4OJEH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
489
structure length
457
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMSRGMQMQFSIGLHTAVCFRLYLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPESDKSDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGGRASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMDDIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLFEDDGWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EFF-1A
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
total genus 93
structure length 457
sequence length 489
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojeH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojeH01
4OJCA 4OJEH 4OJDH
chains in the Genus database with same CATH superfamily
3WDHA 4JY6B 4LRIA 5HI3C 3FQ4A 5AWNL 5HHXL 1FVEA 4QF1A 3BVNB 3H7LA 2V2TB 1X6NA 2BNQA 2NNCA 1U8JA 3S3CB 2HJLB 5PCYA 4Q89A 3D0LA 5CU5A 2NY2B 4NKDB 3NYKA 4U1KA 1K4CB 3S3BB 5EA0L 2YUWA 3VFUA 3NIFB 5HPMA 3U0TB 3VXRE 4NO2A 5HGBA 5CZRA 3ATDA 4GT7A 3N50A 2BIOA 2O5ZH 2FJFA 3O8XB 4AV4A 3L3OC 4GEIA 4YVUA 2Z6FA 5I16B 1AFVL 1NCIA 5IJCC 3OGOE 1BZDA 2VZ1A 4PJHF 4YSEA 5L2KE 4KKNA 2FQEA 4E9TA 5L0QB 4B3EA 2P8MA 4O2FA 4F7KA 1U3YA 5F7BA 1AR1D 3TH4T 2W9EH 5DVOA 2X44D 3CD4A 2DQJL 5FM5O 1MFDL 1ZSDA 3HFFA 1B4TA 4FABL 4R2GC 4M6OL 5BRZA 2GITB 2XG4A 4E36A 4N2NA 3WCYA 2G3ZA 1BAFH 2PLTA 3U6XA 2QBWA 3BPLB 2OM5A 1QKZH 3WLWD 2B1HH 4NQTA 1T3FA 3ZLQC 3CDCA 4M4RB 2NT0A 4FQJH 2P5WA 5F0MB 4NM8H 5DO8A 5T1KB 4N0RA 3VGBA 3QA3A 4OZHB 2JELL 2NY2C 3SOBH 4ZBJA 3ROOA 2J8UE 2VW4A 1M7IA 1I7ZB 1OZTG 3HI5H 1AHMA 1I3UA 1T0MB 3R4DA 1SXZA 2NOYA 5L0QC 3VFRA 2CJUL 3BFOA 1BG1A 1TMQA 4F5CE 2FL5B 4XP9L 1OGAA 5HJDA 4HEMA 2UZYB 4KXAA 3WJJA 1AY1L 3D51A 5SX4I 5ACZB 4K3JL 3HRZA 1INQA 4UV7L 5E8EB 4MAYD 2QLYA 4H25B 4KI1A 3UCRA 3BPLC 3DV4A 1INDL 2MCG1 4HJGA 1HH6A 3SDDB 5KS9B 4LFHD 3U1QA 5IW6B 2X70B 5JA9A 3CSTA 4JHZA 2FECL 1EK3A 2PYFB 2E7LC 3CQQA 1HL8A 4OKVB 3FSAA 3K1DA 4YX2H 1G7QA 4NKMB 1XB3A 2RB8A 2BNRE 4WI0A 4WFED 1T1WA 5DLML 4PW4A 1OY3B 2QVFB 5EHFA 4EN3B 2FQFA 5C86A 5JDSB 3LKSB 5DJ6A 3BEWB 1NAMB 5I8EA 3ABZA 2P24B 4NHCH 3VXMD 1ZLSH 2OR9L 3WDIA 1LP9B 2ODHA 3D25A 4U1NB 5CM1A 1GGUA 1U91B 4YFLI 1WP6A 1WWBX 3A4EA 3FAXA 4MA8H 5HHNB 3MREA 4FG6D 1IZJA 1O6TA 1WCQA 4BWUA 2IBBA 2R1XA 3ZL4H 1ZGLM 4R3SB 4G6JL 5CD3B 5EDSA 2X40A 4RAVB 1P84K 4NZRL 3MLYH 4XXCC 3VWKC 3PDGA 4Y4FC 3SYCA 1DQJA 3BLBA 1GZHC 4TYUA 2Q8BH 4RGOH 3ZYIA 2ARJQ 5IHUH 3DX4A 4R7LA 4CVZB 4QRPA 2OMVA 5T8IA 4AMWA 2UWEF 2XWEA 3SDDC 1EEYB 4YNYA 1GHFL 1UUSA 1OF2A 1RULH 3EOAA 3KYNB 5L9DL 4AEHL 3FB5B 1ET7A 3W5MA 2AJUH 3ROLB 4Y5XA 1UOLA 5CJXA 4LL1A 1G0YR 2ZXAA 3BLPX 3CPUA 4FQXB 4KKBD 2C9VA 3BUPA 1XSOA 3EH5B 2BVTA 3L4CA 4WGKA 4PJ6A 8CGTA 3QNXA 5I1JL 4JFFB 2OMTB 3QCTH 2DQDH 2PF6A 6PAZA 3D85D 4NCC1 4NC0B 3FUMA 1Q9OB 1D9KB 2GJ6B 4YXKH 1IM3A 3DX6A 1WO2A 4EDWL 1YEFL 3TO4B 2MOGA 4IBQA 4UMGA 1ID2A 1RHFA 3BRFA 1EVUA 2O6CA 1MSPA 3O4LE 4MA3A 2EE0A 1BBJB 1FORH 2KC0A 1GGBL 5IROA 4UM9B 4OLVL 4MVBD 3UTQB 2WZ0A 2XZCH 2ED8A 2OMXA 3GHBH 3GBEA 4PTUA 3KPNB 3THML 1ONQB 5BVJA 3BCDA 4OCLC 2ZJSH 5I82A 3NDYE 3GSRA 4ZUTA 5CJ5A 4XHJC 4LPTA 4A7TA 3QRGL 4QXVA 2WGNB 1NJ9B 1QWHA 2J55A 3P9LB 2EC8A 2CMRH 1A1MA 5L6YL 1IGTB 4DP8X 3S7GA 2ALWA 5IHBA 3QEUA 2PPDA 3N0AA 1MFEH 1JRHI 4UT6H 1GGTA 4HJIA 3U46A 4BQ9A 1D9KC 2WB1A 4J3UA 2DYRB 5MP6H 3VFGL 3T77A 1I7UB 1NGXA 2AGJL 3OL2A 4FZEL 3T6ZA 3QDGB 1RJZB 3TA3B 4U49A 5C2BL 3QFJB 4FNRA 2J21A 4YSDA 4LPVA 3VFVA 3ZMNA 5I71C 5C8JA 1K3IA 4JDVA 1FZOB 3RURA 2AK1L 4ZUVB 3VG9C 3ZUCA 1IKFL 5CLWA 3DYOA 2B8OT 5AVZB 4XRCA 1S9YA 3GSWA 5EBMA 5JHMA 4Y16D 2AK4A 1XSKA 3P0YH 2D3JA 1GW0A 2NRDA 4PJXB 5GSVB 2A6DB 3MACL 5SX5H 4QRQA 3HG5A 3WE1A 1EJ8A 4EUPB 3ULSB 4PP1D 1PQZA 1IKOP 5AB0A 3GIZL 3MLWL 5A16B 3TN0C 4M8RA 4UTBL 2GABA 2QKIC 1ICTA 3BWSA 3TNNB 4MQXD 1LLAA 3JUZA 5IT2H 2AP2A 3C2SA 1E5BA 4PMFA 3S3SA 1TYEB 3V6OC 2DMHA 4YSAA 5F7HA 1G6RL 1W6WA 2WINA 4DTGH 1THAA 3OXRB 2IH1B 3UTTA 5DJ8B 2VIRA 3D69A 1OF0A 2CLZA 4ZMVA 2VNCA 3K2IA 2DWEB 3LKQA 4IBSA 4CU8A 3B8YA 2ITEA 5DMKB 3NH7H 2BOBA 4ZSOB 4PFEA 1TLMA 1OWWA 2V5TA 3CSYB 1EQWA 1GZPB 1MI5B 4ONFH 3WEXA 4AG4L 1BEYL 2CJ3A 2APFA 2WN2A 3K6FA 1WFTA 4FXKA 4WI5A 1W2KT 1A22B 2G5UA 2DBLH 3H9SE 3NIDF 1T5WB 4F1ZA 4Z0XB 3DTUB 4L0ZA 1W72H 2F7OA 4G8AC 4PJEA 1MHEB 1NIFA 4N2HA 1PZDA 1FAKT 2Y1ZA 4JPVH 4UU9A 3NPSC 3AABA 4L3CB 5JR1L 5IMLA 3ASWA 5GGRB 1QFWM 4Y1AE 1BVOA 1X7SA 5TQ2L 5DRNB 1H5BB 1G7JA 1TCRB 2I60L 3JV6A 3L7FB 5FHBL 5KANI 5LWYL 3DO7B 5CUSL 1FRGH 3A0OA 5I6LA 2ADFL 1DBAL 4Y4KC 1DSYA 4I1NB 4PSPA 3DHUA 1OQOA 3RWCB 3VACA 2L0DA 5HGAB 4KXZH 4NIYE 4KITB 5IQ9A 1CD1A 1EHNA 1U8KA 3LRSA 2Y6SC 4PJFA 4Z7UE 3QGVA 3C5JA 4GKNB 1NBZB 1NGQH 4WDIA 2GAZB 5AW7B 4X98B 3PHOA 1XCWA 4BFJA 2JB6A 1TJMA 4NCC2 3KCPB 2C4FT 3HC2A 1SDAB 2NY1D 3TVMA 2ADGA 3IB4A 2BHFA 5J6SA 3CH1A 3QORD 3VI3A 2HLEB 3TEZA 1E9OA 4APXB 2VDRL 1FNEB 2HFTA 3EO0A 4OCXL 4W9FC 4EVNB 4UT6A 5FCSH 5GS1C 3UGXA 5F6IB 1J87A 1OD7A 2W0FA 1H5BC 2YPKB 2UWEB 4NI3A 3FN9A 5ALCL 3ULVE 2QLVB 2KDYA 1BYNA 4PJDF 3VFNA 3ESVF 3LPGA 1T0OA 4LCYA 4YHPB 1DDHB 5AAMA 4LEXH 4NJAH 5G5DA 3GINA 3IDMB 