4OJEH

Crystal structure of a c-terminally truncated trimeric ectodomain of the c. elegans fusion protein eff-1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
489
structure length
457
Chain Sequence
RAEPPHCSKTPIVRAQTSQNAMSRGMQMQFSIGLHTAVCFRLYLLHTIRLEKLEHHHPITQRYTFGIPEVHASCICECDATSSTCTAESHQFTACPESDKSDETSSCYRTFFPNQTPIGCSEDDIPKLCCDVRFKPYKNMTFLAVKLEQPTTYATFVYAAYDFVNGYWVEKDKTKIRSQLDGGTQDRHLDQKRRISLAVTAGGRASHQLETGMYFSRTSNGGETEELRMQPLNEITDNNFDRLGWYRMDDSGHFHVNNGVVKMDDIHKAKVKNCKEQTYKSILSANHYMPGHFNLTRPLEVIKPWIQSARIFDSSLRQAVVTHAEGTNLQISIHLESQNLVFFHNASRIRDFSGSIIVDSKSNRLFNLTVYEASGKIDGSVKMSTGFGSDTIHTFTAYVSDLHASNRSMIIPLPAIVGQGARAICLRADSMADIDKICHVIEYFESPLFEDDGWSHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of eukaryotic cell-cell fusion
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Membrane protein
molecule keywords EFF-1A
total genus 93
structure length 457
sequence length 489
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ojeH03
2.60.98.60 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein; domain 1 4ojeH01
4OJDH 4OJCA 4OJEH
chains in the Genus database with same CATH superfamily
4AX3A 6FABH 5EZOH 3VGAC 5B7MA 1FFOB 4OGQC 4Q9CA 4YHMH 1WBXA 3RX8A 1EAPB 3CU1A 5EO1A 3UERA 1N3NA 4P49A 2W8CA 3MBEA 4LSRH 5FOBB 1PBYA 1WFIA 1TKWA 4L18A 3GINA 2WQXA 2WYTA 2XTSA 4KHXL 4Y89A 1J1OL 2DDQH 4PJFE 2K3TA 4XCFH 4BSJA 2YAOA 3NJVA 2OMWB 4ZMQA 1A2YB 4PJDF 4R5XA 1TVHA 4GQPH 1CE1H 2BVQB 3MR9B 4G5ZL 5LNGA 1NCGA 1KF9B 3QIUA 2BS9A 4EZKA 5I19H 5FO8B 4YHYB 4R97C 3O6FC 4ALAL 5AFAA 1NFDE 1GAFH 5GZND 2VLJD 2BVTA 2DYSB 3MGTB 5EBWA 4A39A 3KPRE 1BAFL 5C0DA 3BH4A 4GP8B 4L4VD 2BOBB 2BVEA 1BF5A 4F9PA 2F1BA 2PCPA 4R7XA 2OI9C 1E8XA 5FW8A 1BAGA 2PXYD 4K7PX 3FCUB 4ZFOB 3OQ3B 5BRZA 1P7HL 1U8MB 3BKYL 1HCYA 1XIWD 3CZEA 1KEML 2OMXA 1MWAB 4MLIA 4GBXA 4OZFB 5DJ2B 2AV1A 2NUTB 2K78A 3T65B 1U8JA 2CRZA 3WKPA 4BH8B 3GSWB 3VWKD 3L3IB 3IAGC 2A1WL 4XO5A 3KCWA 3TP4A 4RZCB 2D9QB 1IGYB 2FYVA 4H8QA 4BQ8A 4GMTL 2ZKXA 4KRNA 2XIBA 4NQDA 4X6FB 1KENH 1HKFA 3MCKA 3C5XA 1LO4H 3QUML 2VDOH 3FTXA 4JFOB 2KZBA 1D9KC 2K1MA 4FD0A 1IC5H 4P9ML 3VI3F 4XNQA 1WGVA 2VN6A 2C3WA 1I9EA 3ASOB 4XMZA 3ROLA 1I8AA 4EEEA 3QRGH 3VW3H 1NH6A 3QWNA 1Q9KA 1RUQH 1JK8A 4P3DB 2EACA 2X2HA 2HTKD 2MHAB 2OTUA 4LFHD 4R8WL 2ESVB 3WSQL 2BINA 1PG7L 1PD6A 1W15A 2WXOA 3ZHFA 1H3PL 4TVSa 2R29L 1UOVA 2EDXA 1FO0L 2VC2H 5IVZA 3OAUH 1RFDH 5C6WH 1MJ8H 3MROB 1N70A 1XR9B 3TBSB 1DVFB 1I7RB 2AERT 2XDHA 4BK5A 1V3LA 2BS8A 2DLIA 2X9XA 4LB8A 3KS0H 4FZEH 5ESAB 4B9YA 6CGTA 3N41F 4FLHA 4Z3EA 2JWYA 2PR4H 1HI6A 3HG4A 4NUGL 4YPGA 1FVEB 3P0VH 2FTAA 2OCCB 2B5IC 2WHVA 2Z31C 3B37A 3D08A 2W9EH 4NO2B 3CH1A 5F7DB 5ISZE 4PLJD 4LLMB 4PJGA 4TNGA 3WUWA 1BVKA 3WDIA 4PRAA 2YZ8A 5DEZA 4P4KC 1DO6A 4NIYE 1SNRA 2JFCA 2XN0A 3APNA 4HIEA 5D7LD 4DVRH 1OAUL 3CHRA 3SKJH 2YKLH 1HILB 4FNPA 5GGVH 4N87A 5CNHA 1EDHA 4R4ND 1F1DA 4GPVA 3HNVL 1TT6A 1LP9A 1SN5A 1YYML 2CR0A 3HN5A 3GK8L 4Y16D 1MJJA 1QPXA 1XGRA 4JFDD 5F2FA 1KB3A 1QWHA 5CILH 3DUHA 2YFNA 2DQGL 2NMSA 4KJQD 4F37K 2RTTA 2TAAA 5DDHA 2DQTH 2V5SA 4G7RB 1E8ZA 1KZYA 3E6HB 4Q97A 3H1ZA 2V2WA 1EGJA 2V9UA 1LO0L 2YPLE 4Q0XL 2X4SB 2DBJA 5F1OB 3ZDWA 2FX9L 3AWFA 3M1OA 1ASPA 1Q9WB 1FNGB 3SPIA 1P1ZA 4U1KA 2JKIS 4ADIA 2XZAH 5EH1A 3UADA 4EIBA 4DEPC 3GJEA 4YGVB 1KYUA 1MXDA 3EO9H 4FJZA 4LOVA 3JV4B 5DZLA 5J8OA 1M05A 3CZNA 3JQOB 5JPMC 2KKQA 3AW5A 3G6DH 3W38A 3QDMD 2BERA 1IFGA 3ZVVA 3O9WB 2BIOA 2G60L 3VGDA 3ZTCC 1NIFA 1MFBL 3BFOA 4PREA 4P3CH 3CPLB 1QSED 3BLPX 4TNWF 4YAQB 1LO4L 3QUMH 4A67A 1F42A 5IHLB 1BM7A 4QPEA 4LSDA 4NC1C 2K6WA 1HXKA 4UQDA 1D5XB 4H1LB 1ESOA 4PGBB 5I24A 3QJSB 2NYKA 4LPYA 3D12B 1P2CA 1I8MB 5F7UA 4J6IA 1G1KA 3AGVA 4P2QB 1MREL 1IGIH 2P5PA 4HJ0D 2YA2A 4AQ1B 4I2XA 4ZJ9A 2O72A 3IFNH 3LKSA 2EIDA 2FO4B 4JPIB 2YAFA 4KX9A 5CD5D 4U1NA 4W6WB 2VDLH 1QQDB 3K2IA 2PXYB 1E5ZA 2VXQA 4JN2A 4NWUH 2X44D 3NDZE 1UWXH 4JFXB 1JD7A 4C56D 2P5EA 1YEGL 5E9AA 1UB5B 1NIDA 2R4RH 3DLQR 3HKZA 2LVCA 2PPCA 3MUGB 4MB1A 4M5YL 3QWQB 4YDIH 1TJGH 4LLQA 3RL2B 1Q0EA 2Y36H 2P8LA 3V6BR 5F44A 1DJZA 4AWJC 1E67A 5JLZA 5FB8A 4WHDA 3L1GA 5JIHA 1DFBH 2BVUA 1VKXA 2CM6A 2DWXA 3BPLB 4AM0A 1U36A 2PO6C 3FTGA 3GXDA 4ZODA 1SVBA 1NEUA 1UCBL 1WPCA 5EU5B 3GUTB 3VD4A 4ALAH 5I1JL 3LKNB 1NFDA 1LWRA 2EUZA 4KRPB 2JCCB 5AZ2L 2WN2A 2ZJSL 1XR9A 1KV3A 3II1A 4F24A 4QO1A 2A74B 5D6DA 5EO9A 3QQ3B 3GQFA 3BH9B 3RKDC 1BGXL 2B16A 5E00A 5FYJE 2YAPA 3NJXA 3QNYB 2MMXA 5DEGA 1I82A 4ZAKD 1UWEL 1N19A 2FUQA 4XGZB 3WFBL 2WW8A 4Y5YC 5BNXD 2JJSA 3PQYB 3VG0L 5JHDE 4JLRA 4OJDH 1UZ8A 2YBRA 2J6EH 5CXPA 5IMOB 4H8UA 5J1TC 2CUHA 4FE9A 1Q38A 3QXWA 4KFMA 3B2MA 3GXMA 1GPOH 2X2UA 3D4YA 4ADGA 2BWQA 3B2VL 1MRFH 3K2KA 4PRID 4NJ9H 4NO3B 4XOAA 2FWLB 5DHVA 5IJVB 2R1XB 4M1GH 1MFDL 4K7PH 4JQVA 4YSEA 4TF4A 2EDFA 1YUHA 4GKSA 5EU6A 1YNKL 3WS3A 2XIIA 2G2RA 4NPYA 3BQUA 3NA4A 2XVKA 3QZOA 1UB6B 5AKSA 3P1VA 4ZXBD 2IFFH 3KPTA 3LKPB 4LPUA 1WH0A 4JJOA 2LU4A 1ACXA 4Y4FB 1JJUA 3WS6C 2M83A 3DO3A 3T1FA 3MV9E 5A7BA 1TYJA 2JI2A 3KG5A 2VQ1B 3RTLA 3CHPA 3F64A 3C6SA 3IGAA 4RGNB 5EPMB 1U3YA 1CXEA 2FNWA 4XN1A 5AW5B 3L3OC 4P23B 5IV2B 5ICXA 1Q1JH 2NY4C 1FNHA 3GXIA 1G9ML 5FGSA 3NSYA 2O6CA 2Z1PA 2NY2B 3KPOB 