4UTCA

Crystal structure of dengue 2 virus envelope glycoprotein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
395
structure length
391
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
total genus 75
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utcA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utcA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utcA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utcA03
1RERA 4FFYA 5KVDE 2ALAA 2GG1A 3UYPB 4FFZA 3N42F 3IRCA 5B1CA 1Z3RA 4UTCA 2JV6A 3N40F 1PJWA 1OANA 5KVGE 2H0PA 5H37A 4UT9A 1UZGA 3UAJA 3UZVA 4GT0A 5LCVA 3J2PA 1ZTXE 2HG0A 1SVBA 4FG0A 1Z66A 3C5XA 3P54A 5GZNA 3WE1A 3N43F 4UT6A 3I50E 1OK8A 5IREA 3G7TA 3UZQB 4UTBA 1S6NA 5JHLA 2JSFA 5GZOA 3C6EA 2JQMA 4AM0Q 3N44F 3J27A 4UTAA 1TG8A 5LBVA 4GSXA 5IZ7A 5KVEE 2R69A 1URZA 2I69A 5JHMA 3UC0A 4BZ1A 1OKEA 3N41F 4BZ2A 3MUUA 5LBSA 4AL8C 5AAWC 2V33A 5KVFE 4X42A 2P5PA 4L5FE 4ALAC 3UZEC 2R29A 5AAMC 3VTTA
chains in the Genus database with same CATH superfamily
1MW1A 1ORSB 3KPRE 1PZ3A 1GOHA 1WH0A 1EHAA 4GLRI 1Q0XH 3KCWA 1GY2A 4Y5VA 4P23B 1EO8H 1U2YA 4OTXL 2PO6C 3ARDB 1MVUB 5AOZA 1Q9OA 5FIEA 1THAA 1CDCA 3PGDA 4NBXB 2JWYA 2NZ1A 3HG1E 4L0PB 1PLBA 3HE7D 3ZN6A 4N24A 1FZKB 1X6NA 1B0IA 5E2WL 4NERA 4W9DC 4Q97A 3NAAH 4HEMA 5KYYB 2X4OA 3JWNG 3ZE0E 2O6DA 5E8DL 2XXMB 4H44C 4ZUUB 3WIFB 4WUUA 5ICYB 4WFHD 3MOAL 5TE7H 1UB6B 5DUPH 3KAAA 1YY8B 3ZU8A 4PJ8B 1II4E 4LB8A 3MBXL 5D5MF 1I7TA 3G5ZA 2IBZY 1A6WH 1MLCA 5KSBF 3M1BB 2G3XA 4DEPC 3CZNA 3H2PA 3RUGA 1ZS8A 1ZVSB 4HU8A 3HB3B 3VE0B 5KEZA 2D7TL 4NUPA 4ZMNA 4UINH 2I60H 4LPCA 2EC9U 2R0KH 1RU9L 1HNYA 4X50A 3O2WL 5IB3A 1BVLB 1P6WA 1KACB 1XXDC 2Y5TA 1D7BA 1GYUA 4Q6YA 3FO0L 3MLWH 3ZSSA 4IKIA 3CN3A 3TCTA 2H47C 3NP3A 5DRNA 5MEOB 5LGYA 4WQOA 12E8H 4V2BA 2CCWA 1CFQA 5HHVH 5D71L 2BP8B 2FYYA 2OCCB 4PJIB 3HG3A 4CC0A 2FTAA 1UACL 3KYKL 4MZ3A 5F21B 1YEFL 5KVEL 4J23A 1QP1A 3MV9D 1PZ5A 1UXSB 1I9IL 3LS5L 4S1SH 3MRFA 3ZHKA 2GYSA 1P4BL 1MFAH 5HDWA 4M6NL 5IBTL 4FA8A 3RFZA 2HFEB 3WU1A 5TE4H 4DW2L 1WCBB 2F58H 2PPAA 1H15A 3PABB 5EU7E 5CCKL 1OSZB 5D1QA 5F7DA 1GZHA 5E0QA 1EJ8A 4MAYC 2V37A 4KUZH 1C16B 4JHBA 5FA3B 1I82A 2BHZA 2YD5A 4Y2LA 5IGXH 5AOLA 2VZ3A 5DS8B 3LPFA 3FCSA 4U0RC 3WG7B 2BOLA 1CICB 3L9BA 4NKDA 1CE1L 3H85A 3TXAA 3L9YA 3HMXH 4MXQC 3NZHL 4JL2A 3LKOA 3BSZH 3W9EA 5KW9L 1VDGA 2G3MA 1YEHH 4N2LA 4DIXA 4LEEA 5E08H 3N2JA 3W0WE 3IB4A 3O45A 4LHUA 5HDBE 1FZJB 2FIKB 4LHJB 2CO7A 3OMIB 2CJ3A 4BK5A 4KV5F 3NIDF 3N9GL 1PVHA 1JPGB 1KIQB 1VFMA 2MSPA 4ODTL 5EU5A 4MDJB 4JDEA 3TVMD 4UQBA 3JUZA 3AU1A 4P46C 3QUKB 3BE1L 2WUBL 3CLEH 5CEYA 2YBRA 5FA4B 4AKPA 3PWUB 4YVUA 2IH3A 1AO7B 1HNGA 1YQVL 5AFAA 1GGBH 5GS1B 2DQUL 5C07D 4NC1C 3LV3A 3GSNB 4KUCF 4YAQA 3FQTA 4MNQE 5EUOB 5H37A 4X9IA 1EAOA 2PR9A 3JTSB 2JKJA 3P0VL 4U05A 3SKJH 3IS0X 3O0LA 1A7QL 1H19A 3KNBB 4QRAA 5C9JB 2YKLH 1MOEA 5HYSG 3KYNA 3OGCA 4PJFE 4X8CA 4PG2A 3K6SB 4Q7DA 3CIAA 3M7OA 5CR8A 3BPCA 4R0LC 2XWRA 4ANKA 1JPSH 4F37K 1ZSDB 5CN1A 4FERA 3PGFH 1D9KA 1A14H 1IAIL 4YFEA 1OTSD 2B2XL 4QRSA 2BNRE 4BSVA 4OF6A 4ZFFA 2FWOB 3GIZH 2DQFA 5I18H 1V05A 2B14A 5EU6B 2PYFB 3A3YB 3IMTA 4P5TA 1ZSHA 1ZK5A 2YMTA 3U2JA 4JGNA 1EVUA 2ADGA 4OZHB 3IEAA 3JT0A 2XWBA 5F1NB 2Y2YA 3WTTA 3W39B 1HCFX 4HSQA 1TEGA 4HXBH 1UOVA 4UAOB 1AGEA 5AAMA 3ZBMA 5IHZA 2HLAB 4X5QA 