4OJEH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
489
structure length
457
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMSRGMQMQFSIGLHTAVCFRLYLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPESDKSDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGGRASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMDDIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLFEDDGWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords EFF-1A
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 93
structure length 457
sequence length 489
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojeH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojeH01
4OJCA 4OJEH 4OJDH
chains in the Genus database with same CATH superfamily
1HTYA 5FYJD 2XBDA 4ZD3H 4U7KA 5KWYC 2F58L 3KR3L 4GAGL 4PWHA 5LCVA 2EJ1A 5ALBH 4G6MH 1LVEA 1HNYA 4CSPA 4H44C 3EJZD 3LHPH 4LXFA 4ELMB 5L8LB 1ZSHA 1R3IL 3UC0H 2LTQB 1D9KC 3TA3A 1WBXB 4J3VA 5HVGB 2MPVA 1XXFC 1FGNL 2B8OT 3JVGC 1IGCH 5DURB 1NCHA 1A7OH 1UVQA 5K9OA 3B43A 3QUZA 1KFAH 2R2EA 1S7VB 2G3NA 4OBRA 4YSEA 3ET9F 3RKPA 3S88H 2P8LB 3ULSB 4HISA 1FLTX 2NDFA 2FB4L 2H1LM 3OKNA 4J3OG 4L29B 4F9PA 1L4IA 1MCKA 2A77L 2BNQD 3RWFB 2OMYB 4ZUWB 5D55A 4LOUD 1VIWA 5ADOH 4P23C 4EZKA 3IE9A 3UPAA 1ZLWK 5MHSD 3NIGB 5A2IH 5ESVA 2HUEA 3VRIA 3BGMB 2GJ6D 5D7EA 4KRLB 1FSKC 3CFCL 4N8CL 3DIFB 1ND0A 3QJVB 1U4EA 2ITCA 2WIIB 3GRWA 4P57B 4PHZA 1KLFB 2J7LA 2OYLA 2CIKB 1ZV9A 1HHJB 3O0RL 3CFBB 1BF2A 4KHXL 3GJEB 4RFEA 3T71A 4UDTB 3FUNA 4X7TA 3EYUH 5C0IA 1NBZB 4WGKA 5ICXA 3O45A 4FNPA 2WGNB 1HDMA 4WGWB 3ORJA 4P2YA 1SM3H 3FQ1A 2YBGA 3V0IA 2FT7A 3M1OA 2X2HA 3IDXL 1J1OL 1GSMA 2TSBA 1AQDB 4OUOA 1OSPH 2ZYSA 4Q9BA 3TXAA 1RPQA 4QRUA 4RWYL 2EDNA 4G82A 3V52H 3IK2A 4MFHA 5DZLA 4EN3D 1KGWA 2XYCA 2Y3NA 2JI1A 3D4CA 3MBXL 4EN2A 3EOAA 5LKNA 5DC9B 3RL2B 1JZHA 3G5VA 1NTDA 5LDUA 2B14A 5GGQH 1BFOB 1I9JH 3D69B 2J2ZA 4Z23A 4FA8A 2DIJA 1CFQA 3ESPA 4FJYA 3CH8A 2LFEA 3OHXC 3G6AA 4YHOH 1CL7I 2JB6A 2P1YA 4X4KA 4MLSA 5EBMB 5C0AA 2VH5H 4DESA 4BBWA 4NAJA 2WB7A 2W0PA 5TDNA 5C0JA 1FC1A 3ZT5A 2F2HA 1NUGA 1DJXA 5EZLB 3VU2A 4X4ME 1CO1A 2ITEA 3B6SB 4TUOA 3P0VL 2YO3A 2DMKA 4YE4L 2OI9C 4PB9L 2BVUA 1GC1L 2QPEB 4Y9EA 1E27A 3QUKB 4NO2B 3QIBD 4N0FB 4AUYA 5ALCL 4MDIB 2R2BB 4M48H 2Q10A 1L6XA 1YEHL 3UTQB 1Z0MA 3D25B 4LT7A 5CP3A 3ROLA 2RACA 3WKMH 4EQ3A 2ZKYA 4FNUA 5CIPH 2IWFA 2NY6B 1OE3A 5HVWA 4BJLA 3TBVA 4UTAL 4N0RA 5DK0B 3MRCA 12E8H 1BZDA 1T66D 2R1YB 2XWBB 3GSQA 2JKNA 4I18A 4UF7C 4M6OL 3MBEA 4NERA 4KKNA 2QVKA 4WSGA 3CDGA 1CFVL 2IIJA 3HC2A 3VGDA 1TZIB 1BJ1H 3RDTA 2H3KA 4PS4H 3IMWA 3H3PH 3GMPB 1KC5H 1L7TH 4L37B 4DP0X 2O6FA 4TLUA 4AK2A 4U7MA 2RJMA 5J6HB 1WGVA 3D3VA 1KNOA 4JM2A 4EI5A 1KT2B 3LIZA 5CJXA 3QYNA 4A2GA 3RL1B 2BJMH 3D9AH 2APTA 1GW6A 1RURL 8CGTA 3O81A 4B9IA 1QSFA 3HC3H 3MREA 1T03L 5KJ7E 2KERA 1LXMA 3FRPA 3QG6A 4KO5A 4PLJC 3FQWA 4NP9A 2Y7QA 2YXFA 3S96A 1NSNH 5CXPA 5DJXB 4GFTB 1G6VK 4QRTA 4L3CA 1NJ9B 1NL0H 4JFEA 1SRDA 1DSWA 3HR5B 4QT5B 5FR3A 1GYUA 4RZCB 1NCAH 4XH2B 4C4UA 2PWEA 3GMQA 1B3IA 1R0AL 4XB7A 2OW6A 2IPTL 3LCYA 4XPHH 2BMKB 3LRSB 3O6FB 2PWDA 3DYPA 2MOQA 4CSTA 1UB6B 1MRFL 1TZGH 4KHTL 1AI1H 4PY8I 1A7QL 1RK0A 4P04A 4GOSA 1T89A 1U3NA 3QO1B 3I6GA 3CC5B 5IG7B 1I1CA 1VEPA 4ZW7A 1MWAB 2FSEB 1U9KA 3KCPB 4J1UB 1I8IA 2HRHA 2J12B 2B16A 1CDBA 3NCJL 1KCUL 5IV2A 2WNXA 2YAFA 2WBKA 3DGDA 3FCSA 4WEMB 1TJIH 3GLEA 4WUUE 4DPBX 1U8OA 4K3JH 5JPNC 2ATPA 1CK0L 2VISA 1MI5A 1YO4A 2NNRA 2BVOB 2EIDA 3LAFA 1BSIA 3VWKC 3IJSB 4Q56A 4G70B 4NHCL 3LRLA 4WEBL 3RWHA 3W9DB 1U8IB 2BSTB 5EZIL 1U8QA 3L95A 5HJBA 4EI5B 3JYBA 3T0EA 5HSFA 3VD1A 4JKNA 1ZS8A 4GEIA 3FCBA 5INDB 4NENB 4TQEH 4IMLB 1JGUL 2ESVE 3B9KD 4HWEL 4UTBL 3O9WC 1NCCH 3MRFB 1ZHNB 2AZUA 2PPDA 2CE6A 4B9ZA 4OZFH 5T1KB 3V4LA 4OCWL 2F8IA 3N0PB 1G9EA 3ZDXF 1XIWB 4NZFA 2DYPD 2O5ZH 4L23A 3OZKA 1E2ZA 3UJJH 1LDPH 4X98A 3OV6A 2R56H 3POHA 3SKOA 4ODVH 4XO3A 4N2EA 5I6NA 4MCYA 1GXEA 2MCMA 1ZCRA 5I0YA 3LN9A 4GW1B 4YHZH 2R2CA 4IOSA 5C0RL 5DJCB 5JORB 3C2AH 4L3EE 3WJJC 1S9YA 3L4WA 4RLDA 4XXWA 4UZSA 4HIJA 3P77B 4N2BA 4PJCB 4WW2B 1C16B 2WKOA 3WNNA 4QMEA 4P3DA 1FL5B 3LRKA 4JO3H 5EO9A 2WUCL 4L1DA 5GGVY 1S78C 5AAMA 5IB3A 3DJSA 4MJJA 1IBYA 5AVYB 1MFAL 3GSVA 3SDXB 3UYPB 5E95B 3F58L 3ENEA 4FNLL 3GIZL 3WLBB 4CU6A 3KXFB 4L4VD 2HJKA 3CK0H 3QQ4B 4L8DA 4CMMB 5LVEA 4MNGA 1P4IH 3UXFA 3BP7A 1Z9OA 3KPOB 2FEEI 4LPTA 3U7WL 3V6OE 5DU7A 5GIRA 2DQCL 1EEZB 3MA9L 3NIFB 4WO4A 1QACA 5DQ9A 3H9SA 2NY0C 2PR4L 3HBQA 2A6DA 4UMSA 1VERA 3BWZA 5GHWH 3TN0D 1T4WA 5I8KL 3OJDB 5I73C 4TSCL 1F97A 4BFFA 8FABB 4RMTA 5LCVL 3UC0A 2GUOB 3EOBA 4LQFH 2ZUWA 5JQHC 2OR9L 4Q9RL 4IU3B 2G5UA 4N8PA 1FI8C 1P6FA 2WQVA 1CVSC 3ARFC 5CO1A 1ICTA 4Q8BA 2J8UA 4XBMA 2R27A 4X50A 1A4AA 4UOQA 3T3MF 1DVFB 5JHAA 5G4MA 1I8KB 1S7QA 2DBJA 3TBCA 3L5IA 4FAAB 1XF5B 2Q87A 4HAFA 3ROOA 3FSVA 2HMID 5KSUA 2HXAA 3UPRA 3QZLA 4OCXH 4MKTA 2ZCKH 2J43A 4HIEA 5F9AC 3TBYA 1SDDA 4GUOA 1G6RH 3WKQA 3KPSD 3RGHA 1UCTA 1CDUA 3SOBH 1JZ3A 4BV1A 5C2BH 1FVDA 2JVUA 3DROA 4OIBA 4JS7A 4XMPL 3K6OA 5TGBA 4BWTA 5FYLE 1PZ2A 2WJ7A 1JSYA 4IRSC 2DM7A 4NQCE 4NIKB 2A73B 1CI3M 4PGEA 3W0WB 