5MENB 5J1SC 5DRZB 2ZKHL 4WKZA 4XCFL 3ZPDA 4B53A 4JPVH 2G5RA 4ORZC 3ECVA 2VNCA 3EW3B 4MQ7B 4JDVA 1KB5B 4KVCH 4PCKA 4PS3A 4HZLB 4OAWA 3QZWB 3UCQA 3L7EB 4JG0H 3EYVA 3F83A 5EOTB 4XNYH 4LFHG 2YFNA 5I66A 2BVQA 1CR9H 3QHFH 3M46A 1TTGA 2CKBB 5A2CA 3SCMA 4PV8B 1GZQB 4H0IA 4FOMA 3S37X 3QAQA 3EBGA 4N85A 4HKJB 6TAAA 2XV2A 2NY1D 3AU0A 1NWOA 2WLLB 4JHAH 3G5ZA 4YMPA 3K72A 3R4RA 1AHWB 1ORSB 2LV4A 1NEPA 2CG9X 1YC8A 3L4TA 1ID5I 3NA9L 1QHQA 1IT9L 4MNQE 4JFFE 4YNYA 4M93B 4N90D 2BOLA 3VFMB 1QA9B 5E8PA 2AQQA 5HDRA 3CZUB 3ARYA 1ILUA 2XWJA 4FNPA 1UT2A 5EV7A 3V4VA 5ITFA 3BAIA 2NY5C 5FOBB 2ORBH 4FMVA 2XDHA 3HMWL 5SWZB 4KJQD 1S3KL 1JZGA 3D50A 3RX5A 3ZTCC 1CTNA 5LGJB 3WNKA 4XP9H 1A9BA 1UD8A 3UZQB 2OQJA 2Q87A 4MHHI 5I5RA 5E08L 3NJJA 4BFKA 5DXWA 4KMQA 5GGSY 2K4WA 3CN4A 2BP0A 5MERB 1K8IB 4FQXC 1CFNB 4OGYH 2VLKB 4LRIC 5TF1L 2GABA 4PRID 1XF1A 5EDXA 3WY2A 2OMTA 1P2CB 2CPUA 3MJ7A 3HRPA 1NGQL 1D5BA 3CAFA 3QJFB 4JM4L 3DSNA 3HB3B 2HKHL 3DX1A 2ZOKA 5HBBA 3QXWA 4I0CC 5F3BA 4QRFA 1J8HD 3VXUD 3S2AA 4MAYA 4LSVH 1NOLA 4P8QA 2LU4A 4F57H 1JMZA 2EDFA 4RMWA 2MNJB 4Z0BH 5CBEA 3X1BA 2GJ6B 5DD3L 4Z7UB 2VSDA 1DE4B 1KCVL 3LNGA 1NBVH 4PP2A 5FF6B 1OGSA 4BEIA 2OXGB 5DSCA 3MJ8B 3WKNA 2GSIB 1XQ4A 2BIHA 1MW3A 3MI6A 1A7NL 3O6LH 1DTUA 2GYSA 1ZLEA 1CXEA 5GRJL 3DTDA 3KXFB 2LOEA 4HW6A 4MFHA 2EDJA 2YPVA 4Z7UF 1NIEA 2OV0A 2L3BA 3LCYA 3HLAB 3FFCA 4WHYG 2DICA 5BVJA 5I5MA 5KVEL 1JP5A 1YEJL 3MZTA 3IYLW 5HJDA 1SN0A 1PZDA 3L1FA 4H1LB 1NLDH 3GF8A 4G1EA 1ZV5A 3EF4A 3WXVH 2JVUA 3KR3H 3QQ9C 3V9EA 3OR6A 1PLAA 4TUUA 2Z93B 3JV4A 1K5WA 1IGYB 4X4YA 1KDIA 2BIQA 4LO9A 3QZBA 4YBLB 4C56B 1FSKC 2ZOLA 3ARBA 4M1GH 4W9ZA 1Z9OA 4NO2B 1XXDC 4QOKA 1T3FA 3JWDL 1YN6A 3C60B 3VFOB 2VABA 3QFJA 4R8WH 3QWRD 1JTOA 3AGVA 3FB5A 3OKEA 3C2SA 2ZONA 4IU3A 1I7UB 5FYLL 5KJ4A 1SUHA 2Y4SA 4HF5L 2VL5A 1DQQA 3HBQA 3KPLA 4NN7B 5FYKE 2X4TA 3GMNB 5I1AB 4PJIA 5HI4C 2VISB 4LHUB 1U95A 1ZTXL 1C12A 4GXFA 3FZUC 4FGMA 1OOAA 3LDBB 4DZ8A 2XG5B 1G6RH 1I1AC 3FTXA 4DGUA 6PAZA 3CDYA 4X5XB 1LNUB 1SYSB 3F04A 4QLRA 2N1KA 3D18B 3ZHDA 1QD0A 4HA1A 4XWOC 2VXUL 4LRNL 5D71H 1OOWA 4JNXA 4QIRA 4KO9A 5HGHB 3IK2A 1OZTG 4POZC 4KRPC 5ELIA 2W92A 1MH5B 2H6PA 4B7IA 4BK5A 5JLZB 4R96B 5LBSL 1BYOA 3CVIL 3MRPB 3OSVA 4GXVH 4JQIH 2XN2A 3UO8B 3FPYA 3VUAA 1A3RL 3ZR6A 