1NAMA 4WSGA 2VXUL 2FSEA 5LXVA 5C70A 2KDGA 2O93L 2BY0A 3QHTC 2EE9A 3WLBA 4HPHA 3INUL 2AJZB 4EI5C 1ETA1 2XI9A 4GY4A 4CAGA 4KH9A 3QJTB 1PW3A 3BXNA 1OLZA 4N0UE 2ZX6A 4NWUL 3FB8A 5FHBL 3ULUF 4AW4A 3W11D 1EJ8A 1UOKA 2VH5H 3ESOA 1JN6B 4AYBA 3GS7A 1G7HA 5CSGA 4BYHA 3TZVC 4PU2A 3UTTA 1FZJB 1SF3A 4NX0A 4KVPA 5FYLL 3T6VA 1VENA 2MFNA 1G7LB 4MAZA 4G9FA 1CICC 1CYXA 4Z7QB 3AS3A 3WE1A 3UTQA 4BKTC 3WGVB 3HMWH 3R7RA 3NJIA 1NGPH 2XZCH 1BQHG 4KI5E 3BISA 4JKPH 3F7YA 4JKKA 3SE9L 2JCCF 1EANA 4LCWB 1IKFH 4KI1A 4M3JA 4IIZA 4MMZB 5FCUH 2WZ0A 2VERN 1NCJA 4L1TA 1KYFA 5I1JH 2GAZB 4OSUL 1BHGA 3HBPA 3S96B 3BJ91 4S0TD 4OFDA 5IESH 4P99A 2NY5C 1WRFA 3C5ZD 5ESVB 1D5BB 3N40F 2EE3A 5GZOC 1J8SA 4YHNB 2IH1A 3VGGA 5A1AA 2X53A 3L3DA 4XWGH 4JO1H 1QFWH 3CLEL 5G4OA 1RUPH 1ZRUA 2DF3A 2JH2A 2P7TA 3GM8A 4L3EA 4OKVB 2BPBA 3HC4H 3QP3A 3A6BL 4GQ9L 3H2WA 3V0WL 3NJFA 3ARVA 4GAJH 4HKBB 5LNDA 1UJ3C 4ZMYA 5E08L 4NZJA 5DO2C 1J0JA 3LRSB 5AD0A 1Q8MA 3FULA 4BCZA 4C47A 3AT0A 2XN9A 3KWTA 3VU1A 4ZFOA 1IE5A 4I9XA 3MRQB 2J2ZA 2UZYA 4W81A 4BELD 4F7KA 4WW2A 2FR4B 4I1NB 1I1AD 4AZ8B 4J4PD 5C0CD 1OHZA 2NY7H 1N8ZB 4OVVA 3ETSA 3MGOA 2YSTA 4CSZA 3IE4A 4DOHB 2EC8A 3DSNA 1AD0B 1G6RL 2EAEA 4UT6A 3O0LA 4L2YA 5KOMC 3VXNA 4F2MA 1MN4A 1EAJA 3GMMB 3QCUL 4MD5A 5F9OH 3TYGL 3IB4A 3D87B 3BZ5A 1SJHB 4JFOA 5HVGB 4KROB 2P5EE 2IDQA 4NDMA 3EYUH 3ZKNC 3RUGA 3QA3A 2FQGA 3BKCL 3VFOA 3DA0A 1F58H 1UZ6E 4YQXH 4TRPH 3T0EE 4PHXA 3NEEA 3ARGD 3RWGB 1YRKA 5E6YA 4JRFA 3CGTA 2YAQA 4AVKA 4DKAA 3ZE0E 4AL8C 1G7PB 1TNNA 1A9EA 2HVJB 1TJMA 3AABA 5SWSB 2APXA 4L1DA 4I3SH 1L7TH 1SN0A 3LQAH 5DRXA 4A2DA 3QIBC 3K8MA 3AM8A 4Y4KB 3RVVD 2CCLA 2J4WL 3CBKB 4UOW1 3HFFA 1XF3B 4EZJA 1FWXA 2DLHA 1DN2A 2YUWA 4ZOBA 4K71B 3NCCB 1MFCH 4P2YA 1B6UA 1NPUA 2H41A 2HVKB 3PAUA 3BZEA 4G42A 1SOKA 2AQ1A 2BZCA 1OB1B 3K2UL 1HC1A 3EJYD 1MFNA 3QR1A 3TIDA 1ZHBB 4ZD3L 1JTOA 2EKJA 4NC0B 1VZHA 4EDWH 2RCSH 4PRAB 4Z3IA 3VFRA 3NGBB 4N24A 2X40A 1ZLWK 2OSLA 4K94L 5D6DC 1G9MC 2P5WE 3DV4A 3RJQB 5I15H 1EXHA 2ARJA 4M93B 3B4NA 5ADPL 5K69A 2BVQA 3MR9A 2RACA 4Y88A 2IGLA 4XN7A 5LN4A 5JA9A 1GZPA 4XOBA 4FQJL 1F4YL 2WM0A 2X0UA 4D7PA 2NNRA 5GSVA 4RA0C 1NC4B 2F19L 1OY3B 1JZDC 5GS2D 1PY4A 3VD0A 2PR9A 3T6QC 4PJHB 3IGUA 3KYNB 3QIWA 5IW1B 2G5RA 1TSRA 5IB4B 1JNLL 3IDGB 4ODSH 2AJZA 4XN8A 5DK0B 4AQEB 2IFFL 3RI5F 4PGDA 5EZLB 1MWAA 2R4SH 2GSIB 3NGBC 1ZHNA 2P5WA 2ADYA 4B6ZA 4P2OD 1QA9B 5E6IA 3LQZA 5MEQB 2YAHA 4FLSA 3BVNB 1LWHA 2O6EA 1LP9E 4PRPD 3TS8A 2BOBA 1KGYE 4XODA 3SBQA 4FADA 3IT8D 4HT1L 3NACL 4JAMB 3PWLB 1NUNB 3X12A 3EH5B 4JRYB 1FGNL 2AI0H 5KSUA 1ZCRA 4QRBA 5DD1H 3NABL 3HTLX 5KVDH 3NFSH 3BW9B 1ZT7B 3C9NA 3JWNH 4OCXH 3NIDF 4Z7WA 3SGEI 1HN1A 2JKLA 3CFJA 3QH3B 4M6NH 5DC0A 3IVKA 3SJVB 3EFOB 2EUXA 4MGXA 2A0LD 2GSIA 4MB4A 5DF0A 1MCJA 2AXWA 2AQSA 4OAWB 5I1DA 5F9OL 3KYMA 4WFGE 2XJLA 1HINH 1HQRB 2WLJA 3DOIA 3CLFH 5K5YA 2HJLA 4NO5B 3WMPA 3F5WB 1GL4B 3HA0A 2OMTA 5F7YC 4KROC 2HXAA 4MCZB 4WDIB 3TWCH 1ZKAA 3FDWA 4M5ZL 5DJ6B 4G8GE 3T9WA 4LCYA 5G55A 3VYPA 1LEIB 2L7JA 4LHQB 3V9CA 3ES6B 2AZUA 1LEGB 3WIIL 3MV11 1IKFL 4H25B 4A6YB 5KSAB 4U0RC 2VXSH 3NH7H 4BQBA 2AW2A 25C8L 2VR4A 3BW9A 4X83A 5EB9A 3DVGA 4A6YL 4G59C 1YEFL 1GY1A 2BW5A 2DD8H 1E5AA 5EC2A 1VGEL 3PDDA 2GW5A 4AJWA 1KEMH 2YRLA 4AUUA 5BO1L 4G5AA 5DJAA 1LK2B 2Q7NA 1UJ3B 1WUZA 4NRZA 4OM0H 1Z5LB 1FPTH 3MLSH 3GRWL 1LE9B 4UIMA 2A6IA 3HJ0A 4DW2H 1WZAA 2PYED 5FYJL 2H0PA 5B1JC 3LEXA 3E9UA 1LGVA 1F02I 4NQCD 3DYMA 3DX1A 2CLVB 5AUMB 4IBWA 1FA4A 2ZG3A 4XRCB 5H37H 4AL8L 3EGDB 2EICA 1FQ9C 3QA3B 3SSGA 2VWEC 2EXWD 4AT6A 1PF3A 1DBKH 1WGOA 4KHXH 3DX7A 3PWPE 2R0ZH 3TEZA 3L1OL 1B6DA 1K5WA 1H0DB 4YXLL 4MMZC 3V6ZA 1FIGL 1MZZA 2EIJB 3MLXH 1OARL 5JO5B 5LBSA 3S34H 4PY8I 2WBWB 3SGKA 5FO7B 2IPKA 1CICB 4LVOB 4JUTA 4YSPA 2ZZUT 5AALA 4LBEB 2XWXA 2BVOB 3MLRH 4O2FA 4LIQL 1J12A 4NQDE 1ACZA 3NACH 3DX8A 5CR1A 2YSSB 4RMUA 2HVKA 1VA9A 1U8QA 4K94C 4EF3A 1YEWA 2IDTA 1Z2KA 5J4MA 4HWBL 4JUSA 5C2BL 5GHWL 3SDYH 1EHKB 1VFMA 3O45A 3TCLB 4ZNEA 4RESB 5TF1L 4E0RA 2XNAB 3T1WA 5E9DD 4F93B 2UZYB 2J2ZB 2R2BB 4PJ8A 5EIIG 2BS71 2IXQB 4PCSA 4WHTA 2CJUH 3SQBA 4EI5B 2J8OA 2ODHA 4RSYA 3U25A 1BX2A 1D9KA 2KH2B 4ZW3A 3SZ6A 1JP5A 3LNIA 1MRDH 1ORQB 1U8PB 1UT1A 1QKZL 2M1KA 2O61A 4AJ0A 1AMYA 2YRZA 3FZUC 3RGHA 5J89A 3FFDB 3DX4A 2NY1D 4P23C 1CVSC 3FT1A 5HHOA 1QRND 2ADIB 2CDGA 1K8IB 1A7BA 1SJHA 1UC6A 4RGNC 1X5AA 5EG6C 4QRPD 4PJDB 5AW6B 1LDSA 2Q0ZX 3GHBH 2VL5B 2RCSL 1N5YL 1H19A 2R2BA 4O4YH 3MNVB 4MQSB 4Z5RA 1T3FB 3QJHB 4U1NB 4Y4FC 3FU9A 3H9SB 4LAQH 5FIEA 1UCBH 3RG1C 2H6OA 1RP8A 3VD1A 1CN4A 3VB8A 2I60H 4NGHL 1UD2A 2WGXA 4AIXA 5CM1A 3MREB 5JYLA 3VXME 2HYMA 1F3JB 2IQ9L 1C08A 4ZS6D 3VXUA 2PR4L 15C8L 1B4TA 3ARFA 5IVXF 3NIFE 4ZW7A 5C07D 5BUAA 5FECA 4KMLB 2BNRD 5D7SH 2APFA 1FHGA 3MU3A 5D4IA 2ADJA 2WWOA 4JB9H 4Y1SA 3T2QA 3VXMB 1VACB 3V0VB 2NXZD 3RIFF 1EQWA 5INCB 3U36B 2YD2A 5CGBA 3BAKA 4HIPA 2WLLA 3VCLB 4IBZA 1NINA 1C8PA 4LP8A 1Z3RA 1QSEB 1G6RB 2WMPA 4XCYB 5E51A 1ZA3A 2A74C 4NBYB 4UM9D 4R7NA 2H0JA 4ISVB 1NGZA 2YPLD 5FYLD 2Q1EA 4GG6E 4TVUA 1OP5K 3NK3A 1RUKH 4M6AA 3G6JA 4H40A 3P40A 3SGDH 3MLUL 2EE6A 1S7SA 3ZTNL 2DM3A 3QR2A 3BPLC 4UIMB 1B3JA 2VXVH 1BOGB 4P2RA 3T4AB 3QWRD 5EFIA 4HGWA 4JFUA 4JVWA 