5DSCA 1GOHA 3QB7C 2DQ6A 2GI7A 4H0HB 1N59A 3N40F 3MCKA 4PRAB 3C8DA 4FCAA 5EUKB 2CK0L 3AUVA 4Z8FH 1FIGH 3CLFL 4FFWC 4PJ5D 1QSFE 1S7WB 1FYHB 2J73A 2YD7A 4OLUL 4X7SL 2WUCH 3OAZH 4GMSL 5D5MF 2DF3A 3F7LA 3NSJA 2VC2H 3ARFB 3QXVA 1FDLH 1MW0A 3WFDL 4BUGA 3BZ4B 3M1BA 4N68A 4Z7NE 3VFSB 3RG1C 1QLFB 1MCEA 1NCAH 2WLZA 3FTWA 4JFDE 1EPFA 3KG5A 4WSJA 4WW2F 5IVXE 2VSKB 3C6EA 3CSFA 4XWOC 3H9YA 1ZANH 1K3ZA 4Z7OF 1T66C 2YPLD 3D39A 3Q6GH 3FB8A 1RUML 1OHZA 2WQ8A 3F7YA 1GTNA 5D93C 2MRYA 5DFTA 3GBML 5D6DC 4ZMNA 5JUEL 2C9PA 5F6IC 4ODVL 1UC6A 3D7PA 5TF1H 4UBDD 2P4AB 3CFJA 3FB7B 5TQ0L 5CZVL 1PZAA 5AZUA 4ENED 1TQSA 1WLHA 3QP3A 2X1PA 2XYBA 4QHLB 4XBPA 1QA9B 1CGSH 3QUYD 5DTFB 4QJ4B 2A2QT 3F2LA 3NTCL 2YRLA 2IGFL 2QPEB 1TTUA 1L5GB 3TCLB 3VD7A 1ZLUK 2X4QB 3N42F 2NDGA 2VQTA 1W72A 1QHPA 4KRPD 2WQVA 5EU6A 3WHXB 1N4XH 4AYID 1KEGH 1U8OB 4F37F 4YUEL 2P45B 3U1PA 3GGWB 2Q2LA 3UFIA 2UYLB 3QJRB 3D2TA 3DSNA 3C5ZD 3EJCA 1ZTXL 2EXWC 1WFJA 4NIKB 3V55A 4M8QA 4NO0A 3ZW3A 5F96H 2IWKA 1EXGA 3LYRA 4ISVA 1U8NA 4OM1H 3O2VH 1NDMB 4U1SA 2EEFA 2OJEB 3H9HA 2N59A 3CXDH 2RFXB 2LW3A 1NCWH 2Y7NA 4FNLL 1S7SB 2EKSB 1BAGA 1PDKB 1E5UI 1PSKL 2ICES 4BWWA 1SJMA 2VRAA 3O11A 3CPLA 3JWOL 3QZNA 4K9JA 1CLZH 1M9WA 5L8KB 5FA3A 3G5XB 3JWNG 4XOBA 3MRMB 3FRPG 3UBXI 2GC4C 3CBJB 4ODXB 4L2YA 4AYMC 4QHPA 5D7JC 1GW6A 2FWSA 1KJMB 4I2XE 5C07D 1NCGA 3OJ2C 5HHME 5E8DH 2YIHA 4Z7WA 2CHWA 1VFBA 4FQ2L 1SDDB 4GQQA 3ECVA 3MLZH 2A99A 5AD0A 4GKSA 3RL1A 4L8BB 1F4YH 4OFVA 1CQYA 4WJ5A 5E8OA 3AS1A 1GPOH 3OMAB 4HYTB 1ZHNA 3D9AH 3O6KL 1IGYB 4EI5D 2G9HA 1LL1A 3NUKA 4PY7A 4U6XB 3PWPE 3NIDB 4YL4A 4JJ5A 3VE0B 2YD2A 1KELH 2FK9A 3TIEA 4X6BA 2PUQT 4X6EA 5CN1A 1DVFA 3OV6A 4DK5A 1HWGB 2NTFA 4JKWA 2Z4QB 4FL4B 2J1XA 4G7YL 5F97E 1KJVB 3MBWB 3IMWA 4P5KA 5BV7L 5E5MA 4NQDB 2IXQB 2WW8A 4YIQB 3BVUA 2W9DH 3OQRA 3SYOA 4LSPH 3ARBA 1BD2B 4KQ4L 1TPXB 5EZJA 5AG9A 1YEHL 1JF1B 1QR4A 3CCHA 3SKNB 2C3HA 1JVLA 1BMZA 1YC8A 3MO1B 3OBAA 2N7SA 4JAMB 3TBVA 4WI7A 4OZGF 4DCQB 2WO3B 4WU7A 2XWJB 2X4RB 3NJVA 2XQYA 4YGVA 3VXUD 3G9VA 3NFNA 4PCYA 2CBMA 5E2TL 1A7RH 1FC1A 2EIEA 3K0WA 4JQXC 3NCCB 1VFAB 4JFXB 3MROB 3CHSA 2EDRA 1JV2A 3I3EA 3FTGB 3FRPB 5SWZB 3AREC 2BP8A 3L4XA 1IE4A 4L4VA 1WIUA 2GJJA 1YEGH 1BJ1J 3W39A 1QRNA 1MCQA 2R69L 3RJDA 4KMTL 1N6QL 3FL7A 1YPZE 1M1SA 4X9BA 4TM9A 2MKWA 2XG5A 3STZA 2DW5A 3VWJB 3EYQD 1SN5A 1TPXC 5JW4R 2BXZA 3QIWC 1PLCA 4N6QA 1OXYA 2NLJB 2UY7B 3ETBJ 4MCYA 4KK6D 3TEXA 4MNGB 3NACL 1FSKB 4M7LH 4UYPA 1H8OA 4PJDB 4UDTA 4R4NC 2OI9C 1HCYA 1JPGA 3A4FA 4XI5C 5MEOB 2YAEA 3TO2B 1CS6A 3CVBA 2TSBA 3F04A 1EFXB 2WQRA 2XTJD 1I82A 5CJQH 3PHAA 2X1QA 3FHAA 4KUZH 1N6VA 2HT4C 5D5MB 5AVXB 3KPSE 2HJFB 4PJ9B 2EIBA 2F8OA 2IADA 1FP5A 2X0UA 3UG3A 4N26A 1CI5A 4WW2B 1NPNA 4Z7OB 1LNUB 1YN7A 3O4OB 1U3HB 1KCUH 2YOAA 4MDRA 2ENSA 4X9YA 4GJTB 2X6UA 4XBGB 2FNWA 2F19L 2X4UB 3X1GA 1FBIL 3MJ9H 2F61A 1S5HA 3U7YL 3ARGC 4UCFA 1GC1L 2MNWA 1RZ7H 3H6AA 2YA1A 3VWJC 1WF5A 4G70B 2ED6A 2MPAH 3GMOB 3IWUA 2X4PB 1UXSB 1N5AA 3SKMA 2BS71 4NQED 1JFQL 1RVFL 5FFOA 3DX7A 5FGBC 4KO7A 2F0CA 2EILB 4YHNB 4LNVA 2R2EA 3IEAA 5EIQA 3BSZH 2OTUA 4G6FD 3RVXC 1SOSA 4YSSA 5I1EH 4PY8J 3W0WA 2CIKA 4PAZA 4AEIL 2CSPA 2Y3NA 3AY4A 4AEFA 2QFRA 4YDZA 1XH3B 3N42B 4ZXBA 3MX0B 2CGRL 4CC4A 4PJ9C 3T09A 4XO8A 2K8MA 3G6JA 3KPRE 3SYQA 2EZ0D 2QADB 3ZL2A 2DM7A 3DJ9A 5EBWB 4X8JA 4WW2C 5FF6A 4UDUB 3O4OC 4LAJH 4LGSB 1CO1A 1BVKB 2V9RA 5KSBE 4ODUB 2FQDA 3EDFA 1I1AC 4O5LH 3QNYB 5EORH 2WKOF 3P11H 4AENB 2GT9B 4BSWB 2CXGA 2NXZB 4LAQH 4AGQA 5L7XL 1BIIA 2P5EB 3CBRA 1RSYA 1P6WA 3NVQA 1E6OH 4F15B 5CF3A 2ESVD 3KW7A 2JXMA 5IBUG 2MTPA 3GSQB 4JHVA 5IKCB 2GTZB 5I30L 1VF5C 2GSGB 3D2UD 3MUGA 3FUIA 4NZTL 3KLHD 4IS6A 3QULA 5CMAA 1HTYA 2VDPH 3QZWA 2ITCA 3KAAA 4M3JA 2XA8L 4XN9A 4R7DB 2IGLA 4KHXH 1QLEL 2VH5L 3TJPA 1CT8A 2EAEA 4IQHA 5D1QB 1U21A 3R1GH 4GP5B 5ETUA 1SJEB 1FJ1B 1C5BL 5IM7A 1IAOA 2VDQL 3KEDA 5J6HB 5MEQB 3DGGB 3QUZD 4N9OB 2QADC 1J5HA 3KPPA 4JO2L 2D8KA 5DHEA 1RL1A 5LCVL 3B8SA 3GMPA 3GSNL 3SO3B 2UY6B 3L4WA 4Y2DC 2VR5A 1KC5H 1Z3GH 3WNMA 3TT3H 4DUVA 4PSRA 2I5YH 2FWUA 1D6EA 2BSTA 2Z65C 4IGBB 1VDGA 5GS0C 3IBOA 1B88A 1CD0A 4F15C 5TDPA 1D2PA 4XBEL 5GRWA 2FX9L 2NR6C 3PHQB 3HPJA 4TV3A 1KDJA 1TQTA 4JO1H 1P4BH 4OBRA 4XC3L 2JE8A 4WHYH 4GIOA 1JMXA 4ZPTB 4HV8A 3SD2A 3T3PB 2L4OA 4QUOA 2EH8H 5DS8A 4Z7QE 1ZV5A 5K1VA 2NX5D 3US0A 4DP0X 1UT9A 1MJ7H 3S5LG 3CFMA 4JRYE 2QT6A 1F1DA 3TBSA 2IFFL 4O02A 1E8YA 1MJJB 4PW3A 5DUPH 2A0LD 2EABA 4N2MA 2PO6C 3GI8H 5CHNA 1BLNB 4MAYA 1YJDL 1J1PH 3HW7A 5CD5C 3X12B 3QDJB 4HUWB 4OCRL 5AZ2L 1RZJC 2VDML 2HFGL 3MFGB 3MJ9A 3TYGL 2JJTA 4OV5A 3SO3C 4ZMZA 2GIMA 4GAYA 4OZGB 3VGDA 3GMQA 4URTB 4PCSA 2VUOA 5IBUB 4MCNA 1UKTA 2VE6B 3BHBB 5IQ7H 1JD7A 2DJMA 2VLJE 4XPBH 5DCCA 2FBJL 1JZ7A 4RESB 1G9EA 3CIQA 3MV9D 1ZPUA 2X42A 1DUZB 1HZHH 2EIMB 3TCXA 1U8PA 4U3XA 3CVHA 5BV7C 1X5FA 3VXMA 1FYTD 1AVAA 4BZ2L 5HVHB 1BXAA 3BSZA 4U3SA 2Z31D 1NBQA 2Q6WA 4LCCB 2BMKB 3NABH 4R4BB 3GSUA 2H7WA 2DQTH 5F7UA 2OXGB 4PGBB 2JI3A 1RIVH 4OCWL 7PCYA 1HH9A 1DUYB 4G1MB 1SF3A 2V3FA 4OZIB 3KWWA 3A67H 4X50A 3ES6A 3HB3D 4GG6F 3K1KC 4GQ9H 5IVOA 3WNKA 4ZUWA 2RH0A 2Z92A 1ETZA 4QAMB 5HGDB 1X9UA 3UX9B 1R3LB 1CYXA 