3DXAE 3UTTE 2B5IB 3D3VA 1NICA 4G1MA 4U6HB 4KAQL 3SGJA 5CCJA 3FU3A 2AEWA 4AL8C 5G55A 1F6AB 2QL1A 1U3HD 2IH1B 4LCWB 4N1HB 3MGTA 2NY3D 4KI1A 3LSOB 5HDLA 1UC6A 3L1OL 1ACYL 4OKVA 2X1XR 3FB7B 5DD5L 4BKLB 2HX9A 3LRSA 4K7FA 3KPNB 2DQCH 2F53A 2ZYHA 5DMIH 4Z7WB 3HC4H 1ZS2A 1RIHH 3FU6A 1QBBA 4F92B 1AQMA 2GG1A 4TQHA 2L8AA 2MTAA 4Z76B 2YXFA 3PUCA 5IEHB 2VDNB 5H35B 1AY1H 3MRCA 5EBLA 4JG5A 3TV8A 4PVBA 5BPPA 1IC7L 4G71B 3C9NB 3D39E 4HAGA 4M6ML 1NL0L 1XGQB 4U1KB 1UT9A 2XBZA 1ETZA 2NY4B 4Z7WF 2VMJA 5C8JA 3BDYH 1HHHB 2EVJA 1I8LA 3GMMB 1RCYA 4GRMB 4TSCL 2JCCE 4K5NA 4KMTH 3ZKMD 2G3XA 2XG4A 4RWYL 1RMFL 3NJGA 2DQDH 1H6UA 3FRPA 3IFPB 2J21A 5CEYA 2CBMA 3QUZC 3FO0L 3B1UA 4U1IA 4H8WH 4P2OA 1TQBB 1MN4A 3AQYA 5D9SA 4DEWA 4N2MA 4Y7OC 3MFFB 1PZSA 1QRNE 1BVLA 2YXVA 2HLAB 2EDXA 3W9EA 5C0RL 4GJTB 2QQNH 3OKNB 1MFMA 3U82B 3HS8A 1JPFA 2F19L 3BQUA 3CH1B 3WEMA 1PZCA 2AXWA 3VI3B 4X80H 3L5XH 4K2UH 3H0TA 2E75C 4MRCA 3IPEA 3HAEA 4YFDB 2BHYA 2JFCA 1MQKL 4FQIH 4YSPA 2ITFA 1FNSH 1DSWA 3X3FL 5HHQA 3KBFA 5DFWH 3JWOH 4BQ8A 4HIPA 2XIDA 4LIQH 4A39A 5I1DB 3QI9B 1KWGA 5HHNA 4YPGA 1HNGA 5C92A 1FP5A 3BN3B 3VI3F 4APQD 1J5CA 2BIIA 1H3WM 5I1JL 3ZE1B 2D3NA 3MLWH 3RVUC 1ZHLB 3S5ZA 2N59A 5DUMH 3TLRA 4NNXA 5H37H 3FFDA 4G8IA 1N68A 5D2NC 3LHPH 2P5WA 4N8VA 3EFOA 5FGBC 2ZWZA 4P9HH 4KV5E 5T1LD 3AC0A 3ZX1A 3K91A 3R1GL 4P07A 5FM8A 4RA3A 4GLRI 1E6JL 5HYEA 3ZE1F 5JNYA 3D4YA 3BRGC 3EZ8A 1FG2B 2J4WL 4HSCX 2JK5B 5I1IH 4IRSC 3SQBA 15C8L 5JQ6H 2LE9A 5FK9B 1Z1WA 5M7QA 3FT0A 3OJ2C 1A6TA 1BJ1J 3F7VA 5AYTA 2E74C 4TUJA 4XNUH 2Z64C 4YDLB 4E9WA 1V27A 4JDZB 1IAIM 1I7ZA 4ZXBB 1UZGA 4U0RC 5BW7C 4XPFL 2WTRA 3JQOB 2Q8AH 2JKIS 2J5WA 4N0YH 3TYGH 4UYQA 3AREC 2MOQA 1Q0XH 3AS1A 4FQCH 3O2DL 3TOPA 3AROA 4QHNB 4P3WA 3ALXA 4P5MA 4O5LL 3IDNA 4HPOH 1Q9WA 4KQ4L 5KYWB 3TS8A 1BPLB 4XCNA 4MNQD 4XPGH 1TOXA 4WU7B 3CDZA 3R4DA 5D7JA 1VEMA 3NQKA 4XP5H 2DY2A 4U31A 4XWGH 1EX0A 3QWOA 2LU3A 1J9SA 4NQEB 2BVPB 3WIHA 4YZFF 4PEEA 4MJJA 1H3UA 2R4RL 1DQJB 1T22A 4U7MA 1T21B 3P9MA 3DUSA 5EU6A 3U7AA 1TQSA 1A1NB 2VXTL 3D7PA 1YEEH 4LCYA 3TA3B 1UZ6E 2YPVH 4LMQE 3RA7L 3WN5B 5D2NE 1A9VA 4MMXB 4WGKA 4M6OL 3VRJB 1I1FB 5KVGL 1N59B 3BPLC 4TNFA 4IGBC 1ZDQA 4AUJA 4XE5B 2COQA 2FCBA 5T1DH 3JSSA 1MCLA 3NSYA 1R5VA 3RURA 1MNUH 2HFGL 2QGBA 4RGNB 4NT6B 