4NUJA 1C1EH 1TLKA 4NLHA 2G3ZA 1PAMA 4DGIH 3MRMB 5CSBA 3UYRL 1V54B 1CLCA 2VQ1A 1PU0A 1CFQA 5B8CB 3E9TA 4XNYL 4YVUA 4DK6A 5KYWB 2OTWA 4QGYA 1BMWA 1M56B 2YOAA 4F8PA 4U1MB 4YHOL 4IJ3C 2O30A 2PXYC 3PIQA 4XTRC 1UGKA 1GOFA 2IV8A 4NPKA 4F58L 5DYFA 2AJYH 2IBBA 1FBIH 1AP2B 4AQ1C 5CGYC 4P3CL 3S5LA 2E27L 4JKLA 1SXZA 2BC4B 2PYFA 3DMMB 4FEMA 4TOYL 5JIDA 3V5DA 4WNQB 2EZ0C 1QSFE 3M7FB 2AXGB 2EJ1A 3J7HA 3OBAA 3D1MC 4KI5C 4MKTA 4DPCX 4P05A 4HETA 5F7WC 2WVUA 1DJSA 1CFMA 1UM5L 2DLFL 2BFGA 2AZAA 3FT4A 2AV7B 5ISZA 3OXSA 4XBGB 4Y9EA 1T0OA 3VXPA 4XO4A 3P4NA 2IDCA 4WEMB 1WSST 3MUHL 3QDJD 1CLYL 2VZVA 5I6PA 1IQDA 5INDB 4X7DC 4MZ2A 3ZQ9A 5EUKB 2Y1AA 1BLNB 1FAIH 1KYAA 4N2LA 3HRZA 4LRIA 1CICA 4HYTB 1J7VR 5F1NA 3EBHA 5JXEA 4DEPB 2R4RL 4PTUB 1OAQL 3WGUB 3WMQA 4EO5A 2HT4D 4NN6B 2W38A 4PM1A 5AL0A 4X98A 4OI7A 2HB0A 4O02B 1CG9A 1RZ7H 4JZOA 4APQA 1SDAB 1Q72H 2BLFA 4N26A 1S7XB 2MQ0A 5AB0A 3OTTA 1I8KB 3PWPD 4KNQA 2B4CH 1ZHNB 3HFML 4AQ8A 2UVFA 4HJJH 4D3CL 9PCYA 1ZHLB 3RGBA 2CGZA 5JIMA 5GRWA 2E75C 1AZRA 5GGVY 2KZWA 3KD4A 4QRPA 3X1GA 2WGNB 4KTEL 2QV2A 2HKFH 3FQWB 1JGDB 1FAKT 1KGCE 4YSRA 5M7QA 1M3IA 4FERA 3CUPA 4XXDA 5GSVB 5IF0A 4ZUWA 5AYUL 5I26A 1K4CB 2J8UB 3VE0B 2VR3A 5FUZH 4Z3TA 1OK0A 1BD2A 1JGEB 1YEIL 4FQQB 4N25A 2QQKL 5JW4N 4L29B 3TO2B 3VTMA 4PJDA 3U0PB 2MPAL 1AYRA 3MA7A 1MCBA 3FO1A 4WFFE 3NEOA 5IBTH 1WD8A 1XTMA 4J6RL 4M4PA 5C07A 3WY3A 4P4KB 4NENB 3AQDA 4HEME 3H9SA 2JQAA 1SHWA 1Q9LB 3V6FB 3VSQA 5J6GA 3T0EC 1O6SB 3RIAF 2B5IB 2QVFB 1EVUA 1JHTA 1UACH 1UH4A 2F7PA 4HIXL 4QTHA 2AJSH 5HGBA 2IMMA 3DO4A 2VLRE 4JREC 3QYNA 1E5CA 3O6KH 2O5ZH 4LLQB 1J9CT 1ZA3B 2XTJC 1DVFC 1H15A 4Q6YA 5CEXA 2HVBA 1E6OH 3P73A 3RPKA 1SHMA 3KVDD 1YEKH 3MACH 3P9MA 1RURL 1LO2H 4X99B 3ZOAA 4NO0A 2XG5A 1KNOB 2WIIB 3TCTA 4AV5A 2XXGA 3K0WA 4Y9CA 1HCZA 1ZANH 4HGWB 4WRLA 3G08A 3OB0K 3L4UA 3ESNA 2XNAA 4K2UH 5LCVA 2DMGA 1SMOA 2VLJE 2CIKB 3RLSA 3BVVA 4ACPA 1NIBA 3N44F 2Z7UA 1S9WA 2X1OA 3QFJE 1YMHB 5LGJB 1MVYA 1TVBB 1JGVH 5KW9H 4JFPA 2J73A 1ZSHA 4FTVB 1WZ1H 4ELKA 2AK1H 3LN4A 4J3WA 4M8UA 1SYVB 3TVMA 1ILUA 4K9EC 3RKPA 5DJ0A 3T3PE 4F7PA 2PW2B 2XA8H 1AXSA 1BQRA 4PJAE 4AUJA 3BKCH 5DZOA 5AVTB 3KH3A 3H3KA 1EMTL 1PG7W 3CZLA 2P5WB 4FXGA 4FN0A 3O11B 1XCTA 4R26H 2CLZB 2HTLC 5TH2A 4FKHA 4WHYG 3ZHKA 1X4XA 1J1OH 2DDQL 4XCFL 3TGXA 2WLIB 1ZGLM 4DP8X 4MAUL 1Q72L 1KIRA 1Z9SB 4Z9KB 4HLEA 3O6FB 5CEZH 4HK0A 1J48A 2QPDB 4YHYC 4PIRF 1OTSD 4ABQA 5JW4R 5BVJB 4JFYA 3QHFH 5D4JA 1BVNP 1ZT7A 4LDCA 3LRGA 3WENA 3MV7B 3PUCA 4W9KC 2J8UF 3L3DB 3ZTJG 3U2JA 4BRVA 3V0FA 1HAUA 4DGIL 3DWTA 4DUXA 3SE4A 4HSCX 1KCUH 2DI9A 5FKPB 3FKUS 1T5XB 3R4RA 2J1XA 3BVNA 4HGMA 3X3GL 4OR1A 1MCDA 1MRCH 2QQQA 3SBWC 4HK3J 4RIRB 2VDRH 3ZY7A 1MCKA 3OJVC 2ZSVB 2PTTB 2F5AL 1YPZF 2X70A 3BP6B 1JZ7A 4F2ME 1JFQH 3TNMA 4PJHE 5KVFH 3UTQB 3ECVA 1B90A 3ILDA 3KPSA 3FN0L 3VXQB 1A6VL 4QKXB 4JFQB 4UV7H 2DLEA 4QRRD 4ORZC 1RK1A 1ML0A 4KMTL 3SCMA 1ZK9A 2BIPA 5I76B 1AR1B 5A2BA 2ED7A 5FR3A 2HJLB 4NO5A 3ZO9A 1OAUH 4DZBA 3OC8A 4PSPA 2ZSVA 2G5UA 2BVPA 3OB0H 4N6QA 3SYAA 3DOHA 4UTBA 3N44B 4NQXB 4M9OA 3VMOA 4G9FD 2ZOKA 2FEEL 4JQIL 3N43F 3QEGH 4KWUA 4NHCH 4NPJA 5D71L 4IQHA 2VDML 1FFPB 2H3KA 3MJ6A 5C97A 2Q3XA 2OQJA 1DSYA 3JWOC 2NXZB 4LDOB 4GSDH 2FB4H 3FQYA 3CLWA 1YCSA 5EEYA 1SDDA 4P46B 4OQTL 5JMRA 4HIHB 4PWFA 4JPWL 5IT2L 5ALCH 5JMOC 1U93B 2OJ1A 5DEFA 4E9YA 1FO0B 1FZKA 1UH3A 4U2ZA 1QLEH 3IWVA 3U2SB 3REVB 1DSFL 3MREA 3JUYA 4B0MM 5IHBA 2G0LA 4YX2L 2NT0A 5TE4H 4I0PC 4UTBH 3U30B 4QRAA 4F91B 4EXKA 5CWSA 2FJGB 4OFYD 3D50A 3SYPA 4JZJA 1VZIA 4HJGA 3EAKA 3BSGA 1VPOH 2GCYA 1KXQE 2F5BL 1WUNT 1SXSA 1IAIH 2K6YA 3SGDI 2CGRL 2ZUVA 2LU7A 3ASWA 5F6HJ 4QGTA 3MVSA 3GMNB 3U4BH 4HEMA 4OU3A 1ERNA 2AXFA 3X17A 2JQMA 3UTPD 1KLGB 3OX8A 3Q2LA 1U8NA 4OLYH 3TF7C 3BDXA 4PEEA 4L8DB 4N0UB 4B96A 1P0SE 3QEQB 2QHRH 1KT2A 3OMIB 3C60D 4K9EL 2OW6A 1JDCA 3LIZA 1HXYA 2Z7YA 3JTSB 4JZJB 5IMLA 1H5BC 4RFNC 5JOFB 1DR9A 2CNZA 1PSKH 2X4OB 1OAZL 1X5FA 2A6KA 1EH9A 2GJ6E 4S0SD 1JPST 1RZIB 4XNXH 3ME0B 2Y22A 3QDMB 3MOBH 4X6CE 2F58L 2BC4A 2PYFB 1NGXA 3RVXD 4RWYL 4JO3H 5CZKA 4FNSA 1UFGA 3HBQA 5E1HB 1P9MA 3WO4C 1QEWA 1MHHA 1M53A 3KGTA 1AOZA 2EIKB 1L7IH 5AW3B 4UB0L 3U0WL 3U7YL 5JPNC 4KZDH 3HZVA 3BKJH 4QWWC 4JKNA 2GFBA 1ZLDA 4GW5B 2NW2A 2APVA 5H4ZA 5IHHA 3QCVL 4RBPH 1U3JA 3KW7A 4X6CF 1WFNA 4LCWE 4PCKA 3KYAA 4MBRA 2ZCKL 4WCYL 2FX7L 1C9SA 1CLOL 2OSLB 3OMAB 4A7GA 2XWTA 1U8KA 3F85A 4P9HL 3MKGA 4S1RH 1NGYA 3SKMB 3N40P 2ITFA 3V0DA 4PJAA 3HHMA 4JRWA 5LDUA 2W65B 5EEZA 1DQVA 3NCMA 4GW5A 4LCIH 4PQXA 3VM5A 4H25A 4A6YA 4ZK8A 2QMJA 3G08B 4FDWA 4IRJD 4PP1D 2F8IA 2BSRB 3RU8L 4NN5B 5IHZB 1ES0B 3EH2A 4WU5A 4PJHF 1EJOL 4YLQT 3P4NB 4POZD 4UINH 3RFZC 1OCRB 4RDBA 3BPNB 3H4FA 1BXXA 4KTGA 3ZQXA 3EYFA 1S4IA 4ZS7H 5I1IH 1KJVA 1TTCA 4TTGA 1XTLA 3LKOB 1J9SA 4L0PB 4J39A 5DJYA 5GRJL 3MV8E 1QI4A 1LWJA 3GZPA 4A7GF 4WHYH 5B39G 4QLWA 1CYGA 5H35A 4TSBH 3QIBD 1BD2B 3KPNB 4IOSA 3SBPA 4YE4L 2DY2A 1MIMH 5T1JA 3LZFL 3WFHB 5SX4I 3KGSA 1PKQA 3CFKB 5TJWK 1T7ZA 1W6WA 4UZUA 4BFBD 1ZA6B 1U8OA 4PP1C 1Z9LA 3ZZLA 4WJG3 3SO3C 5I73B 2OTWB 1SEQH 3OKOB 4GAGH 4HOZA 3WTVA 2V5MA 4WI0B 2B1HH 2BRRL 1F8TH 4ZO6A 5MHSD 1G7QA 1VHPA 4MS6A 4GW1A 3CFDB 1N8ZA 2I27N 1G7HB 3DPDA 2KERA 