4BINA 3HUJE 4G2AA 2CLRB 1IAKB 2YKLL 3F83A 5E9DD 3C60D 5IB5A 3COOA 1B9KA 1FN4A 1UWYA 4KY1H 3CHQA 2A3TA 3UG4A 4I1PA 1NGZA 4MMXB 5ITFA 2KDGA 2J3SA 4YHOL 5FUOH 2FZ3A 2IVFC 5IW1B 3RTQB 2ZOUA 5INCB 3ZRFC 4EZJA 3S5LB 4LEEA 2CHNA 1YY8B 5F7WC 4FHBD 3D85A 3KWUA 5F3BB 3LRLA 3X13A 4NX0A 1G0XA 2X41A 3U9PH 4LEOA 1L9OA 4LCUA 2VYRE 2PTTB 1E30A 2X10A 3CN0A 1OPGL 5F93C 4TQ8A 5AZEH 4ONHA 4XPTH 5D1ZC 3S36X 1CJYA 4QD2E 1KYOJ 4M5ZH 1ZLUH 1RZIB 4K7PY 2Y06L 4NLAA 4MAUH 1MIEL 1MWAH 5DR5H 3ILPB 2Y7QA 1EEUA 2PPEA 1IARB 5GGVL 3G04A 2OX5A 1CICD 5E2WL 1CZ8L 1ZVHA 5F44A 4N0UB 1CFMA 5I1GL 2E0PA 1NIEA 4HU8A 3EHBD 4MMXC 1CG9A 3CFKA 4YXHH 3RTQC 5IVZB 4HIPA 3O3DB 1OCOB 2WWOA 3P30H 2XNAB 4NC1C 5ACMA 4KO6A 5KSVB 2C1PB 2FVNA 2BC4A 3C9NB 3CIAA 3MV7E 4P99A 1GC1C 5C08E 4GXFA 4HZLA 1N64L 5ISZE 4EKJA 4AIOA 3ZKSD 2OYPA 2VN6A 3PL6C 1P0SE 4LOUD 2OTWB 1BWMA 3D33A 2K3HA 1AZNA 2Z93B 2XJKA 3KPQB 3NJHA 4FRWA 5ITBH 3VFMB 2VR7A 4XP4L 3EZJB 2ZF9A 4W81A 3OLIA 1I3GL 3H2WA 5BS0B 3ARDC 3KHQA 2YGVA 1XO8A 2R83A 3Q8FA 3FO9A 4Y16A 4QO1B 4PY8I 1RZ8A 5DUJA 2H2SD 3C5XA 4P59H 2NY7H 4GT0A 1SJHA 1U8LA 5C0BB 5GRUL 5JHBA 1I1FA 2C8NA 5FYJD 4MJ5B 1QOKA 4FCHA 3EYOA 1HXYA 4PB0H 1W9XA 2XN1A 3RIFK 4GUQA 5LGHH 3FONB 3P54A 1BDYA 3K4ZA 4MJ6A 2DQGL 4EXKA 2E75C 1U41A 1A4KB 3IGUA 4JANB 1KLGA 3IE4A 2LFGA 3OVUB 2GHWB 2Y5EA 5AYQA 3FFCE 1UENA 4JRXB 2HT2C 1PY9A 5ESQB 4C56B 3BKCH 4V11A 2YR3A 3HC3L 3VRIA 3L4UA 4R26H 3FSZA 3DYMA 2DMGA 3RPBA 1KACB 15C8H 2SODB 1LO2H 35C8L 2FHFA 4JY4B 1N70A 1S9VA 1TTFA 3CC5B 1T4KB 1JGLL 4M43H 4F27A 1HWHB 2ZQKA 5F7FA 1GSKA 2OXHA 1OW0A 4M00A 2BWDA 5FLUA 4EQ2A 1PIGA 5FOBA 5ILTH 1I8UA 1U42A 4GKZB 1PJ9A 3QZMA 3MRRB 2E5EA 3PQYE 1Y6KR 1OP3K 2J72A 2XPGB 3VYPA 1UXWA 3FQNB 2PW2A 3K2UH 4GINA 3AGVA 1KLFA 1WK0A 3IWVA 3QFDA 1MY5A 1WC7B 3APDA 2O5ZL 1SPDA 5AW1B 2F53D 2HFFA 1X9RA 1USQA 2AVGA 3LAFA 3H8NA 1K5NB 5AB2A 1UOWA 2Y69B 4GUPB 4MZRA 3S37H 2IANE 1S7VB 4HSCX 1EEZB 1MWAA 2FIRT 2VDKB 2W9EL 3UOAB 4BQ6A 5J12C 1M2VB 2QSCH 2B7DT 2D2OA 5HVGB 4TQEH 4BUQA 4Q97A 5MEND 2OL3B 4GW1B 2YFOA 4JFVA 3V6ZB 2UZXA 4WENB 1WZ1H 4CVWA 4AE1A 1XF5A 1A6ZA 1QKZL 2B1HL 1A7NH 4WWNA 2CBTA 2CZNA 2G5RA 1Z5LB 4FQJL 4AH2A 4NM8L 3L1FA 2A6KA 3QORA 4QCIB 4D0CB 4U6HA 3TPKA 4GG6B 3DYPA 5EB9A 4DN3L 4P4RA 1AQDB 3SOBL 4E5XG 4Q8BA 1VRSA 3GWJA 3V4VA 3LS4H 4M9PA 1M56B 2EYRA 5LG6A 2MIZA 5HHOE 4DVBA 1ZVSB 2BNUA 3ZQ9A 3LNHA 3HI5L 2ZUQC 3FOLB 4F8OA 3ZZLA 1OGSA 3F00A 4R0LB 4DKDC 3F7RA 1IBGH 4WV1B 4OIFA 3KBFA 1JN6B 2CGZA 1LE9A 3SGJA 2BHZA 5C0ND 2E47A 4L23A 4PJ5A 5FW7A 1P4LA 2CUHA 2WK2A 5D4QA 3CUPB 5EN2A 4PHZA 4QTIH 3RX7A 3N43F 4JKNA 4KRNA 4XMTA 3BKYL 1QEXA 3ILEA 1N8ZB 3V0JA 2PYED 1N26A 5DQJB 1CXEA 2V7NB 3I9AA 1AQ8A 2M8XA 4QNPE 4IKKA 2VLRD 2DI9A 1LQBC 2YPLA 3JVGC 5IY5B 4KRMB 3L95B 5D7KD 2ZX8A 4N86A 5J7CC 2NW3A 4I1RA 5DVLA 3X2QB 1DBMH 4JKPH 4P3CH 2HTKC 4QHUB 1BW8A 3AS3A 1HHHA 2RBLA 3OG6B 4ZFOB 4DGIH 5GJSH 5DHYA 1OT1A 5D72H 5DJ2B 3DVIA 3MJ6A 4LRIC 2I9LB 5C0EA 2EVHA 1H15A 3REVB 4Z3EA 1HFUA 3X14B 4HKXA 4L8SB 4NHCL 3Q05A 4G9FD 4R0LC 3B4NA 3FCSA 2P26A 3KBHE 4JLRB 2D7QA 5BXFB 2P42B 4MA8L 4LESA 3QUYA 3ZL4L 1OCRB 1C12B 3O45A 1E9QB 4KXCA 2Z35A 3MLYL 3AGWA 1YYLH 3B5HA 5DJAB 4ODBD 2WQUA 2YAPA 3GDBA 1AS8A 1HXMB 2Q8BL 2J6EH 4RGOL 4TNWK 4X7DC 5E8PB 4AC4A 5IHUL 1WICA 3GB7A 1YMME 1IEBA 5C0CB 2WLKA 3C5ZA 2NY5C 4E5XB 5LQBH 3R0MA 5AW3B 2VLKD 5BW7A 1DN0B 4HCFA 3FQYA 1A9EB 1RULL 3ASOB 4CGUB 4U2ZA 1XCQA 2EEDA 4PVLA 2AJUL 1U8MB 4KVPA 1I3RB 2X2YA 4YDLB 3AWGA 4LIQH 2ARJB 4NWUH 2WZPD 5DC4B 1Z9NA 2Q87A 2HJKA 2XV0A 4Q56A 2OZNA 1UVQB 1XH2A 3MBED 1FHGA 4L8SC 2N1TE 3QCTL 4JM2D 2DQDL 5BQ7B 2CKNA 2K6WA 4R96B 4GRLB 3UEZA 4YXKL 3VXQB 3LIZH 4QRSB 3GM8A 2O1AA 1LILA 1AYRA 4XVSH 1Z1WA 4DVRH 2AXWA 1JI1A 4PQXA 2ADIA 1RXLA 5C07A 2ENJA 2G9KA 4C59B 1I31A 4PG2A 3T2PA 1FORL 1DLFH 1D6VL 1L3WA 4PS4H 3X11A 3L3IA 3ZVVA 4I85A 1QX1A 1G7IA 1HHKA 2A1WL 4G82A 2XZCL 3GHBL 4GFXA 4MX7B 1T1XB 2DTSA 3WO4B 1TEFA 3V4UL 3KBPA 5JNYB 4J2XA 1GS7A 2VRKA 4R7NA 3WJJC 1A6UH 4EI5A 5AVUB 4C4BA 3E1ZA 4L9LB 5ECJE 3BVWA 1KCLA 1VFMA 2CMRL 1G7MA 3BH4A 1AG0A 4NSKA 1BQUA 4NKOA 4P9MH 4GO9A 1SXAA 2I27N 4JG1H 1J0KA 4AIXA 4UT6L 4NN7C 3OPZH 2YA2A 5ID0B 1NGWB 4IRJB 1S9WB 4XX5A 5DJXA 1VGKB 3BO8B 3F7PC 3MDJA 5MP6L 1F58H 1E27A 5AL8A 5FYKD 3FFOA 4AXWA 4B9ZA 3RWFA 5J1TC 4PBXA 2BOCA 5LNEA 3WIHH 1WFOA 3AG2B 4QOKE 1D5IH 1P7BA 5E1AA 3ZSTA 2XXFA 5ICZA 3WTTA 4N2EA 5D2LF 1INEH 2ZAGA 5HSFA 1ZSHA 4PGEA 1WA0X 2D03H 3FQUA 3VXNA 5EEYA 1E2ZA 3MFFA 4ZQTA 1XZWA 4S0HA 1JE6A 3EGDA 4JFEE 1I8LA 3RFRA 1KFGA 1A6AA 2E27H 3PS6A 1H3WM 1CDBA 5BZDA 4OAWB 4R9HA 4WU5B 3VXUA 3O3BA 3UIZA 3ZKQD 4QLRA 5EUOF 5TGBB 1CLYH 3M07A 3MC0A 5FFGA 3PAVA 5I1IH 2EEAA 1ZIBA 1LWHA 3EKCA 5D7LD 2XBTA 5INDA 3S48A 4J8RB 1KN2H 2DKMA 1IEAA 4FQQB 5IT2L 1MH5B 2LLLA 5KBMA 3C6LD 1QFWH 3W82A 5HDBB 4GXUM 4I88A 4DTGL 4AQ1A 4BH7A 2KZBA 2JJSA 1BZ9A 1HL4A 4QY8B 3NH7L 4LARH 2X6MA 2ZKHH 4JL1A 3VW3H 5GGTH 3APCA 2J6EA 3WJLC 4ONFL 4E0RA 4PRIB 43C9A 5I66B 4KV5F 1FG2A 3VGAC 1RLBA 2UXGA 1ROCA 2ROYA 3ABLB 2DBLL 3SB3A 2UZIL 2H3KA 4HF5H 5B38A 3AU1B 2OMUB 1QTYT 3J07A 5AW0B 3RVUC 1MVUA 5IQMA 2ADJB 3BQUB 1W72L 4JO3H 2XWBB 3LHPH 2FEDC 