4GT7A 4XNZB 1QQDB 3GRWL 3X12B 3EHBB 4ZOAA 1J8HA 2PWGA 3MV8A 3QUYD 4G9FE 3SBPA 1WT5A 2NSMA 2H2PC 4NQDD 3H6AA 3V5HA 2FDBP 4EOWL 3DSFL 3QA3A 4FULA 3BAJA 1Q9WB 3FT3A 4F24A 3L3JA 3WE1A 3QDJE 1HS6A 1D6VH 1I3GL 1T22A 4YK4C 5HHQB 4NZ8A 1EXUB 1BDYA 2FZ3B 4B5ZA 2IDSA 4N0CD 2D3JA 1WFTA 1CFNA 3JV5A 3OKDA 5K9QG 2IANA 4ONOA 2E9IA 2YBRA 5IVOA 4C47A 4Q9QH 1UT1A 1FNHA 3K71B 4G80A 1U95B 1MXGA 1WJ3A 4TULH 4YXKL 3N2JA 4CSSA 2DQIH 3C5ZA 1OAQL 2K3HA 2VLRB 3BEVB 3UZQA 4P4KD 4F7TA 5F97E 3H42L 2VIRA 1KLGA 3AXLB 3GJFA 3QJOA 4M8QB 4XCYA 3LEYH 4C83B 3UADA 1DN0B 1IGYA 3L5WA 4FZEL 4CGTA 3D07A 2VZTA 5GQBA 1HN1A 4AOFA 4FLHA 4MAYB 3TFKD 4QF1A 5L6YL 1VADB 2R2HA 5CIPA 3VVVA 2HFEA 4GG8B 2W0FB 3L3DB 4FKEA 3EGXA 3JUZA 1Q8MA 3A67H 1M6OA 3FQXA 5F6HJ 2IOIA 2XV0A 3P9MA 1XZ0A 3F65A 4AYMC 3F6IA 1W72H 2EIEA 2K8QA 3L08A 3OGOE 3GRBA 2Y0SA 4QYOA 5D5MF 3WJLA 4UINH 5E6ID 2F7IA 3M6DA 5E8NB 3KE0A 2OQJB 4LVNB 1FYTA 3TO4C 1A7NH 2PXYA 4XNYL 5KVFE 5GXBB 3GHBH 2K9UA 3II3A 5K5YA 3PL6B 1CICD 2LABA 3LEVH 3ECBA 3E3QE 4WFFE 1MCIA 4XAWH 3LIZL 1E4XH 3GSUA 4A2DA 4EF3A 1OCWH 1LNUB 1AXTH 2BOBB 3UJIH 3OF6D 4TUKH 2BLFA 3MV11 4YDVA 1IEBA 5JOFB 1TTRA 4WEUD 3V4VH 1I1YA 3D39A 4KO6A 4TQPA 5BRZB 4QHLA 3EO0B 3QJFB 5CZVL 2EVJA 4R90L 1QWHA 1EV2E 1PSKH 5LNEA 2Z4QA 2PN5A 2ZSVA 1BD2E 4TVPL 4FOMA 3R7RA 3N1MC 3WUWG 1A6AA 5HJ3B 4NQXB 1G94A 3VI4A 3CVHH 2EYTB 1M05A 1FFNB 2XWXA 4JDEB 1F90L 3W82A 5DK3A 4GW5B 1CXKA 4MAUL 3DTUB 3KAAA 4ZTPH 2BVYA 4WW1A 4OGQC 3GGWB 1HILB 2ADIB 4Q6YA 5FGRA 3UO1H 2CXKA 4Y2LA 3VAEA 2NY3B 5K39A 4I1NB 5KJRL 3ETSA 1E5UI 2FJGB 1BQHB 1UJ3B 4ZTEA 4HBQA 2UZYB 4JO8A 4OTXH 3MLZL 1YY8B 2Z93B 3FAXA 1KPUB 1MZZA 4PGBA 2VL5B 2P26A 1X5MA 1AC0A 1JGLL 2J8OA 1A21A 1JGIA 2XN9A 3SPVA 5J11C 3UTTA 1BMZA 3W9EA 5K9JL 4FQCH 2H9GA 2YIHA 1AVAA 4K9JA 3O3BA 5TH2B 2FATH 4AJ0A 4K3DH 4FFWD 3HNVH 3NG5A 3Q2VA 2KHAA 5MENA 5I6XC 3GUTA 2DQHL 4J2QA 1CZ8L 1AQKL 1N3NA 3A6BH 4JREC 5T5NF 4ZFOA 3VI3B 1LE9B 3RI5F 1G1OA 4BQBA 1EFQA 5F9WC 1ES0B 2CRYA 1AD9B 2XTJC 5DGQA 3GBEA 4RGNB 1IM9B 4M5ZH 4OM1H 3FN9A 1RULL 2QKIA 2MHAA 3EDDA 2ZOUA 4AEHL 1PG7X 1OOWA 3MGOB 2Z91A 4TVSa 4XN1A 3OR7B 4IK6A 1HU8A 2NW3B 2Y6SC 4TQ8A 3ZTJH 4ATWA 2YQ3A 2QPFA 2AEQL 3US1A 1A65A 2B7DT 4B5EA 5KG9B 2C1PB 3FQTA 1FP5A 1FNSH 2LW3A 2BVEA 4PJHE 4JZNA 4XCCH 5EBWB 2P48B 2Y06L 4WTXA 2HLEB 3F8UB 5DMKB 5HD8C 4HJEA 2IADA 2G3XA 4DAGH 4OU3A 1Z9PA 2SEBB 4GRMA 4QOKB 1ZHLB 4M6NH 5TK4A 3PYCA 3SYAA 3I50L 1J0KA 2R0KL 2GSIA 5JLZA 3D52A 4R7VA 5CUSL 5I66A 2ZUQC 3ES6B 1BLNB 3I3BA 4KKBC 1WZ1H 5E8OB 1XCTB 3UROR 4F5CA 2EH7H 5B1JA 2P5EA 2XV3A 1G43A 1VPOH 1JXFA 2NNAA 1IT9L 4DKFH 2OJ1A 3VG9C 2D0FA 5FV1L 3WIFA 4IJ3C 3TVMC 3CU1A 3QZOA 2G9HB 4UIKL 1RERA 2D03L 1JI2A 5C07A 5K9KA 2VN7A 4IGBB 1EFXB 2KDGA 3AG4B 1PLGL 4F57L 4FFZA 1ETA1 3T0WA 3S34H 4PJ5A 1IAOA 3SBWC 2XJKA 1L0XA 4IBWA 4PJEA 1MHPH 3N40P 3VYPA 2R8SH 2WKGA 5I28A 3B7SA 4DVBA 1OEZW 3SODB 1KPVB 3FN3A 2P80D 3KGTA 3A5VA 1RUKH 1BEYL 3POCA 2N7SA 4OZHA 4X99B 4JFFA 1RLBA 4Q0XH 3SCMB 3BWAA 4E41D 4ONFH 4PJ8B 3N5AA 2XOTA 1G5GA 1K9TA 3N04A 3KPNB 4H1LG 3ARGA 3FFCB 4HWBH 3NABH 1QHQA 2B1AH 4KVCL 3UC0L 3X1EA 3NDZE 2BSED 1BVLA 1BQLH 2PO6B 5I16A 2CDGA 4KWUA 1IBFA 2K8MA 2TSAA 1UKQA 3GWJA 4KUZL 1K6QL 4WRLA 3NCFB 3VFSA 1T6WA 5B1CA 4N2FA 3PNWB 2F8OA 4PG9B 5CJ8A 1KFAL 4P46C 4PV9A 2WUBL 4MKMA 3V4UL 2VJXA 4XVUD 3S88L 1K5WA 3AW5A 4PRDB 4M7LH 3MOBL 4F2MA 1SLWA 4OCLC 3LH2H 1I53A 3GEWB 4LSTH 5F1OB 2AXGA 3UEZA 5J57B 3LNHA 3CCHB 4ZMAT 1AMYA 3TJHD 5KYWB 5ADOL 5IUCA 5HYIA 5D71H 2MMXA 4L8SC 2ZP0T 3HPLB 5C2UB 1FDLH 3IF1A 3NP4A 4UQIM 3VGAB 4IOFD 1MSPA 3HLAB 1HINH 1GAFL 1NC4B 1WCBA 4KJPC 4ZZKA 2H0EA 1BZEA 5EUKA 2V33A 1BHGA 2IH1B 2KC0A 1UA6L 4NO0B 1HI6B 1VZGA 3OJ2C 3PWPB 5D1ZA 2CJ3A 3VFUB 2VR6A 4B53A 4A7GF 2QTEA 3OXSA 1XSKA 1AXSA 3JV6A 3FO1B 3QIWB 4FHBD 4OCNC 4ZW6A 5JXED 3RVWD 5KYXA 4OI7A 4I0PD 1M7IA 3SE3A 3ZUCA 2O5XL 1WEJL 2BHZA 1K8DA 4ILDA 4AZUA 2YPLA 3L16A 5KBLA 3RJQB 3N43B 3ZKQD 1LEKB 4HBCL 2E7CA 1OSPL 3OAZK 1QLEL 3FU5A 1GOGA 1CS6A 2ZCHL 2IO5A 4K71B 2FJSA 2F15A 4WHYH 2E9WA 3CFKA 1MDAA 2EDOA 5E4AA 1YRKA 2HN7A 2FHFA 3LS5H 3L81A 4FS0A 4PGDA 1I9JL 4ETYA 2V5SA 3MLXH 4KK8D 1OGAB 4YSPA 1LM8V 4N0UA 1Z0NA 2ITDA 2F54B 3F7VA 3TBSB 1BF5A 2K9FB 1SJXA 2X4PB 2HT4C 5CJBA 5D72L 3TEWA 5KSBA 4M61A 4WLCA 4X6FA 9PCYA 2FTAA 4FZ8L 4UQCA 4A04A 1X5GA 1S7SB 1DZBA 1UENA 2GCYB 5CHNA 3OB0H 5C3LD 2GJJA 2VDQH 4F58L 1B0RB 4EIGB 1C7TA 1N64L 3D8MA 4JGMA 2JFCA 2E46A 1UC6A 3AU1A 3VXPA 1EDQA 1MNNA 3QG7H 1I4FB 4FQ1H 3PGCB 5EF3A 3VMOA 1RHFA 2YD0A 1UGNA 1BBJB 2EZ0C 3ZUNC 4NO5B 4KPHH 3NYKA 3TNNB 1NEZB 4PJ6A 2EVHA 1M2VB 1S5HA 4JFDD 5FV2A 1F02I 3FU6A 2BW4A 4LHJB 4Y9FA 1MRDH 2IDFA 1U8LB 1G9ML 1SJHB 4FYSA 4IRJA 3UBGA 5DZNA 3BAYA 5FOBA 1WGOA 2XDHA 3AB0B 3VXUE 1A6VL 3MLWL 4TSAL 3HAEB 3PHSA 1LTXA 2PPFA 5DEZA 3ZKSD 1C1EH 2B39A 3CVIH 1JTPA 5IVXE 3HBZA 2EVFA 1U93B 2FR4B 2XVLA 3PQYA 1JGVH 4HQQH 4LGPB 2Q8AH 2JKXA 2F7RA 1GGCH 2CDFA 2MKLC 3KDPB 3U2SB 4HEPG 5IKCB 4YDIL 4U6XA 3VFVA 5IREA 4NKMB 5J1AA 3QDHA 2B2XL 4UT6A 4WJG3 4LMQI 5FYLH 1H6FA 3K8MA 3H1ZA 5AW4B 5ES4B 4H25B 5D1QD 3K72A 3NSXA 3QO0B 5C6TH 3WGVB 1NL0L 1KZYA 2D2CC 2JKWA 5IP4A 3CMOL 1UH2A 