1ETZA 2BK8A 2H7WA 5BVJA 4PV8A 1IGTA 3CUPB 4XXDB 2OMYA 3MUJA 1CO1A 2EINB 1XH1A 1YEJH 2ERJC 4NQED 2A9AA 5AYTA 2FH8A 2G75A 3DMMA 5T1KB 4LEOB 2VDMB 3N42F 5FK9A 5DJZA 4HIQA 4UZSA 2G9HA 3QBTB 1W0VB 4U6VH 5B7FA 4XWOC 1OPGH 1BYOA 4UV4L 1BMGA 2PWEA 3NIFF 4FJYA 3LN5B 2C9VA 4L48A 4XNXL 3E8VA 4AKOA 3FS9A 5IGXL 3IF1B 2IWKA 3MCG1 5CINL 1P7QD 1ZLWH 1NGWB 2KLTA 3MOBL 4U1MA 1U91A 1DBAL 5DEGB 3F8UB 3ZKSD 3CFUA 1DJIA 1DVZA 2W9DH 4HHAB 4PV8B 2LW3A 3CZUB 5J13B 3DJSA 4LIQE 4OLZL 3HE7D 1CPUA 2E74C 2JCCE 2IQ9H 4WI0A 5E8OA 2AEPL 2J6EL 4GO6B 3GKWH 4TSAH 2AXGA 5C09B 2PNDA 4UM9A 4JM2A 2Z91A 2VXTH 1KTBA 4JE0A 4UBDC 2YPLA 2V17L 1A1MA 3AS0A 2HFGH 4A7VA 3RE0A 4EAEA 4AG4L 5CUSH 3V79C 3L3HB 1A6TA 1YUKB 4WK4B 5I30H 1QHOA 2EO9A 3Q3GB 3MFGB 4G7YH 2OX5A 4LSTH 3WKMH 2OS7A 2HLFC 1IEBB 1AXIB 2VLMD 3MN8A 4ANXA 4UOZA 3O6ML 1E9QA 4L3CB 3MBED 5EOCL 3AG2B 4UTBL 4TNVK 3MRIB 1NBZB 1YVLA 3R19A 3CFCH 3GSVB 5IOPB 1QSZA 2G3NA 5HI5C 1EJOH 2R59A 2YD0A 4E5XB 1OP3K 5E5MB 4Y5XA 2H6UA 1MW3A 4YPJA 3S36H 1NCWH 2FGWL 5IEKA 3JWNC 4HP5A 2HH0H 4NZTH 4H0LC 4P2RD 4MJ6B 1FFTB 1L9QA 2G4EA 4RDQF 3Q5YA 3VX0A 4EVNB 2X4NB 4ALAC 1AI1H 2IANE 3R0NA 4WEUD 4YXKL 15C8H 3S4SB 3QEUB 1JZ6A 4Y5YA 2BJMH 1FHNA 1JZIA 3RILA 1YMMB 4DP5X 3ARSA 1NANH 1M6OA 3LNHA 5DZPA 4N22A 1SGKA 4YEFA 5IF0B 2IOMA 4IYKA 5FHBH 2IPTL 3LKNA 4XP4L 4ZUVA 4N8VA 3V52H 4WTZA 1T0PB 1ZT4A 4EUPG 3SDXF 2AJXL 3MJ9A 4ODUA 3UJTH 1VKXB 3QXAB 3HI6H 4P2RE 2OW7A 4HIXH 1UKSA 3L3KA 1MWAH 1XSKA 5JHAA 1M57B 1Q9LA 5J6GB 1WCBA 2IBZX 1JYVA 4I3RH 4PJBB 3HFMH 1E9OA 4JFFB 5C09E 3BZ4A 1I4FA 2VMEA 4R2GD 3W81A 1L6PA 4UV4H 1VEMA 2VDPL 1O0VA 3C09B 4A63A 1I7ZB 4PVLA 3IU3B 3LV3A 2P24B 3OGOE 4HZLB 5EC1B 1FCCA 3EYFB 1J05A 3JTSA 5J11C 5HHPB 2CD0A 3CVBA 5HI3D 1QOKA 1L0PA 2E6PA 3UO1H 1T4KA 3FCTA 4GXUM 3ATAA 3LN4B 3P54A 3QXAA 5IMKB 3CVHL 5M94B 3ISRA 1ETJA 1OAJA 5IQ9A 2CQVA 3BPCA 5MENA 2IBZY 1XGPA 2MOGA 2J1WA 4X9HA 2CO7A 2IF7A 1YEDA 1AZNA 1W72A 4JO5A 2FJFB 1C12A 3AU0A 43CAB 4N8VB 1U92A 1UB6A 5I66B 3ECQA 1V05A 5IBLD 5AQ0A 2QELA 2OJEA 3WLWC 3EYOA 3TV8A 1R3IL 2CKNA 2WQVA 3MNWB 5IZ7A 2RD0A 1O7VA 3MBXH 4BXVA 1V3KA 4ISVA 4UQ2A 3HHRB 1HHIA 4QHPA 1KNOA 2UXVA 2V17H 3QZPA 2HKHH 3CU7A 4RX4A 3T0XA 2VJ8A 2ZPKH 3CX2A 5JQ6L 3RFRA 5I0YA 1CK0H 4HCRA 4XVUD 4NQEB 5T1KD 3SDCD 2X4RA 4LEXH 3VFMB 4MAYA 5CZXC 4AGMA 2CKBL 2XZAL 3POCA 5ILTH 2WZ6A 4HIEB 3LD8C 4UQIM 3V4PL 4GRWF 3REWA 3O6MH 3F65A 1A65A 1KEGH 4UZGA 3BAWA 2G75B 1OGAA 3E6HA 4G8AC 4M7KL 4GYBA 3FSVA 4TSCL 5L0QC 1KWKA 1HEZA 4RMQA 2BSBA 1H3PH 3OG4B 2LE9A 3Q43A 1CFQB 5ELIA 5B8CA 3ARBA 4Q4EA 2IAMA 4I7ZC 4ZNCD 3FSZA 4OI9A 3VH8G 2EVFA 4WFEE 5DXWA 4NHUA 2Y3AA 3CMOL 2NOYA 1DVTA 1OGPA 2XWZA 3QXUA 4RLDA 3UPAA 5DDHB 5TQ0L 1J0ZA 2XLLA 2GSMB 5HDRA 3UDWA 3V6ZB 1JXDA 3P0VL 2H2PC 5DD1L 4KK8D 3QQ4A 5E2UL 3LCYA 4UTAA 3V0EA 1OTUD 3O6KL 1GGTA 3Q05A 4HKXB 4ZPVA 4ZTEA 1TVHB 2HAZA 3QPXH 4QIRA 4G8IA 4XCCH 3L8QA 4GXFA 1T7VA 1E8WA 4LCCC 4WO4A 3DBSA 5KBKA 3DXAA 3FQNB 3RB5A 5C8JB 4N85A 4Y19E 4HC1L 4Y16B 1KWGA 2R2HB 1OD7A 2OXHA 2TRYA 3EYSL 3HZYA 5SX5K 5J12B 2WNXA 3QUXD 1A6VH 3DRQB 4XO8A 4WIQA 3L5WB 3U46A 3OAZK 2BSCA 1RD6A 5E6IB 5E6SB 5T33H 2C8NA 4P2QA 1BJMA 4Z76B 1FC1A 1OZTG 2E7BA 2H2PD 1JMZA 4U1JB 3ZGHA 1NDMB 1OXYA 4DN3H 2GHZA 2ZCHL 5IVXE 1ADQA 2Z4TA 3KNBA 3GLZA 5F6HI 4RAVB 5HHNA 1J18A 5IVZB 1DVQA 2R0KL 1A3QA 4J5VA 2XTJD 1UM4H 4JCWA 1NCAH 4P2CG 4NB7A 4WLCA 5AZ2H 3WNLA 3LZLA 1M6UA 2WBJD 2H5UA 4HCRH 2AJUH 3GLAA 3SGEH 3FQUA 2ZXGA 1TSHA 1MHHB 5B1JA 4DAGL 1PY9A 5IUSA 2ZX5A 3VFTB 4MXVF 2JTDA 3EO9L 3GIZH 3UX9B 1JK8B 4ODHH 5CGYD 3WTXA 1FFOA 1XIWC 2F18A 2OYLA 1CUOA 1LO5A 3ZDYE 4DW2L 4PJBA 4BHUI 4MHHI 3EJZC 3TO4C 4MD4B 3NRPA 2VIRA 4NXKA 1ET8A 4XC1L 1A7PL 1B4JL 3OSVA 4FMVA 4Q9RH 2OA9A 2OCJA 4ZTOL 1MQKH 2DWDB 3ABZA 2UYLB 4Y2OA 1FFNB 3APMA 2VR7A 5ALCL 1IBGL 1R0AL 3QQ3A 5EZIH 3OJMB 3SJVA 1ZV5A 1TR7A 3Q06A 1QLEL 2OPCA 3CZSA 3MGTA 3KWVA 4OCMC 3N55A 5DHDA 3MCYA 2PW2A 4O2EA 4BFOA 1AFVH 1A02N 1TJIH 5J3HD 4HS3B 5B3SB 1HE7A 4KKCD 5KTEH 1OM3L 3UPCA 4OJYA 2LHAA 4B27A 2V33A 1QO3B 2WXMA 2YD6A 3EBIA 4LMQE 1MIEH 3ZHNA 4ETQA 2JIXA 1Z5HA 4C4UA 4LSQL 3SY6A 5KUMA 5JHDA 2BSDA 1MI5B 2X1WL 3RBGA 5KJ7E 1A6UH 3HI6L 3B2XA 3AXHA 4Z77A 2JJTA 1AHWB 2V9QA 1IL1B 1WC7A 3II2A 5IFAH 1ECYA 3U1PA 4F92B 1RAMA 4NUQA 1FDLL 5B3JF 1E27B 2WXGA 4X99A 2YN5A 4UUJB 1IAMA 3HR5A 2YA0A 2EADA 2A4ZA 4ABWA 5HYJB 4HA1A 4WTQA 3ZPDA 1BPLB 1CFVL 1VFBB 2GJ6B 3W1ZA 2F58H 5I8EA 5ENWA 2Q7YA 4DQAA 3BSHA 4CVUA 3RNQA 4YDKH 4C8XA 3WNPA 2YZ1A 2YWZA 2X09A 3DO7B 1KT2B 1NGYB 3BYYA 3WHXB 2ZNWA 1NTDA 3LN9A 1YY8A 5I6OA 2XPYA 1PYWB 2X4OA 1ZLSH 3NSCA 4NKOB 3OC5A 5E8DL 1O9WA 4MMXA 4CKQA 2WUBH 4FNRA 3ZT5A 4TLSA 2KLSA 3BVWA 5E8EB 2Z4QB 3AG1B 3RWDA 3O2WL 3MJ9H 1IC7H 4FTDA 5FGBA 4HKZB 4AYID 5IR1B 3IEAA 4P5KA 3D2UA 2FQEA 3ZKXC 3L3IA 5HI4D 1UD4A 2A5UA 2D7MA 4OIAA 3OJDA 4NNPH 4Y7OC 3C6LC 2Y7QA 3D69A 4E41D 5DQDL 5IVXA 4WW1A 4EPSA 3UTSD 3X13B 3IDIA 1AY1H 4Q56A 4LGPB 5TGBB 1E4KA 5C0JA 4W9GC 4X7EC 2OSYA 1CG9B 5B39B 4M7ZC 3VA6A 3RVUD 2LTQB 4ZXBC 5HYJD 5IG7A 3CSYA 3J07A 3OKDA 4M8VA 4YDJA 5HDBF 2B2XH 3OKOA 3H9HB 4N2OA 2QHRL 1HK6A 2I5YL 2HUHA 1PY0A 1R5IA 3FUKA 2GAZA 4PJ5D 2MTAA 3FW6A 4B7LA 1AFVL 3QT2A 3FCSA 2DTMH 5C08B 3IFPA 1Y7VA 