1BWWA 4Y19D 5EIIA 2CLZA 5C2UB 4F15B 2VYRE 2R23B 3MNDA 2BX5A 5DJCB 1NC2A 4IBWA 5DTFB 2DLIA 4KDTA 1U8JA 4R83A 5C0JB 1LK2A 2R0ZL 2W5PA 1EMTL 1F6FB 4GW4A 1JERA 3DVFA 4CVXA 4H26A 1IM3D 4K3GA 4J7RA 3C2AL 4QGTA 5F0JB 4ZYKB 3DMMB 3PHOA 3WJMA 3QWOB 4HYTB 5DSCA 2HFTA 2VQ4A 2ATPB 4LDCA 4R7NA 2KZBA 1QSEE 3FT3A 5D1XD 2VR3A 1HOCB 2VDQH 4N8PA 4Q9BA 2VMFA 1XGPB 4KBPA 1BEYH 1FCGA 1PEZA 1SFDA 2J8UA 3BP5A 4PRPD 4WO4B 2EKSA 4RCAA 4Q2ZA 3U1SL 3K6IA 2G9KA 5EOTB 3WNNA 4ODVH 4P57B 5F1IA 2JCCA 4R2GB 4PJ7E 1PLGH 4AT6B 2ESVD 2IFGA 3V4UH 1PG7X 3RWCA 3CHQA 3GD1C 1N10A 3QO1B 1PNCA 2ZCLH 2VRAA 5KVGH 1UEMA 4F92B 2XHNA 1SPDA 3VNYA 5FYJD 3NK4A 4KGLA 4LCCB 4Y5XC 4PREA 5IMKB 5TFSH 2EYTB 3WN5B 4HJTA 2OX5B 5DD6A 1J9QA 2NDGA 2FGWH 4X7CC 3F3HA 1N6QH 1JZ7A 4ZMAT 1G0DA 2A74A 4TQPA 1DEEB 3FQWB 4LSTH 3UIYA 3F2LA 4YLBA 2ATKA 3CK0H 4X4ZA 4JY4A 4H8WL 3HS8A 3TEYA 1PZ2A 3G6DH 4M3KB 3K71B 4B9PA 3MYJA 5GIRB 3F5WA 2IMNA 1O6SB 1QATA 2UX7A 3TO4A 5I6XB 1P4IL 4HKXB 1O7DE 2XYBA 1X9LA 3RIFK 5JMOC 4JHAH 4KQ3H 5K93A 1TNMA 4U3SA 2N4IA 1D2OA 3V0EA 4L1LA 3ZY7A 2WUCL 3H0TA 4YL9A 1IAKA 3P3SA 3TA3B 4EN3B 2B59B 5CF3A 1TMCB 2BCKA 5EB9A 3MRBB 4WEBL 4NFDA 3DDGA 4L3FA 2JKRM 4JQXA 4B3VA 1LP9A 3GI9L 1ETJA 1Q9KB 3F00A 4WW1A 3DI2B 4OF8A 3L4WA 2UZXB 2C4FT 2B1HH 1JWSA 4R96B 4AJWA 2NNFA 3KWXA 1O5DT 4JQIL 3ULUF 1XGQA 4DKEL 3OJMB 4CC4A 2CBQA 4UM8A 2H41A 5LKNA 1YJDH 4URKA 1H3TA 1HHGB 2Z6FA 1PBYA 2G9HA 5AW9B 5F96L 3U82B 1SJVA 2PTTB 5AW4B 5JW3H 4Q9RH 4PRBB 4ZNEA 3QYNA 4E42A 1M9WA 4OIIL 2N1TE 1LMKA 2YC1B 2XA8H 2YSSA 1DQKA 1ITBB 2NUPB 2VLMD 1HHKA 3UTZA 3QRGL 3EZ8A 3QJFB 4P9HL 4UTBH 3X11B 3N5AA 5JLZB 4UDUB 2ZUQC 3GIVB 1PNDA 2ENYA 5JHLL 1NGXB 4YFDB 2DZEA 2YS4A 4L8SB 1QHQA 1FFNA 4G5ZH 3REWB 1MH5A 2HP4A 4HHGA 4PJDA 2YR3A 4HFUL 3LZPA 4NN5C 1LMIA 5HI4C 1NICA 2RJMA 2Y5QA 5GGSA 3ABLB 3DUHA 2VSCA 1SGKA 2W81C 1XCQA 3MX0B 1H3XA 4HFWB 4QXUH 1N7MH 3RX9A 2NY6C 3M7FB 3FN3A 1DANT 4A7UA 1HKLL 2DB8A 3G5VB 4BFBD 4GS7B 5F1SA 3ZYZA 1Y6KR 2JF1A 3GQFA 4EUPB 2V8LA 5T8IA 2VGLM 3KDMA 3K8MA 1KGIA 5CJXC 4KITB 1J5IA 1GOGA 1QFHA 2DEWX 4DO5A 2V4LA 3TZVC 3ZKNC 3H42L 3KW7A 3GJFB 1BFOB 4QCIB 3MV9A 1PDKB 1YN7B 3KYOB 2IPTH 3UAEA 4AX3A 4P4RB 2Q3AA 2OSWA 1KTLA 2LOEA 5C8JB 2O72A 2E47A 2I07A 4YHZL 5HGBA 1X5JA 1XO8A 1YCSA 2X9WA 4A2GA 3U6RA 1EXGA 4R3SA 4FXKC 1QBBA 3I50E 4KHXH 4NO2B 5LUMA 1UUNA 3A4DA 3GLAA 3RL1B 5BS0B 3GS4A 4PS4H 1Z9MA 1FYTE 3UZQB 5KAQG 1IC4H 3FPXA 4RNRB 1IBHA 3D7PA 4Q89A 1AD9B 3DDFA 3ABGA 4KO5A 4HIEA 4KRLB 2IH1B 3TPUA 3PIQB 5DVPA 4RX4A 2F61A 4NKMB 3WDHA 3E2HB 4IBTA 4PJCB 2HVKB 4MAUH 3GGWA 4M7LT 1DBKL 5JHBA 1WBZB 1FFRA 4PVNA 2GJRA 4OFPA 1OAXH 4KI5C 2WKOF 4KXAA 3DRQB 3TVMA 3UL4A 4X98A 3O6KH 1XF5A 5I8EB 1XF3B 3PWNB 3UAAA 5DRXB 2Q7NA 3ZTNL 1TZIB 4U33A 1TU2A 2XFXA 1DQVA 1GHFH 2R4RH 4P23C 5LBSA 4H2AA 3ARDC 4FXGC 4TULL 1WS7A 2P5ED 4PY8J 5B39B 1WF5A 5C7XH 5JHDD 1DUZB 2R15A 1TYRA 2Q76A 1VGEL 1XGTB 5C07A 2ZSVA 4R4FH 3QDMD 1G7IA 3RWHB 1A1MB 1U4EA 2IIJA 1U93A 5A2AA 5GISH 3FN0H 3FYEB 3DX6A 5E1IA 3T65A 2ZXDA 1WFJA 5K9OA 4XMKL 3MUHL 4R26H 2X87A 1ZA6B 3U0PB 3GMPB 4G43B 4ORZC 4ABVA 1F11B 4XPTL 4C57C 2ORBH 4ODUA 3MLXH 4X6DF 3RNQB 5IT2L 3MV8B 5CINL 1SY6H 4H0LC 1G0YR 3DGGA 3PV6B 3GHEL 2V3DA 2DJUA 1M4KA 4N5EC 2MOGA 5H8DA 5IG7B 3IKCB 2EYRB 1WTLA 2R39A 3D0VB 4JY5H 4F7PB 1WC7B 2B08A 2BVPB 4HGWA 1J8RA 3PFUA 1P7KB 