5GS2H 4YL4A 3FOLB 1RAMA 1XL4A 2VN5A 2Z6FA 4A39A 1JBJA 2EDEA 1CU4L 3H6JA 4PWKA 1NCAL 3GZQA 1MVYA 2F61A 4JN1H 4PRNA 5A2AA 2LHAA 1D2PA 1BYOA 4XP1L 4XPHL 5HHNA 3QRFM 3ESVF 1QWNA 3GSRB 4XOBA 3LYRA 3ARWA 4NQSB 4EZMA 2X1WL 1T3FA 1TTCA 1INEL 4G7QB 2VM3A 5I18L 3UMTA 3KS0H 4F7MB 2VSMB 4R4ND 1MPAL 3ILQD 4MMZA 2ZX8A 4QHNB 1NLBH 2QADD 3UG3A 2QV4A 4LCCA 4D9QD 3QVAA 1T5WA 1OD7A 4Z7VA 2LQRA 4R83A 2A6KA 5EEYA 1N8OE 2BSSA 2HUHA 4NHUA 4K3JL 3BH8A 4JM0A 2MCAA 2D4FA 1MCBA 2O6CA 4TPRL 3VGBA 1CGVA 3ATFA 2JQZA 4PGJA 1OM3L 4ZSOE 3NJIA 3T04D 4QNPE 5J0BA 4LPYA 2X28A 3UYRH 1XGUB 4ZFOL 3BP6A 4KXDA 1BX2B 2P24B 2VW4A 3K6NA 3TO2A 2FYYB 5CLWA 4Z7AA 3T77B 3WY2A 3B1UA 3GMNA 4O02H 4NN7C 3QW9A 3VXNA 1H6UA 3RQ3A 1NCCL 2CK2A 4P2OD 3GI9L 3T4AB 1Z2KA 3SZKC 1KV3A 1ZTMA 4MNQE 2YA0A 4FQ2H 4FXKB 2DQFB 4HV8A 2ADFL 3PHOB 2V8MA 3WLWD 3H85A 1PX4A 5AAWC 1R3JA 2R0WH 5KVFH 4ODVL 2EKSA 1AHWA 2VTFA 2A74A 4DEUA 3VXSD 4ETQA 3WELA 5EO1B 4GP4B 3ZT6A 4LHUG 2IH9A 4UYQA 1ZLSL 3PS6A 3M1CA 4ORGA 3RVVD 3I2CH 3UTPD 4JR9H 5HHMD 1KY7A 2QVIA 3C2AL 3Q9QA 3CH1A 4K5NA 2I25N 3BQUC 2QJDA 2AKRA 5B39G 3QPXL 2V3FA 3QWNA 4P2RE 4L1BA 5IIEA 4K3EH 1VCAA 4NNYB 4NKDB 3V4PH 1O6TA 2IBGA 5D7LD 3S7GA 1DQKA 2WVUA 3KG5A 4S11A 5C7XH 1W8EA 3MLSH 3TJEL 2E4TA 2Y4SA 2QDVA 1DBJH 4Y0GA 4DT2A 1Z32X 4EBQH 4F8LA 3NSJA 5DA0B 3G3LA 5CLZA 3X11B 5I1CL 4UM9B 2OLDA 4ZAKB 3B9DA 3M8OH 4FFZL 1ZTXE 4O2CB 1D9KA 3HOGA 3Q6GH 4ZS7H 3TA3D 3RHWK 1B6UA 1TZ8A 1J9SA 5HHOA 4QTHA 3JVGA 4G2AA 4YC2B 5L4IA 1KB5H 3O6KH 4NZUL 1KWGA 1LO2L 1JUFB 3OTTA 3IVKA 1XGPB 3TT3H 1HJBC 1BQRA 2Y7LA 2DYSB 1IVLA 1CLOL 1KN2H 2X4SA 3HRZC 3L5HA 1R3HB 1YJDH 3EF4A 5DS1A 4OI8A 3IRCA 1MOEA 2FH8A 2KYIA 1N18A 1MJ7H 1L9OA 4KK5C 5DC2A 1F58H 3MLUL 4P23A 2OW7A 2J25A 3BFOA 5DJAB 1XZWA 3LXUX 5C8JB 3K2KA 2FGZA 3EOTL 4K0OA 1U6AH 5F89A 3WN6A 1F6AA 4RIRA 2W65B 1MN4A 1YN6A 1OV8A 1HL5A 2VW7A 3PU7A 4U1LB 3TCLA 4PGCA 1GIGH 1Q1JL 2VXSL 5C2BL 2VZ3A 3HS0B 4ONHB 3SJVE 3H0TB 1ECYA 2ZOOA 1UASA 4KRPC 2QQNL 3DVFA 3FSZA 2ZXCA 1L3NA 4OIIH 1KTLB 1Z5LA 3DO4A 3RTQB 2ZF8A 3MO1A 1M71A 2XIIA 2OL3L 2MTPA 2YQGA 5LGJB 3HG3A 4JY5H 3UX9B 4PVBA 4HHAA 1V5JA 3EAKA 1W8NA 1SUJA 1D5BA 3EOAB 5F7BA 3G5VB 1I7ZB 3BW9B 4I89A 5I1EH 3KL3A 3FTGB 1OAXH 1A4KB 3FC8A 1WFOA 1U2HA 1GKEA 3G6AB 1HHHA 4MCZA 2WXOA 1KYOK 3OHXA 1SXSA 3I74A 1XMEB 5C0AB 3PGFH 1CVRA 4JG1H 5DC4B 5TDNB 1YEFH 1Y18A 4P4RB 3JWNG 3BUQA 1IO4C 5E4EC 3P4MB 1UWXK 4JJHA 5DD3H 4G5ZH 3F7LA 2CLRA 1R46A 3SPGA 2I7OA 3NA9H 1MAJA 4AYBA 3E0GA 4ODSH 4YHIB 3DXAD 4UQDA 4PJHF 4TULL 4LLAA 4BZ2H 4LLWA 3ROLB 4G8AC 4HS8L 3QE5A 3MRPA 4XMXA 5HYQB 3OKEB 5E0FA 2Y5TA 5ISZE 2A3TA 3FT2A 2H47C 1UD3A 2P5WE 3HNSL 4LEOA 1USZA 1F3JA 3ZE2E 3SBRA 2YQBA 1V54B 3IGAA 2GK0A 4XMLL 1DQDL 1QUNA 2EVGA 3IFLL 5SX5K 4FQJL 4AMKH 2EEBA 3MBED 3MRRA 4LIQE 4PRIA 4N22A 3IT8D 3RDTD 2H1PH 2PW2B 1UOWA 1YN7B 4L1LA 3BO8A 1KB9J 1U3HD 4BFNA 4FFTA 3VTTA 3EH4B 1YYCA 2D9QB 2EIMB 3GMMA 3V0VA 1DQLH 3P3RA 3T2PA 3D3VD 4JM2D 3JTSA 4RVBA 3U7YL 3MBWB 1HJCA 1NFDB 4AYGA 5TE7H 3CXHK 3DHUA 3AACA 1GZQB 3DHMA 3DUUB 4NXSA 3MCLH 2I26N 3MREB 4ODTH 1BXUA 1W16A 4XBGA 5MERB 1QSFD 3PHQB 1A7NL 1V3MA 1ZPUA 4GUPA 3VFRB 1A3QA 4V1DA 4WEEA 5D4QA 1WHPA 2HH0L 3VD2A 4L3CB 1JMZA 3T0VA 4QHMB 3G7TA 4Y19E 1FZKB 4XAWL 1E4XL 2Q5BA 3S35L 5EMYA 3U4BH 3CPLB 3R8QA 4FGMA 2L4OA 5C0FA 3U4KA 1UZ8A 1LEIB 3UJIL 1WLHA 1QLRA 2WXQA 2JTYA 3FONB 2F53B 2VUOA 3VXTB 3BRDA 1Y6NR 3BFQG 3AABA 3QXVA 4NQCA 3M45A 2V8LA 4UT6L 4I13B 3MRGA 4QRBA 3W81A 4E68A 2YD6A 4XP6H 1XSOA 4WTQA 5IK3B 3QUXB 4RAVA 4HMCA 4JRLA 4EJ1C 2FX8L 5J1TC 4YWGH 3TBTA 2UWEB 4PWFA 3ZVVA 1EZLA 4Z3TA 4PW9A 4XC1H 1SPDA 2W94A 1ZT7B 25C8L 4ZTPL 2G4EA 2X0UA 4JFXA 5B1AB 2CCLA 3NQIA 5FB8A 1JPSH 4N28A 3VXQA 1D5XB 4TL5A 3VXMD 5JW4M 5JPNA 1F2XK 3VX0A 3D85A 4MVBD 2RQ8A 1NCDH 4GMTL 5ELIA 1MI5D 3EJSA 2J20A 4FLQA 4PJXB 5GRVL 1F0LA 3ZSSA 3VWKA 5J13C 4H4NA 3F01A 5EEZA 2EQDA 3U4EB 1A6ZA 2EDRA 3ILDA 5FXCH 3T0ED 2IPUG 2RMNA 4FQCL 1SF5A 2Z9TA 3AADB 1ODUA 3G6JB 3NACH 2GITB 2H32H 1PVHA 3LSOB 2A83A 3FB6A 3NCMA 1P5VB 4NP4H 1CCZA 1F6LL 3N42B 2HVJB 4OR1A 4AVJA 1LD9A 1OARH 3O9WA 3S8WA 3BDXA 4O00A 1EEYB 3A6BL 5ECJE 2V2WA 2IAMB 3QCTH 1MVUB 2AQ1A 3OG4B 1R3LA 1YG9A 4U1NA 5SWSB 1QBMH 1O7SA 3HC0B 3HCVA 1NIEA 3T4YA 1CIDA 1QBLH 2OM5A 5KN5B 2UZXB 5D93B 4S1DC 2F19H 5DJYB 2DICA 1HEZB 4LHUA 3VWJC 1H9VA 3BDYL 3WJJA 3EJCA 2ZCLL 4NC2B 3IFPA 3IU4L 2NUPB 4UNIA 2ZOKB 5B39A 1IVTA 1E5ZA 1XGYH 2BP8B 3MRLB 1B3JA 1OP5H 3TM6A 1SVBA 4L4TE 4P5MB 2XA8L 3L1OL 2MNUA 2VDOH 2ENYA 5CZKA 1KYAA 1TNNA 4L4JA 3GSVB 5F7FA 3D08A 2L7QA 4N5UA 3IAGC 1FQ9C 3HPJA 3EDFA 4QKTA 3TPUA 5TD4A 2NXYD 2IQ9L 2Q7AA 5I6LA 5JYMA 1F86A 1JGEA 4MNGB 2RCSH 2EDHA 4PRPA 4Y5VC 4JGUA 5DD6B 3UBXI 5DZAA 2Z8SA 4DKFL 2G3MA 1N0XL 4WO4B 1XTLA 2VKWA 1E9OA 4JVUA 2FO1A 1ZMYA 2J6EH 4XNMA 1NBYA 1LP9B 2EXWC 2HKHH 1TQVA 1EJOL 3EH5B 1JXKA 2IV8A 3H9SD 3WEMA 4ZPVA 2X2UA 1WA2X 5C6PB 4JFQA 3EOBB 1YDPB 2CRZA 2V3EA 2Z7WA 4R96A 2V9UA 5IVXF 5EOCL 3VYOA 4XMKL 3ARFA 4ICXA 3DURB 2MKWA 3HG1A 4AK1A 1PLCA 3RGVC 4OCYH 1H8OA 1H8LA 3VB9A 3ABKB 4WWKB 1FV1A 4J3TA 5IJVA 1D5IL 2DQTL 1IL1B 4LLQA 1U3YA 4NJAH 3UPRB 4ONFL 3BHBB 1IU1A 2ZAIA 3K2IA 2DQGH 2DMGA 