3COOA 5C0AD 4PFEA 2Y69B 4N9GB 3V4PA 3ALXA 2V2TB 2B1AL 4XBMA 1WD9A 3T8XB 3N41B 4L9LC 1RZFL 4XZ4A 4Y4HB 5AOMA 4L1BA 5GGQL 4HC1H 3Q8FA 1PCXA 3QS3A 4R4FL 4J27A 1W91A 1SPDA 3TO2A 2VN4A 4L3EB 3MRQA 4OKVA 1XXDC 3HS8A 3HG1B 4QRFA 5TDNA 2F54B 1RK1B 4JO2H 4LQ1A 5E2WH 5IP4A 5CCHE 4X8XA 5IHUH 1MKFA 2EH7H 4S1SL 4HZAA 3NSFA 1QMUA 3HS0C 4NLAA 1JGUL 1KCKA 2ZXQA 3TBCA 5HDQH 1FDLH 2R51A 4FQCL 2YD4A 2CGYA 5J1AA 1CVRA 3H3PL 1RUAL 4YHLL 3OPZL 3PQYD 4NQQA 3VD9A 5E1AB 1G5AA 2VLJB 1HS6A 1MEXL 2VR5A 5PCYA 5L4JA 2X38A 2X2IA 3FUMA 4H8WH 3LS5L 3CC1A 5B4MC 3GIVB 4FTVE 2P43B 1JMXA 2OZ4A 3BKMH 1UT9A 1MAJA 3C6LA 4A2HA 2GTWA 3CLEH 4PB9L 2SEBB 5FGRA 1ZVYA 3IN2A 1DBMH 1KG0B 4E36A 3M1BB 1UQSA 3HOGA 4X8JB 1AR1D 3N50A 5D93C 2YA1A 3O4LB 5J1AB 3I50E 1M71B 3TA3A 1E5UI 2KMWA 1PX8A 1E40A 2UWEF 1XF3A 3B9KD 3LXCA 2Q86A 3F7VA 4UQ3B 1CTMA 2X4QA 4E5XA 4DO5A 1OP4A 5TE6L 1D7FA 4FQIL 2OULB 1RPUA 1F3RB 1EWHA 3QDGB 1YO4A 5F7BA 3KZ8A 1DQKA 3GSRA 4YHIA 3O8XA 4AOFA 1FYHB 5EOQL 3RGVA 1J5CA 3MA7B 3DXAD 1MIML 3BH8B 4IIQB 4KKPA 1YY8B 4C59B 3B6SA 3HB3B 4HUUB 4FULA 2AMGA 4WI2A 4QNPE 4ZMOA 3O4OB 1QYGH 5D1ZI 2WZPD 1MFBH 2D3JA 1A6AA 3ZZ1A 3OAYK 1TPXB 3G04A 4V33A 4KKLD 4MRBA 2DB8A 2WSPA 3P4MA 4HUKB 1H9VA 3ARDB 4D9QE 1U8NB 2MCG1 3SB3A 4LK4A 2D73A 4LNVA 2N59A 1F86A 1GSMA 1RJZB 3QQ9C 3NCXA 1H9DA 3RGVC 2FLRT 4PW3A 4IBQA 1EPFA 1U2HA 3GZKA 1IGJA 1KFAH 4L8CB 2FO4A 3QAZB 4JPIA 2XCMC 3QJXA 3WUWG 2WIIA 3UXFA 4YBQD 3PE9A 3TJEL 2AEOA 3IJSA 2ADIA 2CDGB 1WTLA 3UACA 4LLVB 5D7JA 5JOPD 3IFOA 1HYSC 4WWPA 2Z35B 4KTDL 4HSQA 5FCSH 4W9ZA 2DH3A 5ESQA 2DWSA 4J3UA 3L4CA 3A4FA 3VFGH 2JIXB 2GC4C 3GGWB 2D7NA 3MRNB 3GM0A 3Q6FB 3PJSB 3FT0A 1JGLH 5EUOE 1U3HA 4JM4L 4OZIF 1T80A 1I7UA 4BBWA 1UKTA 4ONOA 2WO2B 1AQHA 5AW4B 1AS7A 4JPVL 3FFOA 3PHQA 2ZE0A 4J3TA 5F1IA 2KQNA 2QGDA 3SQRA 3APCA 2FL5B 3R06B 2HSIA 4I9WE 2OCFD 4M6OL 5TE7L 1J1PH 3BH9A 3ILPA 4UCFA 4OZHF 3CFEB 4PWHA 3QPQC 2J8UE 5B38A 5IOKA 3AADB 1Z3GL 3FPXA 4MZ3A 2VDRB 1NICA 3RNQB 1VFUA 5D1XA 2DIJA 3ESVF 5IROC 4Z8FH 1NCNA 4O00A 3QXTA 4UYPA 3DV6B 1QSFB 1B4RA 1OP9A 3EJYC 4FFTA 3UTTB 3DYPA 3QVAA 3HG2A 1PD0A 1QHPA 4IW4C 2GKIA 2JMRA 3HNVH 1MRFL 1S3RA 3WEBA 4ZW5A 2IPUK 4LFHG 2ISDA 3VXSB 2NSQA 4JRXB 3ZDZB 4M1GL 3SGJA 1XF4A 4PS4H 3F6LA 3FQUB 1Y6NR 5FM4A 4UQ2B 3NJGA 3PYCA 3X1NA 4JDTL 3WIHH 3V9EA 1PJ9A 4XI5D 3LSOA 1OF2A 4W9DC 3ARFD 2A6IB 3M1BA 2NXYC 2DQJH 5C0GA 5T8IA 3WTTA 2XWCA 3NYKA 1HCFX 4L1SA 2GIYA 5KVEE 3NZSA 4NSKA 4XP9L 4LO9A 5FS5A 3RVTD 1VRSA 3FO2A 2YQBA 4HJ1A 1P5UA 5IOPA 1R3KB 4PBXA 4KKRA 3G5VA 3VXTB 4ODWA 1INEH 5CU9A 1KC5H 1S9XA 4FQ2L 4YHZL 5E9DE 4PWEA 3QYCA 2IH9A 4YC2C 4H0GA 2KZKA 3BESR 1FVDA 3MV8A 3BVTA 2Y7NA 4MDJA 2P3YA 4KC3B 2UX6A 3GI8H 3S5LG 3UZEC 5DTFB 4GINA 2C9XA 4J4PC 3UBXI 3IMTA 2JB5H 4XMVA 1CBVH 3K71B 2YGPA 3P30H 3NIFB 5T5FH 1PX3A 4GRLD 4LL4A 4QXGL 5L8KB 3SYCA 4DEWA 5C09A 1MAML 4B9ZA 1H0DA 1RHHA 2YO3A 4KZ0A 2Y06L 2H4EA 3I9GL 4JO8A 1TCMA 3QHZL 4K5LA 2XN2A 3FUEA 2ADFL 1BZOA 4OF5A 1ECZA 5C71A 4I3GA 2VDNL 5LG6A 1GCYA 4ZYKA 1VEPA 2V2WB 4PJDE 5CMAA 5IB5A 3ARGC 3D4ZA 3FOLB 1SXCA 2OLDA 2J1ZA 2B9BA 3VXTA 4RETB 2HFFB 4OZHB 5I0XA 5BQ7A 1XFPA 3LZOA 3G04B 2ZUQB 1X6NA 4WSKA 4JAMA 4WTWA 5E4OA 3P9LB 4IRSC 1JTTA 1E4WH 5F1KC 2MJWA 3G6AB 2H45A 2VB5A 4QRRB 1HE8A 3VD5A 3BZFB 2CZNA 5DURD 1GYCA 2C9AA 2HP4A 2XV0A 4I3RL 3AB0C 4MJ6A 2QPUA 3HE7B 2NYYD 4RISH 3T77A 1KTDA 4WGVB 3JBG7 3UABA 1T20B 5D1QB 5IK3A 2ZWZA 2XUWA 1RIHL 5D2NC 5E08H 1GXEA 1PLGH 5L7XL 3CG8A 1TLMA 4UAHA 5I74B 4MFHA 3TX4A 3ZZQA 3B1UA 4HFUH 1ZV9A 5A2AA 1JYXA 3BMWA 1O75A 1OGTA 4GG8B 2Z8VC 4CC4C 1KPVA 2X6VA 2OMVA 5E2UH 3TBSA 3FHAA 3VNZA 4AYGA 1LE5B 2EVIA 4J3OF 1OE1A 1S3KL 2VDQB 5D1XB 5LQBH 3TYFB 1FL3A 2NZ9C 2XC8A 1I1AB 1NQBA 1ZEAL 4L8SC 4P0DA 3ABMB 4CUCA 2QFPA 3H9SE 3R7QA 3UBXA 2BNRA 4G1EB 5FWRA 3TJEH 3W9DA 2R0WL 4MB3A 1LDPH 5ADOH 1IT9H 3KPNA 1AXTL 3K6SA 1RFDL 3A6CL 4IRZA 3S2AA 4DGYL 4DZBB 4F7MA 4HWEL 3P3YA 1IM9A 2FD6H 4TUKH 4JANA 4F7CA 1F4HA 1WBXB 3PWPB 2V2XB 4D0DB 2W9EL 3QUXB 1DQML 3MQIA 1L9RA 5IEHB 5D7LE 4X7TA 3HMXL 4GBXD 4PJBF 4YE0A 1XAUA 3BQVA 5LXGH 3EJCA 3E1ZA 3Q1SH 1T1ZB 3VD2A 5J5EA 1GJIA 1EUTA 1NBVH 4X0KA 1V3JA 2DN7A 3LXUX 4NRYA 4Z78B 1WEJH 4U4IA 3CXHJ 5HGHB 4Y4HA 3LEYL 1YQVL 1MI5A 3RUGB 1F1GA 3IPEA 2K8QA 1R3JA 1L9SA 3MRCA 3WE6B 2WTPA 4PJEA 1FNAA 3GI9L 3GO1H 3SDXE 4HIHA 1NMAH 1S7TA 4XB3A 1MHPH 1JHLH 1UD5A 3GTVA 4ZOAA 4XPBH 1NCTA 4YFLF 2PYEE 2P26A 3K4AA 3B9KB 5FOBA 3SE4C 1JNHB 2FLBT 3H54A 3CDGA 5DC4B 2EEFA 1GKEA 3PP4L 4WDIA 1KMGA 2VC2B 1THAA 4NQDD 1XBRA 2IAND 4ODTL 4WNQA 5AAPA 4P5TB 2Y1ZA 2NY4D 3GMLA 3I9IA 4U1HB 2GBVA 3RWCA 3IXAB 3KW8A 4TQ8A 2EEAA 3ES6A 2WUCH 4NFBA 1P1ZB 2OL3H 4WEBH 3UCRA 2F19H 3L7FA 5CP7B 4LVHC 2WIMA 2F5BH 4PJIB 3K72B 3I75B 4M9PA 4M8QB 5C86A 3P2BA 1BM3L 4IRJA 4BZ1A 4FFWC 1TZ8A 3N0PB 4FHKA 4GBXB 1AY1L 2XWRA 4GS7C 1BAFH 3VVWA 3L08A 3PWLA 2Z64C 1X5MA 3WY2A 1XGQA 1SYSB 4LVNB 1SLWA 2UV3A 3ARBC 1BBJB 1IILE 3SJVE 5C0JB 4CGUB 1IKOP 1N4XH 2MCPH 1ID5I 2GBUA 1G94A 4ATTA 1KBVA 3IN0A 2NLJB 5D8JL 3O8XC 4KJYB 4MS8D 5A2IH 2EKSA 5IEKB 2Y7QB 3X11A 1MNUH 3IDGA 4NAQA 3CX5J 1ZLUK 1YN7B 2C3VB 4M62L 4UOQA 3ROLB 2KQMA 1L7TL 3ZKMD 3GNML 4JG1H 4MAYC 4NCC1 3HNTH 4OCYL 4U6XA 2DWEB 1HQ4A 2BMKA 2EH8H 