5TDOA 4NCC1 3US0A 1RLBA 4XNQB 1T7ZA 1ID2A 3IDIA 2UZIL 1SDDA 3V6BR 4JR9L 3MV01 4NHUB 4X4KA 1ETB1 4JPVL 3TNNA 1JV5B 1NMCB 1OARH 3GEFA 4KVCL 4TLSA 4FXLA 5E9DE 5H37G 3UMNA 1SJVA 4JG0L 3X1GA 4QGYA 2YQBA 2XV6B 3VNYA 5HP5A 1U8KA 1ZS8A 2WV3A 4XNYL 1CD1B 4FNUA 1CR9L 2X9WA 3QHFL 1XD1A 2HKAA 2ZX6A 3V6FB 1OB1B 2FX9L 1E4HA 4GW4B 2NY7H 3FCSB 3VQ2C 4CL7A 5ITBH 3VGHA 3CN1A 2QFRA 2UZYB 1WRFA 4JHAL 3CCHA 4AI7A 3S96B 1HVXA 1WAEA 3JVGC 1MW1A 2XNAA 3RWFA 1T03H 4N86A 3RJOA 1MDTA 3W0WA 1WT5A 2RR3A 4L4VB 3SDXA 3KPTA 4F8NA 1XBRA 3V0WL 2UUDK 4OIIH 1D6VH 4FQXD 4WWPA 4B3VA 2ORBL 2EYRA 4ZQTA 4RMQA 1DVFA 4P57A 2VZ1A 2ZKXA 3ABMB 5E70A 4CKQA 5LBGA 3F7LA 1CBJA 5KVEE 4XP9L 4R7VA 4XZUA 1PFOA 3RUGE 3T9WA 2Z0UA 3ROOB 2BDNH 5DJAB 3GXFA 4YSAA 4K94C 5I75B 2FJGA 3KLKA 3V5HB 5FGCE 4OGYL 4ZX6A 1AZCA 4FC3E 3QIUB 3PWJB 4GBXC 3U2GA 1ZVHA 5FYKD 1XH2A 1P6WA 1PKQE 2WO4A 5F6IB 1KGXA 3M1OA 2N0MA 5DRNB 3MO1B 1GZPA 4MHHG 2X12A 4W9IC 3OXRB 4Q9CA 5EHFA 4LSVL 2DWDA 4F57L 4F7TB 4V2CB 5DZPA 4Z0BL 1E2ZA 1JD7A 1FVCA 5CWSA 5FYLE 5DD0H 2P52A 2P44B 4OZFA 1DJXA 1NBVL 3PHQB 3LXCA 1BF2A 1DFBH 1U58B 5DJ6B 1WC7A 4XXDB 5FFOA 4YHKH 5FDWB 4PMEA 2WLMA 1OP5K 3BRDA 3CFCH 5GISH 4ACTA 5EU5B 2EC8A 4J6RH 5B3NA 3NESA 4QRRA 2DM2A 3P11H 3O6LL 3DXAD 1DEEA 2G3MA 3HRZC 3UTTD 2XTJE 3CPLB 3OLEA 4OJEH 3KWWB 2OBGA 2YC1A 2CPCA 4EOWH 2IQAA 3QQ9D 4FQLH 1N5YL 4LP8A 4YSUA 1KENL 2BW5A 2OXHA 2XXMB 2EDBA 1OZUA 3P0GB 4U3HA 3WSQH 3PJSA 1NLDL 4FXTA 5BCAA 2FT6A 4PRBB 3QIWA 2WJ7A 4JFQA 5TQ2H 4Z77A 3WXVL 1DQTA 3KR3L 4B9PA 1CG9A 5C6WH 5IHHA 2AZUA 1TSRA 1KIUB 3IJSA 1ZSHA 2C7FA 1YMMB 2WZ5A 3N50A 2EEAA 2KI6A 3V0DA 4QXVA 4M1GL 1N6UA 1NTDA 5JYMA 2D7QA 3ZDZB 3RWIB 2EXSA 2OM5A 3FZUD 1VF5C 1B4LA 1EGJH 3D39D 4N3UA 4R8WL 1ZSDB 1EEYB 4KHTH 1I1AD 2VXQH 1FUNA 3SZKC 5F1KC 5K9KA 4S0HA 5EIIB 3P1VA 2APBA 4KZDL 1MLCB 5D55A 5GJSH 3LEVH 4L8SA 4POZD 4I0PB 5EC1A 1H8LA 5EOCH 1PDKA 4I0KA 3ZDZF 1MFUA 1EERB 1WIUA 4ZBJA 5C09A 1R3HA 2BX5A 1G6RL 3WHXB 1Q9OB 1EEZA 2KHAA 1QRND 4QHMA 4BDVB 4LLVA 3EO1A 1OWWA 2RHEA 1H8OA 1QLFA 5D71L 5JA8B 1DO5A 3QNYB 2IBBA 3KLLA 3SKJH 35C8H 4RRPA 2DB8A 1F90L 3MX0A 4XB8A 4H26A 3V8CA 2C3GA 4G9FB 1FL6B 4GXVL 1MHEB 4JQIL 3CVHH 5DJ2A 3T3MB 1G7QB 4OQTH 2J25A 3ESVF 4YSQA 3UIZA 4HV8A 5ESVA 5FEBA 3JWNH 4XVUD 1X5KA 1OQOA 3LIUA 