4OQTL 1JZ2A 2B1AL 5I6OA 2XWJA 4AC4A 4LLYA 5FM4A 3N44F 3MQIA 4XX5A 1BQLL 2XQBL 2FL5B 5FFLA 2QVMA 2QL1A 3TZVB 1LJMA 3DROB 4N8VG 2VLJE 1HCFX 2D8KA 3LQMA 4GMSL 2VDPH 2Q7YB 1WD9A 4QO1B 4IRSA 4X6DF 2BS71 1BM3L 4MWFA 1RZFH 1U30A 4NUMA 3HN8A 1M1XB 2AV1B 3LH2L 4LSTL 3CNKA 4G8GA 4QY8A 1J8HD 4R7XA 1NCTA 2A0LD 2RB8A 3MV8D 4LKCA 4UIMA 1G7JB 5DRXB 1S7XA 4M5YH 3BZEB 4NBZB 2RTTA 2C1OA 1FDLL 2VXVL 4Y4HD 3STLB 5JIIA 4HUWA 3SGDI 1ADWA 1B4JH 1KCSH 4IOIA 1I9RL 2UZIL 4ODWB 3CN4A 3WXWH 3NCCB 3B3BA 3KD4A 3S2CA 3DX8A 4Y89A 3H53A 1HEJC 3QDME 2TAAA 4NQEA 2ZT9C 5F96L 1EO7A 4A2EA 3OVUB 1BIIA 3T0BA 5L0QB 4O2EA 4QNPF 4AIZB 3NCBB 3WXVH 1P4BL 1ZVSA 2IAND 1QI5A 1F2QA 2LTQC 1KIPA 4PR5B 4FQHA 3VGFA 5FECA 1FJ1A 1K2DA 1AZBA 4QTIH 3WE6B 5I75B 5IHBA 4KFMA 5IUSA 3QEQE 1AG0A 3MNVB 5DHVB 5SX4H 4E9TA 3HEIB 2IJ0C 2FK9A 1BZOA 2XXMB 1D7DA 1OANA 2CO6B 3LV3B 3MLXL 4J28A 4BZ2A 2D31B 4I9WD 4Z3FA 3NJXA 1EHNA 4O2FB 3ZMNA 2FHBA 4AX3A 1OP3K 2XX1A 4AENB 2CM5A 4PJAB 3LNEA 2Y2YA 1CD1A 2YUVA 1VA9A 1ZGLB 1KTBA 2FECI 3FUJA 2ED8A 1ZTXH 1PU0A 2XFGB 3VD5A 4D9LL 1OLLA 3GQFA 2ZP9A 1AG6A 5DD5L 4PJ7A 4F92B 3CBKB 4LSRH 4QYOB 3MRQA 4F8OA 3JWOH 4PVLA 3TO4A 1A3ZA 1NANH 4RGMB 1FYTD 4XZUB 5DJ8B 1JRHL 2PXYD 5E00A 4FQ1L 1W80A 1VB9A 5G5DA 4XPAL 4UB0H 4KI5C 4G7RB 3ZR6A 1NM4A 1WK0A 4ZMZA 4NKOB 1MRCH 5GGRB 3VXOB 4YMPA 1JZDC 3QI9D 4UAHA 1HH9B 1AJ7H 4YGVA 5IF0A 1WPCA 4HEME 4TMPA 4XPFL 2OS7A 3O4LA 3WTWA 1QRNE 3D39D 4XNQB 1UOVA 3PDGA 5EC2A 4WI4A 2AK1H 4MQXD 5JO5B 4K23H 1G0YR 5C08A 3THML 1N68A 1JIBA 1OAYH 2W88A 1Z1WA 1OVZA 2DQDH 2FSDA 3LZNA 5KVDL 5T1DH 3RWDB 3WNIA 3FCTB 1YC8A 5FLUA 2BP0A 2V7NB 2YC1A 2BNRE 1GGCL 1NOFA 4W9LC 5DEGA 1HH6B 3RFZB 3NJNA 2VAJA 4H8WH 4AEIH 4AT6A 3KLQA 5MEOA 3QHZH 3UTSE 1B0GA 4FFVD 1F42A 2DF3A 2WTOA 1C5CH 2N3JA 1KENL 3NT0A 1GMEA 2XZQH 3LPWA 3SPIA 2VDNH 2W9DL 3MNZA 2OK0H 2ETWA 1IILE 4S1RH 2ED9A 3IWVA 3J27A 4OZIE 1KIQB 2KI6A 3L5XH 2FWOB 1FZJA 4P5TB 2NY6C 4ZMTA 1R5VA 1KJ3H 4PGBB 3V0JA 3WFBL 5I8EA 5DWPA 2AAAA 5CSZB 4NC1E 3T2QA 5IOKA 2XN9D 4NM8H 2BM3A 3OKKB 3UTTD 2GVYA 4X6CB 1A22B 1JHLL 4JCMA 5L88H 4HOWA 1BFVH 4ZX6A 3GUTB 1G1YA 5IWLC 5MEND 5EU6A 3CIQA 1IC1A 3DYMA 5D1XB 2PYEA 2MQCA 4NQUA 2ISDA 4AITA 4DN3H 5IQLA 2DQJL 5HY9B 2P46B 2YJQA 3LQZA 4PJBA 1TSHA 4YHLL 2L7EA 3M86A 5F3FA 1NUDA 5AD0A 1BQSA 3BCDA 2MHAB 3D12B 1JNLH 2VLLB 2B15A 3O8XB 4I2XA 4XTRD 1D6EB 2EO9A 3WNJA 5T3XE 4GG6B 5AWNH 4U3SA 1U8PA 4LIQH 1N67A 3UYRL 5HBBA 5K59E 5I8OL 5F21B 4J8QA 1BP3B 2YWYA 2QHRL 3EZ8A 3TT1H 1EANA 4APQB 3I9GL 4B9KC 3VJ6A 3I02B 1X5LA 4LSPH 1TTAA 3EO1B 2DWEB 3VQ2C 1WO2A 1TO4A 2IADB 2BCKB 3PE9A 4URTB 1FZMB 3U9UA 2JE8A 2DD8L 1SY6H 1IGMH 3MV7B 3O6FC 1HIML 2P47B 2ZE0A 1FWXA 3ZE2F 5DFVC 3V6FB 1RQ5A 1OK8A 3NRQA 5KBPA 3UDWC 4KO7A 2XFXA 3Q1SH 2AJZB 3U0PB 3OL2A 5IFHL 1EPFA 2A4CA 3P9WB 4JKPH 2R0WL 1O7VA 2P5ED 4K7PX 5D7SL 3MRDA 4H0GA 3W39A 1BZ9B 2BNQE 1JZ4A 3TVMA 5DS8A 3W11D 2C34A 2EILB 5FO9B 3CXDH 3OKOB 1YHPA 1ZVHA 2GPZA 2ITFA 2NNFA 4PBDA 4X6BB 1XQ4A 1X5HA 5HTSA 2GTQA 3RNKB 1XCQA 1JK8B 4LCUB 5DUJA 1UWEL 3DO3A 4GLRH 2HLFC 3T0AA 1XD0A 4JO2H 4ZUVA 2GUYA 1UQSB 2G0LA 3FTYA 3OAYK 4KZDH 2GJ6E 35C8L 3VGEA 3SBWA 3ZGHA 4HKZA 5CINH 1CXLA 4L4VB 1H3VA 4PJ5D 5I30H 3V0DA 5BOJA 4X7CC 5TQ2L 3MACH 4OZHB 4G43B 5A2BA 4KMQA 5EWIH 5B8CB 2C8NA 4HJ0C 5E8DH 3BWAB 4EI5C 2VRQA 1KTDA 1U8CB 3BZ4A 5ANHA 1AZVA 5BCAA 2DPKA 1N6VA 1Q0YL 4O51B 4Z7NB 2BY0A 4H2CA 2AJVL 1JFQL 1VFMA 2VXUH 4O58H 1YA5A 5E0QA 2OPCA 3FUFA 4PJDE 4ADGA 3ARGD 3I9IA 5I16B 4UI2A 3S2AA 4NZDA 4OF8A 3LRMA 1NWOA 4FFYA 2KPNA 3GXPA 1OQXA 4PTUA 4Z78A 1J5DA 3O6KL 3HI1A 1RKRA 4H88L 3IXAA 4N8VA 3E8UH 2WLIA 4LDOB 4M4RB 4BDVA 1XIWC 2ZXGA 1DFXA 1I8UA 4P46A 3RKDD 3L3HA 5DC0A 4NRYA 2B4CC 2YXVA 1O7DC 1MHEA 3CQPA 4F2MB 1KN2L 4R5XA 4O9HL 5IBUB 2ZWNA 1DQIA 4Q74A 3NPSB 3EJRA 2GW5A 3QDGB 4D8PB 1F58L 3OKMB 3QFDB 4KJQD 3KPSB 3BPOB 4CJ1A 4L8SA 3IDJA 4YNYB 1DQJB 2DWDA 3QNYA 1YY9C 4QR7A 3MROA 1MCCA 4C56A 2OL3B 4WW2C 1QR4A 2H6UA 2QLYA 4HALA 2V7HA 3NZHL 4RWHA 5CZXD 3QJXA 1I8AA 2VQ1B 2FT6A 5E5RB 4DCQB 1LE5A 1NAMH 1NWPA 1LO5B 2ADGB 3WFCH 1SEBA 4HC1H 3X2QB 1GCYA 1HQ4B 3V0FA 1AO7A 2A9NL 3AQZA 1N8ZB 5C0CB 1ZRUA 5H37G 5D2LA 3DVNA 2Y24A 5ID1A 5C3TA 1KBVA 2BS9A 1N5YH 4G1EB 4S2SA 4OIIL 1PEWA 3RE0A 3Q8BA 2YPLD 5IROC 2IBZX 1DO5A 1X5KA 3BIKA 3UFIA 3WKYA 4JY5L 1EHLH 4BUHA 4HZLA 3UL4A 2PP7A 2QMKA 1DBKH 5DFAA 5D7IB 5DT1H 2XU9A 4TQHA 4JN2A 1TNMA 4RNRA 8PAZA 4OZ4B 1NGWA 1UXLA 2J8HA 4ZI8A 4MMXB 4YXLL 4PTTB 1RPUA 1S7TA 1TYRA 4N0UB 3QULA 1ADQL 4YDLB 1BXAA 5E2UH 3SDAD 4ZMOA 1L9TA 3RZCD 1DVFC 1GGYA 4UOJA 4YH6A 1NINA 1KOAA 4NN6B 4R2GD 4Z0BH 3BH9A 5LBSH 3QJRB 5FM8A 4HGWB 3S4SB 1ORSB 3QPQD 3AROA 1T0PB 1RZ8B 5DD3L 5BV7C 4M00A 3EXJA 1AOHA 4G6KH 1SBBA 1W8OA 3VFWB 3PWNB 3AU0A 4G9DB 4ZXBD 5D2NC 3AS1A 1OAZH 4XVSH 4BZ2L 2JKIS 3UP1A 3ZE0B 5D6DC 5H94A 2CCWA 2WMPA 2KUTA 4JVPA 4XP4H 4W6XB 4P59H 2RHEA 5JPMB 4FABL 4CA4A 4LQ1A 5I5IA 2DS4A 2G3ZA 2V2XA 4XPTL 3RAJL 4I87A 4AQ1B 4A37A 5AB2A 1QFWH 4ZMXA 5F9JA 4LCYB 4HIXL 4B3VA 3PP4H 1Z9SB 4HK3J 1AACA 3N6YA 3RVUD 4WI3A 2BWIA 2NY2D 4DQOL 1XDTT 4GEJA 5KVEH 3HUJA 3WUWB 2CO3A 3OMNB 1ZVNA 5F9OH 5GGVH 5JHMA 4Q52A 2WXLA 3PQYD 2C4FT 2K78A 