2E7MA 43C9A 4P07A 5ID1B 1L7IL 3O3DA 3U7YH 3U0WH 2Z34A 4KZDL 5JHLA 5T3XE 1FG2B 1MFEH 4P5TD 5GRJH 3B9VA 4M1CC 3HBGA 1JPGB 2PETA 3TURA 3ARYA 3QRFM 1ZGLB 4JGUA 1LEIA 1I9IH 2N7BA 3ZIYA 5IGXH 2X12A 4PGCB 4AQAA 4BXSV 4N9GA 1CTNA 1R5VA 2ZT9C 4IOFC 3RUGF 3W9DB 3W57A 3QEHA 4MNGE 2L7EA 3RZCB 4KO7A 4GXVL 5FUCC 2CMRL 2D03H 4TVPD 3IPBA 3H42H 3IWUA 5FYKL 3VFTA 4AEIL 4ZQKA 3MJ9L 4R4NC 4E42A 1W9XA 1CDHA 4ONHA 3Q6FA 1NAKL 3FQ4A 2VN5A 3PWJB 1LP9B 3JXAA 2GY5A 4X4ME 1TO5A 2VSKB 2ZSWB 4ODVH 5F7EL 5CF3A 4Y0GA 3WNOA 3RDTA 4RBPK 4PGEA 5HHOB 5CEYB 3C6EA 2XIDA 1IFRA 1FCGA 4X5QA 5CBAB 1MW1A 2QSVA 3LH8A 3A67H 5B4MD 2BSSB 1B0GA 3NA9H 5C0RL 1ADQH 1JG9A 4QTIH 3TT3L 2DJ4A 1SY6A 4PJIF 4H8VA 3SDCB 3FQTB 3EJRA 4ETQB 2A38A 4NO0B 1XCWA 3GIVA 2ENQA 5D5MA 5KVDL 1NMCB 4X50A 1QNZL 1NUFA 3EHBB 4DGWC 5B3NA 3GEFA 4IKJA 4PWGA 3CFDA 1AD0A 3WNMA 1S7UA 3QWOB 1FL5A 5C0EB 2C7UA 3NT0A 2DQUH 2IG2L 3KLLA 3WDHA 5DQJB 3SJVD 3MXVH 2FGWH 1F4WL 1MY7A 3TBTA 1MEXH 3MNDA 3BSZL 3QUKA 2C9PA 2ZOWA 4PY8J 2Z3FA 3VFWA 4NM4L 4OGYH 3O41A 2H6PA 5DUBA 5GGQH 4CC1A 2NTFA 1ZVSB 2W9LA 4DOHE 4LHUD 2HPOA 3GZOA 3QORC 3BAEH 4KK9C 5DFTA 3CVDA 3WTWA 5IWLC 3KPOA 2BY2A 1HTYA 3PPSA 5I8EB 5AVQB 2BSEA 4HJTA 1N9PA 4NHUB 1W0YT 3BZ4B 4TQPA 4PJXA 4O5LL 5C0BD 3QFJA 2DQCL 4PGDB 2FZ3A 4X6CA 1BMZA 4G8GA 1FLRH 4F9PC 1IBBA 4RRPA 4H8PA 4OB5L 1I3RA 4BSVA 5GS1B 3BGFB 4K2UL 4OZ4B 5ENWB 4AQOA 4K7PY 4UTAL 3NQIA 3ZDYB 4A37A 4OCRL 2DMBA 3MDJA 5FX3A 3BI9X 1D5RA 3QJRB 5D6CB 2O6DA 5DQJA 3T3MF 2HLFD 5I9QB 2N1TE 3L5IA 4NYLB 4EQ3A 3EJUA 2X4PB 4IS6A 5AAMA 2B9AA 3I6GA 2VDPH 2DRUA 2XKUA 4L1LA 4PB9H 3G5ZA 4W70A 3IFNL 5F7AA 4XVSH 3DVIA 3WBDA 3EOTH 1MPAL 5GGUA 2VWEE 3VG0H 3A3YB 3C5JA 1U21A 1EHAA 3ZZSA 1OM9A 3I3EA 4PJ7F 1XH3B 5E8PA 4BE5A 3US0A 2XBDA 1A66A 4N8VG 5IVXB 1II4E 1AAJA 4U1GB 4BA0A 4Y4KD 3THMH 4KPHH 1AGEA 3CXDL 1NEZA 2WBJA 5KSAA 1LP9F 2DWTA 1H15B 3QE5A 5LDSA 3GJFA 5EIIB 4CVZA 4ERSH 1K8DA 5L9DL 3T2NL 1N12A 1XF4B 2I9TA 3WHE1 5IFJA 2X9WA 3QO0A 1YG9A 1CLZH 2DIEA 4V1DE 3X3FH 1RKRA 4Z95L 4PW4A 4DTGL 5ANMB 5INCA 4GQ9H 3U36A 4XNUH 2V5TA 2YPVA 5HD8D 1A7OH 4K8RH 1MFAH 1CFSA 4WWKA 5H2BB 1SDYA 3ULVF 1KTLA 5BS0D 1JRHL 4FFZL 4P4KD 5HGAA 4D0BA 4JL1A 3TTYA 1KBWA 1JFHA 2EDQA 2JCWA 1JNHA 4QTHB 4PJ5A 4Y1AE 3PP3K 4AYSA 5A6MA 4RGNE 3CSGA 4HAKA 4HKXA 5AVUB 2OL3B 4NJAL 5HDBB 3ARFB 3ELAT 5CLXA 2HT4C 3GMLB 4YOKA 2XXMB 4IOIB 1H3WM 3SCMC 3V7AE 2VSDA 3A4EA 4DO6A 1PFOA 5F89A 4EN2A 1J9RA 2VAAB 1AYOA 4OD2A 4QRPE 1GS8A 4XT1C 3ATBA 3IJEA 5CP3A 3VI4B 2GSGA 2V7HA 3S5ZA 4R2GC 1NCCH 3IJ7A 5ALBL 4C83B 3JWOL 1OTSC 4XMWA 3UTSB 4JO4H 4RGOH 4LSPH 1V7NL 2XJKA 4XVOA 1E4JA 1Z66A 1OEZW 2X0WA 1D7BA 3O2DA 1DUZB 1XCXA 2CK0H 2I85A 2CKBH 2CRMA 4JDVA 5MERA 3IF1A 4FL4C 5EN3A 4WWKC 2CHWA 4HMEA 3CCHA 4BGLA 2E47A 3GMRB 1IBFA 1OF2B 1T0NA 5AVWB 3K1DA 2AFNA 5JHDB 5C07E 3NDYE 2VZSA 2BWIA 4PJ5B 3SE9H 2PPAA 3GMQB 1Q9OA 4I77H 3ZDYF 3P3UA 5D96C 1X9LA 1CIUA 3OHXC 3A21A 3MMEB 5F6IC 4TOYH 1SJVA 4K3EH 3P0GB 1XSJA 1AE6L 1UJTA 1E9QB 4L3CA 3BFQG 4HHGA 4N8UA 4AH2A 2DJUA 1QVOA 1LVEA 5AW9B 3VNYA 3UZQB 4DPAX 2IWGA 3TFKC 3EF7A 3DX6B 4BZ2A 4XXWC 1U95A 1A5FH 3DURA 3MFFA 2EDHA 2QR0B 2Z92B 4MB5A 5K39A 4PP2A 3UL4A 1PZDA 3PHSA 2FWUA 3V7MA 5GGTH 4N3TA 4ZXBA 4GW4A 4MRCA 4H20H 5ETUB 4WI6A 2Q10A 2QQLL 1XR8A 3F6JA 5E7FA 4UDUA 4FQJH 3B43A 1JWSB 4ZZFA 5FYJU 3WS3B 1JZEA 4JFXA 4OLVH 5FYLH 5FA4B 5F88B 2C9SA 4Q14A 1LK3L 1S7XA 3Q5OA 1YJDL 4YH6A 5DD0L 3I6KA 4HWBA 1A3LL 2B15A 4OFIA 5C9JA 4W6XB 1NCDL 2WQUA 4OFKA 4LAJH 3TBYB 1TVBA 4GSQA 4MAYD 2WSKA 2F0CA 1RZGA 1S9WB 4MCNA 1ROCA 3ECBB 4FFVC 4JFED 5BQ7B 3BQUD 4M03A 5I17A 2IO5A 3HRZB 1LD9A 5KN5A 3QZMA 4ORGA 3QHZH 2I7OA 3V6OE 2IDFA 5KZCB 2DYRB 5F96H 3UOAB 3SDXA 1UXSB 1YMME 3CH1B 1CIDA 1P5VA 2P46B 4R0LB 5C09D 2Q6WA 5FO2A 3ULSB 1YEHH 2I26N 3PG2A 1S5HA 4XPFH 1PCSA 2V7NB 1A4AA 3S37L 2FATL 2WP3T 1I7ZA 5ISZD 2AANA 3MRPA 2KL6A 1KDJA 4JANB 2UY7A 2RFXB 2JJSC 5FWQA 2G5BB 2E9IA 4ACTA 3LNDA 4BFJA 3SPJA 1UT2A 3U83A 4ZTOH 2FX8H 3H9YA 3ML9A 1YN6A 3PAYA 4NERA 3H0TA 3LOWA 3RDJA 3TEUA 5JNYA 2Y3NA 1E5BA 2X4TB 2QHLA 5CGMA 4LARL 1IBYA 1IFHH 3IAQA 3L16A 5CN1A 1ZLUH 3CN2A 1T0MA 4J8QA 3TBYA 2QBWA 1RJYB 3FONA 2UY6B 1PEWA 2VZ1A 3LKOA 2VCOA 4R9HA 2YKLL 5HY9B 1J8HD 1CLOH 1HL4A 4J1UB 1AGCB 2YC1B 2DQJL 5TF0A 1TIUA 2C1PA 3D3VD 4XXCA 3T4YB 3T71A 1XVSA 3A47A 3DHMA 1NMBL 2YLKA 4MJJA 3VXUD 1CS6A 3T6WA 3O9WD 1JSYA 3ECUA 1O6VA 3VAEA 1D7CA 1E9PA 2XQBL 1G7MB 4OLWH 1YQ2A 1MWOA 2OXGA 4JFEA 5ACLA 1IEAB 3VWJD 3I84A 5F9DC 3JWDH 3BLKA 1PZUB 1RZPA 1UD6A 3E8UL 2WQ8A 3DJRA 4AEEA 1DQJB 2WXPA 3W39B 4GMTH 3BDYH 1GGBH 2OJZH 4EOWH 1UJ3A 4KVNL 4NRZB 5E5RB 2JKTM 4NQEA 3DSFH 2GCYB 5DVKA 1S9YB 3VFMA 4BSWA 4G5ZH 4IM8A 4RISL 3F7LA 4BK8A 4Q7DA 3SQOH 3R1GH 1CB4A 5CJXC 4NYLA 4XNUL 3L4ZA 2VQUA 2VLKA 5EZLA 3D3VA 3V10A 4DN4H 5M95B 1XSIA 2C9UA 4FQXD 3RPBA 3FOLA 1F11B 2NQ3A 4PREB 1C5BH 3BP7B 1LNUB 3WIFA 3WL9B 1XIWA 5GS3A 3NABH 4MWFA 3L3JA 2MQ3A 3C5ZC 3FU8A 3NFPB 4XZUB 1KV7A 3DURB 3AREC 2OAAA 1FORH 1LLAA 5DJCB 2BRRH 2JQZA 1NPJA 3LVEA 4YIQA 4DZ8A 1I8MA 3Q3GA 1YHPA 5D4HA 1PYWA 1A6PA 4MD0A 1IAOB 5GZOA 1DQLL 2WXJA 1EUUA 1MJUL 1P4LB 3GS4A 3SODB 3BD3A 2X4SA 1E4WL 4MA1C 4Z0XB 5JLZB 1C7SA 2NX5E 4UANA 1OO2A 1WA1X 3VRLE 