4S11A 1P6FA 4MJHA 5FS5A 3U4BH 3HUJB 1PAZA 1S7WA 3GBDA 3LV3B 3Q3GA 4QYOB 1DZBA 2CRYA 5DUBB 2RAMA 2TAAA 1L6XA 3N3EA 1TVHA 3G6JA 3QW9A 4L37B 3T3MF 4LEXH 4H44C 5F7EH 1NCWH 2BOCA 5FCUH 2DQCL 2JI2A 5DMIL 3HC4L 1P7BA 2KZWA 1RIHL 3QORC 3QQ4B 3O6FB 4FXGA 5J6SA 2BHZA 1CXHA 1MEXH 2PYEE 3KW7A 4GLRH 3HUJF 1AY1L 4YDJA 2FYYB 2ATPB 2WZ0A 3L3HA 1IAOB 4QRUA 1F1DA 4R3SA 4RZKA 3T0WA 4F9LA 4FFTA 3ARPA 1CGYA 3SO3C 3QUZD 3OMZA 2VXSH 4HPYH 3FU7B 3QR0A 3BP7A 2NW2A 1BBDH 3BDYL 3FCUB 1CWVA 5BS0B 5EZLB 4LLYA 2K1MA 4LNRA 4NQXA 1F2XK 4AC2A 3TYFA 4X9YA 3RE0A 2WLZA 4JJHA 4H8WL 4OH2A 2G4EA 3TZVC 4ES9A 5GGUA 3GSWB 3CK0H 3G5XA 2QQNL 5KOVC 5ACLA 4QF1B 5F44A 4UM8B 4WZ9A 1VGKA 4L3EA 5H94B 3UTOA 4NIYE 4Q6IC 3QG6A 5EEZA 3L5XL 3MODH 4M03A 4IBTA 4K2UL 4JHZA 4EZJA 3CSTA 4JRYE 4HIJA 3RVUD 4GIAA 2FHCA 5KW9H 4FQIL 2BSED 1FNSL 3JWOL 4LIQL 1IE5A 1LO3H 1WCBA 5D1ZB 1UWYA 1Z5LB 4ZO7A 1ZTMA 5I73B 4Q9RH 1M2VA 3OAYK 5AAMA 1HILB 2QPDB 2F1BA 3X12A 3MLWL 3I50H 1JHTA 3JT2A 3SKMA 5IB3B 1CL7I 4DN3H 4DFHA 3JWNG 2NUPB 4UANA 4NRYA 3BEWA 3LHPL 1L7TH 2R7EA 5IFAH 4P9HL 2Y3NA 5KVGE 2Y69B 4KKNA 5DS8B 1M7IA 1S9YA 1I8KB 4TOYH 3Q2NA 2Y6SC 4FCHA 4MJ5B 5JHDB 2CRIA 4Y4HB 5I1IL 5AAWC 3ARED 5K1NA 3RNQA 4Z3FA 3U4EB 2Z92A 5JQ6L 1CGTA 4H0GA 3QNXB 3C8KA 4GXUM 5E9DD 4WO4C 4AIOA 2OCCB 4XNUL 2CO3A 3EOBA 5GGTH 3ATAA 3U0PB 3DGDA 4G8GB 2WYHA 5DMKA 2PP7A 4N2AA 1QFHA 4QHLB 4HXBH 1IAII 2Q8AL 2WXPA 1HOCB 2G4GA 4N0YL 4NOFA 5E6IC 3TYGL 4AV5A 4ONHB 4OZGA 4MNHB 1Q0XL 2ADYA 4FQCL 1G1CA 3GJFK 2WGXA 1T6VN 4DP1X 2FE0A 4P3DB 1KXTA 2W0KA 4AW4A 3TNMB 3QJHB 4DH2A 5CLWA 1SJHB 4HPOL 3RWEA 3O81A 4MZ3A 2GSGA 3DIDA 2BSSA 4M4PA 2DWEA 4JREB 1L9QA 4XPGL 2IV9A 3AUVA 3PWVB 1CXFA 4QHKJ 5L7XH 2IDUA 4IGBD 3WMSA 1YEDB 4R5VA 3ZIMA 1WS8A 3WLWC 3QZMA 2EKSB 3HCVB 1H9DA 2X9YA 2WKOF 1JVLA 3WY4A 2VZOA 3WEOA 1YEEL 2GT9A 2YPVL 3IF1A 5CSZA 1WBYA 2BNRA 3UYPB 3ET9F 3BZ4B 2X09A 4DWHA 3KAAA 1Y18A 3O3UN 4P23A 2P5PA 2ZQKA 5IVOA 5T1DL 3LH8A 1MAJA 3U1QA 1QW9A 2ZT9C 3JTTB 3IJHB 4J3OF 4EO5A 1MNUL 2EIDA 2DQGH 3QJRB 5KSVA 1AFVH 3KWXA 3MFGB 3KLDA 3D69A 3DDFA 4J8RA 2H3XC 2X4NB 3W9DA 4LCUA 4ELKA 4DP9X 1LE9A 1DHKA 1NCNA 4XHQA 2BNQE 4D0BB 4L29A 4NYLA 4YL4A 4N20A 4ZI8A 1N8ZA 7TAAA 1OWRM 1EQWA 2KZ1B 3ABGA 3IDGB 5ETUB 3P73A 4JRXD 2X0VA 4KKRA 4FZ8H 4KO5A 3IDJA 