4AVIA 4HH9B 4AUYA 4OVVA 4KJWD 3RU8L 1EGJA 2DAVA 3QJFB 5K39B 4IHOA 5J56B 3N43B 3RNQA 3WIIH 1AIFA 1P6FA 2DICA 2GY7B 2MFNA 3BSHA 3RWHA 1VB9A 2OMZB 3L3KB 5JHAA 3LIZA 3MZTA 3IBEA 3L5WA 2KH2B 1AGBB 2CUMA 2FO4A 5CIPH 4NFBA 5F89B 3T0EC 4W9HC 4JGMA 5ESVB 4CU6A 3MCYA 1YN6A 4NQEA 5DZAA 1DJWA 3IMRA 3UGEA 2H6UA 4ATTA 4Z7WF 3IVKB 1K9TA 4ZOAA 3KYMB 5T5NF 1FGNH 1ITCA 1NGQL 3CFBA 2AEPH 5AB1A 2EXSA 1KPUB 1LO3H 4Q2ZB 1ZA3A 2EDTA 3BQUC 4LLQB 3RKDD 1EHAA 4Y19B 5CU9A 5GSRA 4AQZA 1N2RB 4HH8A 2VAAA 2OULB 1FA4A 4QXUH 4Q14A 4K23L 2LAAA 3RI5K 1UD3A 1BFOB 1IBYA 1KY7A 1M7DA 1SXSA 2VXVH 3OKNB 4HS3A 4LLDA 4LSRH 3UZEA 4JHWL 4K3EH 1BGXH 1GYWA 3QIBB 3V0DA 5KVEE 1PZ3A 4BELD 2PXYC 1B2WH 2WBJD 1N6UA 2Y3AA 4OTXL 3RX9A 4L29A 5L2JB 3VFTB 4F9LA 1QBMH 4PD4J 4LEXL 4ZS6D 2PR9A 4JE0A 1NM9A 4PLKC 1E42A 4OF6A 1OB0A 3W11D 1A64A 4Z8FL 3P3YA 1IILE 2XXGA 3T8XB 2BRRH 5KZCD 2ESVA 5J9PA 4TNFA 2WUCL 1FNFA 4YFLF 2VSMB 3D2UA 4YDKH 4XE5B 5DFWH 1I4FB 2VC2L 1FDLL 4HC1H 3PNRB 4O51B 3PY9A 2WV3A 4NDMB 3UYRH 4LSVH 4RRPM 4BFRA 4G8IB 1KGCD 3E38A 4OBSA 3TESA 4LVEA 2J44A 1ZANL 2WWMD 3CWGA 4OLEA 5DYOB 2DYSB 3Q6GL 1HEHC 1Q9WA 3VTAA 4L8CA 3PWVB 2HX9A 3FNKA 1OOAA 4FXKC 4K73A 2CHZA 4TMPA 4PRDB 3BIKA 3QJXA 3QUZA 5CEYB 5E1HB 5TF1L 2D4FA 1YYMH 1TQWA 1IQDB 3FMGH 4PJ7A 5FYLD 1JHTA 1G5GA 2WANA 3QYCA 1CXKA 3ZKMC 1MOEA 1UB5B 3HAEH 2FO1A 5GGTA 3E8UH 3G5VA 1OQXA 1LMKA 4BEIA 4F9PA 1FL5B 3VG0H 3C08H 5A2CA 4Z76A 1CGSL 3IJHB 1H3TA 3O6MH 3PGFL 3POHA 1OP3H 5J5EA 4KI5E 4QGTA 3HE7C 3BUYB 3BP5B 2M2DA 1RPQA 3SPHA 5J57B 4W4OA 1N4XL 5HYSA 1KEGL 2NQDA 3K72A 4JFQB 3O41A 1TU2A 5I75B 1X5YA 2YAHA 3RVTD 4LBEA 2NX5A 1KTKE 1ZRUA 5T3ZL 1VA9A 4K8RL 4H8VA 4GOSA 4RX4D 1DBKH 1S7XB 3RWDA 1JWUA 5D2LB 1J5DA 1HQRB 1MRDH 5F96L 1MCLA 4N0YH 2J8UF 4JZJA 3CFEA 4N8PA 4P46C 4EI0A 3US9A 5AUMB 4OM1L 5IFJB 3ZIYA 3DVFA 3O2VL 2BZDA 3QG6B 1S8DB 4N8VG 1TG8A 3AQXA 3QNZB 2DL9A 4W9KC 4FLRA 4NKQB 5CIPA 1NCWL 4H5SB 3HS0A 4IEFB 3SQBB 2NUPB 4KFZC 4J1UA 3HE6D 4FQCH 5T5NG 4OD2B 3VGFA 5F3FA 4CC0A 1HYSC 3O3EB 1A4BA 3RWJB 4B97A 2KLRA 3L7EA 1TSRA 4YEEA 2YXMA 1OANA 1NGYA 3ECWA 3MV9A 2PWGA 3VXSE 2VR4A 3UDWC 4N6RA 1WHPA 1UQSB 5FYJH 1ZV9A 1FYTA 1M53A 4PVBA 1RZPA 3RL2A 4ORGA 5CKGA 2BSED 3ECUA 2WLIA 2BVPA 2Z31A 3IU3B 5E8DL 4BDVA 3BPCA 4FX5A 3MAWA 5DD6A 5AAMC 4XCFH 1CFNA 2E7DA 4A2HA 1T6WA 2Q1EA 4CJ0A 5D2NA 3FUEA 3MLZL 2H47C 5E4EB 1SVBA 4E9LA 5K59E 1RZQA 1F4YL 1WYJA 2VUKA 5JHDB 4EMZA 3RQ3A 4ATWA 5I6MA 2ETWA 4AYGA 4WFGE 1GPOL 4LZKA 3ZDXE 3D9AL 4LKCA 5MEPA 2P9RA 1JNHB 4KUCF 1BVNP 4IMLA 1NA8A 4I0PB 1KENH 1B4RA 1KELL 3GMRB 3TURA 1OWRM 5E9DA 1U8IA 2IDCA 3BVTA 2DJSA 3C60A 4HJTA 3O9WD 4YDLC 5EWIL 5HI3D 3LMJH 3U4AA 4NRYA 1W16A 1A9BB 4CN1A 1ZS8B 3FQXA 2OLDA 4AVHA 2W9DL 4LSPL 3EFFA 4GQPH 1OB1A 4HC1A 1LO5A 5C0RH 1ZT7B 4AIZB 3JWDL 2VL4A 2P7TB 4UMSA 2XTSA 3A6OA 4MXVE 5JIQA 5ENWA 4ZO6A 2NNAA 3BDXA 1BXVA 3D4YA 3QAZB 4NQXB 3AAZB 3BD3A 4P2QE 1E4XH 4XOEA 5DZNA 3PP4L 5HDQH 2R2BB 3W1ZA 4OLZH 2V7HB 4GG8B 5IP4A 3L6FA 2WKGA 1PZCA 2ISDA 3MSPA 4G80A 1R5WA 1U58B 1UJ3A 3MRNB 2ZOKA 1KY6A 4DGWC 1BQLH 1F45A 4PWIA 2V2XA 1DQIA 2GFBA 2QR0B 3I84A 2Y6TE 3PWLA 4E41B 1A7RL 4I0PC 4R90L 3WUWA 4YHKL 1MAMH 1WAPA 2V2WA 1FL3B 4RQQB 5EOCH 3HAEA 3HMWH 4FXGA 5G4MA 2LU7A 2EC9T 2ZNWA 2KHAA 3OGCA 2A6JA 1CICA 5T5FH 1YEGL 3MUZ1 2RIKA 5IHLB 4UQ2B 3GD1C 2P8PB 4QHMA 3KYOA 1Y0LA 3MNWA 2QTEA 1H3PH 3VH8A 3B2VL 3LKNA 5FXCH 5AQ0A 2NY2D 3T0AA 2X6BA 4X99A 3RVVC 2CH8A 4L8DA 3K71B 4QTHA 4YE4H 3F12A 4M7LL 4A67A 4OZFH 1X44A 1LD9B 3UGUA 3UC0H 2FYYB 3JTSA 3QAZC 1SEQH 1KDIA 4G9DB 1Q94A 2P3YA 3KLAA 3O8XD 1F18A 1N0LA 3QUXB 5SWQA 4PR5A 4PLJC 5KBNC 3R18A 1V7NH 3JTBA 4MQSB 2HKFH 4YSCA 3Q43A 5ECGA 3BKMH 3OAUH 1T5XB 4AK1A 4BKTC 1Z9PA 3T2QA 4M7LT 4CSPA 2Z7WA 3HI1B 4KUZL 4M61A 1AACA 3BZDA 4XNDA 3GMLA 4X8XA 4XP5H 4N24A 3B7YA 4P3DA 1CYWA 2AJSL 4O02L 3VU2A 1VKXB 1ETJA 5AAWA 2G3MA 2YC1A 2ZKYA 4TQPA 5M7QA 2FATH 2ZAIA 4F7EB 3MPCA 1GZQA 3BW9B 4MZ2A 3DIFA 1PF3A 2VDNB 4LF3A 3I9IA 1FLRH 3IF1A 3N44B 2RACA 2WXHA 3MJ9L 5T1KD 1UZ8A 4WEBL 3W9DB 4IBUA 5C0GA 3HHSA 5T1LB 1ZEAH 1T0NA 1S7TA 4PRHE 4Q9BA 1KIUA 1YA5A 3VXRB 1RZ7L 2XUWA 2LOEA 1I7RB 1F6AB 5HYQB 1YNTA 4P57A 2MPAL 2H41A 1JDDA 4PJIA 1B90A 2DRUA 5HJGA 5L2KB 3GJFB 4GAGH 3UJTH 1P2CA 3NFPB 5TE7H 2C3GA 5B3NA 2RCSH 1X7QB 1AOZA 4HG4K 3QUXC 3CVHL 5IEKB 2FYVA 3QEHA 1DJGA 2R15A 3BSZL 4ONOA 3MNZB 4KTYA 1PKQA 1GH7A 2R4SL 5I1EL 1BZEA 3A23A 5ANMA 2IPUG 3B2XA 1UTDA 1B3JA 1PYWA 4R4FL 1NH6A 4H8WH 1IKNA 4PJCA 3MUJA 4F2ME 4D0DB 1JTPA 3F85A 2VT0A 1JSYA 4XMKH 1H3XA 5DK2A 2VW6A 5KG9B 4UOW1 2HT3D 5EN3A 3GPSA 2E6PA 4AQEA 1QSED 2EADA 4Y5YB 4YO0A 4XNUL 1G9NC 1AHWC 3SDDD 2EVGA 2H4EA 1XGRB 5K33A 2ZUXA 2F74A 5EORL 1HJCA 1NBYA 1RJYA 3EJTA 3P11L 3OSVA 2J8UB 5DZJA 3BFWA 1FUNA 4OCSH 1KPRA 4U1MB 4C58B 5IEHA 2FR4A 4X4ME 1E6OL 4BBWA 3OMIB 3WTVA 3BAEH 3MRGB 1IGCH 2F53A 1A3QA 1AH1A 3LH9A 4JGUA 1P4IH 5FKAA 2IPTH 2VDPL 4NRZB 4PJBA 5JXEC 1CE6B 4U6YA 3QS2A 4UNVA 3SE8H 4J23A 4LEBA 5EIIG 2LT9A 3KS0H 1MCSA 1UGKA 2FLMA 3R1GL 4KC3B 4JCLA 4WEMB 4Y89A 1ZV2A 5MENA 5JIPA 5FC9A 3VM7A 4K8RC 5T5FA 1JG9A 3HRPA 4ETQA 5KANG 3ULAB 1AHKA 1C08B 2WYHA 3ILQC 4JZOA 3P9MA 3BE1H 4OQTH 3A6CH 