2ZUVA 4U6XB 2IPKA 3MCLL 1NGQL 5EBLB 3UIYA 3HB3B 2BIPA 4IIQB 1ET5A 4LSVL 1UM6H 3BP5B 3N9GL 4KMTL 4KZEH 2DBLL 1KULA 5FW8A 2MWCA 4FE9A 4L1HA 2CO7A 5CBEA 3RBGA 4IHBA 3BSZA 4PP2A 4ZX3A 5I2IA 2N4IA 3B9AA 4UOZA 1G9NC 5GJTH 5AYUH 3L1EA 1XAUA 1C08A 2NR6C 5E23A 2HKAA 3L9RA 1NDGB 4I77H 4UV7L 2RIKA 2UYLB 4AL8C 2K70A 2JELH 2Q6WA 3PWJA 2P5PA 3CFMA 3TFBA 3VFOA 4JQXC 4MZ3A 5ESAA 3T2NH 1BZ7A 5ENWB 4M7ZB 4MAYC 4XP6L 1Y07A 4Y2DB 1J86A 3S36X 2AJ3A 1U3JA 1D7FA 3CDCA 3L7EA 3D0LA 4MMZB 4TOYL 3SE8H 4YBQD 5I1LB 4N2HA 2DLFH 4JHWL 1VFAB 4OLVH 3DBXA 2EEAA 2GTWA 2BVPB 2DWSA 3CZFB 3PV6A 1SXCA 3EUDA 4HKBA 4HMEA 3MZGB 2A6KB 5F1NB 1S6NA 3OKLA 3BH8B 4J3SA 5I26A 4IEFA 3WV0A 5F7AA 2VDMH 3U1QA 5IOPA 4Y4KD 5B1BB 4P3CH 3DWTA 1KUMA 3PL6C 2BSRA 4U2YA 1FLRL 1MHHB 3HZVA 3B34A 2H2SD 3DRQA 4FQLH 3OM3B 2IOMA 2NYYC 4YSTA 1NMAH 3UG4A 3ARSA 2WOYA 1J5HA 2E7LC 3CFDA 1XGTA 3RPIA 4DGVH 4R7DB 2F08A 2HTKD 4Y4FB 1FAKT 3MXWH 3QQ3A 3Q8EA 3AREB 3HI5H 3NIFE 4JL2A 1MCFA 1P7QB 2M2DA 4D7PA 4F20A 4HV8B 2ZNWA 3LN5B 5FA4A 1HSAA 2VWEC 1R3JB 4HFWB 4JM4H 4KQ3H 2YFOA 3CFEB 4XB3A 2EKSB 1PTZA 3DVGB 3FB5A 5AAWA 4GB9A 1A14L 4ANUA 4LL4A 4HWUA 4M1CD 2EDJA 2W92A 1KTJA 1QBLL 3BT2L 4Y8DC 1J5OL 1I1FA 1SY6A 2ATKB 3MUGB 3RA7H 5L8KB 3ZPDA 2F19L 1ORQB 4OJEH 3EYQC 3BAIA 4ONGL 4QXTA 5AKRA 1V7NL 4FG6D 2W1NA 4U1GB 4X5WA 1OP9A 3L2NA 3BQUA 4DN4H 3ULUC 2VC2B 1K72A 4AW4A 2WVVB 1AP2A 1S8DA 2NY3C 1KJ2B 1PL3A 4X6EA 5DK2A 3WD5L 1UJ3C 1XGYL 3BUYA 1IEHA 2WBXA 3Q6FB 2CGRL 4ABQA 2LU3A 2CIIB 2QBWA 5GRUL 1JZ7A 4FEMA 1CDHA 4EDXB 1SHSA 2ICWB 3N1QC 1EJFA 3DI3B 2F5AH 4Y19A 5KS9B 4J2XA 1JN6A 3HG4A 3OZLA 4Z18A 3AQXA 3NH7L 4KKCD 3IDMB 1U8HA 4HAKA 4H1LB 1R5WA 2RFXB 4N2MA 1AGBB 2E6JA 3WFEH 5B3NA 3BAWA 5E99L 2BOCA 1X7TA 3GBML 1D9KD 3C5XA 4Y1TA 1T83C 3W0WE 2HFFA 4BFEA 3ABGA 2EDKA 3OJMB 4DO5A 3ZL4L 2EXTA 5J3HC 1FHNA 3NOIA 1JE6A 2EE6A 4YHNA 4NQDE 3IVKB 1ZSDB 4WO0A 4RGNC 4DZBB 4E41B 1QA9A 2J88H 2LAAA 3HFMH 3HRZA 2PYFB 1RD6A 1FG9C 3BIBX 4ABWA 3VFPA 3F5WA 4WJ5B 1TIUA 5C86A 4Y5XB 4OCYL 4JFPA 4HX1A 3I9PA 1PIGA 4XN5A 4S1QH 4P2QA 3LH8A 4P23D 3SQOL 1IFGA 4FFYL 1Q9LB 5EU5A 5DQJA 2R7EA 2VERN 2AK4A 3LKPB 4ZRGA 2PETA 2KLRA 1NAKH 3V55A 3LKSA 4RESB 5JZ7D 2ZKWA 5ITFA 3K3QA 2A2QT 5DVKA 2UVFA 1A3RH 1W2KT 4JQIH 5IB5A 4OZIF 1AGFB 2VUKA 4J8RA 2X70A 4QLRA 5GGRY 3FTSA 1HL4A 2PWHA 2X1PA 1IBGL 3V5KB 3VXRA 1W9XA 1J1PH 3OX8A 5B38B 4R26H 5T1MA 2DIBA 1CF1A 5DO2C 4RAHA 5DZOA 4HC1A 4IK7A 2UY7B 5JHDB 5T1JA 2NLJA 5EUOE 1S7WA 5T3XH 3ZO0A 1U8NA 1EK3A 5HDBB 1RPKA 3GIVB 5JXAH 4IGBC 1A25A 2BXZA 3FO9A 3ULVC 2WNKA 3MI6A 5J06A 3LIUA 2LE9A 3MGTB 3MJ6A 2FYVA 3ZZ1A 4YDZA 5F7NC 1J12A 1DDHB 4YDKH 1KCSL 1SOQA 2NX5E 3M88A 3OHXB 4B9FA 4Z77A 3SDDD 1CB4A 1EA9C 3O0LA 1DJGA 3FN0L 4ZBJA 3U46A 1E8YA 1MFBL 3EYFA 3ILPA 2MCPL 2EINB 1KGJA 3LNIA 5IHWA 3SCMC 4J6RL 3AG2B 3RILA 1WZLA 5ERWA 3QIUD 5IHZB 2J1KA 3WU1A 1DVXA 3B2XA 3EO9H 1YEWA 5K59F 3INUH 3OAZH 4KJYA 4FQQB 2PO6C 3LDBB 2OXHA 4GKSA 4N1HB 5DDHB 5AVVB 4AQEB 1WV7T 4M03A 5LXGH 4HAGA 4ZNEE 2Q8BL 1MUJA 4H8VA 4AZ8B 5BRZE 4U6TA 5IESH 2R1WB 4Z3EA 1DSYA 3GTVA 4N5EC 4P5KA 4PRIB 4Z0XA 3MV9A 4Z95H 4X9GA 5DLMH 1HQRB 4GI6A 1Z7JA 4HKXB 4LLMA 4ECNA 5DLLA 1KBPA 3MJ9A 1SF3A 4XPGH 1DANT 1E9PB 3ME0A 2J4WH 3UAJD 4N9GB 4DPAX 2VOTA 1T1ZB 3CBJB 3FQNB 1GY1A 3GI8H 3OLGA 1A2YB 4QGTA 1GYAA 1P4LB 3DVIA 5HI4D 1U8KA 4ZS6C 5FDYA 3BQVA 4BSJA 1NCWL 1PFOA 2O61A 1HC1A 1BQ5A 3QIWC 4KJWC 4M7JH 1T04A 3CSGA 2WO3B 3C6LB 3X13A 1QW9A 3GMLA 1UOKA 1XF1A 4LDEB 2RH0A 2XG5B 3PXLA 4XNXL 5FYKL 4PJDF 4Q58C 5E8EA 4K71C 4R5TA 3B2VH 3MRMA 2XWTA 5DJDA 1FL6A 5FYLD 3HZYB 3RVXC 3GB7B 3IJEB 3F64A 2QMJA 2NNCA 2YSSA 4NEHB 4NQCD 2O6DA 5EPMB 4HKJB 3ASNB 4DO4A 2R4RH 5LAPA 3MSPA 2VE6A 1ACYL 1A7RH 3HG2A 3DIVA 5D1QB 3BSZL 1UUSA 1JNHB 3G6DL 4OD3L 4Y7OC 5GS2D 5BMFH 4XP9H 3TBTB 1CF8H 4OJFH 4IKNA 3ZHDA 4HSCX 1MIMH 5A7EA 1AKPA 2VDLL 5C9JA 2UX6A 3CJJA 5JIDA 4PP1D 1EO8H 4AEIL 3CX2A 2DY2A 4JEGB 3CZJA 5HJGA 4OFPA 2OFQA 4JFXB 3FYIB 3QDJD 3HNTL 1C5CL 5FHAL 2C3HA 3NFSL 2WXGA 2DI8A 2ZXEB 5J12C 4EZJA 3D85B 4HUVB 2F1AA 4S1RL 2OMZB 4KBPA 1HAUA 3ZZQA 2OJZH 5FO8B 1P53A 3MYZA 4OI9A 2XTLA 4MA3A 5FUZL 1WA1X 1FO0B 4EUPH 1AMXA 3D34A 3DTDA 3SYCA 4Y9CA 1ZE3C 5FUOL 2QADB 2EDQA 2V17L 5DWUH 1F4XH 1TUPA 1HCVA 2CR6A 2WN3A 4KOCA 3MXVH 2OA9A 2Z65C 4MD5A 4NI3A 1BFVL 5L2KA 2IALB 4ZW8A 4FEIA 3AB0C 1Q9KA 2V2WB 3FCGA 4PRBB 2OCFD 4DN3L 4ZW3A 3JTTA 1EZSA 2H0JA 4LCWE 2OSXA 1SJEA 5KAQF 1IC7L 4BFOA 3IMUA 3L4YA 5KANG 1HXYB 1FVEA 1P84K 1YEGH 5CJQH 5ITBH 4XBPA 1KIUB 4U1JA 1QG3A 1YMHA 3V0HA 1MIEL 5AEAA 4P05A 3UGUA 2DQ6A 5E1AB 3VWJA 2WXPA 4LHUD 3IS1X 3LKQA 3E6FB 5AWNL 5CF3A 2MIZA 4DVRL 3P11H 4QRPA 5B39B 3R18A 1RU9H 3M7OA 4OFYA 1ET8A 4D7BA 1TKWA 2DKSA 3LN4B 1VKXA 1R1CA 4J3UA 2C9XA 2JSFA 4QCIB 4Q9CA 1NOAA 2V4LA 1LILA 3O11A 2XKUA 1SY6L 4Z7UB 2FT8A 3TPUB 2ENPA 4EKXA 3BGFB 5HHMB 2EECA 4LSSL 1CYWA 3B56A 3MTXA 1UHVA 3Q1SL 4Y5VA 5E5UB 1RHHB 2Z31B 4PRPD 2JJUA 2X4OB 3GKWH 3KCWA 5BO1L 3DUSB 3WN5B 1Q4NX 1ERNA 2JCCE 4XP5H 2GFBB 3G08B 2OULB 4PFEA 4Y16B 3F12B 2CHDA 5D7LB 5LWYL 5E94A 4X83A 5G4OA 2BNRA 2NY0D 3BZFB 4NZTH 4YSRA 5TDOA 4JFQB 3RPKA 5I73B 4S0TD 3DTXA 5TQ0L 2Y2TA 3FRUA 4OD1H 3MLRH 4AMWA 