1TJHH 4AQ1C 2EQDA 5C6WH 1C1EH 4P3WA 3RGBA 5EF1A 4D9LL 2X6UA 3CX5J 3FO2B 1O6TA 4JVPA 4P2AA 3PPSA 3ULVF 3BWAA 1GGIH 1TTRA 4PWKA 4YZFE 3GXDA 4ALAH 1L0XA 2OXHA 1CTMA 2UUDK 4POZC 5FGCB 3NQIA 1G1OA 3QB7C 1IC5L 4I2XE 1HDMB 1B4RA 2VDML 3MSPA 3CQPA 4OJFL 1MUJB 3L45A 3MC0A 4U1SB 3SODB 4OW6A 3I50L 1V54B 4DGIL 5B8CC 3EXLA 4Y19A 3HKZA 3UTTD 1FH5H 3WKYA 1RJZA 5I74B 2IAMC 3B2VL 3L3HA 3R18A 3QZWB 2XIBA 4TSCL 3OJDB 4FMKA 3Q0HA 3MRMA 3ARTA 5T5NG 1PLAA 4FQPA 2G2PA 1UFUA 2A9BA 1IM3A 2A4ZA 4FS0A 4TSAL 4JCLA 4DP2X 3B4NA 1HHIA 2YSTA 4PSPA 4TNVK 1PD6A 5JQ6L 3MZGB 3MLRL 4EO5A 2QVTA 5E8NB 4CJ0A 1PPIA 2Y36L 4G8EA 4TLKA 5A2LH 4U7MA 1IKNC 3OAUH 5GRXG 2CO6A 3GSOB 4A7GF 5J06A 3E9TA 3FPYA 4M02A 4ZOAA 5D1XA 3MRJA 3QR2A 4I88A 4X6CB 3WFHB 1QI4A 4HZ1A 4PRPA 2EH7H 1GPOH 2QEJA 1R0AH 1C5DB 2XTSA 3P9LA 5D7JD 4YSSA 1QABA 1W9XA 3HNSL 3MPCA 2NSXA 1CLCA 5E1HB 4J3VA 3VB8A 2WLYA 3W82A 2ESVA 1NBCA 5LBVA 1WPCA 5DD3H 3NCJL 4GRWH 3RWIA 4YBQD 3RJQB 1HK6A 4OM1L 1NSNH 3CZFA 4NAQA 4Y4KB 1H3VA 3IAGC 1SN2A 4OZIB 5HGAA 5EZLB 1OQXA 4I48B 2YAFA 4HJ0D 1EJFA 4F7EA 4OD1H 2QR0A 1CS6A 1G9MH 4K3JH 1A7RH 4TQEH 1ZV2A 1IFRA 5F9OH 5IVXE 2ZIDA 3U48A 3FNKA 3QGVA 1C08B 1WAPA 4H20H 5D7LD 4DVBB 2OI9B 1NIEA 4GG8B 3T1FA 4FFVD 3VXMB 4Y9EA 1FO0A 3J07A 2FUQA 3QDGE 2APXA 5GS1C 1RI8A 5BW7A 4W4OC 2E7LA 1K8DB 4QMEA 2DQDH 3FU5A 2MJWA 5D7IE 5L7XH 2MQ3A 1PY4A 2WO4A 5E7BA 1M53A 1CGSH 1RIUH 1T7YA 2CDFA 3FMGL 5CHNA 4YWGL 3W5NA 3BSHA 2B0SL 4OCYL 5I15H 3RWJB 5BNXD 2VITA 5FKPB 4TVUA 1F0LA 4AV0A 3EOTL 3L3IA 4P04A 4PGCA 2JK5B 1YY9C 4HKJB 1YPZE 3IGKA 1A3LL 3B9EA 5AKTA 4PUBL 3BAYA 4ZS7H 1TFPA 1CXHA 1FAIH 2H1PH 4LFHG 1JXFA 5CP7A 4XP9H 1AG6A 3ENEA 5A2JH 4G8FB 4UT9A 5GJSL 4AJVA 3LQAC 3DA0A 3NH7L 5D72L 2P26A 3KW8A 4OZFB 5IB1A 5T3ZD 5DR5H 4F8PA 3AG3B 4OGYH 4RMBA 1J1XH 2XSKA 2V2XB 4JRYD 4YK4C 1HZHH 1OTUD 3CPUA 2Z7UA 5B4MD 4ILDA 1QSZA 4KWUA 2ZCZA 4NUJB 1KCRH 4RGNB 5F6IC 2BIQA 5BV7L 4JANB 1IIKA 1E3FA 3C60D 5DRWA 2J1KA 5DUBA 5I0ZA 1KXTB 4PJ9B 5IHHA 4MA7H 1X5IA 1MCNA 4LOUC 4P49A 3D4GA 1HJBC 2G3NA 4HPYH 5ITFA 4AEEA 4HLZG 4YHYB 4I0CC 2I5YH 3SKMB 2NNRA 1HYSC 2GBAA 2HG5B 3QUYD 5EUOF 3DO3A 6PAZA 1QX1A 1T4KB 3UBFA 4LSQH 2VL5A 2C9QA 1A25A 4YX2L 1VKXA 3FTVA 3HC4H 3TYFB 1XGUB 3V5DB 1TUPA 4UUJB 2VDOH 1Y6NR 3UXFA 3HVNA 3RVUC 2CMRL 2CNZA 1C8QA 1U8HA 2OTUB 3MLUH 5CBAA 3G5YA 4FG6C 4QNPE 3BZDA 1I8UA 3AB0B 1TQBC 4XXCC 3EGSA 3ZLQC 2YD0A 4HGMA 4NWTH 3RTLA 5LXGH 4WO4C 3IGAA 4P5SA 2QQLL 2VW6A 3BWSA 3MI6A 1KWGA 4G1EA 1GJUA 1RUML 1T2QL 1MAJA 1TZHB 2AXGB 2HPOA 3DGCR 3JTTB 2H32A 2VMJA 3NJKA 5D6CB 2RAMA 5D7KD 4NKIH 2O1AA 1PFCA 4KH2A 2W0FB 5GHWL 4DZBA 3HAEG 5DJDB 1T03H 1KJ3L 3B5HA 3KLLA 2HRLA 3JV4A 2I9TA 4PCKA 4MNGB 4XBPA 1MCOL 2APVA 2Z3FA 4L05A 1X5HA 1OE1A 4IJ3B 4OZHF 1W72H 1T1XA 3WN5C 4E68A 1ADQA 4YDKL 4OD2B 4BFKA 3F62A 4AV4A 1O7SA 4ANXA 3QJTB 1AJ7L 4XAKD 2PCPB 2DAVA 1IBZA 1XTLA 3S37X 1H9DA 3K1DA 5HHOB 3EOBA 4A7QA 4NQTA 3O2DA 3EF4A 2H0JA 4X7TB 2FNBA 4KZEL 1BX2B 2NW3A 2ENJA 1YSOA 5C6PB 2ZWNA 4OR1A 2V8MA 4BHUI 3ZDYE 4P2QA 3MLZH 1T1WB 2W0PA 2YPLD 3MNVB 4BZ2H 4NP4L 3EO0B 3ALWA 1PAZA 3I84A 4O2FB 5DMKB 3IGLA 2X1WL 1MVYA 5DMJB 5AZEL 4P5RA 2WQVA 4PTTB 2DLFH 1CL7L 4LP5A 2CXGA 2O61A 3U0WH 3BPLB 4K5MA 4AYBA 2JIXB 3CFJA 1G87A 5FUCC 1FZOB 4EN3C 1KV7A 1GSKA 5IJBC 3B34A 4UV4H 5GJTH 3VWKB 5FCUL 1A02N 5AL8A 1BEXA 5E6YA 2X6VA 