4Y5YC 1C1EL 1ORQA 2BNRB 1Z3GL 3S8GB 2IAMB 1HZKA 5IHZA 2AV1A 4HUCA 1TJGL 3TT3L 4WEEA 2I5YL 3IXAA 3QR1A 2NNFA 4HEPG 4ZX6A 4NO5A 4QHKJ 4OZFA 4UZUA 4XHJD 4Z7UF 3EYFA 2WLJA 4GS7B 3EGSB 5DJZA 4FQXD 4RMUA 3QO0B 3PWJA 4Z7VA 1ZJAA 3DX8B 3NEOA 1E4WH 4L18A 3LPWA 4JFFD 3K81A 4IRSB 4B9KC 4MAZA 2BIMA 3K6SB 3VB9A 2EH8L 1D9KD 4KKLD 2GJ6D 2R51A 4LT7A 5D7IB 5DEZA 2Q20A 1MJ7L 5C7XH 4Z3GA 1SVZA 5M95B 5FYKH 1CD8A 2H3NB 2ERJC 5KYWA 3ALPA 1BBDH 2X4TB 3GI8L 5IREA 1T83A 4NPKA 2PYEA 4G1EB 1J1PL 2CIIA 3EFOB 4UM9D 3ULVF 4MWFA 3ZDWA 2F1EA 5LGJB 1A4JA 3QC5X 1H8LA 2VLRA 4ZZFA 4BQ8A 5K9KB 4MFHA 2DDQH 1J9TA 1QHOA 2BFGA 3L4YA 4U1LB 5DU7A 1JZDC 1RHHB 2DWXA 5ALBH 5I5IA 4K3DH 4ZXBC 5IQ7L 2O72A 3LN4A 1EH9A 4WNQB 4XPBL 3EOYG 2D4DA 1X4XA 4CC4C 4EIGB 5FKPA 3OB8A 1T21A 2Z7UA 5K93A 1KLUA 4L4JA 1BXXA 1HZHL 1OKEA 5E2UH 3QEQE 3TBBA 4Z7NF 2XWCA 4ODSH 5I9QB 2EYSA 2WB7A 1M6UA 1Z0MA 2ZSWB 4G9FA 4IRSC 4AYDC 5IVXF 1G6RB 4HBQA 1SHSA 3NABL 4J3TA 2DQTL 1ORSB 3JWDC 3MLXH 2CKBB 2IGTA 3KWVA 3DVGA 1RIVL 5DEFB 4ELMA 2XWXA 2DM2A 4YSPA 3V5KB 3O4LB 3QDGD 5DZVA 3TA3D 1E3ZA 1YMHA 1HK6A 1U2CA 5I5MA 3QH3A 5SWSE 2H2PD 4GQ9L 3P4MB 4FE9A 3WEAA 3PXJA 2XZAH 5L4FA 1MDAA 5I19H 1IZKA 2VN4A 5D1XE 1LP9E 2HX7A 4GP4B 2VLKA 1HHIA 3RX5A 1F11A 4F7CB 3WTWA 4B9CA 2AI0L 4KVCH 4FQHB 4X7FC 1GOGA 2QVIA 2X4OB 3MRCB 4PPTA 5EZLA 2B08A 3FH8A 4KY1L 3S96A 5B39A 1P9MA 2WZPA 2EDQA 3MRBB 5CGMA 1B0WA 5FUOL 1XR8B 2QV2A 3BH9B 3WLWC 3MBEA 1J0JA 5FM5M 4JM2A 2K45A 4PRPE 3Q3GA 4ZYKA 2R7EA 3FO2B 3PGDB 4S2SA 3LXUX 3QO1A 3WEBA 3OHMB 3EF4A 5EC2A 1OL0A 3OZLA 4Y4KD 1H3GA 4QXWA 5EC1B 5FK9B 5AZEL 3D18A 3FT2B 3FTZA 1MI5D 1OAXH 2OYKA 3IK2A 4M5ZL 4BSJA 3KXFE 3LPPA 4MAUL 2HRPH 1MWAL 4NERA 4OQTA 3MMEB 5DR5L 5ESAB 2AKRA 4NC2B 4IIQC 5LN8A 3RAJL 3I6KA 1CPUA 1PL3A 3UERA 3UADA 2G4EA 4DUWA 1RH8A 1X5IA 3OLDA 4NYLA 3MNVA 2JB5H 1R9FA 3DPBA 1WA2X 3SQRA 3KH4A 5CCGE 1AXTL 2Q0ZX 4JREC 1OARL 4TUJA 4M6AA 1S7RB 3ZBMA 4HLZH 3C5SB 4YXHL 1CGYA 3P3TA 3D0VA 3P30L 4TSBH 1CIUA 1XR9A 1CDIA 1MJ8H 3KLQA 3L4VA 2FEEL 5KTEH 3T0VA 3T0DA 2AABL 4K3GA 3BZEB 3I50H 3QWRD 1TVHA 3V4VL 2LTQC 4RNRB 1VFOA 1E4HA 1QQDA 2JSFA 2LVCA 1X3DA 1E90A 3CFDB 2EE3A 4WFHD 3MRIB 2XFXA 4J4PD 1X9LA 5J89A 5ITBL 2NPLX 3EYUH 3NESA 3H9SB 4QRTB 3MV01 2HG0A 3CH8A 5KJ4A 3WIAA 4AQAA 3T1WA 3MUUA 1NUDA 3SIKA 4CN6A 4KKZA 2DQEH 1JZGA 3RGHA 3H9ZA 5C09D 4HU2A 1SLVA 2YAOA 3VA6A 4HMCA 3NK4A 1J1OH 3QEGH 4FG6C 4JQVA 3SZ6A 4O2EA 4O00A 5GGVY 3IPFA 4D9QD 3U0PA 1CFTB 4JDZA 4EDXB 4HGWB 2VLLA 1TF4A 4P59L 4LPCA 2NY7L 3IDXH 1ZT4B 3JVFC 2EIZB 4Y1AB 3EGXA 3QFJE 3M1OA 5D7LA 1YUHA 2NZIA 5BOZG 2DLHA 3HG1D 5IB4B 1SF5A 4FNPA 1XWVA 1GRWA 4Y88A 5LGHL 2VKXA 2N7BA 3C6LA 3P73B 4MBRA 5HHPB 4ANUA 4QHNB 4I5BA 3Q48A 3SE6A 5C6TL 2OSYA 3UAEA 4X6DE 3FPXA 3O6LH 4PJXE 2XN2A 5FYLH 3SD5A 1PLBA 4BFGA 1FO0H 1Y18B 3IDIB 5I0VA 3GHPA 2NYKA 4UQ3B 1RP8A 4LLUA 1I7TA 3KPLB 4Z7UB 2A83B 1XD0A 3IFOB 3ZT6A 4R26L 4FF9A 5F9JA 4XH2A 3TNMA 3ZR5A 1GCFA 1XSIA 2H45A 15C8L 5HDOA 2ATPA 1JWMB 4NNYA 5G4OA 2QL1A 3SBRA 3SPJA 4ICWA 3TIDA 1MXDA 2D3NA 2YGOA 1DSWA 3M17A 2ZX9A 3B9KB 3JZ7A 4N5EC 4M43L 2D73A 2CA4A 1F00I 3KL5A 1YPZF 2UX6A 1G7LB 2B5IB 5ILTL 2EXWD 4D7BA 1U9KA 4NZDA 1WG3A 4P04A 5I17A 4GO8A 5H35A 4OIAA 1RZFH 2XXMB 3IDJB 1NCUA 3P2BA 4B95C 4LGRB 3K2UL 3D52A 4LCWE 5FDWB 4JW3A 1O6SB 5MHSE 5FV1L 3OKOB 5F1KC 4JDEB 1SBBA 4C54A 1IB5A 2Y36H 4NZUL 1J8SA 3L1OH 3A3YB 1QSFB 3S37L 1JMZA 5KYYA 4Q9QH 3HHRB 5GGSA 3U82B 9CGTA 1L9MA 1GKEA 4XPHH 1WLGA 1AGCB 4NN5B 3OD3A 4IBLT 2QSCL 4BHUA 3IU4H 4JFDB 4TQEL 2MQ0A 2NYYC 4WI9A 5IVXB 3LN5B 3ZTJG 1KXTA 4BK5A 1WZ1L 2MEJB 2WLNA 1M6OB 3F5WB 4TSCL 1MLCA 1A7NL 5ABAA 2HG5A 3UJIH 4H88H 4HFUH 5AVYB 4ABVA 3O6FB 4ZMOA 1CXFA 5I76B 5TPWH 4LBAA 3V0VA 3OKDA 1HCZA 1CXLA 3ULVC 3HLAB 3OKLA 4ZMLA 2KZ1B 2VJXA 2ED7A 1OAUL 3MRDB 5F7YC 2WBJA 3UBHA 3E6HA 4X9GA 3T8VA 5HHQB 2XV6B 1CF8L 1IBGL 2QQQA 1I1RA 3RNKA 2CRYA 1AYOA 3BP4A 4PRBA 3T04D 2MMXA 1P1ZA 3CDZA 3AXLA 4Z3FA 2Q7YA 1CCZA 1B2YA 3TGXA 1MIMH 3EBAA 2BK8A 4ODHH 4OI9A 3FC8A 4NN5C 2X2HA 4DKAA 4Z3TA 2J2ZA 2JKNA 3CFUA 4QTIL 3FZUC 1KGWA 5LBVA 1DJHA 1S7QB 5FYJU 5H4ZA 4LSSH 5KSBF 2J71A 1DE4A 1MPAH 4DP2X 4MASA 3R8QA 3L3GA 5AL0A 3U79A 3IFPA 4U1IB 5AG8A 3SKOA 5MI0C 5JQIB 1IRAY 1DBML 4NRXA 3HTLX 4L05A 1DVQA 3BP6B 1N8OE 1ZA6A 5F7DB 2BVQA 2PPAA 4DGIL 3LRMA 2EQDA 3TBCA 5HVFB 2FDBP 1YO4A 3BJ91 5D72L 3AG1B 4ODWA 3NA4A 5EF0A 2GG1A 4NQQA 4PBVC 1HS6A 1WFMA 5EU5B 4BFIA 1LO0H 1EWHA 1FO0A 4DK3A 1OW0C 4YBLB 1PX3A 3FOMB 3GK8H 5ICXB 4HUUB 4K7PX 1UD2A 1FV1B 4GAFB 2AQNA 4I2XB 3WUZA 3SDCB 4NQDD 2X4NA 4HXBH 3E80A 3GO1H 3CN4A 4OJEH 4PTTB 2B0SH 2X2UA 4HOMA 5IUCA 4ZJ9A 2Z91A 4NO3A 1YYLL 3VUAA 3AT0A 4YBQD 1HE7A 2ZCHL 5IR1A 5GGUB 2J6EL 2QMKA 5EO1A 1BREA 3EADA 3NCYS 3R0NA 3ETBF 4R4ND 3C6SA 4NJ9H 5DMYA 4XI5D 5LQBL 3FHEA 3U9WA 2H0FA 4ZRGA 3V7AG 2W65B 4RX4A 3ARXA 1EBAA 3ETTA 2K4AA 7FABH 2JCCE 1J8RA 3PWPB 5DRXB 4EIUA 4M7KH 3V52H 4LIQL 1AD9A 1MCWM 2HT4D 3APMA 3HOGA 1DQKA 2R29H 3BC9A 4L5FH 2Q86B 3FQTA 1EDYA 2NY1C 5SWZD 3HE6A 4YBLC 3IT8D 4Z7QF 4MZIA 3QORC 3RDTB 3CFIC 2OMWA 5EDXA 2D0GA 3LIZL 1JK9B 4XVSL 4DVRL 2Q76B 4X7CC 4BA8A 5DWUH 4ZT1A 1PG7W 1MCCA 1L6ZA 3HJEA 1NFDE 3VWJD 