1YPZB 1QBML 4P4RA 2HX9A 3MV8B 3DNKA 4QHUB 1IKNC 1NUGA 3OR7B 3S37H 3MNZA 1A3ZA 3WKQA 4E41B 1CDYA 3K6OA 2OL3A 5KSUB 1YEGH 5LCVH 5C0NC 1G7IB 1V55B 2NUTA 4AYEC 3AAZA 1A9VA 5I71B 2NY0C 1N68A 2ROXA 3IDMA 3HHSB 2UZXB 4HWZB 1QFUH 2PPFA 5DHXB 4BRJA 4J3OD 4X5WB 5FHAH 1FYTB 4CN4A 3S7GA 3TZVA 1TVDA 1M7DA 1XCQB 3QEUA 3VI3A 2PABA 5E94A 5GRUL 1H3VA 4R90L 1HZHL 2VZUA 3AWEA 5DZAA 4IKNA 2MQCA 5MI0C 5L8JB 4JFHD 4OCXL 2MKLC 4LLVA 5D7JB 5BO1H 5JW4M 1BA9A 3OXRA 4NP4L 4FTVD 4FXGC 4A04A 5EUKA 2GJRA 1FH5L 1XH3A 4O4YL 2YMXH 4P5SA 5E8PB 4WHTB 3SDDA 2HFGL 1IBDA 1EHNA 4PJFB 4PY7A 4GRWH 5GGVL 4UNVA 1JYWA 1ETZB 3FBQA 3BQUC 2ESVA 3BRDA 3TEXA 4LBAA 5TK2A 2AJSL 4I4WB 4HUWA 3RDTC 4MJIA 4KXBA 1PZSA 3T5WA 4OIIH 1G0YR 4LL1A 2R2CA 4LP5A 1E9OB 5F0PB 1T0MB 3QDHA 3WUZA 3EG9A 2WLNA 4G1MA 1MHCA 5K9JL 1T1WB 3BP4A 4CC0A 4AUYA 1J8RA 2PWFA 1WLGA 1CGSL 2EH7L 4OFPA 4S1SH 1FP5A 2A9NL 4AT6B 1YEEL 1Q1PA 1NCDH 1WBZA 2P4AB 4PGCA 4OLXH 1MLBA 1OTUC 3NCYP 5HDQL 4JHWH 3RGVD 1E3FA 1U93A 2X4UB 4MYWB 4TPRL 2BP0B 3OKKB 1M42A 1TOXA 1UB5A 2KC0A 4HCFA 2UWEA 1BXUA 5EDSA 1QLEB 5GQBA 3TJHD 1CFNA 4W9EC 4LHUG 3T8XA 1FYTD 2OBGA 5F7MC 3BCFA 2HA1A 4CVZB 1QBLH 2EXYD 2H6PB 1SBSL 3CFBA 4PJ5E 5DUBB 4XRCA 5BOJA 5AB1A 1JNNH 2VAAA 3KPRB 5HGGS 3GBEA 4CN1A 3ZK0A 4K23H 3PRZA 1GOGA 1BFOB 2KYIA 2ADGA 4EMZA 3I6LD 5PAZA 4DSYA 3PHOA 1ZGLP 1J5DA 1C5CH 3LSOB 2AS5M 1DLHA 1U8MA 4NC2B 3DO7A 5FUOH 1NGQH 2QZ5A 4K7PL 1J8HA 3GRBA 5I75B 4WI8A 4P2OC 2AQNA 1INDL 2LAAA 4FYTA 3UCQA 4FYQA 4JFWA 4G6JL 1TQCB 4EIUA 4NN7C 3EH3B 4KGLA 1NCBL 4X6FA 1ZE3H 2I25N 1OARH 4H88L 3ZHLA 3NFPA 3AACA 4XZUA 3L4VA 3RL1A 3E38A 4S2SA 2IJ0C 2C3GA 4ZFFA 1VADA 1J0KA 4OM1H 4AIOA 1N0LB 2HWZL 5DZNA 3FO0L 4U7SA 1AKJB 5EA0L 1ZD6A 4MCMA 2NYYC 2JE8A 1G9EA 3PAZA 2FZ3B 2ICEC 4X6CB 3QEQA 4BZYA 4DIXA 3RTQB 3HMWL 3LAFA 2ADGB 3RZWA 4DPBX 2P7TB 1KBGL 4GI9A 4YNYA 2FDBP 5GS0H 2X87A 4PJFF 1H6FA 3C60A 4GO9A 4V1DB 3KVQA 3OHMB 1AQDB 1H6UA 2HKHL 3AROA 3ZHDA 2I07B 2P1YA 3OKNA 4Y8AA 4HAGA 2FE0A 3FF7A 4HCRL 4ZDHA 2VRKA 1CE6A 3GMOA 2XPGB 1AKJA 1CD1A 3EFOA 4NXSA 5F9WB 2EECA 4EI6B 4IRJB 4KX8A 3LN5A 4MLSA 4CJ0A 2BFVH 4S2SB 3NSDA 1RUPL 3S5YA 1C5BL 5FOJA 3U0TB 4UU9B 1LMKA 5EMYA 3DETC 1QNZH 5I8KL 3NIGB 3RTQC 5L9DH 1KZQA 3ULVE 3KEHA 4F57L 2ICEB 2CRYA 2FYYA 1G7LA 2XVLA 5JW3H 1L0QA 1CLZL 3HCVB 2JV6A 3LVTA 3HE6A 3N1PC 2OQJB 4E42B 4M3KB 4MYPA 1KPRB 1NA8A 2HUEA 1WS7A 2VRAA 2WB7A 3D2UD 4GXVH 3DGGB 3ETBF 4K8RL 3CQPA 3X11B 2N7SA 4KDTC 2B14A 5TPWH 3V4PB 4Z0BH 5C92A 1RULH 1HHKB 3HUJE 2CO1A 2BIMA 2VL4A 3GXPA 3QPXL 4ZDHB 4XVSL 3IBOA 4GAYB 1QFWL 3MRPB 3OXRB 2BDNL 4ZMZA 2BSED 4KRLB 2F8XC 4YXHL 1T22B 2E9WA 1KCRL 5IBTL 2A7BA 2P24A 4YHML 4WK0B 4S1QL 1N5AA 4DFHA 3M86A 2YUVA 1RJCA 1G87A 4JO3L 4J3OH 3U4KA 2D4FA 4HFWA 3N42B 5KAQG 1KTKE 1QFUL 2XZQH 1H6EA 1PJWA 1FZMB 1CGXA 4ZUWB 3S5LB 1KCVL 1J9TA 5IB3B 5DHYB 3AMLA 5JHDD 1IC0A 3VFNA 3IETA 1CE1L 4IKIA 4JKPL 1GHFL 1JPGA 4L8DA 4XAKD 4U1LB 3RA7L 1OT2A 2ZCHH 1QFPA 3BIBX 3FH7A 3OPUA 4PJGF 1M71A 5IIEA 4H88H 2UVEA 3MRRB 3CVHA 5I1AA 5JHLH 5CJQH 1T1YB 4WKZB 2WXQA 2FIKA 5KS9E 2WAHA 4LLWA 4OLYL 4WV1A 3V6FA 1YYMH 3ZRFC 2H1PH 1SYVA 1E5YA 2YAMA 3L5HA 4G7QB 3RWJB 3TVMB 3VXNB 3EYUL 2EDYA 3F01A 1QSFA 2K70A 4F2MB 2OMZB 4L4VE 4BQ6A 3KXFE 3QFDB 4D0CA 3QRBA 4HXBH 1YMHA 5ETUA 4MNHA 5BPPA 2OK0H 3N85H 1E4KC 1KN2H 2AGJH 2JKJA 3KJ4B 5IIEB 2XX0A 3HZVB 3VFUB 2VAJA 3KPRA 5BO0D 4W68A 1BZEA 4LRNL 4Z7WF 1C5DA 5I1CL 4BUHA 3MZTA 4EDXB 2VZOA 2W07A 4XBGA 4BKLA 1SXNA 4Q6IC 1QHQA 3IU3A 1OSPL 4ENED 4FXGB 3CK0L 4MMYA 2LLGA 5E03A 3BJLA 4TSBL 5EZJA 5H8DA 1KJ2H 5D7JC 5TFSL 2WLMA 5MI0B 5LGHL 1OAKH 5HP5A 2QTVA 3LB6C 1EXUB 4OCWL 4F7TA 3QCUH 2YLHA 3TYGH 4IKLA 2WSDA 2PO6A 1A0QL 3DPBA 4YDLC 3MA9L 5EU6E 1OB1A 3FU0A 5FM8A 4ZUUA 4P46D 2NY0B 4NRXB 5EO0A 1IAOA 4O02H 5AG8A 2QVKA 2ZNXA 2V5RA 4QJ3B 4ZSOE 3B7SA 2R69A 4AGLA 3S36X 5TDPA 3LMJL 3VXOA 2DL9A 1MFMA 4S0HA 4Z0XA 3D0AA 2RHEA 3CJJA 3L1EA 5HI4C 5HJ3A 3BT0A 4P59L 5EEVA 3BO8B 1U3HB 5I18H 1OE2A 3FC8A 3KPSD 3FU5A 5I28A 1CI5A 3GEWB 2F1AA 3SDXB 1GSKA 5TGBA 5DURB 4D3CH 2XN9D 3QIUC 2DH2A 5A2LH 3VM7A 2X70B 3BP6A 1R3HA 3RHWF 2R39A 3V95A 4DGYH 1H3GA 3SKOB 2AJXH 4YDIL 5FO9A 2O4EA 2C1PB 3T4YA 1EXUA 4F7TB 4JR9L 4XH2B 5AW0B 4F2FA 1LL1A 2ADFH 3QQ9D 3C5ZB 4LLMA 4PJGB 3RYMA 2D7TL 2GEQA 3WJMA 3T3MB 4DKFH 1ITCA 1ND0B 3KPQA 5FF6A 1JZ2A 4K3DH 3OR6B 4GJTB 2DM4A 3K6NA 3VXPB 1ZV2A 3RPIB 3DC0A 1CCZA 1WZ1L 1Z6JT 2AQ3A 4OZGE 1A7QH 4BZ2L 3MNZB 1SEQL 1RL1A 2O6PA 1EHXA 1GGCH 4OLUH 1IM3D 1YECL 4IRZH 3JWNE 3ZBMA 3UBXG 2ZOTA 1N6VA 4BSWB 1IT9L 3H85A 4RGOL 3DHUA 3LS5H 1PTZA 2EEXA 2Z0BA 3F00A 5CZVH 3UBXB 5IJKC 3GUFA 4OZIE 3CZKA 3SDAA 1I9RH 4OM0L 5IB1B 1D5IH 3IKCB 3TIEA 3KCPB 4GEJA 1ET5A 3TWCL 5ICYA 1R17A 3MJ8B 1JYNA 1BXVA 1S78C 3D0LA 4OBRA 2Q87A 2UY6A 5I6XC 2JTYA 3VQMA 3ZYZA 3MBXL 2XG4B 5DD0H 3QQDB 1DYZA 3DRQA 4GSRA 4KK9D 4OUOA 3MX0A 4BUQA 1IAKA 1MCPL 2JSFA 3HG0A 4HT1H 4ABUA 3QUXA 4MWFB 1Y6MR 5J0BA 3O3EB 2WUCL 3UBHA 1ODAA 1JGDA 2NNAA 2W60B 3WCYA 4C54A 1HHHA 5CEZD 3LEYH 4DKEH 3RWHA 2QMKA 3M17B 3OGCA 2R83A 2GTZA 4N8CH 3VB9A 5E56A 4YX2H 2FQDA 4U6HB 5EEWA 3DX9B 5KW9L 2PWHA 4C4BA 3F7YB 1PMYA 3KL3A 4AMKH 1OT1A 2XG4A 4XPBL 3LDBB 3IRZA 4K3JH 1DN0A 3SQBB 3MYZA 4CW1A 3A22A 