5C09A 3PY9A 3H8NA 1TJHL 3ALXA 4DP2X 4F3FB 2OTWA 5I30L 3ARFD 3RGVA 2X0WA 3HG1D 3KYNA 3GMOA 3ZKMC 3RWIA 1IGJB 2Y69B 4TVUA 1EBAA 1MAML 2CO2A 2F9BT 4LESA 1KXTA 1T0MA 2VW6A 3BD5A 4I4WA 3AM8C 5DVLA 3TYFA 2VXUL 3MNWA 4O58L 1N2RA 4GW4B 3QCVL 2XWJB 5HPMB 5IMKA 1I9IH 1RJLB 1CE6A 1QW8A 2EDBA 3I6KA 1CN4A 3FUIA 5AAPA 4B9JA 2VLMD 4PAZA 3QT2A 5TDPA 3U0TA 3T4AC 4ERSL 2ZKHH 3E8UL 5DMYA 5GGUA 2UUDK 3CFIC 4XCEB 4FXKC 2FJFB 2NSQA 1U91B 4M43L 2AJUH 1FORL 3NUKA 2DLGA 5EIVA 2O5NA 2YD9A 4KZ0A 4GXFA 5CM1A 3VCLB 7PAZA 1T0NB 4QHUB 2HYMA 4GYBA 5DRWB 5CEXA 2B20A 3C5SA 1GTFA 2X2IA 4YLCA 3S3JA 2CU9A 3U9WA 1NC2D 4MDJB 3VACA 4HIHA 1YEJH 1OAJA 4MJIA 5IEHB 3L45A 4NT6A 4DKEH 4OZGE 4CC0A 1GS6X 4L8BB 2D7PA 4KTEH 5EOCJ 1MJ8L 4YK4B 4BQ6A 4MA8H 4HC1L 2VT0A 4JB9H 2Q2LA 3GUFA 1E5CA 3FT0A 2A4ZA 3STBA 2EXSA 1RSFA 3S3BB 4N24A 1U0QA 1TT6A 3GZOA 2DJSA 4ZAKC 1OXYA 2DWYA 4RA3A 2QLVB 4X8GA 4ELMA 5BS0B 1AIFB 2C5DC 4DOHB 4GQZA 3RNQB 4JFDE 5JHLA 1OTUC 1YYLH 4YC2C 4BKSC 3GD1C 1KELH 2X41A 5EU7C 2GC4C 4YX2H 3NGBB 7PCYA 4PJIB 1DBKL 2APXA 4DF9A 4KITB 2X3CA 4L1TA 1S7VA 4FTVB 3MRKB 5HDOA 1ZOXA 3NTCH 1RI8A 3U30B 1TENA 2D7QA 2P8LA 5HHVL 3ULSA 4L29A 2WYHA 1K4DB 4GO8A 3RWFA 5FHBH 4CUCA 4W1TA 2FQFA 2OMYA 1XSJA 4ZUWA 3FCUB 2BVTA 3DXAB 4OLXL 5BRPA 3LMJH 3C5JB 5INCB 4JFUA 2WSPA 4M9PA 1N6QL 4AMXA 3CGTA 5TF1L 4QKXB 3FT1A 4K15A 3BGMA 1M53A 4I8DA 1BA9A 4K7PH 4K5OA 3U48A 4XOCA 2FWLB 4PJ7B 2WIIA 4P57A 2HFTA 1KYUA 1JHKH 1DBMH 1FH5H 1KLFA 1CTNA 5D4HA 2CIKA 1HHJA 4E42B 1JHTB 1UM5L 3CFBA 3ZSTA 3ZJAA 3MUUA 1F1DA 3GJEA 3VH8B 4A2FA 2AQNA 4UDTA 3HS0C 2BP3A 2ZCZA 3MJ9L 1MJUL 3LPPA 3TO4D 5CD5C 3TURA 3LXCA 3W2DH 3D2UA 2IMMA 4JE4B 4UANA 1CBVH 4R6UA 2ZKMX 3RTQC 4A7VA 2IBBA 1AQDA 1I82A 4YBLC 1WZAA 5C0ND 2IG2L 1HZHL 2AABH 5ADPL 4JW3A 1EX0A 1NCNA 1QFWL 2E9BA 2AEIT 3O4LB 5I1DA 5KOMC 3WSQL 2Y3AA 3RL2A 1V8HA 2Q1EA 2EO7A 2NUTA 4EI6B 1BFOA 3D69A 2Y25A 1KY6A 5C08D 5E5MB 1AGCA 4LCIH 5KVEL 2IAAC 3VNYA 3QCUH 5D6CB 5GGVL 5I0WA 3FUHA 2Z1KA 4HYTB 3K6SB 4JG0L 5GISL 1YEIH 4LSUL 5EBMA 3D48R 4F27A 4X7EC 3WY1A 4XWGL 2NY1D 5EZLA 3S3SA 3UIZA 1QLFB 1UM6L 3B6SA 4H26A 4KZEL 2XUWA 4U7SA 1WRFA 2OR7A 1NPNA 3PWVB 3P1VA 4GNKB 2ORBH 5ICUA 3MMEB 3QUKA 1JNNL 3QORD 2VZSA 3ELQA 2GKIA 4NO2A 4N0FA 4PHXA 3U1SL 1F00I 2R2BA 4MDIA 3GBDA 1R4XA 3UTQA 1NEUA 2OMXB 3D25A 1A9EB 3ARPA 5AYUL 4BIKA 5FA3B 2GY5A 3H7LA 1UZGA 1LO3H 3HS8A 3IPEA 3IM1A 4XN2A 1CGWA 2R1YA 2ENJA 4DGIH 2XWBA 1NDMB 2R9HC 4MNHB 1YC7A 2HKFH 2YR3A 1TZIA 1R5IB 1KJMB 1MFDL 4OW6A 4BXVA 3M07A 3GMPA 1IBHA 4L37A 5F1IB 4FMVA 2H26B 3VTAA 5IWLA 4HPYL 1EZVX 4ELKB 4N0YL 4TRPH 5EUOF 2Y5EA 3VXSE 3RRQA 4PJ9D 4FADA 5J6HA 2R0LH 2PYED 4CN4A 1KT2A 1IMHC 4R8WH 2BCMA 3QZWB 2IFGA 4GH7B 5AZEH 4N6RA 3RL1A 5AOZA 4K9EL 3UTPE 3ZDYB 2AI0H 5I76B 4F37F 4DW2L 2XTJD 5AD0B 1XO8A 2G0KA 4W6WB 5LUMA 2N7AA 1I8LC 3FTWA 4P3CL 3IJHB 3NAAH 2KL6A 2Y6SD 4YFEA 2COQA 4OSUL 1KV7A 1NJ9A 3PG2A 3HR5A 4JRXB 1CGTA 3QJHB 1Q0EA 3P30H 4NDMB 2P8MB 3TBBA 2AQTA 2J72A 4RZCA 4XH2A 1UACL 4C58B 2N56A 3CDZA 3OLDA 5HD8D 2AXFB 2DMHA 2BMKA 3LRSA 1WYJA 4QAWA 2ARJQ 3O6FA 2YRLA 4WV1B 3VRLE 1GTNA 1UB6A 3L7FB 1E6OH 1N7ML 1GKOA 1FCCA 3QUXC 3QO1A 2FNWA 2VNCA 3UDWA 3GLAA 3KPMB 4PUBL 4RFOH 2M26A 3CC5A 3O4OC 5IG7A 4P9HH 5D96C 4W9GC 3W39B 4HA1A 1AC6A 1MWAA 2FSEA 2WPGA 4A7UA 4NYLB 2NYKA 3KCPA 4J1UA 3IWUA 1TJGH 4UILH 5ID0B 1NLDH 3ERXA 4PCTA 4GSXA 2I9TB 2J1XA 4AEEA 2E7MA 3B5HA 4JRYB 4M62L 1ZT4B 4GO9A 2IGLA 1VJSA 1K8IB 2J1WA 4NKIL 2NXYB 4KH2A 1RK7A 3VYNA 1SMOA 3A21A 1KTRL 5F3BB 2BVOA 3P4NB 1LWHA 3IJSA 1KJVB 2BERA 4MX7B 3RX9A 1DVUA 1JV2B 1U8IA 2BSTA 1WBYB 2F5AL 2JIXD 4I3RH 4PWGA 4WU7B 5DRNB 3Q01A 3V95A 4B96A 1HE7A 4H5SB 4BFKA 4OQ1A 2EDLA 4JHAH 2A4EA 5INDA 4G7SB 1CPUA 2VAAB 4NENA 4YBHA 1N70A 4IMLA 4U1SB 4YO0B 5I8CB 4HU2A 3CU7A 2F1BA 3MRFA 1ZHNA 4JY4A 1KZQA 2H41A 3FT4B 2OZ4A 4C4BA 4Z78B 2IAMC 4JPIB 5T1KA 1RUPL 3ATEA 2UVEA 2QQKH 5I71C 1KG0B 2YFNA 3KVDD 1XIWA 4RBPK 4BZ1H 4FQPA 2Q3XA 4XGZB 1MHEB 4P46D 2JK5B 1LDSA 3HFML 4ZUSB 1NCUA 4LARH 4NJ9L 2V2TB 1MW1A 5D93C 4NWUH 1DJSA 1UZ6E 1QFWM 1Q94B 1KN4L 4GW1A 5DJCA 5JORA 5C0AE 1TETH 4UBDD 3Q5YA 2DZEA 3N55A 4JPQA 5I74B 3P77A 1T2QL 4PJCA 4WW2A 4C56D 2X6UA 1C16A 5ECGA 2V7HB 3FPYA 5F71A 2BIHA 2GQHA 2E6QA 1FL5A 4UU9B 1NAKL 4HGMA 4PS3A 4XN4A 4CMHC 5C9KA 4KJPD 4QRRB 1E0OB 1JXDA 4GAYB 2LLLA 2F58H 3KR3H 3QWRA 4GAGH 5BZDB 4F7PA 1BPLB 3VMPA 1B4RA 3DVNB 3SDXA 3UYPA 3V7AG 5ABZA 1X4ZA 1R3IH 4A6YA 3KXFA 2J6WA 3B9VA 4AY0A 2DIAA 1I7RA 3ECUA 4CMMA 4LAQH 4NIYE 4Y4HB 5KYYB 1FGNH 1S9WB 5IROA 1ED3B 2IQAB 3KPOA 3MLVH 1GSKA 2CHXA 3PDOB 1EEZA 3MKKA 1A6WL 4GQPH 3Q06A 2AANA 2V3DA 3L1GA 2HLAB 3OJDA 4LSQL 8FABA 1NGWB 3KLAB 4G5AA 2FB4H 1ZANL 3QAQA 3D3VE 1WQVT 3HRPA 4IU3A 4NPYA 4PPTA 4WWOA 2HJFB 3VUAA 1QBBA 3LD8C 4ZK8A 3ZN6A 4OFQA 1DVFA 5JHLL 1I8KA 4WWKC 4F8TA 1XF5A 2VABB 4G6FD 1T1XB 4YQXL 3DC0A 5DUPL 3DX6A 5J5EA 3CFCH 4N8CH 1BWMA 2VLKB 3M1BB 1A3LL 2IWKA 3QFJB 5F2FA 3ZHNA 3O0RH 4TVPE 4KHXH 5D2NA 5BPPA 3INUL 1HYSD 4JFEE 2P8PB 5DUBB 5LG1A 4ALAC 1B4TA 1WAAA 1G0XA 1PBYA 3DJ9A 1EDHA 3TZVC 4LOUC 1L6ZA 2WMPB 3DBSA 2CO1A 5D6DA 4OGXL 4E9RA 1JDCA 3IDXH 1J1OH 2F6AA 3K2MC 2WZAA 4HLZG 2EZ0D 2A73A 