1J9RA 2ZX7A 1T1ZA 5EF1A 2BSEA 2XBDA 1DLFL 4HJEA 2EDWA 5E6RB 1KPVA 4PS4L 4PI0A 3DTDA 1M71B 3FKUS 3P77B 4HWUA 2R23A 3KL3A 3SGJC 2VM3A 1E7VA 2G30A 2QQLH 2MKLC 1F4AA 3CZKA 7TAAA 1T03H 4CADA 1CU4H 1EFXD 4PJAB 3JYCA 3ZZSA 4X4KA 1A6UL 4YAQA 1QI5A 1UM4H 1ZT1B 2XVBA 4K94L 2VLMD 3EXLA 3VYOA 3NP4A 3FF8A 3NSYA 4H7VA 4LDLB 1SLXA 4PJ9D 3W3BA 4X4YA 1KSRA 4DGVL 5TD4A 2IF7A 1J0IA 3UROR 4JG1L 4P48A 3IDUA 1XV8A 1WWWX 3O9WA 5C0FA 1U3HD 3RDTC 1YPZB 4BFFA 1XGYH 2JTYA 1I9JL 1F58L 3BIAX 4MKTA 4XGZA 3NEEA 3B7TA 4FHJA 1HSAB 3Q1SH 1QO3B 5BO1H 3G3LA 3KVDD 2VM4A 1SXBA 2AJXH 4HKBA 2D03L 2JKTM 4DZBB 2R2HA 3Q2LA 3HUJF 4MMZA 4B9GA 2AJZA 3DO4A 2E9IA 3I9PA 1M7UA 1JVKA 3VI4A 1EZSA 5D4JA 3V0EA 1DQQA 4RDQF 2A9ML 4MNQE 1NAMH 1WD8A 4U1GB 1JGDA 3S36H 3Q2NA 4RFNB 3KGUA 2WAHA 4FYRA 5FGCE 1A7PH 3QRBA 4X4ZA 1JS4A 4F7TB 3NA9H 3NK3A 1F4HA 1XVSA 2F54E 1FVCB 3BT2H 3KPSB 4ZDHA 3LV3B 4N4YB 4ODTH 3V0WH 2DIJA 3TWCH 1BD2E 5H8DA 3VXPB 2WLYA 2VN7A 2PCYA 4OSUH 1KN2L 2FSEB 1DQML 3C5ZC 2QADD 4JY6A 4AZ8A 4CVXB 3G7TA 3GSNB 1MHPH 43CAB 1BP3B 2P80D 4QXTB 3RWGB 3MR9B 4X0NA 3BVNA 2KZKA 3H4FA 3DX9B 3CG8A 2V2TA 2AITA 5CLYA 4F7MA 2HJLA 1R6VA 4LARL 4MBOA 4S1QH 2ZKHL 2ZYSA 5F9WB 5E95B 3VW3L 4NKDA 1K4CA 2NXZD 5GGTL 1G84A 2P5ED 2WQSA 2HB0A 5GS0D 3H42H 3GMMB 1P6AB 4KPHH 3GIVB 3U0TA 4D8OA 2NR6D 3I6LD 3O8XA 4HF5L 5I16A 5IESH 3ZE0E 3L5JA 1XZ0B 4AGLA 5IF0A 3LHPL 1OTSC 3R4RA 1NCJA 4G59C 1V7MH 4QMEA 3ULUE 1SVCP 4AEEA 1J7VR 3ZK0A 5CZXD 1VACB 3QUGA 2R29A 4E9SA 1QFWI 3QISA 4XCNB 3KPRB 4N2KA 2J5LB 3VA2C 2ZIDA 3WIIL 4AJ0A 5KJRH 2GITA 3PGCB 1E8ZA 1QEWB 5GPRA 5KSBB 5CD5D 1VADA 5JPMB 3QI9B 1AC0A 4M4RA 2C9RA 4TVPD 2GJZB 4EI5C 2JLPA 3DMMB 5T1KA 4GQRA 2E7LA 4F33A 3GC3A 3BGAA 2YZ1A 2XX1A 4G11A 3NCBB 4OZHA 4Q74A 5F9WC 5T3XD 3L9EA 4HJSA 3SDXE 5DC9B 1Q9KB 2CCVA 1I7ZA 2X1OA 4GRWH 3D4CA 5HHXH 2DJUA 3EIFA 2AEPL 2MCPH 1KFAH 1T0MA 1LO3L 2E8ZA 1G1CA 1NC2B 1WD9A 3IGAB 2F1BA 1COBA 5JW4N 4HPHA 1JGVL 2BPBA 5KSUB 2FL5A 5EA0H 4JUSA 5K5YA 2MQCA 4QXUL 5CGTA 2ODIA 4A7QA 4XXCA 2DQHH 5ACZA 3BWUF 2VXVL 4LSRL 4XB3A 4X5PA 3ESMA 5BRPA 1GZHA 5FYKU 3GXTA 1AFVH 4H25A 1I8LC 4K3EL 3FU6A 3CDYA 1BGXL 2JJWA 3AG3B 5HGGS 3QDJD 1BSIA 3QI9C 5JPMC 5K69A 3ZHKA 1WAAA 1B2WL 1Z9SB 2RR3A 3SDDA 3VQ2C 5KS9A 5IW6A 2X70A 4F37K 5AOLA 3UZVB 5K9OA 4OKVA 5FIEA 3BUTA 4FABH 4RDQG 3FHQA 1FVEB 4JE4B 3Q01A 1TEYA 5E5LA 3OR6B 2EDOA 2BRRL 4EUPH 1GYUA 2BNQB 5JDSA 2BWQA 3EH2A 3E1F1 3BEWA 4OLWH 3WAJA 1NAMA 4A7SA 4G83A 4GAAA 4YDKL 2P24A 1FNAA 1YUKB 4G8GE 4AQ1C 4HC1L 3ZE2E 4U1NA 4Z7QB 3UYRL 3T4AB 1U91A 4JRYB 3IMTA 4BKLB 2XA3A 1LTXA 1OM3H 2A9DA 5TJWK 1WVZA 5HHNA 3EYQC 3HI6H 4MDJB 4M4PA 4R3SA 1HNGA 5CD3A 4RAVA 2EJ1A 3ARWA 5EU4B 1UWFA 1C5DB 2R1WB 2IDQA 1ROWA 2DTMH 1YNKH 3MOQA 3DBXB 3WS3B 12E8H 1BOYA 4CVZA 4M93C 3MCLL 2P52A 1UGNA 1YYML 2Z64C 5F6HJ 3FMGL 3ZYOA 5FV2A 2XG4B 2XTJC 4O2CB 2C7UB 1VZGA 2VLJB 2V0AA 4NFCA 3E8UL 2DM3A 1V3MA 3KYNA 3VG0L 4HJ0C 4K3JH 1T3FB 3C08L 4N9GB 3ROLA 2ZSVB 5JIDA 1CDYA 4UV7H 3AC0A 5D1QE 1KYUA 4P4KB 1D2OA 4HQQH 4LKXB 4FQXA 5HYJD 2VO8A 3RTQD 25C8H 2VQ1B 2YQBA 1TFPA 3QA3B 3QXTA 5C6WH 4JFFA 2OMTA 4PM1A 5F7MC 5HY9A 2C5DC 3I02B 1GVIA 3ROOB 1R5VB 5F9OH 1Q9OA 4V1DE 1D9KA 1ZVNA 1U93B 2CNYA 2GJ6A 1A25A 1LWRA 2F2HA 5DS2A 2WPGA 1CL7I 5DLMH 4P05A 2X3BA 3ZE1E 3VRJB 4C8XA 4S0TD 3VMOA 4DPRA 4KTEL 7CGTA 1IBFA 1MRDL 3TASA 3VFRB 1OAYL 2WXFA 2WCSA 2EINB 4N0YL 4CU7A 1BBJA 4F8PA 4UM9A 3PJSA 3JTTB 4PWJA 3OX8B 2ICWJ 5HD8C 5EEVA 2N1KA 1PD1A 3ARDD 2XN9E 4MQ7A 3UTQA 4P23C 4K94C 3T3PE 4FQCL 4A04A 1QR1B 1QD0A 3MRLA 1HSBB 4MA7H 1EIBA 5FA4B 5C97A 1KUMA 3UPCA 4HJGB 1HH6B 2X1XR 3UZEC 1PCSA 3BT0A 2FT6A 3P9LA 4U1JB 1IL1A 3M86A 4GMTH 5FYJL 1IGTA 4AMKH 1DCEA 2CD0A 4ESKA 1RIHH 3U2HA 4Q6IC 4QNPF 1UM5H 3KPOB 4UAOB 3HC0B 1SN2A 1TQBC 4RRPA 4XCFL 3P9WB 5DJ6B 1I7UA 1MHHB 4M5SA 2W07B 5LAPA 3MGAA 3QDGA 1RJZA 3TA3A 2HT2D 3VDAA 2UXFA 4PJCF 1A7OH 1FZOA 1X7TA 3DX3A 5EIVA 4GSXA 3KLHC 1KENL 5BS0D 5BMFH 4PJHA 4TNVF 4I4WB 1DQJB 3ECQA 2YBGA 1V3JA 1A2YB 5GSVA 3K8KA 3ZDZE 1VHPA 3LMJL 5DO2C 4Q58C 1PNCA 3L48A 5C0BD 4EUPA 1RPKA 3ULSA 3SZKC 1JD9A 1ZD6A 2AQRA 3QUZC 4HSAC 5B8CB 4YNYB 4WEUD 2H1PL 2OYLA 5A16A 2WKLA 3MV7B 5C08B 1YG9A 5D7KE 5C0RL 4JNXA 3TNNA 1KIRB 4Y5XB 5JOEA 4EF3A 5CSGA 4UAOC 3OXRA 2IH1A 1KTLB 4ZOCA 1E4XL 5DJ8A 3ZGIA 4F9PC 4PJBF 4HJJL 5HDQL 4Y4KA 2DWEA 4OLZL 4RSYA 1V10A 4QPEA 5DMKA 3VXOB 1QHQA 3MV8D 4ZSOA 2H0EA 3KLDA 4C56D 3CSYA 1BQLL 4U6VH 1GZPA 1MI5A 2NY3B 4M5TA 5ADOH 3DX6B 2AFNA 1TQVA 2D7PA 2VM9A 1YEEH 4XBMA 1MAML 1T5WA 3WHE0 3LZRA 4HALA 5IWLC 5EOCL 1ZLEA 3HMWL 4L4TE 4Z0XA 5FGSA 3WFBH 4DWHA 2QVKA 3IAGC 5T5FL 1MHEA 1UZGA 4MCZA 1E50A 3BN9D 3G5YB 1NKGA 1D3CA 2X7LB 4L3CA 1R3JA 3ETSA 2AK1H 3BGFC 3RVWD 4X7TA 5DJYB 5B8CC 2FRGP 3NCWA 4JO5A 2AAAA 3CVIH 1R75A 2EDEA 3EAKA 1H5BA 4YE4L 1TCRA 3UAAA 3L7FA 1JBJA 4LSTH 5E99H 3UMNA 3QWRA 3DO7A 3FFCB 1SEQL 1GSMA 4L3ED 2DMCA 5JYMA 2ZUSA 2BRQA 3VDCA 2AQ2A 1XIWB 4HIJB 4PS3A 3U46B 2HKFL 3RWCA 3GEFA 4B96A 5HGAA 4J4PA 2W0LA 3BKML 3OAUL 4Q6KA 4UTBH 4YQXH 2ZE0A 4XAKD 2Z31C 1I53A 3BLKA 1S7UB 4XP5L 2IPKA 4GKNA 1WZMA 1NBZA 5DRZB 5C09A 4HGMA 2PWDA 5C8JB 2NSQA 4X98A 5ABDE 2FATL 1KB3A 4RA3A 3KCPA 4P06A 3WFCH 