1LDSA 4PWGA 4PYGA 2VDNL 5LCVA 4WF7A 3BWUF 3GK8L 1H6FA 2OFQA 3JWNH 4BUHA 4ZPTA 2EDKA 3IXAA 4JM4H 4ZW8A 1NFDF 1MCPL 1MIEL 3DK2A 4YHIB 1BPVA 4I9WD 1JYXA 3ZE2E 4PVMA 4LSUL 3U9PL 3BIKA 3HZKB 4YHLH 3U2SB 3SJVD 4AMKL 5GS0H 1FL6A 4Z3HA 1AG0A 1QLFA 1TMQA 4A6YH 4IGBB 4OVVA 2P5EA 2MKWA 2PW1B 2ZUSA 3ZE1E 5IROD 3RTQD 3P77B 3DO7A 3B5TA 3NSYA 3QDMA 2OMWB 4R4BB 1Q9LB 3LEXB 3NJXA 2HKAA 3BC9A 4GAYB 4FYSA 3QEHB 3FCGA 3HLKA 3RIAK 1IEAA 3QFDB 1XIWB 5DD1H 4GQRA 1GRWA 1AQDB 5F7EH 2B4CC 2Z64C 4M61B 1G9NH 2CKBA 2NXZB 3MACL 2ID5A 3UDWC 3UTOA 4MQ7A 5JW5A 1E4WL 4LPWA 3RAJH 4L3CA 3KYMB 1OLLA 1A6PA 4PHXA 1E5BA 3UROR 3P11H 4JGJA 5C97A 3V4PB 2VABB 1D5ZA 1U42A 4L8SC 1FVEA 4G83A 4RAVA 4YHKH 5CBEB 4IOSD 4JZJB 1NAKL 3RIKA 1KB9J 2AV1B 1DTUA 1UVQA 2R0LL 3BHBA 4QRRE 4C56E 3QI9C 4HCRA 1ZHNB 5ID0A 3L6FA 1O7VA 4FQIH 1REIA 3MV7D 4OCSL 4RETB 2SEBA 3EJQA 3JWDL 4XMLH 5D8JH 5A6IA 3STZA 3H3KA 4AL8L 5HVHB 3AWGA 5BJTB 2O6CA 4HJJH 4WHDA 2D7PA 5EBGA 1DZ0A 5GS2H 5EBWA 3ILEA 5BO0D 2XETA 3BPNB 3C8KA 3GMNA 4GS7C 3OVUB 1OARH 1MRFL 1OGTB 1FG2B 1WDAA 2NY2B 5DZLA 4ELKB 3HHMA 3I9GL 2QJDA 3FUIA 4HWZB 5KUMA 1TZOA 5L0QC 2OKMA 2YUVA 2XWTB 4I3SH 2PYEB 3UTTA 5J6HB 2HX9A 1XVSA 4HX1A 2EEXA 4KJYA 3JV5A 1I8IA 5DJZA 4A63A 3LXUX 5CEZH 2BO0A 2VJXA 5I19L 3VFPB 4ZX4A 3DTXB 4PI0A 4EUPG 4QF1B 1MY7A 3B43A 4IRSD 4Z7UA 4ZUWB 3TBYB 3NZ8A 2GUOB 4CJ1A 3LRHA 2ZSWB 4ETQB 2HB0A 1VCBC 2B77A 2IVFC 1R5VB 3GO1H 3AM8C 3X17A 1QFPA 1R3LB 3MLVH 3MXVL 2MTAA 2DYSB 2R29L 4KAQH 5D7JA 3II2A 3G5XA 1HILB 5EU7C 5EU3B 3GLDA 1BG9A 5AKSA 4AEHL 1U36A 4ORGA 2VLJD 3HLAB 3QIBC 3C6LC 2EJ1A 1IU1A 4PR5B 3BJLA 4XNUH 1YZZA 3VVWA 1H5BB 1HHJA 1Z66A 2MNJB 1ZY9A 1O6VA 3ETTA 5BVJB 2B15A 4JGMA 3VYNA 1U8IA 4N8VG 4Z7VB 3RWEB 1UWGH 3FFDA 2JKLA 3HRZC 3QXDA 2DS4A 2XYCA 3ATBA 4LT7A 3CDGB 3DVIA 4R97C 2XPGA 3WD5L 2FJFB 1A4BA 2QGEA 2QKIC 4K7PL 4X6FA 5K9QG 4HZAA 1J9RA 2P47B 2NCMA 3BQUB 3WS3A 3OMZA 2VDPL 3TIDA 2QPFA 2XQBL 1JNLH 1UC6A 1OCOB 2P42B 3O11A 4WI7A 1A0QL 2J1WA 1G7LB 4Z7NE 3AROA 4YIQB 3EFOA 4APQD 4O4YH 2R27A 2FB4L 3RWGB 1NAML 1NLDL 4LU5H 4ODWA 4IBVA 3L17A 1QNZH 3Q6GL 5AEAA 1ETZB 2UY7B 2WHVA 3SDAB 2YARA 3FT0A 2VXTL 1ACCA 5EFIA 3FQXA 3A67L 4IU3B 4AVJA 5J8OA 2KPNA 4HIIA 3PJNA 1L0YA 1YEDA 3PYCA 2V7NB 1S7WB 1BQ5A 1CR9H 2QHRL 3T2LA 3HHRB 3NCCB 4JO2H 1MZYA 1XGRA 1A8ZA 3ABMB 4N22A 3PWLA 1AHWB 2FBJL 4PRHE 2D03L 5E99L 4JN2B 2WINA 3QAZB 3GRWH 3VM7A 3WIHA 5AD0A 4H8WC 4PJCF 4NDMA 3C5ZC 4JRYA 3A24A 1SHXA 3LNDA 3U25A 3L4XA 4DUVA 1JNNL 3BLPX 3UBXA 1KGXA 2DQTH 2Y7LA 1NC4D 1YEIL 3CVHB 4DVRL 3ZHNA 1AYOA 3VFVA 2GG1A 1FH2A 1F4AA 3C60A 4X4XA 4G72B 1I8MB 3RE0A 1J11A 4KKPA 1KYAA 1ES0A 2BXYA 1ICTA 5I74C 4P2YA 5LAXA 4PJXB 4DP4X 4MLIA 5J1AA 3GSUA 5TK4A 1KGWA 2Q8BH 3IE4A 1NOLA 3QUYA 2DWDB 2UYLA 2F5AL 1KXVC 1MRDL 5TGBB 3T4YB 3ZX1A 1NEZB 1MW0A 1ZTXH 3IU4H 4JQVC 1A21A 4XPAL 5E5RB 2YJLA 3I6SA 2YUZA 2HFFB 4PY7A 1M05A 3BN9D 5I8KH 3DPDA 4JFDB 2QPUA 2EDYA 4RAUA 3KJ6L 2HRPH 2R69L 3O6LH 5F7BA 1WT5A 1JWUA 4BQBA 4KKBC 1MHPL 3MMEA 3VFGH 3C09B 1TETL 3MRCB 3FUKA 4PJAE 1H8LA 5I1CH 1PSKL 4RFOH 5K1JA 5F6HJ 2IDTA 1HESA 3WHE1 4N28A 3HIZA 1MSPA 1JZ5A 2X4TA 4NQCB 1QTSA 4XAWH 2FHCA 2Y7SA 4ZOCA 4P9HC 5IB4B 3KLHC 3SKNA 1A6AA 5DRZA 4WV1B 3PWPD 4X9BA 2A6DB 4M3JA 4N4YB 1DSFL 3CFUA 3IDYB 3LD8B 3OKDB 2ZQKA 2A9CA 3ZIMA 1L9RA 2VN5A 2OI9C 3RVVD 2CJTA 4OLVH 3OZ9H 