4PIBA 1X4YA 3CLFL 3VI4F 3LNGA 4RMVA 5IB1A 3WFCL 1V27A 2PW1B 1N64H 2F54D 2FO1A 4H1LA 3FTZA 1A4CA 4DNLA 4KKZA 4E9VA 4EUPA 1OTTD 3JV4A 4MZIA 4QY8B 4B9IA 1IC4H 2CR3A 5DEJA 4Y2OB 5IHWA 3TBTB 1ZXQA 4MAUH 1BVNT 2CPUA 2J44A 3BWAB 2X89A 3JTBA 4IRSA 3CZJA 3PGCA 4W9HC 1EO8L 2J5LB 2VDKL 3OKYA 1NLDH 2K4WA 3QDMA 2Y2TA 1SMDA 3PFQA 3HRZC 2CSPA 1TF4A 3EOAB 1EBPA 1BJ1J 1M7UA 1I3VA 2HH0L 3CIAA 1E42A 1OGSA 4NZTL 1WFMA 5DR5L 3P9LA 2DLGA 5C7XL 1NJ9A 3KWWA 5JIPA 1EA9C 1XZ0A 1UD3A 2E4FA 4V1DD 2ZXAA 4XO3A 5C08A 1W16A 1XR8B 4UM9B 2NR6A 4S1DC 4P4RB 1JWMA 3LRMA 4XBPA 1U8QB 3L6FB 3H7BA 2FB4L 1FZOA 4CVXA 3TPKA 4NAJA 4X4KA 5JQ6H 4I88A 1OK8A 2FJUB 3FN9A 5BRZB 3JTTB 5D2LB 2O5XL 1NKOA 4AK1A 4AQ1A 4BH7B 4DUVA 2GUYA 5GGRB 5AWNH 5BJTA 4F37F 3T0VA 5BUGA 1QBMH 2FQFA 3ARZA 1WAAE 1CL7I 3UP1A 4QR7A 3K1KC 4Z8FL 3U2SA 4JLRB 5FYKU 4ELMA 1R1CA 2ZAHA 2YD5A 5A43C 3TH3T 2O5NA 1C12B 4PBWD 3QI9B 3VDCA 5F6IB 2I24N 5C08D 3UO1L 2VDOL 2RA1A 4JY6B 1NOAA 2X9ZA 2PCYA 4RMTA 4QO1B 3O6LH 4XTRD 4ZX3A 1S7QB 2W65A 1UGNA 3SDYL 1CGTA 3HRPA 4XNDA 3VFVA 3ZYIA 3CBRA 4D8OA 5DMJB 3W9EB 4FL4B 3B34A 1P7QA 5D2LA 4XNQB 5I18L 1OM3H 1HSAA 2GIMA 1WS8A 3MNVA 3IMRA 1HHJB 1GS6X 5GZNC 4YDVB 4QCIA 3RRQA 3BP7A 1J5HA 1G4RA 2KUTA 3S88L 1BWMA 2CLRB 4QRTA 5I1HL 5DJYB 5AVVB 1GVIA 2UUDK 4M7JH 1BJ8A 4LLYB 2QDVA 1NOFA 1IQWH 3EGXB 3SCMB 2KT6A 1KJ3H 3TPUA 5GS0D 5FK9B 5KJ4A 4O2EB 4TVPH 5F71A 2OP4H 1XDTT 3U7WL 3ARFC 2OFQA 5DHVB 3EO0B 2X2JA 1EO7A 2GJZB 2DMCA 2WWKT 1A14L 2QSTA 2P44B 4QOKB 5ITFB 1TZHB 3BWZA 1CBVL 3FB7A 4YPGB 5KBLA 3U6RA 3QXDB 5DD5H 5EOTA 5E9DA 5EU3B 2E8YA 1HXYB 2OR9H 1MAMH 4G6AD 3MAWA 4UTAH 3FRUA 2IOIA 4MDRA 4DAGH 1IQDB 3VU2A 1SF5A 2XWTB 4PUBH 2YD7A 4FGMA 4Y19D 2C34A 3CFJB 2JKWA 1IGJB 1VB9A 4JY5L 3TF4A 3DARA 4IU2B 5DO8A 2Q8AH 1TDQA 1AC0A 3B6SB 4HUUA 4MA3B 5D2LF 4PS8A 4N0FB 4GKOA 2ZP9A 4O5LH 3RVVC 4CW1B 3WJMB 2YQ2A 1WDAA 3EYVB 4NZDA 4PJCA 1K2DB 2F2HA 1JXJA 1QD0A 4PS4L 4U1KB 4WKXA 3MTXA 1MCHA 2VITB 1IGFL 4GIPD 1L5GB 5HHNB 5DTFA 3HJEA 1MCOL 4G8GB 5D1ZB 4G6JH 3P3RA 1B3IA 1SLVA 4OKDA 4OUUB 2YRBA 3B8YA 2EABA 1CWVA 3TXAA 4Z76A 4ZMTA 2X1QA 3BWSA 2QADB 1U8IA 3B7TA 1EFXD 1HNFA 1T2QL 4F33A 5EUOB 2IH3A 4PJ9A 2CU9A 4KTEH 1JNNL 4PLNC 4PV1C 3OLGA 1MPAH 2YMXL 3U0TA 4XP5H 3BGFC 4K23L 5GS1C 1F1AA 5JW5A 3GHEH 3SO5A 4FFYL 35C8H 2FT7A 2QDWA 3PHAA 3X1FA 2CKBA 5FUZL 4ES8A 1WWWX 4NJAH 2MOQA 4JHAH 1FSKB 1IIIA 3EFFA 1RUML 3MKKA 4GUQA 3T0DA 1SQMA 1MLBB 1Z5LA 1DDTA 2JKSA 1XD0A 1HYRC 2F53A 1EGJL 1UWYA 4AEHL 3MYJB 2XWJB 5KSBB 4JG0L 5D70L 4PRNB 1PIGA 4MXWL 4QXUL 5H94A 3QORB 1I8LC 3MOQA 5K9OA 1EO8H 3WXVH 3IK2A 1AO7B 1AXTH 2CH8A 2VUOA 3N1FC 1FVCB 3KL5A 4HIJA 1UWXK 1TEGA 4P2OA 3DGCR 4IMKA 5EU4B 5A2KH 4ZRGA 3LPFA 5D7KD 3V0HA 2D3NA 4MDIB 1DLFL 4U33A 3SDDB 3QZLA 3P3TA 4ZX4A 1OALA 4PV9B 4TV3A 1PKOA 4CSPA 5I23A 4Z7OE 1E50A 1INQA 2BOCA 2NX5A 5IHUL 1FN4A 1NMCC 3MYJA 1IM3B 5FC9A 5IMMA 3VH8A 2WQWA 2XA3A 3QS2A 5DMGD 2QR0A 3ULVC 1HNYA 3QPKA 1AGEB 3RJOA 2HT3D 5DMKA 4G80B 4AW7A 1C08B 4WWOA 4K7FA 2AVFA 4Y5VB 3B5GA 2QL1A 4GAGL 4JK0D 1BFSA 1AMXA 4HXAH 3EJTA 4K3EL 4G9FE 3AM8C 4MQXC 4AYFA 1NCCL 3L4TA 3L3GB 4XWOD 1T7XA 1Q90A 4GQZA 4P23A 5C1MB 3I9AA 2EXSA 4GRLC 2NSXA 2XWJA 4TRPL 1DL7H 1E0OB 3CVHH 4D9RD 5IFHL 1N7MH 5K9KB 2DQMA 3D0VB 4NQVB 2DOCA 4G7VH 3FMGL 2CNYA 4HH9B 3NPSB 3O3UN 3C8KA 2UWEB 2BCKA 3BUIA 4FQHA 2BW4A 3RQ3A 4RMRA 3J27A 1CLYH 1W2KT 4K15A 4M43H 2IFGA 4UWQB 2VDQL 2YQGA 4IDJH 3HR5B 2FH6A 4Y4KA 4ZMPA 5HGHA 4OM1L 5IW6A 3VGBA 1Z5YD 3RZCC 3Q2WA 4V11A 1B2WH 4JJ5A 2OL3L 3ZE0B 4X0NA 2XG5B 3JSSA 2R8SH 3QARA 1P53A 2YGOA 2QLVB 4K7FB 2NXYD 3RWIA 5I1EL 1HDMA 4R7DA 2J25A 1ZS8B 4TQIA 4XI5C 5DQ9A 4F8NA 3D48R 1UFUA 2VN3A 2YHGA 4HKZA 3HZKA 2E7LC 4JE4B 1BEYL 1V7NH 1S7TB 4JFPB 2QV4A 1I7TB 3S96A 3KWUA 1B4LA 3GF8A 4ELMB 1GRWA 1OCCB 5HGDB 1DVSA 3KL0A 4LNRA 5F7LB 5IY5B 3QJUB 1OWWA 2EYTA 3LS4H 3RWIB 4WFGD 3U9PH 1RJLB 4HS8L 2A83A 1L9OA 2KDYA 4QHMB 3O8XB 5EBGA 1D6EA 3G6DL 1YEIH 2R4SL 4DP6X 3G5ZB 4HPOL 3S97C 3V5DB 5EU7C 3OAYH 1HZLA 3DTXB 3F12A 4JZNA 4PRHA 4EVNA 3ARBB 1UVQA 1MCFA 2V9RA 4OAWA 4LVNC 3WNJA 4KROD 4BFEA 4F33B 5I1DB 3L9EA 1W0WB 1EEUA 5D6CA 5LBVA 2CM5A 3FNKA 1UA6H 4L05A 4ZUTB 1E9PB 1YQVH 1UWGH 1T21A 4GBXC 2NY3B 2HLAB 5KVGH 4LARH 2AV1B 2J43A 2QADD 1EERB 4QCIB 1DLFH 3MJ7B 3BVDB 3AAZB 4QRRA 4HIIB 2WP3O 2DS4A 3FSWA 5I1GL 1L3NA 4L4TB 2Z0UA 4YO0A 5FEBA 1USQA 4XPGH 3F62A 3ISYA 3ZRSA 2VW4A 2YMOA 3ATEA 5EFIB 3ASNB 1NIAA 4O9HH 3TJHC 1JAEA 3LEVL 4MCYB 5JR1H 3QEQD 4CSTA 2HJKA 2H0FA 5K33A 2OJEB 3K6SB 1JGEA 5EIQA 1RZJC 1FNSH 1R19A 3MLYH 4ZPTA 5E1IA 3SPVA 4YK4B 3UTZB 4YSUA 1TU2A 2ENPA 4HMCA 4JFFD 5LB1A 4YWGH 3MJWA 3Q9QA 3FMGH 4X7TB 3PXHA 3HZ3A 1CL7H 5KVEL 5CS7A 4CDHA 4XMLH 5T3ZL 2R29A 4HKBA 5CJ8A 3NIGF 4NBXB 1I7UB 3ZDZF 3V5KB 4I48B 3WMSA 1A1OB 4BIKA 3ZE0F 5F8RC 2FT8A 1NANI 3QGVA 3OAWA 4JY6A 3MRDB 3WEXA 2YPKA 3T8VA 3VFRB 1MXGA 1TQSA 4CC4A 2W0KA 5DUPH 1D2PA 5ITBL 4E2OA 3TU6A 4ICWA 4JFEE 3JV6B 1KGUA 2PWGA 4WFFD 1KB9J 3UIYA 4YHKL 2HFFA 1G1YA 4K5PA 4XNMA 3QUXC 2AXFB 1MCSA 2Y6TE 3EDFA 5B1AB 2EVHA 4M48L 4BFNA 1A7NH 2HKAA 4FA7B 3AITA 1KYOJ 3FN0H 3MX0B 4OQTH 1OWRM 4NQSB 3WD5H 4IGBD 3QIWC 3UYPA 4I2XB 4AYFB 4WO4D 1QACA 5E4AA 3W37A 4K07A 1FV1B 2W0FA 2D4DA 3QIWD