2HMIC 5LBGA 3HB3C 3GSWB 5EBMB 1FLRL 3BUQA 2AK4B 2WCPA 4JPQA 3PQYB 5G2NA 1BEYH 4N8UA 3BWUC 1ZEAL 4OCMC 1FNEA 1CDHA 4EVNA 1DO6A 3HG1A 2IOOA 1BG9A 1NPJA 4PP2B 2OMYB 1QYGH 2UWEA 3ZUNC 4YFEA 3C60C 3NDZE 3F84A 4AJWA 3TT1L 2RCSL 3VJ6B 2IANB 4YHPA 4BUHA 1K8DB 3EH4B 3IDMA 4EPSA 4XMWA 1LEKB 3F62A 2WINB 5GRZA 4PRAA 2WLLB 4POZC 4CA4A 5EUKA 1W91A 5AW9B 2VIRB 4H8WL 4FXLA 2DYPB 2I60H 3DTXB 5C0AE 2BOBB 3NIGE 4XMKL 3BZ4A 3VFSA 3BAYA 4QRRD 4AWJC 4G43B 5FO2A 1E8XA 3S2AA 4HJUA 2QQKH 4TQIA 1UJ3C 5ACLA 2FT7A 3NGBB 3K4DA 4JFHD 1XQ4A 4KJQC 4Z3HA 1QAWA 4PJGE 3CFQA 1Q0XH 1E3XA 2WTRA 5IGXH 4OCSL 2BVOA 5HHOB 4JR9H 3POCA 5ICYB 4O58L 1WWCA 1EZVY 4FJ6A 3DXAE 4UIMB 1P1VA 1K8IB 4RMVA 1AG6A 4N85A 1P4IL 4IOIB 1FZKB 5L4MA 3JWNH 2IPTL 3NP3A 4M48H 1GTFA 3VTMA 1G7JB 5GS2D 5CEXB 4QHLA 3SE8L 1QA9A 5DTFA 3MA7B 5JOPE 2BZCA 3CHXA 1PTZA 2X4QA 3WHXA 3SGDI 1U8OA 1WTLA 1WZLA 1KBWA 1TTBA 1S9XB 3GGWA 4P5RA 3QIUB 2D7MA 4LOUC 3GXFA 4DGYH 2XWRA 4B9YA 5AW8B 3BE1L 4JG0H 3A6CL 4OQTL 4J3VA 5C0CD 4XNQB 3NGBC 1E6JH 3G08B 5E1GA 4QAWA 2L04A 4DT2A 1LMIA 4I77H 4W9LC 1TO5A 2PCFB 2ZWSA 5BQDA 3WG7B 2HVKA 2ICWI 5J06A 3K5RA 5HGHA 3L9BA 1BZ8A 3GPEA 1PZ2A 5AAWC 3OKEB 2OJEA 1A3RH 1E9OB 2RFXA 5HDWA 3UTZB 1BQRA 3LNEA 1J48A 1S7SA 3BGMB 2EKSA 3IGFA 3MLSL 5IK3B 4F80A 1U8HB 3ABGA 2G2PA 4FTVE 4GRLD 5CINL 3G5XA 1CWVA 3EUUA 3MRMA 3IGLA 1E5YA 3O2DH 1SOKA 2JQAA 2K6ZA 4L1TA 4WUUE 3V4PB 4ODXA 5C7XL 5JUEH 1CMOA 5FYKL 2E6JA 2XX0A 2VW7A 3U4EB 1KJMA 1URLA 4KMLB 5A3ID 3BPOB 4TVSa 1RCYA 2NY6B 5CCKH 1YMMB 3LQAC 1J0ZA 4KK5D 4ANXA 4Z9KB 3WMSA 1SDDA 1ETA1 4XO5A 3LS5H 2B9BA 4DO4A 2DDQL 3MXWH 1FL6B 1XF2B 2DLIA 4N2IA 1HC1A 3WOVA 4K3DL 5A43C 2IQ9H 2Y7SA 2CUIA 4U6XA 4YUEH 3F7YB 5DC2A 4MB3A 5E2UL 4WKXA 2XKUA 4XTRC 3FU7B 3VE0A 4ODSL 2HLFD 1U92B 3ZKXC 3V5DB 4XB7A 2Y1AA 1FNLA 3UCQA 2Z4QA 4IRJD 1OIOA 1KJVA 3NG5A 3EDDA 4B9JA 4NQDA 2J5WA 2IXQA 4KAQH 5ICUA 1MVFA 3EH3B 4DGUA 3BX7C 3BPOC 1JF1A 3SKNA 1YEDB 4LGPB 2NSMA 2XZAL 4AW7A 2P28B 1XF4B 1UXLA 2W38A 5GS0H 1S3KH 2Y5QA 3G5ZB 5I19L 1JNLH 2GC7C 4JAMA 1A4AA 1LE5B 4DCQA 1FFNA 4R97B 2ZG3A 3MUY1 4KVCL 4MS8C 2FEDD 2X4RA 1ZY9A 4KI5F 1J88A 3HNSH 3A24A 2G0LA 4KKQA 4FQ2H 4JFXA 1VFAA 3MROA 3L2LA 4FADA 4N22A 3SOTA 4V2CB 1F3DH 3FRPA 1T7YA 3FTGA 3HN5A 3QDME 5SWZA 5I0YA 3KR3H 1YHPA 5EF3A 4PIRF 5DQ9B 5KOMC 4F58L 1RZJH 4IBYA 4B60A 3T0ED 1UA6H 4TVPH 5CEZD 2H8PA 4NNXB 3VWJA 1A6TB 1OAXL 4H13C 4PRID 4RMQA 1UA7A 2NLJA 2UY7A 4MMYB 5I8CB 2AMGA 4MNGA 5T3XH 1F02I 2YD4A 2HRPL 3NPZB 4JFEB 4R5TA 1RUQL 4YVNA 5IOPA 4PJDA 1O5PA 5FGBA 1FE8H 3RGVC 4AQ8C 4NKIH 3TO2A 5BV7H 3BQUD 3IKKA 4R97C 1EFXA 2JB5L 4GBXC 1EO5A 1WAEA 1SOQA 4NZ8A 1HN1A 5CWSB 3CN1A 3NZSA 1S4IA 5D5MA 2YO3A 2HJFA 4XVOA 4PJ9A 1KCKA 1O7VA 1ZHNB 2AVFA 4LU5L 5DMIH 4YDNA 4OGAC 4UILH 1MJ8L 4K2UH 2QFPA 4WW2A 1OP5K 4HT1H 1U3HA 2I24N 2PXYD 3I50L 5K59F 3O2DA 4FZ8H 1PY0A 4XBGA 1Z3RA 1GY2A 3IJSB 2X4UA 4X6BB 3ZDXF 1DVFB 1MKFA 3IDNA 4TLSA 2OW6A 4PLKD 4MDIB 2VO5A 1RURH 3TOPA 3GMOA 2X4PA 1UXSA 1HI6B 3MYJB 4ACTA 4LLAA 2VC2B 2DQEL 3ARBB 1LK3L 1HE8A 2LU5A 5CJOL 2ZWLT 1AE6H 4JFYB 4YHNA 5EZJB 1IAIH 1IUZA 3QEGL 4Z78B 3FK3A 2VERA 3MJ8B 4ICXA 4Y19D 2CHXA 6FABL 1JJUA 4WFFD 2AQSA 2DS4A 3H0TB 3IDXL 5AOIA 2ZWNA 5DUBB 1XH3A 3NACH 5DDHB 2K7PA 2OV0A 3MX0A 4MXVF 4P5TB 4XR8C 2BLFA 5EBWA 1F86A 1PFOA 2Z7YA 2HFEB 4UDUA 2P80A 4MCMA 4X6CE 3TZVC 4AX3A 1BVKA 3MNDA 4ODUA 2V9TA 3ZKMD 5FYLL 2QHRL 5JIKA 4CBZA 4AYSA 3QNYA 2AHIA 3FUDA 1FO0L 1P9MC 4AENA 2GT9A 4BSWA 3D48R 3TH3T 1N9PA 2P5EA 4GLRH 1UG9A 3KGTA 1AIZA 3HE7D 5H37H 1TNNA 1HESA 5IKCA 4S1SH 2GTZA 2NR6A 2GSGA 4K15A 4F24A 1OAQL 2NZ1A 9PCYA 3QC6X 5HDBE 1CR9H 3U7YH 3TBYB 4A6YB 1FZMB 5B1BB 1GC1H 4KO9A 4R7DA 3UC2A 1SJVA 1QPPA 5I6KA 3ILDA 5E70A 1SJEA 3QZBA 1FJ1A 2AJ3B 2WNWA 1RZFL 4DESA 3FU0A 2BVYA 5J6HA 4P46D 5MEQA 3DGGA 4P5TC 3IRPX 4N90E 5IFHH 3UO8B 3SPVB 1IMHC 3DJZA 4HBCH 3D34A 1XBRA 4W9GC 2A6IA 3MXVH 2UY6A 4P2AA 3QCVH 2EYTB 4MYWB 1IFHH 2IADB 4CL7A 1EJFA 2Y36L 4AEIH 5FB8B 1TITA 2IBZY 3VD2A 3L1OL 1HYSD 1YN7B 5A2BA 5B1JC 2GJRA 2Q10A 4Q9QL 2OQJB 1T7XA 4H1LG 4BZYA 4ZFFA 2ZXCA 3V6FA 4BE5A 3P4NB 3IU4L 1XCTB 3PHQA 5F7EH 3LDBB 4H26B 2AQ1A 3PRZA 4ZPTA 1A5FH 4EJ1C 3SKMB 3HVDA 3O0RH 4KWUA 3DX7B 1NC4D 4HIIB 3UJIL 4H88L 4HFUL 4P0DA 4YSTA 1XXFC 1MJJA 1R19A 2R2EB 2J88L 2EXYC 5TPWL 3WTYA 1BLNA 6CGTA 2ZPKL 4TF4A 4S1RL 3EO1B 3X12A 3QDJA 4HUWA 4DETA 4NCDA 3DK2A 4L5FE 4OT1H 4OZGA 4ZAKB 1IGFL 2OA9A 3FQ1A 3RIAF 1QLEH 3FT3B 5HJBA 1G7PB 2VE6A 4HAKA 1KGXA 4WSGA 3RLSA 3BHBA 4UZGA 4Y2OB 2E9JA 4P5SA 3FU5A 2VDQH 3CZFB 1MIML 5DK0B 4ODHL 1H9VA 1DUZA 3WKPA 4D9RD 2IOMA 5B22A 2Z8VC 3GSOB 2WXRA 4TXVB 4NHUA 4NT6B 4LCCA 5DZ9A 2ZCKH 3P4OA 2BMKA 4R4BA 4LSSL 1N67A 5KBKA 3GSXA 1ZXKA 5JQHC 2AEIT 5JHDD 1DUYA 4G1MA 3S5YA 4IS6B 1A1NA 3NZ8B 1TJHL 4X8GA 4OZIA 1A6VH 3EJYC 3K91A 4XBEH 1WFNA 1NMCB 3AXIA 1IVTA 5TH2A 2F8XC 4NBYB 4GIAA 2C9QA 5HBBA 4HHGA 5HGDA 4I0PD 3WY1A 1R3LA 1PGRB 4N1HB 1YCSA 1IAKA 1LO0L 2CLRA 2CO3A 4JJOA 4ZAKC 4H1LB 5D7SH 3EXJA 3GK8L 4PG9B 4R83A 4IJTA 3VXSB 2YXVA 2ZP8A 4KI5C 1GAFH 5H37A 2E9BA 2CBQA 2ZKXA 3FUJA 4MMXA 1QSEE 3GO1L 5B21A 5HYJA 5IW1A 2B0SL 4LP4A 3RTQA 1SQMA 1J9QA 4N5UA 2VDMH 4FNTA 5AZ2H 