2E6JA 2L0DA 4IEFA 1OARL 3FQTA 1VERA 2EE9A 1MI5E 5I74C 32C2B 4PH8A 3V4PA 1B4RA 2HG5B 4B5EA 1S6NA 4H88H 2WBJC 4MWFA 3FK3A 4NUJB 4OQ1A 5DHVA 5A40E 1UA7A 2NY7L 4ZOAA 3UJJH 2HLEB 4MMYB 4S1RH 2BVUA 5ITBL 1JWSA 4NERA 3EH5B 3SOTA 1T4KA 4XP6H 2EE2A 4JUSA 4Y2DC 3O9WA 1WS7A 2MCMA 4QHUB 2GBUA 3CFTA 3FL7A 2YD5A 4HMEA 1JERA 4HJ0C 1D5XA 1SYVA 1T03L 1KGYE 3ARFB 1JGDA 3DJZA 2Q5BA 1ZT4A 3TBCA 3SDAA 3O8XA 5TTRA 2VDQH 4ERSL 2Z6FA 1WFMA 2CHWA 5EO1A 4QXUH 2ICEA 5FO9B 1D6VL 3AT9A 5AVUB 5CO1A 1WAAF 3ABLB 4IMKC 3DC0A 1U8PB 4N2DA 1OGTB 2Y7LA 4OCSH 1SVBA 1AS6A 2Z4TA 4JKLA 2EIMB 4N0UE 4HLEA 4P4RA 2AXHA 3KVQA 4XN8A 4PV9A 4UOW0 1OHQA 5LCVA 2AXFA 2BDNL 3FCTA 3O41B 5F0LB 4BBWA 1R17A 1TZHB 2YD9A 4JY6B 2BJMH 4AT6A 4OJAA 1XGYH 2DMGA 3DV6B 4X0NA 3RGBA 2VM9A 3MV8B 5INCB 2N4IA 2APTA 1WFIA 3KLHC 1E5BA 2IADB 3H7BA 2DKUA 2W9LA 5I6PA 3G08A 2FQGA 2UWEA 3VXMA 3QA3A 3E1F1 4D3CH 4KZ0A 5CCGE 2H2SC 3P69A 3GMOA 2HPTA 2J5LC 3ILEA 2CBOA 3WD5L 1CD9B 5DD0L 4EIBA 4NNYA 4OCRH 3QDME 3L9RB 1FZJB 4JZJA 2GSMB 4AYFB 2B3RA 1DFBL 4A7TA 3DJSA 1WZMA 1GA2A 4FL4C 5KSBA 5ESAA 2FUQA 4YHKL 5IF0B 4ZOEA 4IBSA 3UABA 4MJ4A 4I1PA 5JHAA 3CFCL 5GISL 4IS6A 3A4AA 4J6RL 1ZK5A 4KHXH 4P04A 2E46A 3P11L 2RJMA 5DA4A 1XV8A 2AJSH 3N0AA 2DYSB 1S4IA 1RJCA 3LKPB 5MI0B 2CO6B 1C16A 3ZDYE 2R1XB 4EOWL 3DO7A 4FQLL 25C8H 3T65A 3KJ6L 2ZWLT 2R2CA 4UZGA 1KJVB 4JS7A 4X7FC 1Q4NX 3KPMA 1KTDB 1P7QD 5F72S 3WSQL 1PX8A 4BH7A 3LJ3A 1NFDB 2F54E 1S7XB 1ONQA 5D5MA 3MREA 5TQ2L 2DLGA 3ESMA 4G6FB 4NRXA 2Z8WC 5D2LE 2ATKA 2QGCA 4PJ9B 2PPFA 2PYED 3UROR 3NYKA 4HGKC 4N6RB 2EYTA 4O2CB 4PLOB 4L1SA 5HGAB 4H40A 1NFDF 4GO6B 4DTGH 3SCMC 2ZSVB 4KHTL 3JV6A 1YUKB 4DOHB 5JXEA 5EBMB 1IRAY 1YPZB 3JWOC 3LXAA 4DJMA 1AR1C 5BZWA 1BIIB 1LMKA 4LP5A 3LEVL 2E8ZA 3MRQB 3OG6B 5GJSL 4AQEB 1MFAH 4LFHD 4H8UA 3HJ0A 3CZSA 1E5YA 5EOCL 1E4XI 2EEFA 2FSEA 3Q2WA 3LN9A 4XC1H 4KJYA 3IMSA 3X11B 5CUSH 3H9SE 1JZ4A 3DVFA 2WAQA 2ED8A 3WDJA 5IB5B 1IVTA 1J5HA 1YPZF 4FF9A 1WIOA 3KPRA 4LDEB 4MKMA 1J0YA 1Y0LB 1B0IA 4HJIA 3SKJL 1WCQA 1NEUA 35C8L 3RGVD 1YYLH 2UYLB 3JYCA 1FNGA 4ODBD 4WV1A 5EIQA 4YXLH 4S2SB 3WDIA 4R6UA 2YHGA 3MA9L 2YR3A 3RBSA 2XJLA 5HHOB 3CVHL 4WU5B 1GGBH 4JRYD 5IW6A 4OQTL 3E8VA 4LPUA 4KZCA 4LSQH 4L1BA 2OZ4A 3TC9A 2X2YA 1NJ9A 1CE6A 4AENB 1PNDA 3QORD 2NY1B 4RSYA 