4KRNA 4I5BB 4RWYH 3STZB 1VRSA 3ARQA 2R1XB 4JFHD 1F11B 4LF3B 1QQDA 3OPZL 3X12A 5I0DA 5DLML 3PFUA 3KW8A 4LLDB 1BVNP 1DE4B 3OKYA 4MB4A 4JDZB 4FERA 3QWOB 2JCCF 4ANVA 2CBMA 2RGSA 4WHCA 3E80A 3M17B 4WY7L 4Y1AB 1B0WA 1MCSA 1Q9WA 1CTOA 3WGUB 5TF0A 3CLEL 2F5BH 2IVFC 4YSAA 2C9QA 4Y1SA 1LQBC 5MI0B 2OMUB 1KGIA 1EXUA 2FZ3A 3QI9B 2PP9A 1TFPA 5E5LA 5AZ2H 3L9EA 3P0VH 1MI5E 3ARZA 2ARJB 5EZJB 5L0QC 1H5BB 4PB9H 1GC1H 4XHQA 2E76C 4U0QB 1PYWB 3BPCB 1U95A 2WAHA 5AW7B 5ALCH 4G42B 2QGDA 4HUMB 2YRPA 2VR4A 1YEHH 3T0EE 3P3UA 4BCYA 3U6RB 1O5DT 2IFFL 5A3ID 5I75C 3SJVD 2NR6A 4FXGB 3G6JE 4LU5L 4UTAH 2VLRA 3BEVA 4LZKA 2ZWKA 2C9RA 3H55A 1VZIA 1WISA 4M8QA 5BZZA 5I1KL 1CFVH 1DN0A 2ERJB 2WXJA 4JQXA 4NB7A 4DP8X 2YMTA 4KDWA 2R51A 3SGEH 4MAYA 2F18A 2AQ2A 2N0MA 4LNRB 1VADA 1ZAGA 3QIBC 1CF8L 2K4WA 2MRYA 4GG8A 2W0FA 3WTSA 1PKQA 4PQXA 3L3DA 5EEWA 2R59A 3NJFA 2WLLB 5FWRA 4XE0A 5F70A 2BY3A 1W6WA 3I85A 1QP1A 3RWCB 1ZE3H 5H8DA 1T66C 1RURH 4XBEL 5FC9A 3VSVA 3JWDC 4ZUTB 2LAGB 2VO8A 1T03H 4OZGF 1ZK5A 3JV4B 5E8NA 2OQJA 4ZMWA 2VM9A 2F7PA 5IOPB 3LXBA 1INQB 4XO4A 4RGMC 4ZMVA 2R15A 3PL6A 3ZDXB 3MX0B 3BWSA 1YMMB 1UGKA 1OZUA 4G8FB 1OPGL 2WTPA 2XV2A 2FQGA 3HI6L 1N5AB 4ZMNA 1FNEB 1N0LB 3G5ZB 1LNUA 2BOBA 3ZE1E 4LPXA 3MGAA 2IMNA 3MXVL 4D0DA 3VB8A 5ISZD 1R0AH 2E7LA 1XGTB 4YVUA 2IPTH 3EO0A 3QJFA 4MNGE 3O2WL 4NWTL 2MNJB 3DHPA 3HAEG 1MRFH 4JX0A 4KHTH 2NZ9D 1A7QH 2PUQT 3SD2A 4F1ZA 1TYEB 4OZFB 3H9SE 4ZYKA 4YE0A 4MJ6B 5HJ3A 1HSAB 4WK4B 1QO3B 4NQXA 4DH2A 1YEGL 4JFSA 3RFZC 1RJYA 1AANA 2EYTA 3BUTA 1FFNA 3D1MC 4ISVB 4JDEA 3NCJH 2J8UE 4GW5A 1KCUH 2QHLA 2Y6TE 2WBJB 5DHDA 3GGWA 1HILA 2GBUA 4X4ZA 3SKJL 3SO3B 1HEHC 3BT0A 3DV4B 3NSYA 3W38A 2EXYD 3QEGH 1HHGB 1I3RB 1CK0H 3MRIB 4A68A 3KYKL 3P11L 5DK2B 2XCMC 4E0RB 4UQ2B 1UJ3A 1ZPLA 1QWUA 4WI5A 4P5TC 3SKUD 1JVLA 3F6JA 4WI7A 1YY8A 3MODL 2Z93A 4NHCH 4PLNC 1KPUA 1VAHA 2BDNL 5EZIH 1MWAL 4BHUA 2VL5A 4P5RA 1OOAA 4Y19D 1PNCA 5HI5C 2CMRH 4WU5B 1XR9B 5K33A 5TH2A 1JGUH 4UWQB 1GJIA 4HWEH 2H0FA 5DSCB 2X0VA 4UTBH 3T3MB 4JZOB 4LGSB 2BRRH 2LT9A 1T83A 1Z9LA 5CWSB 5D1XC 4CAGA 3BPNB 1X6LA 1UWFA 4OCWH 5F0LB 3VI3A 1J8HE 1XGRB 5F6IB 1LE9A 2EYSB 3ILEA 4NX0A 3L3OB 4NZTL 4PD4J 1ES0A 1AD9A 2E86A 1FG2B 1E42A 5IQNA 1IM9A 1HX0A 1S9XB 4ZMQA 2WLHA 5D7JD 3D5OF 3F5WB 4KX8A 3O8XC 3MGOA 4HX1B 2P7TA 3OR7A 2K0RA 5C0RH 1DZ0A 1B9KA 1P7KB 4P2QB 1YYML 4ES9A 2CLVA 2OZ4L 1UD6A 3L9YA 4DGYL 1JWUB 5KG9A 3LH9A 1A4JB 2C1PA 4HJIA 1EO5A 3ALWA 5ILTL 5I15L 4APQC 3VX1A 5G4NA 2AK4D 5FO2A 3K1DA 5J56B 2EEDA 4ZTOL 2KLTA 2IANE 5EBWA 4BKLB 3TOPA 1PS3A 2B4CL 2XTSA 1F4HA 5DMKA 5CCJA 3L4VA 5DD1L 2CK0L 2SEBA 4P9MH 4QOKA 1MFAH 4X9IA 1ZHLA 4YEEA 4FYQA 1G6RB 1DLFL 3F58H 1OGPA 3EBGA 3GIZH 2V6HA 4FNLH 4HF5L 3VA6A 3GZPA 4FCHA 4H7VA 4KQ4H 2ZKHL 3ES6A 1BLNA 4KX9A 4KRPD 2DV6A 4PY8J 3VXRD 5E8OA 1XCTA 2FIKB 4UDUB 2AITA 6CGTA 2AJUL 2YD5A 3U7WH 5FM5O 2WLNA 4NKQB 2DQCH 3VA2C 2X4UA 1HK6A 1AIZA 15C8L 3QHFH 2PR4H 2CRIA 3QS2A 2G9HA 3MCKB 3Q43A 4I3SL 2V0AA 2XIDA 4AIEA 2CJUH 1CD0A 6TAAA 5I8KH 2GC7C 4IGBA 4TSCH 1EFXA 5LCVH 3Q13A 3I6LE 4LDLB 5BZWB 2OR9H 1YEJL 4PY7B 3UTOA 4FLOA 1E4JA 1WE5A 4A6YL 3LS4L 4YSOA 4LDCA 1KPVA 1MH5B 3S35X 4XVJL 5B8CC 4JB9L 4X99A 5IW3A 4P0DA 4TTDC 3SCMA 1HE8A 4LP8A 4ES8A 3HG5A 2HAZA 3JTBA 1FN4B 4YHKL 3KPNA 1N26A 3TN0C 3IRZA 3FFCA 4DGUA 5EF0A 3PRZA 3KWTA 4OCSL 4ODBD 3LNDA 1CGXA 2P43B 2XXGA 4GKSB 2PO6A 3KHOA 1NH6A 2ZTBA 4KTDL 5GS3A 1QTYT 3PAYA 4XMPH 4X7FC 3DJRA 2XJLA 3PNWA 4KK9C 4PG9A 3D39E 2VO5A 4KKLD 3VRLF 4WHTB 1ZXKA 2NQ3A 4BKTC 1VF5C 2CHNA 5D5MB 1UA7A 4N2CA 4PRDA 3D0VB 3GRWH 5BV7L 5EV7A 1BV8A 5CILL 3CCHA 4ZXBB 1Y6MR 2X4TA 5EFIB 3FF8A 5KYWA 3KJ6L 3BPOC 2GI7A 1CLYH 3FB8B 5IMMB 5AL0A 3HPLA 4EOWH 1SNRA 2EIBA 2P3YA 1BG9A 4NM4H 4MJ2A 3HLAA 1NC4A 1I3GH 4R3SB 3TIEA 4XZ4A 3T8MA 1W72B 4NO0A 3PWPA 3UJTH 3VFUA 4F7EB 4FXLA 3QIWA 3FO1A 2O93L 2WBWB 5DTFB 3X13B 2CALA 3SY6A 4YXKH 2DMBA 4CADB 3E38A 2XN9E 1LEKA 2XBTA 5E1GA 3UTTE 1OAQH 1XR8B 4BK4A 3IJYB 2VLJD 3DX4A 1IQWL 2WTRB 2GAZA 3H42H 4GS7B 3E2HB 5MENE 1FFRA 2CDEB 2EDTA 1YNTA 3V4VB 3UAEA 1F1AA 5JW3H 1WFNA 4FZEH 1RZGB 3UYOD 4MMXC 5GRXG 2YPKB 1JPFB 5L6YH 3NZSA 1OGAA 1S3KL 4LCIL 4YDLC 2NY4D 4AKPA 2F54A 5IEKB 3TBSA 1GHFL 5C9JB 4NN6C 5CP3H 2X4PA 4M1GL 1G9NL 4G7YL 3WIIL 2B1HL 4PLKD 4YHPA 1UZ6F 1ZA6A 3CVHB 3FU9A 3QR1A 1S7SA 1PZSA 5HGDB 2AP2A 4NLAA 2GCYA 4H0HB 1KLUB 2VZVA 2YKLL 4AL8L 2YLHA 4B27A 1L9RA 2XC8A 1A64A 1B0RA 2APFA 4PBWD 4AWJC 2ORBL 2ZG2A 3CSYB 1L0YA 3OQRA 3QDMD 1Z5YD 3TFKC 5C0GB 4DEWA 5E2WL 2BWQA 4XNYH 1UFUA 1I4FA 3VFTA 3PGCA 1BEXA 3L3KB 1LO3L 2YEZB 3U4AA 4CVZB 1WDAA 1E3XA 2X4RA 1BBJA 4NAMA 5JPMC 4NO5A 3LIZH 3TNNA 3FUKA 3R4DA 1T1YB 5HGAB 1OB0A 3EBAA 1OK0A 3VQ1C 3KWUA 3WL9B 1NZRA 4AQ1C 5HXMA 2XN1A 1EUTA 4RGOL 1KDJA 4BYHA 1U8LA 1SJHA 4U3CA 5CZVH 5E6IC 4F5CE 5L2KD 4R90H 4JO1L 4QGYA 2NY5C 4Y4KB 3HAEA 1WF5A 4UM8B 5LGHL 2FWUA 5FW6A 3AWGA 4TVPH 4W4OC 1B2YA 1CICC 1P4UA 1U93A 4GQRA 4ABUA 1QR1B 5C07E 2FR4A 1HHKB 3QFGA 1A7BA 1FVEB 5IKCA 1MAKA 3U2SA 1AHMA 4JM2F 4WVRA 3B83A 3QJZA 1N59B 1HESA 3ECQA 1F90H 3HB3C 4NKMA 4PJ5E 5IHLB 4I88A 4MAUH 2H6PB 3Q7JA 4IIQC 4PJEE 4DIXA 1P1VA 4BZYA 3CFUA 2BC4B 4N2KA 3TX4A 4X2UA 