5INCA 3VSUA 3S5LA 1YY8A 1UWGH 2HPOA 2BSTB 3WY4A 1Q0EA 3LXBA 3LIUA 2DEXX 3D08A 4M1CD 3ARYA 3FSWA 4NJ9L 1UT2A 2PTTA 3CHPA 3ZDXB 3HPJB 3GM0A 1J8KA 4PLJD 2Y2TA 2TAAA 3QUMH 4GSUA 3S3PA 7FABL 1NMCC 2JI2A 3V52L 1RZIA 5KVDH 2NW2B 3TBSB 2R29L 4L5FL 3ILPA 3ARDA 4PS7A 3RKDC 2EDNA 1MG3C 2G2RB 4KOCA 4OCWH 2I26N 2OL3H 3Q06A 3JXAA 1ETB1 1VJSA 4PWFA 4YHZH 4HULB 4N0UA 4G7QB 2WD0A 4GAYB 4NENA 2GBTA 2DWDB 4LDEB 3WFZA 1I8KB 4FXTA 2OJZH 5IVZA 1YYCA 2XHNA 3O3DA 1YY9C 2XNAA 3H2QA 5KSVA 2DLFL 3L16A 2EO9A 2VISB 2O5NA 3C9NA 1SDYA 2EDXA 4XVUC 4YDVB 3ZL1A 4QI3A 3KW8A 2CDFA 3W11C 2Z8RA 3QUXD 2QQLL 2H9GB 2OTWA 2WKOA 3NJMA 3ZQXA 2QVTA 3WIFA 1CU4L 3ELQA 4Y9BA 1XMEB 1O9VA 2Z93A 1ECYA 3SKJH 3DI2B 1UM4L 3VFMA 1IFGA 2CCLA 2R59A 5BS0A 4BFBD 1UKQA 2CGYA 2WWMC 1GY1A 4Y7OC 1IIKA 3FF7A 4IU3B 4QO1A 4AC2A 1HOEA 1L9NA 1TETH 3PWUB 3OG4B 3GLDA 4PGJA 5I1DB 5C0BA 3B9DA 1KTRL 4AMXA 2B4CL 4QWWD 4MJ5A 2NY5H 1T22B 5T1LD 3Q1SL 5BO1L 2YUZA 3VXRD 3HG0A 1FN4B 1AGEB 4CAGA 2AJXL 3CZLA 3FONA 4K9EC 3WSQH 1MUJB 2R0WH 1LP9F 5L2KD 2BSSB 1A4KA 1CZ8H 3FUNA 4JANA 2RMNA 3VD0A 1NAML 4CSSA 4OD1L 3S36L 4JRXA 5JXED 3MRHB 3MV8A 3A22A 5ESQA 1KJ2B 1XGQB 1A7PL 3I6GA 4C56A 4LEOB 3NA9L 3N1FC 4EOWH 5CAYB 5GS2H 4AK2A 3V6OE 5TFSH 4ODTL 1F4XH 4OM0L 5DD3H 2COQA 2ZXWB 3SE3C 3TWCL 1XEUA 1T4WA 1B0RB 3IJ8A 4OSUL 1K5WA 4GYBA 1N19A 1CLOH 1EUUA 4OD3L 3RVTC 4HD9A 1UADC 4UTAH 1OT4A 2BM3A 3J7HA 3WNNA 1KV7A 3IKCB 5I74B 3QDAA 1MHPL 4QRBA 1PX4A 3P0VH 4PRHB 3NCMA 4YK4B 5LG1A 5E94A 4GKZA 1HL5A 1IC4H 4B5ZA 4S1QL 2DY2A 2OX5B 3MRRA 4PRNA 4DSYA 1QZ1A 4BRVA 4ZD3H 5HI5C 1TLKA 2XPGA 1OE2A 3FQNA 4KPHL 3EO9L 4LNRB 3DRTB 3HE6C 3MJ7B 4YH6A 2X05A 1PPIA 3AQZA 4L3EA 4WF7A 3QUMA 5GRUH 4P2RE 1KXQA 1O75A 5JA8B 1K5NA 1P5UB 4GUPA 4NQCE 1V7ML 1S7VA 5CS7A 1EEZA 3S35X 3BZ5A 3H55A 4HK0B 1M2VA 1HDMA 1JZ2A 2XY1A 5KJRL 1DVZA 2OL3A 4D0BB 4GW1A 1F3JB 3S4SG 3V6ZA 5CZKA 1HCVA 2CA3A 1NL0H 3JYBA 5I74C 2E4FA 2VTFA 3G9AB 5AOJA 1WBZB 3X3FL 1WGVA 5CKAA 4OF5A 5EULV 5FHAH 3T1FB 2BNRD 3DDGA 3AADB 4XNXH 4TNEA 4QCIA 4YK4C 4D0CA 3DROB 1ZLVK 2G4GA 4GG6A 1RZ8B 4KUCD 1MF2L 4WW1B 2OK0L 1AQDA 2ZKMX 3OMNB 4PWHA 2C3WA 4P9HH 1I1FB 1DVUA 1SMAA 4WGWB 4AZUA 3O9WC 1JGLH 1ZVSA 1OP5H 1OGTB 2DLGA 1U8QA 4LQFH 4JCWA 1KFAL 2VITB 3FOLA 2MCPL 3SEPA 1HIMH 2A74B 2FX7L 1SJXA 4IRSD 4R0LA 1T2JA 1WBXB 1JN6A 1P5UC 2VJ8A 2BW4A 1UH2A 3GJFK 3NJJA 4PS8A 3D4GA 1SEBB 2J12B 3CUPA 3IMBA 3P4LA 3FXIC 2ADYA 2DQHL 1IBDA 4MMZC 3LH8A 2EUXA 2QEJA 3EZ8A 4PH8A 2YUVA 1AKPA 5DQJA 3MQIA 2V7NA 4QRRA 3VDBA 3K7UA 3B5GA 2VQ4A 2MCMA 5IV2B 4X6DF 2VSDA 4PJXF 1KBGL 3L95A 2VR3A 3BCFA 2GIXA 4RA0C 2WP3O 4QHUA 3C75A 3EOBB 1ITBB 1ZXQA 2NYZA 4KX8A 3ZHDA 4ZFOA 5J1AB 3BIBX 4D9QE 5DJ2A 2AXGB 4FGMA 4OLWL 2I9LA 2VCOA 3REVA 3X14A 4L8SA 2X53A 3FO0H 4WNJA 2A74C 4XT1C 1UXWB 4F2FA 5EOTA 4LLYB 4JLRA 2KQMA 5BXFA 1OM3L 3ZMRA 4DN3H 3UTPE 3HI6L 3S4SB 4HX1B 3IYLW 4P3WA 4D3CL 1NFIA 3HPLB 3O4LD 1E9QA 4Z0BL 2ED9A 4UTAA 1KZQA 4XCEB 1A8JH 5DJAA 1SBSH 2YLKA 3DRQB 5CEZH 2DTML 4DO5A 1YNKL 3O8XC 5HHVH 2Q5BA 1HXMA 2DWTA 12E8L 5E8PA 2FJGB 1OP4A 2ZXEB 3PV7A 2FWLB 5C0CA 5LXVA 1OLLA 3AS0A 2QGBA 1VGEH 4E5XA 1DN0A 3WYRA 1GOFA 2UZXB 4JRFA 2AQTA 2WYTA 3D8MA 2CQVA 5AW6B 1CFSB 3OAWA 1RK7A 2ALAA 1U8MA 3ZGHA 3NJFA 3QEQB 1I3RA 2D31B 3H3BC 2EECA 2V17H 3BKYH 2ARJA 4HQQL 3N1QC 4U6HB 1UVQA 1D7CA 4ZUUB 25C8L 4MJ4A 4KX9A 1JXGA 1KNOB 4P4RB 3I6SA 5BZWB 5BQ7A 4R96A 5F9OL 3N1MC 4GRLA 3VXQA 5SWSB 4QRSA 4G5ZH 1DZBA 2VDLB 3QJHB 4RDBA 4JPWL 5DEGB 3PP3K 4XMUA 1E2VA 5E23A 3HR6A 5D1XB 4P5MB 1MDTA 5IJKC 2X2JA 4E2OA 1G0DA 1UKSA 3EJZD 3KPMB 4FTDA 4MX7A 3ZPDA 1T1XA 2XIBA 3NCXA 3PUCA 5JNYA 3VNZA 4MA7L 5D7IE 2JH2A 4D8PA 3D05A 4R5XA 4DEPB 5BUGA 2EUZA 2YPLB 4XE0A 2X89D 4FI6A 1AQKH 2FECI 4XNMB 3NQKA 4UUJB 3UH8A 2HT3C 4GMTL 4PRPB 4LMQE 5E9NA 4AMKL 1RIHL 2B4CC 1UM5L 2AEQH 4AYEC 5ID0A 1E43A 4D7PA 4IRJA 1S9WA 1OAZH 1VGKA 1YQVL 3QNFA 2J1ZA 3BO8A 5C0EB 2O6PA 1N3NB 3HG3A 5FO8B 4UV4L 4YZFE 5CP3A 4EN3C 3KXFB 3M8OH 3WJLA 1A7OL 1IQWL 4HK3J 2XXCB 2EEBA 3H9SD 3DECA 2BH0A 2JKRM 1JHLL 3NSFA 2FGWH 4AKQA 5BMFL 2P1YA 1VERA 2G5BB 1CBJA 2CHDA 2WXGA 4UOZA 5AVTB 1IC7H 2VMEA 3ZIMA 4OAWA 2GKIA 4N5ED 3ZXAC 4WU5A 3BUIA 5F8QC 2J25A 4BCYA 4DEPC 3IAPA 5TGBA 1AZVA 1P7KA 2JI1A 4YHLL 5F0PB 1D6VH 4K5MA 4OKDA 4WWKB 5F7NC 4FQQA 1CGWA 1MH5A 2A1WH 3U4BH 2DD8L 4NPYB 2WIMA 2BSCA 2JK5B 2VL5A 4Y5VB 3V4UH 3KEHA 2HJKB 5J4MA 2OSLB 2X9XA 4B0MM 3T0EA 4TN9A 4QY8A 5F2FA 4JFTA 2ENPA 4FQXC 2Y2WA 1N7MH 4U6VL 4PRIA 5ADOL 1I9IH 1ZS2A 3WKMH 5I66A 1CXHA 2IDTA 1Z32X 2NUTB 1V27A 1YEEL 2DQUL 3I9GH 4P2OB 3QQ3B 5KJ7E 5C07B 3AU1A 2OMUA 2NYYD 4KKLC 2W5PA 3P2TA 4JVUA 3OJMB 5HHPA 5MERB 2ADJA 3BQUA 3B9KD 1WIOA 3WFBL 4CNIB 3ABMB 4ZNCD 1MFAH 4HH9A 3TO4C 5DEJA 1KB9J 5KVGL 3QJFA 4V33A 5K39A 1KTJA 1T20B 5LAXB 5KVFL 1Y07A 2X2IA 3BSGA 3AB0B 1TZIB 2QPDB 4ZS7H 3SPCA 4R7NB 3CVIL 2ZONA 1TSHA 3ULVD 3SE4C 1U6AH 4HIHB 2OMZA 3L3KA 4X6DB 2NSXA 4LSTL 2PXYA 1XAKA 4Y5VC 5E99L 2Q7NA 2ICEB 3PWNB 3K6NA 3WJMB 1I8MB 1AGBA 3BESR 4H2AA 5F89A 4YDJB 3DETC 1MW1A 1QLRB 1QSFD 2BIPA 5CBEB 2CNZA 1EAPB 4JN1H 4JFPB 5DJXB 4YQXL 1AD0B 4HKJB 2FCBA 4N2LA 4GW5B 2KL6A 1YEIL 1ZGLB 3IVKA 2BOCB 3KYMA 1OAKH 4JFDD <