3U4BL 1YNLH 3MV9E 2A6DA 2ADIB 4LBEB 1TO4A 5I24A 4KZEH 1IM3A 3TPKA 3P77B 3H4FA 4K71B 2ZUTA 2O93L 1TJHL 2UZXA 5L9DH 1CL7H 4MAYC 4LEXL 5F7EL 5FCUL 1NCWL 3CVBA 4MDRA 5IMKA 2X0WA 1R3JA 3E80A 4OZIA 2JXMA 4BE5A 1X5JA 4AQZA 1RZIA 2QSQA 2E7LA 4DVRH 1MEXL 3NPSC 4LIQE 3HI5H 5E5LA 1AP2A 2YAOA 3PF2A 3K80A 4HUVA 2WZPD 5E8NA 1KV3A 1CJYA 2B3IA 2AQTA 2VXSL 2Y7QA 1HC1A 4HPYL 1K8DB 1F13A 1GXEA 1Y1UA 3ERXA 5D1QE 1BBDL 3TZVD 5KYYA 1CDBA 1QATA 3HZ3A 4PRIB 3TBTB 1NCGA 3VMNA 4I9WE 3GUTB 5HDBE 1D7FA 2WZAA 3BGFB 5FXCH 1IAIH 1HTYA 1UCTA 4AMKH 3B4NA 3EDJA 4MZRA 3FH7A 1HQRA 1ECZA 1PZ3A 5F9AC 1WLHA 1J8HB 3BSZA 1BAWA 2NMSA 1IKNA 2XPGB 4J1UA 3HKZA 3DX6A 4U3SA 3CK0L 3C5ZA 4C54A 2ZCLH 2D8KA 1XF3B 4GKSB 3P3YA 4EJ1C 1E6OH 4C8XA 1FFNB 4NGHH 3IDYB 8CGTA 3ARBC 4XXWA 3T8XA 1D5RA 1WEJL 3MODL 3BWSA 1Z66A 2ZPKH 3TBSA 3GHPA 5AKVA 5DHVH 5KW9L 5E6SB 4MJIA 1U92B 1CICD 4F24A 3B9EA 4HUWB 3OHMB 4I18B 2CIKB 3CSBA 2JKXA 3NJVA 3EG9A 1LO3L 4NAJA 3TBYA 4N9GB 3RHWK 1RZFH 3BRFA 4YHYC 4Q9RL 3FDWA 4Y2OB 3GXIA 2OI9C 2AQ2A 3I50L 4E41A 4L4JA 1T0PB 2Y6SD 3CFJA 1FL3A 1OTSC 4IBLT 4DN3L 2QKIA 1RUKH 4H4NA 4RX4D 3HE6A 5IFAL 4WO4D 1L7TL 1R24A 2AQPA 4Y4KA 4O2FB 1IKFH 2BNQD 2F7RA 4QMEA 2HT4C 4BK5C 3EGXA 3NFSH 3FFCE 1BJ8A 5HVWA 4TOYL 4U1SB 3ZYJA 2AVGA 1MHCB 2ARJA 5LCVH 5BNXD 4V1DA 3OB8A 2CWRA 5FO8A 5E6ID 4BKSC 3LKSB 4Z7VB 4PN6A 3SGJC 1L5GA 5GGTL 2OL3A 1MI5D 1PEZA 5IVZB 2GFBB 3BPOC 4E9SA 1DR9A 1KOAA 4Y9FA 2AK1H 3DX4A 1BDYA 4AQ1B 4HXBL 1SEBA 1A4CA 4O9HH 4X4ZA 3BZEB 1G5AA 4PS7A 3QFJE 4HLJA 4X8JA 1JXFA 5GS1B 4Z7VF 4PJCA 1ROWA 3VYNA 3T09A 3RBGA 3NMEA 1T2XA 3BDBA 3WG7B 2HRPH 1T66C 3ESNA 5JHLA 4L0PB 2VIRA 4HBCH 3ZSTA 1RJLB 3MV7A 4PJIE 3DPBB 2QHLA 4HKXA 5L7XL 1EK3A 4JY4A 2CZNA 3WE6B 2YRPA 2EIZB 2YD0A 3ZLQC 2DBLH 2YAMA 2OYLA 5FUOH 1U21A 1QSFA 2R23A 1AACA 2DJMA 1BXAA 1A4KA 1I8LC 2DWSA 4LF3A 1JPTH 2C7UB 5EU3B 1U3HB 4OCMC 3RRQA 3MRDB 1B0GA 5E00A 2NY3B 4IKNA 3VFRA 1ND0A 1XD0A 5L8KB 4NN6B 3AACA 3ILDA 2QGEA 1E9PB 1A1OA 1Z7JA 4I7ZC 1UXWB 2GK0B 2F08A 3BXNB 2ZOTA 5TH2B 4AH2B 5KAQG 4WKXA 1T20A 1FZMB 1INDH 2XPYA 4HK0B 4P2OC 2P8PA 2DQGL 1AFVL 1F02I 4GI9A 5DJ8B 4U1MA 3VXPB 5A6MA 1BCIA 3D3VE 4WWID 4ZPVB 3P0VH 2R9HC 2XZQH 3BQUC 3L2LA 2ICWA 4UI2A 3EHBC 4Y1SA 1CFMA 1CLOH 3REVB 2BC4B 2DW5A 2WBJD 3FO1A 2FO4A 4XAKD 