3S8FB 4S1DD 1MHCB 4KAQL 3VWJD 4OZHE 4JFFE 3QO0A 4NQQA 3NN8B 1T80A 5IJDC 5KBNC 4KVNH 5KJRH 3FF7A 1ZIAA 3P3TA 2DN7A 2AXWA 3FOLA 4QRPD 2ZP8A 2XG4B 3FPXA 1YAIA 3MLZH 1SVZA 4NCC2 4OFYD 3EJPA 1T5KA 3P2DA 4BFBD 5F88B 2CG9X 4XO5A 5J9PB 5K9JH 5F1KC 1MG2C 3V0EA 1YEDA 1UXSB 3O3AB 3GSRA 5B7FA 2AJXL 4RDQF 4Y2DC 1DBBH 4NQSA 4Z3IA 2WWOA 2DQHH 1E5BA 1LK2B 3CAFA 3ULUL 1CZ8H 5H2BB 4ZUUB 3A22A 4F7MA 1UWYA 1AQKH 5AW6B 3L3GB 4QHNA 2WYTA 4F2ME 1Q9OB 3ELAT 3QXDB 1EDYA 4HUXB 4KMLB 2X10A 4GRWE 2Q76B 2EXWD 4OF6A 1COBA 3WEBA 2BNRD 1W91A 4QRQA 1BXXA 3WBDA 5C09B 4HULB 2R23B 1DUYB 2ZQKA 3EKCA 4XI5C 4BQ8A 4MJHA 3UTSD 5J4MA 1RUML 1SUHA 2AEQH 3D51A 2A38A 4U1KA 1XGUA 2WZ5A 1T6BX 4I3RL 1KEML 1CDYA 1BX2A 3MJWA 2P24A 3WJMB 4WKZB 3MU3A 2CJSA 1DHKA 1FBIH 3AM8A 1G7PB 3DJTA 3MJ8B 2AJSL 4JHAL 4AG4L 4GIPD 2Y06H 4OJDH 5F7HA 3HHSB 3T77A 1NIFA 2ZG3A 5PAZA 4Z9KB 3RX5A 3S98A 4BFGA 3K2UL 3KBEA 2YPLE 4W9HC 2QFPA 2ZYRA 2ICES 3QPKA 4GKZB 3I50H 2XETA 2R0KH 4N6QA 4Y4FC 4A1RA 5CUSH 3AREC 4NUPA 4LK4A 3T4AA 4N2AA 1TTGA 5C0DB 3C87A 4LB8A 4WUUB 4FXKA 2DQFA 3WI9A 4DP1X 5EIQA 1OF2B 3PHOA 1IT9H 3TNMB 3N85H 4B60A 2LU7A 3A47A 1YECL 4ZFZB 5KTEL 1EEQA 5EO1A 2D03H 3FQRB 4N0UE 4NWUL 2FLMA 4F57H 1JPGA 1LGVA 2JF1A 5AUMB 3Q1EA 3ZTEA 2WQ8A 3FUMA 4U1GC 4HT1L 1TETL 3KZ8A 5KSBE 4MJIB 2ZAGA 1JYVA 4BFIB 3NCYS 2W91A 4MDRA 4MD4B 4NT6B 1SYSB 3GM8A 1FFPB 2O6PA 1ID2A 2YLKA 2ESVB 2JWYA 4NNYA 2QKSA 4NKDA 1BEYH 4APXB 5B4MD 3BKCL 5T3XD 3BUIA 3V6BR 2WKOF 1GZHC 3LKNB 2ZONA 5C0BB 1OT1A 2COVD 5CJOH 3AT9A 5DF0A 3X11A 4UM9A 4LOFA 4BFJA 2WVTA 4ZAKA 3ZE0E 5BJTB 4UQ3B 4KVCH 2IDCA 1VLXA 4E9QA 1TF4A 3ULVL 3H2QA 4O2CA 2VMJA 4K94L 4LAQL 1J8RA 4J3OH 2H1XA 3FQUB 4DZ8A 2NT1A 3ISRA 1K6QH 3MLVL 4KUZH 3ZE1F 3MLTA 4HPOL 4EQ2A 5AB1A 4Y8AA 2G60L 5HYFA 5DURD 1NMBL 3PJNA 4NUJB 4YPGA 4L3EB 2HFGL 2WUBH 4G8EB 1J7VR 3FOMB 1JUFA 5LJYH 3V4UH 2EYRA 1XGPA 2BH0A 4N3TA 3MOBH 2UY6B 3QIUB 4X5PA 2JJSC 1NPUA 1R3HA 1BYNA 4LL9A 4JAMB 1P7HL 1UEYA 3FHAA 4WNQA 3RIAK 4Y5XC 1VGKB 3PQYE 5GS1B 1O9ZA 5EEXA 1OALA 2YAOA 1PG7L 4JG9A 4WI0B 5H35A 5DJAA 5AOKA 3QDAA 1PIFA 1RMFL 2J8UF 4J3OF 5C8JA 2VCOA 4OAWB 4F8PA 1GAFH 1GA2A 2FX7L 3KDMB 2HRGA 2EADA 4M3JA 3RB5A 4HW6A 3QJTB 1BIHA 2W65A 3KLHC 5FWQA 3H9ZA 4LLUB 1UA6H 2CJTA 2CM6A 3A4FA 2VDQB 5ICZB 5LG6A 5CCHE 4U1LA 2BX5A 3C60B 1LLAA 1ZHBB 3C9NB 3TJHC 3HS0A 4ONHA 3H0TA 4AGPA 2O5XH 3D0AA 2ZICA 1WEJH 3D2UB 4Y7MA 4CW1B 1RL1A 5DGRA 1KTLA 4HBCH 1UB5B 2J57A 3DPDA 1L0QA 2ALWA 4IOFC 1QLEH 3RTQA 2ZCHH 4HJGB 3ZR5A 1UD5A 4KI5D 5LGJA 5IJKC 1C5DB 3RIAF 1R24B 1JF6A 2QEJA 3AXHA 3KPQB 5I1DB 5IR1B 1FZOB 2G75B 5AW3B 1BZQK 2IWEA 1OO2A 3K0WA 1I7ZA 3BW9A 3FFOA 4PLOB 1DBAH 2NTFB 2NUTB 4NPJA 5IQOA 6PAZA 3FTGA 5JXEC 1A4KA 3WENA 1NIBA 1JDAA 1AGCB 4NOFA 5JW4N 2F5BL 2WY3B 4Z7VE 5D72H 4KZCA 4HCIA 4P4RA 1UWGL 3EGSB 4FZ8H 3GPEA 2J56A 1QEWB 3OAUL 3DX9B 5AZ2L 4H26B 3P4MA 3BVWA 3FB7B 2X1QA 3U25A 4A66A 3GJFH 2CBOA 5EG6C 3LY6A 4F58H 4FNRA 3AT8A 3QR2A 1N64H 3BLBA 2YZ1A 1FCGA 3FMGH 1WTLA 4KVPA 4YHIA 4J3XA 4NZJA 1IBBA 3LDBC 3SQBB 3BMWA 2DI7A 4MA1B 1HHIB 2DJUA 5HYQA 4G9FB 2FE0A 3OKEA 3MN8A 1YQ2A 2A6IB 3RURA 1QHOA 2O4EA 3ARUA 3PXHA 1UADC 5E8PA 3TEYA 4ZMPA 5SWZB 3K0YA 5KZCD 4MHHG 5IMOB 3KM1A 2F1EA 3BP4B 1G9MH 3L6FB 2PW2A 3JWDH 4ZMYA 4NNXB 1YN7A 5FK9B 4AYEC 4WNJA 1A6VH 2EEXA 2R69A 3DNKA 3MLWH 1L9MA 4TSAH 4YDJB 5JMRA 3L54A 3MFFB 4LVOB 1YUHB 3MBWA 1GRWA 1MW0A 1YUKB 4N6RB 1NFDA 3T8VA 3QQDB 2K1MA 1GZQA 4IRZA 4YDIH 4GBXB 3DUUA 5IW1B 3OXRB 2C9PA 3BD3A 4WF7A 1FVCB 3OGCB 1AGDB 4OJYA 5MERA 2B2XH 5DD0L 2I60L 2DQUL 1I8LA 2WHVA 3PHQA 3AUVA 3QXAB 5EOQH 3F7YB 3VFRA 1H9DA 3G9VA 4FI6A 3C6LC 2KLSA 4QHMA 6FABL 3CMOH 1EWHA 1FZKA 2YK1L 5EN2B 5T8IA 3F84A 4NFDA 3CPLA 5JUEL 1CU4H 1JAEA 1LEIA 3MA7B 3APDA 3A3YB 3FONA 2CKBA 2F53A 1D7CA 3OG6B 1E6JL 3VXTA 2M83A 3RFRA 3CDZB 2O26U 3QNXB 1JGDB 2DIEA 2C3WA 4O02B 4XP1H 4CU7A 4MZIA 5HHOE 3D18B 3O6FD 2Y1VA 3FFDB 3BAEL 2V5YA 1RZPA 3EH1A 5D1QC 5IK3A 3QUXA 1XFPA 5IVZB 1INEH 1WCQA 1FGVL 3ASOB 5DFVD 5I18H 5IHHA 1MPAH 4IJTA 2UWEA 1AYRA 3RUGB 2GY7B 3KNBB 1CE1L 4GSDL 1ZT7A 3I75B 2P49B 5E9DB 4HJJL 3VI4F 2FEDD 3ZYOA 3VRJB 1E67A 3UP6A 4FQXB 2CAKA 2HLFD 4KROD 1D5XA 2P44B 3QEGL 3IEAA 4TPRH 5A16B 2GIYA 5TFSH 3QP3A 4GKNB 3BEWA 4OCRL 1VENA 2CCVA 1OM3H 4PJXA 2ZSWA 3B3IA 3ILQC 3O3UN 3V4PB 5IQ9B 2QADC 3U4EA 4HUUB 5DVPA 5LNGA 4EI5D 1BD2B 2CMRL 1HVXA 2AGJH 5CD3B 1SN0A 3G6JA 3PP3H 2GITA 3LSOA 3VSTA 1P5VA 2RALA 2Z0BA 2HVJA 3P9LB 2H8PB 2WXKA 4JY4B 4LRNL 3VW3L 1DQQB 2BRRL 3GI9H 1EEYA 5ACLA 1WP6A 1CT8B 2Z8WC 2IAMA 3FYEB 1E2WA 1MVUA 5T1KD 1TLKA 1KB5B 5C71A 1BJ8A 2PWFA 1Q1PA 2BIQA 1TLMA 5D8JL 2ADFH 3T6VA 3TEUA 4DO6A 1T7ZA 1ZLUH 5AALA 3QZNA 5SWSA 1TEFA 2XRAL 3D05A 1VEMA 3HC0A 4FG4A 5FAAA 2AV7B 4LKXA 3A6CH 5KN5A 1ZLSH 2UZXA 2XKSA 4OBSA 5DJYA 3PJSB 1HEZA 2JKTM 1T1WB 4OJCA 5HGGS 1L6PA 1EAQA 3BAKA 2E56A 3Q9PA 2DTML 3QPXH 3BI9X 4PSRA 4NRZA 2NUPA 2ZOKA 2PW1B 4MJ4A 2BP8A 3MRLA 5KUKA 2B9AA 5KJ4A 2XKNB 2MTAA 4OKVB 4P5MA 3WLWC 1HFUA 3TJEH 4AKOA 4F7PB 4P9ML 2BFVL 5I1CH 3QWRD 3RVVC 2E27L 3CVDA 1NC2B 2VN4A 3BGFC 4FFZH 4A6YB 4KQ4L 3AVEA 3RIFF 1I7RB 2N7BA 4ZT1A 5FOJA 3KXFD 3LZFL 1D5ZB 1QFUL 2Z31C 3EFOB 5DD6A