4PG9B 1BF2A 1XDTT 3QHFH 4GBXB 4HIJB 3TWCL 1ZT1A 4U4IA 3STLA 1OAKL 4HISA 3KEHA 2ZICA 3BKCL 4N2DA 1NGWB 3L16A 4LL9A 5L4MA 1IVTA 3VI3F 1Q4NX 4PQXA 4BGDA 3CHOA 4PJGB 4LCIL 3IM1A 2B3RA 2VZUA 1OB1B 5E51A 4KJPC 2DI7A 2APSA 1UD2A 1KELL 2NY0C 1ASQA 3GSXA 3PF2A 2DI8A 1O0VA 5F7WC 3W56A 5L9DH 4BWUA 3I3EA 1DQLH 5F72S 3PL6D 3IDGA 4HEPG 2W65A 5I23A 3DUUA 2X42A 5GZOC 5MHSE 4YC2B 2HN7B 4X6CF 5MI0C 4IBUA 3WMSA 2XN9D 1VPOH 1YAIA 2J4WL 2HWZH 5EEXA 1F45A 2K7QA 3FTZA 4GXFA 1YEJH 1ACYH 1O7DC 2OR8A 4MA8H 1QLEB 3LZNA 5DYOB 5HPMA 3WUZA 5DK2B 1Q94B 3MKKA 3NSCA 4OSUL 1M6OB 3FRPA 4F7TA 1IM9B 1MAML 2CE6A 3APCA 1WAAE 3BDXA 3GBDA 4OZGF 1WYJA 3W11C 4Q9QL 1RZ8A 5MEPB 4OZIF 2Z31B 5F88A 3LB6D 4M43L 3RUGE 3VW3H 2ETWA 3BAIA 1UJ3A 4NM8H 1KJ2A 1RP9A 5IROA 4Y2OB 3I9AA 4DWHA 4F7MB 4QGYA 1JZIA 3HE6B 3RTQA 3UJIL 3VG9B 4RGNC 3J8F7 2VLLB 2XOTA 2F7RA 1RZQA 3ZT7A 1RK0B 4PJ9C 3IS1X 5HGGS 5DJ2A 4L4TB 1EO5A 4XCCH 3SE4A 2OJEB 1YEGH 3L08A 5J56B 4LCWE 3O3EA 5JIHA 3O2VH 2XKNA 2D73A 4GT0A 4QJ3B 3REVA 3W5MA 2ODIA 2YWYA 1D7FA 1DFBL 2IADA 2FD6L 2JI2A 4HOWA 4UQCA 3DV6B 4NJAL 1ZAGA 1BZ8A 4XPBH 1P2CB 4PIRF 3G6AB 4IOSA 3T3MB 1F5WA 4QO1A 3EKCA 1MNUH 2GIMA 4G6AD 3FSAA 3L9EA 3R4DA 2AABH 3AB0C 4E9XA 3B3IA 2VXVL 1NGZA 3UYRH 4FQJH 4U1HA 4GRWF 3QQNA 1GAFL 4KUCD 3EJPA 3MV7A 1RZIB 3EGDB 4TVPD 3D39D 4X9YA 2XZCL 4PLNC 2FX7L 1NMAH 4FQXB 1NKOA 1UWEL 2BVOA 1Z9SA 3EO9L 5EIQA 4NRXA 4NZ8A 4ACPA 5T3XE 1EHLL 3FK3A 2M2DA 4ZFZA 5B3NA 2E0PA 2J44A 3WEXA 5FUZH 3WSQL 5I1JH 4JG9A 4IJ3C 4WW2B 5PAZA 5LAPA 4QHMA 3TBWB 1EIBA 1N6VA 4S1DC 1QLRB 1FFOA 5FHBL 2XXCB 4FZEL 3S4SA 2DD8L 4QHKI 1E5AA 1AIFB 1A64A 4IRSA 3LKRA 5SWSD 3HFMH 4OB5L 5ICXA 5GGTA 2HSIA 2CHDA 4AM0B 1E6OL 4HUWA 1NJ9A 2HA1A 2K8QA 1N5AA 3QP3A 3GZKA 5E6IC 1AH1A 4FZ8H 2HT3C 4JDVB 3CX2A 1KIRA 4GOSA 5BUPA 1T83C 5G2NA 1TEYA 4Y16B 2QZ5A 3CFMA 3MCYA 5JHAA 3BESR 3IPFA 5E2UL 2JQAA 2A99A 5ERWA 3BRGC 2VLJA 2AK1H 4KXZI 1BZ7A 2BOBB 3Q5TA 2Y6TE 3BPLC 3IMUA 1QQDB 1ZE3C 4HLEA 4XMTA 3RBSA 4IRJD 2VERA 3UPRA 3EBAA 5L88L 2ZYRA 4G3YH 3VWKC 2H9GB 1E2VA 3DKHA 4WLCA 3LIZL 3C5JB 2ZKWA 4JRFA 4DQAA 4GSDL 5JOFB 4NCDA 3D0AA 1NCHA 2F5BH 5SWZD 5EPMA 3T09A 2WP3O 1L6XA 3QQDB 2CU9A 3GZPA 4WZ9A 5F3HB 1HTYA 1CD1B 1OVZA 2F54D 2ICEA 1T7XA 5DEJA 5B38A 3A6OA 2VM3A 2GCYB 4IGBC 1OANA 5HHME 1ADWA 3T6XA 3S35X 2NT0A 1YNLL 1WFMA 2BSED 5FGSA 2G5UA 5LB1A 3V0WL 1LDPL 2XIDA 5C08D 4QOKD 4YBHA 4OGZA 1E2ZA 1XIWC 3SDDA 5AUMB 3KBHE 4BA8A 4X4YA 3IVKA 2Z1KA 1IGIL 5I73B 2A77L 3LZRA 4APQA 2QQNH 3DYPA 1D2PA 3TJEL 1DBMH 1YMMB 4OV5B 2X70A 1HHHA 4LF3A 4S11A 1ZDQA 3FUFA 3VJ6B 4I0PB 3O0RH 1EDQA 3D07A 3DBSA 2XNAA 2WXGA 3HJEA 3R1GH 1ORQB 4JZOA 4MJJA 5T3XL 4JZJC 1J05A 3UTPD 3Q7JA 3MQIA 3VQLA 4FC3E 2XTJB 1KYOJ 4MMZB 3GM0A 2XVGA 2K78A 2OMUA 2WSPA 4JEGB 1TTBA 1G7QA 2WANA 4M8VA 4PJBE 1EVTC 1ROCA 4AEIH 1EEZB 3QUMA 4MVBC 5HVHC 1CFTA 4LVNC 3CFTA 3QNYA 3IJYB 3RLSA 3GMMA 2J8UE 3BPNC 1NC4A 1BV8A 3GSWA 4UTAA 1WFNA 1FORL 1ZHLB 1F02I 4KFZC 3APMA 5JR1H 3NIGE 4NC2B 1ASPA 2ZOKA 3SO3B 4Z6AT 1CXKA 1OKEA 4ZXBC 1WZAA 3ILPB 3I6LE 4FL4C 3GJEA 2VM4A 2E75C 4LDEB 3X13A 5I1HH 3BPOB 2Q8AH 5ETUA 2HKHH 5EEZA 5DUMH 1H6TA 2RB8A 3U46B 2ICWA 2AK4B 2L8AA 4FTVB 2FWUA 1RJYA 3NP4A 5MERB 4DSYA 4Q6IB 2LT9A 2AEQL 1NTDA 3BQVA 3U30B 4WAFA 1YECL 5IKCA 2VR6A 3DOSB 2Y7NA 4KVPA 1I1YB 4YSCA 1KBGH 3KWUA 2PKDA 4FRWA 4NZDA 4OY9A 4UV7H 