1YNTB 4FZ8L 4Z7OB 1A3LH 1XCQB 4TTGA 3TF4A 2VDOH 2BY2A 1BD2A 1PFCA 1XF4B 3CFEA 4JGUA 3FQNB 1F3RB 1RP9A 4P4KA 3STBA 5IJKA 3FUJA 4MJ6B 1HHGA 1UWFA 4H88L 4HJ0D 5JQHC 1WA2X 2G75B 1CBVL 2HJLA 1S9XB 3BKMH 3UJJL 4MLIA 1NGWB 4S1RL 1YNTF 3ZO0A 4PW3A 2RA1A 1YEFH 4Z7OF 4QRPA 4XP6L 2DIJA 1DN0A 4BSJA 1TEYA 4OLYH 4CVZB 1DDHA 3B6SB 2G3ZA 3QNZB 3QS3A 4KKCC 5DJDA 3MRGB 3T8MA 5F3HB 5CJ8A 1KNOB 1FIEA 1O6SB 1RHHA 1AG0A 4WFHE 1GJWA 3B9AA 5IP4A 1Z0NA 1BAGA 2VDQL 2GC7C 2F54D 4N8PA 4GG8B 3GMPB 3H42H 3TURA 4PRPE 3WUZA 4QXUL 3KDPB 2A4ZA 1M2OA 3PY9A 1IAKB 4YSDA 5GIRA 3WFCH 4OCSL 5C9KA 3VCLA 5AB9A 4WI9A 2ZG2A 1OT4A 3DBXB 1E50A 3KLHD 3AABA 3OF6A 2CMRH 4R9HA 2Q8BH 1JYXA 2OMVB 5G4OA 5EF3A 3PWUA 3ZQWA 1RY7B 2GEQA 3T0EA 2BJML 4RDBA 2H2SD 1XGYL 3JWNC 3VXSB 1CPUA 1T83A 2EDRA 1RERA 4MBRA 1IMHC 1E4XH 1FYTB 2NOYA 4JPIB 1O7SA 3IJYB 4TUKH 4RAUA 3RX7A 3WDHA 3VFNB 5IMOB 3MLXH 2DJ4A 5D7JC 1NGZB 4D3CL 3CG8A 3H9SD 2BHFA 2BK8A 2O5NA 4GUPA 1TLMA 5E1AA 4URKA 4Z7QB 2IDQA 4OCRL 1AC0A 4F7EA 2F74A 4QLWA 1BG9A 2DDQH 1ZMYA 2JKSA 3PFUA 4W4NA 3M1BB 4IIQB 1E43A 1IEBB 2ALAA 2FHFA 2J6WA 1VCBC 2HT3C 3BIKA 3QAZB 4QTIH 4KHXL 1IL1B 3ZGHA 1R5IB 3QCUH 5I2IB 1BFTA 1LEGA 2AJSL 3S97C 4FA7B 3BOVA 2AABH 1NKOA 4Z7QF 2PPDA 3WJMB 4NQUA 2V5YA 1J0IA 25C8L 4OJYA 4PYGA 1PU0A 3K74B 4GKNA 3MV9D 2J1KA 2KS0A 5IJVB 1SMDA 3DX9B 4X9BA 2P26A 4E9QA 4MNQB 5ENWB 1KEGH 5FO7A 3O6MH 5EZOH 3RVXC 2XWEA 2XQYG 3HI6H 2E76C 1OAKH 1E3XA 3OL2A 3TP4A 1QI5A 2PPCA 3SCMD 2EH7H 2OMWB 4Y9CA 3SPCA 3UG4A 1J5OH 1D5ZA 1Q1JH 1T2JA 3JWNE 4HAKA 2X1PA 1NCDH 2FL5B 3C08H 3E1ZA 1AR1D 1AYOA 1JXJA 1PQZA 1WD8A 2EIEA 5G4MA 5DK0B 1Q9LA 2E86A 2XN9A 5ICZA 4DTGL 1DVQA 3U7WH 2FWOB 4N0CC 5IW1A 3EDDA 1NCOA 2H5UA 2VDMB 5D1QD 3D12B 2Y2WA 2NYKA 4N5EC 4BGDA 2TRHA 4I9WD 5DHYA 2ZUVA 3QEQB 5EU6E 3LQZB 4I5BA 1MQ8A 5I1LB 2KDYA 4EBQH 4EDXB 4RZCB 3NTCH 3TN0A 4XMVA 5I16A 4X7SH 5CUSL 3PP4H 1S7SB 4GRLA 1WT5C 1S9VA 2XN0A 1WBZA 2OX5A 3K8LA 5ANME 2CJTA 1UWXK 2CH8A 3T2LA 1K2DA 3GB7A 3MSPA 4PRAB 1DVFC 2QVMA 1OKEA 1YYLL 3DV4B 4PJ6A 3WTTA 1J1PH 5AL0A 3FO9B 2KQNA 3QUYA 5AL8A 4DIXA 5A1AA 2WN3A 3BN9C 3HS0A 4ATWA 1HKFA 4PJDA 4HWZA 4GOSA 1GGBL 4ZUVB 4XX5A 5D4JA 4MAYD 1C9SA 4LSQL 1GYWA 3LNEA 5DEZA 3WNNA 3MUZ1 1AGBB 2W88A 1YNLL 1KLUA 2E7CA 3CN2A 4H8VA 4KZEL 2Q86B 3C8DA 