2V7HB 3ULUD 1PZSA 3WY1A 2OTWA 4ERSL 2BFVH 2BCMA 2DQCL 4MB4A 1T22B 1A66A 5BV7C 1Q0YH 3QH3B 1IX2A 5C0AD 4MJID 5K39B 4LLVA 1ID5I 2VE6B 1DJWA 1H5BC 1CXEA 3NVQA 5CR1A 1XX9C 3INUH 3QULA 2AERT 4ONGL 5E94A 3GC3A 5D5MA 1ZLEA 3RX7A 2MFNA 2CRIA 3PWPA 5KSBA 2AF2A 4Z7IA 2P7TB 4FQHA 3FO9B 1JRHI 2Z0UA 4JPKH 3TNMB 2Y22A 2BS8A 4XB7A 4UQ2A 3KPSE 4ZFGH 1EFXD 3IFNH 2CIIB 3O6ML 4H8VA 1Q1JL 1ZPLA 2Y6SC 1A9BA 4JFTA 3UMNA 3V55A 5EUKB 4DQOH 4NCC2 3FUDA 5JA9A 1E28B 3DIVA 4MZ2A 1MCRA 1EAQA 3Q9QA 3VXOA 3QPXL 3WLWD 5JO5A 1KB5H 2ITCB 1J0IA 4UOW1 5DMIL 3GBLA 3HI6H 1EXUA 2VIRA 3DJTA 1IEHA 3SD2A 4WCYH 4PJHB 4XPFH 3T2OA 3QNZA 1K8IA 1MEXH 5DJYA 2PTVA 5EDXA 2C7FA 1FSKB 3IN2A 1UOKA 2AJVH 3SDAC 2P24A 1ILSA 1WBYA 3V10A 2XN9A 4K8RD 1TO4A 3NTCL 4DK6A 3LQAH 3UGXA 1RFDH 1LGVA 1N12A 1ASOA 1Q9OB 4OLXH 4UNUA 5FO7B 3ZL2A 1KULA 3EBHA 3FN9A 3PGDB 2LU4A 2XX0A 3MRQA 1FNHA 3FU8A 4GG6E 4YUEL 1AHWC 3WHXA 1FL3A 4HLZH 1TG8A 5BZWA 1W0VA 3QWNA 3QYCA 5M94B 3OKLA 1AR1D 3BI9X 3M6DA 4ZQKA 2X4OB 3VSUA 5IBLD 5KVFH 4N9GA 4WUUB 2NXYB 1F1DA 2PXYC 4K94L 1RJLB 2RALA 1NINA 4L1DA 1DQDH 1OT2A 2EYSA 1DCLA 5D4HA 5I6MA 1S3RA 1I7TB 3G5ZB 5I76A 1TJXA 3FFCB 2J5WA 4MX7A 3NCXA 4G6JH 4XTRD 3MJ9H 5CIPA 3FUEA 3W81A 1ZS8B 1GS8A 3S3JA 2BZCA 1JPST 3SYQA 2Z34A 3T3PE 3HNVL 1W0WA 2HRHA 4XN1A 5IB3B 2V9RA 3ARFA 3HAEH 2Y5TB 2X40A 4A66A 1J8SA 4OTXH 2N3JA 1V5JA 2D0GA 5IJKC 4XH2A 3D50A 3EG9A 5DRNB 1KBBA 1JDDA 2OAAA 5J5EA 2AXWA 4JVWA 4CA4A 4MCZA 4Z7WF 5CFAA 2W91A 1CFQB 3H2QA 1NEZG 3PWVA 2I7SA 5IB2A 4I1PA 4IOIA 2FYYB 3C09C 4I77L 5E2WH 3ZTJH 4WK2B 3WEOA 2VQTA 5E8DH 4FX5A 5C0FB 1TQUA 5AW3B 2OULB 1E5UI 3MOAH 3MRFB 4E9SA 4FNUA 2ENQA 3DX0A 2F8XC 2R8SL 3PU7A 3RFZB 1U58A 4CN6A 3MBXH 3LY6A 4OF7A 2WBJB 3CVBA 4GUQA 1H0DB 1QBLL 4C4BA 1NPUA 2G3ZA 5D1QB 1DP0A 2R7EA 4N2BA 4RGOH 4N86A 5F7DB 5F89B 5E8EA 3MA9L 5B1JA 4WV1C 4B9ZA 2IGFH 1T89A 3MREA 4HT1L 4TM9A 4QUOA 2D7TH 2FJGA 2LTQB 3QNXA 1WZKA 1INQA 1RCYA 1RU9H 1CCZA 2V5RA 3APFA 2YEZA 4A2LA 3O2WH 3QEQE 1F90H 4DP9X 3AITA 4JKWA 4PJXF 5HGHA 2EDXA 5IUCA 4KKAD 1JNJA 3LKOB 2KZ1B 5DJXA 4PN6A 3GSVB 2NZ9D 4G8GE 3FUMA 3W9EB 3V7AE 3ULVD 2JJTC 3QQ9C 4MNHA 3JWDC 3ARYA 3EDJA 3O45B 1QEXA 2JB5H 1G6RA 4JFQA 2CO7B 1Z7JA 2AAVA 4JG1H 4KROB 3E38A 2FEEI 2LQRA 1JYNA 2AS5M 3KYKH 1XWVA 1YEFH 3LH8A 4WFEE 1EJOH 3AU1B 4YC2C 1G9EA 4BFEA 1I9IH 3LS5H 5CEYB 3QR1A 5FLUA 1P4BH 1S7RA 2YBRB 3QUXD 4M6NH 5IBTH 4P2RE 1MJ7L 4DW2H 4AQ8C 1E8YA 3LKNA 2AKRA 2EINB 4KKQA 5CCKH 3D69A 4GUCA 3CCHA 3NCEB 1AP2A 1D7DA 3Q8AA 3LV3B 1IGTA 4YAQB 2VQ1A 4CGUB 3FQTB 5SWZA 4G7QB 2JJUA 2Z31C 4Z7QF 2BDNL 2F54A 3VFNA 1AKPA 3CFDB 3N6YA 2JXMA 1KZYA 1XSIA 3NZHH 3NACL 4HWEL 4OCLC 2WNGA 5I5IA 3KYNB 3OGCB 5J12B 1T04A 2AI0L 2BSEA 1BD2D 3LKPA 4WU7A 3BPCB 4A2FA 4BSWB 2MCMA 5C08A 2MCPL 4QOKA 4QXTA 3G08B 3S3DB 4ZMTA 1D9KB 3LYRA 1WA0X 3WFEH 5BPPA 3TBTA 3VTTA 3N0AA 3F85A 2R0WL 1NUDA 5T1JA 1JF1A 4NRZA 4C8XA 1GYVA 4CMHB 2BRRL 1E40A 3N9GH 3F6IA 3Q13A 3OHMB 1J1PH 2Z92B 2E6PA 3MUGA 4G5AA 4Y2DD 3EBIA 4HS6B 1T80A 5LJYH 3BE1H 2WUBH 5CSGA 4BZ1H 5FB8A 4JZNA 2ADGB 4GP5B 1IAOA 2XWBB 3WNKA 1V7MH 4WSKA 3BO8A 4MYWB 1YQVH 2DQUH 1AGEB 1SVCP 3K6DA 3OC8A 3OSKA 4ODBD 4XVOA 5IHZB 3E9UA 4U6XA 3D9AL 2Y07L 5EIIB 3S2AA 2CLZB 5IWLA 3LNIA 1NC2B 4NI3A 3IJ8A 3KPLB 1U8JB 3VCLA 4FYRA 1PG7L 3ZMRA 1QBML 1Z9NA 4GW4B 3FSWA 4FQXC 3UO1L 5K1NA 2VDRB 1NCWH 5D7SL 4CVXB 4H26B 2VB5A 5AW5B 1H9VA 1ZHKA 2W80C 4M6OL 5FOJA 3PHOB 1Z1WA 4ZSOA 5J3HC 3WJMB 1SXZA 3BT2L 2NY5L 1LO5A 3NFSL 3WE1A 1VAHA 3DETC 4G6FB 2KH2B 1EX0A 3HN8A 1IAII 5E0FA 3RZWA 5TD4A 1L5GA 2N7BA 3BP5B 5BRZB 4D3CL 2V2WA 3BMWA 3GNML 4Q2ZB 1KCVL 3ESPA 1CFNA 3PQYD 1DN0A 3QUHA 4E41D 2R9HD 2CO3A 2EC9T 5F1IB 2JCCB 3A21A 3BKYL 3HJ0A 3Q43A 4PGDA 1UOLA 3RWCB 4J3BA 3GB7B 4KKNA 3SE9L 4Q6KA 1AYRA 2YRLA 4PREB 3T3MF 3CWGA 4UYPA 4R9HA 3S36L 1VSCA 2R0ZH 4N0CD 2FUTA 4HK0A 3RL2B 1YO4A 2QPDB 4OLYL 1EMTH 1WAEA 2A74B 2PETA 3B7YA 2FL5A 5E8PA 4DK3A 5K9QI 4PRAB 2ATKB 4HLJA 5B3JF 2CGRL 3RY6A 3C2AH 1QZNA 4JY4B 4N0FB 1X5XA 4N2EA 4XC1L 5AAWC 1FIGL 2YD4A 4NKQB 1P5VA 4OAWA 1X5LA 1IZJA 2OMNA 3MYJB 1QI3A 1A7OL 3WL9A 3F5WB 4FI6A 5TQ2H 4GFXA 3KH3A 3TO4B 3BAEL 2VAJA 5D7HA 4N20A 3V4VA 1KCUL 4WW2F 1EFXA 2H2SC 5AOIA 2I7OA 2ZD0A 4N68A 5H94A 2A0LD 1DJIA 1WZMA 3U1SH 5DQJB 1BGXL 1P7QB 2XWDA 3AS0A 5E4EC 3E6FA 3JVGA 3H0TB 1HT6A 3PP4L 2A73A 3S97C 2Y06L 2BCKB 2VWEE 3H9ZA 1CLZL 2AXFA 2MNWA 3Q2LA 3O4LE 3OJ2C 3U1QA 4EI5D 5KSAA 1HKFA 3VG0L 2Z7YA 1LP9B 2XV2A 4ES9A 4D9RD 1X4XA 4OIAA 1L6PA 4HAFA 1JWSB 3P30L 3VD4A 1DQQA 1RULL 2MOVA 2QV2A 3ZW3A 3TS8A 2Y7QA 1XGQB 1WGOA 3DXAD 4KO7A 5JPNA 4P9ML 4A2DA 4UM8B 2NY4D 2X4RA 1A2YA 2BWQA 3B2UD 2XTJC 4MMZC 1ZVYA 2G9HB 3OLIA 2ZWSA 3HE7B 4NP9A 3B2MA 1VEMA 1IRAY 4E42B 4A39A 3VXUD 4MWFA 3AMKA 2YSSB 4QPEA 1T0NA 4O51B 1P4IH 3UTZB 3CFQA 2F53E 3E8UL 4HWNA 3D52A 3CTTA 1CGWA 1USQA 3NFPA 4B96A 4B9JA 5DU7A 2YGOA 5KWYC 2FO1A 2VLRA 3QJXA 1S7TA 2Y1ZA 3O6FD 4HH9B 4NNXB 1F97A 4FMVA 4NAJA 1FFNB 1SM3H 3FULA 3R8BB 5KYUB 3HC3L 4PJDB 4ZFOA 5I30H 1UENA 3ZR6A 3ESOA 5F7FA 3OMNB 1FO0L 5CJBA 2BSCA 2XN1A 5GGSB 3Q5OA 2EZ0D 1LE9A 2X41A 3SQRA 1XCQB 4YBLB 1MHCB 3NG5A 3GI9H 5F7UA 2VO8A 2WKOA 3WLBA 3AXLB 3FTWA 3QUZC 4NO3A 4J4PC 4Q6IC 1S78C 3IF1A 5DVLA 4S2SA 5DI8A 3KHQA 3GXPA 4LLWA 3NCWA 4JQIH 5K59F 1Z5HA 3ARGC 4DKEH 5K5YA 2JJWA 1JNHB 1UHVA 5ADPL 5ANMA 4TPRL 3KDMB 2F7PA 4EKJA 2BY1A 1U8CA 2C3VA 5DQDL 4OIIH 4UT6L 4GQZA 5KANG 2Z8SA 2ZUVA 1Z0NA 2KLRA 5J11C 1ILUA 3MV9B 3QRGH 3ARBB 1IIIA 4P2QE 3E7JA 3N50A 1L3WA 2IOIA 4D9QD 2OXGB 2QQKL 3D1MC 5D1ZC 3F8UB 4UT9L 1BAFL 3E3QC 2I07B 2R2CA 5JHLH 4A7SA 5HGBB 3CH1B 4QHNA 4GPVA 1S5IL 4CBZA 3U6RB 2VN4A 1FC2D 3GSRA 4N2AA 4EZMA 5HYJD 4CSPA 4R3SB 4X6DA 1S7VA 4UZSA 2VN6A 4HFUH 4XXWC 2X2IA 5G55A 4AE1A 1E4XL 5I8OL 2G0KA 4JAMA 4RFEA 3V6BR 1J8KA 5JORA 4ZK8A 3K2MC 2MCAA 5ISZB 3FS9A 2F2HA 2WXKA 4KY1L 2EDRA 2KYIA 3MRDA 4HIEB 1MJ8L 4Z0BL 1HKLH 3ARZA 4HF5L 1FE8H 1KJVB 1X5YA 2WN3A 1UUSA 4FADA 1FPTL 3BXNB 1S7SA 2YN5A 4NBZB 3VI4B 4BDVA 5LQBL 4HWBA 1SBBA 3GGWB 4Z3TA 1VFUA 3TASA 3HOGA 1RUQL 1MLBA 1U3HC 3H42H 4FXLA 4EXKA 1FSKC 2EDTA 3RVTD 4HAGA 1I8KB 1AS6A 1P84K 4ZO7A 3QUXA 4Y5VC 4LRNL 2XFXB 4YHZH 4U2ZA 5CJ5A 4AQAA 2Q76B 1PX3A 4PGBA 5C07B 1ROWA 4ZMLA 4C59B 1U8QB 3N1FC 4ZUUA 1G7IB 3HI1A 5DA0B 3VRJA 1QFUL 1U93B 1YY8A 4A7GA 3DX6B 3IMSA 5HHNA 4AQEA 1BAWA 1JCKA 2BNQE 2XJLA 4XVTL 4XP6L 3AQZA 2VR4A 4YE0A 2XPYA 1E67A 1TZ8A 4AGQA 1A65A 1S6NA 2ZX5A 3MODL 3VGHA 3W2DL 4ODUB 4L3ED 2EDHA 2W0KA 2AP2A 5CS7A 4HD9A 4O02L 3OKMA 4GO9A 2OSYA 3DGGB 1GSMA 4XPHL 4E9RA 1TJMA 1BVLA 2JKWA 2XKUA 1DBKH 4JFFE 4GKSA 1MF2L 2GBVA 3VXRD 4H7VA 3FW6A 2GAZB 5DZNA 2WVVA 5MEOA 3ARRA 3BWAB 3ZTNH 4QJ5B 2OXHB 3L9RB 4PJHF 2VC2L 3N42B 2BP8A 1DN2A 2WB1A 2DQIH 