1TQTA 1H15A 4P2AA 4AYFA 1BYNA 4UTAH 3NK3A 1U8IA 5L9DL 3G5VA 1T5KA 1CL7L 3CDGB 1BQRA 5KZCB 5ISZA 3R7QA 2Z4QA 4QKTA 1NC2A 5JYLA 4ZSOB 1OW0A 3FQ2A 3PNWB 4FQXB 1KTBA 4YDZA 4XCEB 4DVRL 4XH2A 2GITB 2ADJA 2X2IA 4FABH 4R84A 3HI5L 1GYAA 4WDIA 4A7VA 4YN3A 5K9QG 4PHXA 2WIIB 3FFCD 2IDCA 1QWHA 3WJLA 2BSCA 3NJIA 5T5NF 3H8NA 1TJXA 2I7SA 4O02B 4AV0A 5AUMB 1CDJA 3I50E 9CGTA 4GPVA 3SDXE 4R90H 4L8BB 3QRGL 5HYJA 3FTZA 1FZOA 4JFYB 4JO3H 3W5NA 1IAIL 3N9GH 2Y1ZA 1FFTB 1KJ2A 4L1HA 3VWJD 3ARBD 1UXSB 3DYPA 3H56A 5E8OA 2VLJE 1XR9B 4J2QA 4PBVC 3MNWA 5AALA 1UM4H 3QFJD 4FFZH 1BZOA 4TLKA 5HVFB 3DJ9A 1LK2A 3QIWC 4N0RA 3CZFB 4NQDA 3EZJB 5JIDA 3PV7A 1QTSA 2ZCLL 2HWZH 1E6OL 4R0LA 4NGHL 5I0XA 4RMBA 3I02A 5I26A 1NIAA 3HG1E 5C0JB 4HJTA 4IHOB 4RMUA 1E8XA 1FE8H 3ZTEA 2ZPKL 1BX2B 3E9TA 4ZDHA 4AYBA 3DXAB 3P30H 1K5NA 1QQDA 2OJ1A 2ZKWA 3ZDWA 5AZUA 3RVWC 4E68A 2C4FU 5BUGA 3L08A 2BVYA 5DEGB 3KH4A 5BRZA 5C0AB 4L8SC 5T1KD 4JLRA 4JQXA 1RZFL 3LPOA 5EEWA 2YGNA 1FSKB 3O45A 1JHKH 3T6XA 5CGYC 1S46A 2WLKA 2F61A 1SDYA 4BFNA 2CALA 5BXFA 4QRRE 1RHFA 2VQUA 3FO2A 1EFQA 1MUJA 2AJVH 1RUKL 3D3VD 4LSTH 1NFIA 2AJZB 1OVZA 4L2LA 3SB3A 1UXLA 4N0FB 1IKFL 5CINH 2J2ZB 1Q38A 1A6VH 3QFDB 3E7JA 3NFSL 1XTLA 3IBEA 4X5WA 1CGWA 1KPUB 2WB1A 4DPBX 5LCVL 3D39B 4RFOH 3PHAA 2VWEE 1I1AB 3GTVA 3OQ3B 4IOSA 4WTXA 5EOQH 4Z7NB 4PGZA 4BINA 3O3AB 4HCRA 4LCVA 1PG7X 1BV8A 1T66D 2MKLC 1ZIAA 2AK1L 2XVLA 1P4LA 3T71A 4KRPB 4OF7A 4TSAH 4O9HL 1I1YA 4FG6C 1T7YA 5AEAA 1NCUA 2DWTA 2P4AB 2KDGA 5DDHB 2IDFA 4PJXA 1C5BH 3D8MA 2KUTA 1A66A 1QRNB 4Z7NF 2R1WA 4GKZB 1R19A 4G6AD 2V2XB 3TTYA 3EOYG 5FB8B 4FXGC 1XH1A 5F9DC 2HRPL 3KW8A 4HBCL 4A38A 1U8NB 3VDBA 4YX2H 3MQIA 1L6PA 3TF7C 4QO1A 4F9LC 1LYQA 4N4YB 4NM4H 3IU3B 5F97E 2DBLL 3ZXAC 5CLXA 1B9KA 2DKSA 4FI8A 4WCYL 5C0EB 4J4PA 4P2OD 4U1NB 1OSPH 2WMPA 4NQTA 4OGXH 1D9KD 3L45A 2H9GA 1JPTL 1COBA 1I3RB 2IBGA 1HEZB 1BQHG 1QASA 2Y7NA 4O51B 1I3UA 1I9RH 1NCBH 8PAZA 3BQUD 3KYOA 3EHBD 1AGCA 1X4YA 3C12A 4GQ9H 5E99H 3FQ4A 5I6KA 4N24A 1DQLL 1INDL 3TVMD 3ZMEA 3K0YA 5INDA 4ZRGA 3S3PA 1HS6A 3V7AG 2WWOA 1HEHC 3MCYA 2ENJA 4ZFFB 3P0VL 3DIFA 2XZQL 3LN5B 1JF1B 3U2SA 4JX0A 2YOAA 1E9QA 1HOEA 1F4AA 3PAVA 2J12B 1CLOL 4FLOA 1KLGB 3KPQA 4F93B 2WQRA 4IDLA 4UUJA 1A4JB 4DZBB 1S78C 4HWBH 4IK7A 3QUZB 5JIIA 1THCA