3HR5A 4M7KL 4TULH 4ZS6D 1SXCA 1ET5A 5ECGA 2BHUA 4JGUA 4ZO6A 4DO6A 4Z7UE 4V2CB 1JF5A 3GBML 5DCCA 4EJ1C 4Y19B 2VISA 4ZTEA 1RJZB 3B5GA 4N6RB 2NY1C 2O5ZL 4XMKH 4QRFA 2V5TA 5A7EA 1IMHC 3RFZC 1IM3B 3COOA 4A7TA 5EEWA 4XPTH 5I1LA 2X9XA 1B0WA 1QA9A 1WD9A 1LO3H 5D1QC 1GZHC 5C09E 5IT2H 2J71A 4G8EB 2H8PB 5TQ0L 4ABWA 2CO6B 1I9JL 5FF6B 5D1XB 3GHEH 1X6LA 4GMTL 3QPQD 5C0NC 3MRJB 5F8QC 5I2IA 5EZIL 2DQHL 2X9YA 4HJEA 4PRPB 5DFVD 2FR4A 4Z76A 2EABA 3B8YA 3P9LB 2KKQA 4D9LH 3PQYA 3L5XL 4D0DB 4E41A 4TLUA 1WCQA 2AQRA 4M1CC 3KPTA 5KYNA 3ULSA 4WEUD 2ESVB 1FN4A 2KQMA 2IPKA 3H7LA 4XMVA 1KBWA 2F18A 1IC5H 1X4YA 3V6OE 1AHKA 4F7CB 1JPGA 1KIQA 3AXIA 2VDMH 3CZFB 3DK0A 4OJFH 3FQYA 3AS1A 2W07B 3I50H 3WGUB 1E5ZA 5HJ3B 4DGIH 1P7BA 1IQWL 4BK5C 1ZE3H 3ELAT 5IJCC 4F7EB 3PJLA 2QR0B 3T6ZA 1OHZA 1QKZH 4M48H 3B2VH 5DHEA 2VR5A 4MLSA 5LG1A 1CXFA 5JXED 5B1AB 2F7QA 4B0MM 2WBWB 3T1FB 5I9QB 3GSNA 1KCBA 2YAEA 4HCRL 4LHUG 4MB1A 1FO0B 4XZUA 3WJLA 5JQ6H 4CW1A 3MLRH 3V9CA 1T66C 5I1KL 2Y36H 4U6TA 5J6SA 3KNBA 1CU4L 5IVOA 1ZPUA 3HMXA 1AQHA 2CDFB 4YSDA 5CHNB 1PYWB 1BZEA 2FATL 4KK5D 3TTYA 4PRNA 1CGTA 3BSZA 4H8UA 4L9DA 2F0CA 4N26A 3CZGA 2NYYD 1SYSB 3D25B 1DDTA 3HNSH 4E9VA 5J12C 5H37G 3SIKA 1Q38A 4WI0A 3Q05A 3D8MA 3NCJH 3WEAA 2QSVA 1ACZA 5EU6A 4DESA 1B6UA 1G7JA 1NUFA 5AOMA 5CP7B 2FAUA 2DOCA 4EI5A 2DTMH 4CMHC 3RU8H 4RMVA 4B60A 5IW6A 3EYOA 4OZHA 1IGCL 5I0DA 2CBTA 2ALWA 3HRPA 3W39A 2PLTA 2Z93A 4F91B 4P5TC 1GC1C 1NQBA 4GRMA 1FP5A 5IEKB 4IS6A 2IANE 4AYSA 4Z7OB 4EIUA 4BM7A 3B37A 3DXAA 1FNGA 4LARL 3ZL4L 5DJCA 5GRJL 1A3ZA 5F70A 3US9A 2DWEA 3F01A 5FWQA 1AIZA 5AAMC 5C0JA 2YMXL 4XX1E 2UZIL 3B9KD 4IK6A 5DRWB 1P4UA 5DUBB 4ZT1A 4P0DA 3VXUA 1NCUA 1NCDL 4XI5C 1CT8B 3FMGH 4IKLA 3TTSA 2JNZA 5L2KE 3EYQC 3U0TB 4ZYKA 1BG1A 3DMMA 4BINA 1AFVL 2IV9A 4S1RL 4PGEB 3IDUA 3EOTH 4PRID 4L3AA 1RIHH 5CNHA 1UWXK 5TE6L 1UURA 1N2RA 3O6FA 1Z3RA 5E9NA 1JGEA 2QGDA 2WBXA 1A3LH 1TLMA 1XGPA 4AGLA 5D7KE 5C71A 1ZHBA 3ARED 1NUNB 3WFDL 1TTGA 1U8HB 1BCIA 3T5WA 5JTWA 1VEOA 3G5YB 5DJ8B 4CILA 5GJSH 3S37L 3EOYG 2AQ1A 3EGSB 2OK0L 3HN3A 5D72H 3ABKB 4URTB 4W9ZA 4AT6A 3IGAB 5E70A 4DGYL 3CZEA 3QO1A 1NFDA 2H32B 3QJUB 4EQ2A 3LRSA 3KMDA 3MTXA 1R6VA 4U6HB 4LCCA 2GW5A 4DZBB 4FLOA 3BAXA 3IBOA 4QD2E 4YSRA 4RDQF 5F7KC 4FMFA 1FVCA 1T1XB 4X6EA 2OYLA 5JIIA 1MFMA 2ICES 2XN0A 4RRPA 2WW8A 4BWTA 2A74C 1G43A 3B2DC 1JJUA 1ZLDA 4ZMYA 4C58B 3LRLA 1AI1L 2ED9A 1O6SA 3WIHL 4YX2H 5I0YA 2LV4A 3QORD 4JRXD 4XOBA 5HYJA 4HKXA 4L0ZA 4ONFL 3ZMEA 3WAKA 4JFZL 5ABAA 1D5IL 2IWEA 2GK0B 4JFYA 3N44F 3MCKA 1HEHC 4GW1B 3TO4C 1TTUA 2ZE0A 4ZUVB 5KJRL 2C34A 2ZUWA 4IW4C 1XR9A 4UQAA 2DBLL 1T2QH 2WNKA 3TA3A 3MRBA 4W9JC 5EULV 4NQEE 3U6XA 5GHWH 3CFJB 4ISVA 1KJ3H 2EH8L 1ID2A 3FBKA 1A4JA 3KXFD 3HNTL 3ZE0F 1CD8A 4OM0L 3QWRA 4LGSB 1FYHB 1MCOH 4Z77B 3DV4B 1JK9A 4R96A 2JCWA 4YDKH 1BDYA 5EOQL 1A7BA 2P8LA 4JQXC 4L4JA 1F3DH 3CAFA 4ZPTB 3UTSD 3DIFB 1ZA3A 2C9UA 4CL7A 1L9OA 2M1KA 1CVSC 4JO8A 2PTTA 1FL6B 3B2PA 5JHDB 2CPCA 2P5EB 4CC4C 2QADC 3DO7B 2H0EA 4KZEH 3MV01 3QDMB 5EO1A 3QJFA 4Y4FD 3OLGA 3S96A 3TBVA 3U36A 5C0DA 4UDUA 1IEAB 2H1XA 3OHXA 3Q48A 4NP4H 2JFCA 1TQVA 2VR9A 1XGZA 1S9XA 1BVKA 3CZUB 3TBBA 5C0EA 2CKBB 1HSAB 3TURA 2MH4A 5AZEH 5JW5B 4L3CB 1JGVL 2BM3A 1CL7H 4FGMA 4HKZA 5IM7B 3DI3B 1V7NL 4L3EA 4OIFA 3CHPA 1D5ZB 3NBNA 4A55A 3OPZL 1FVEB 3PNWB 4UOQA 4RAVB 3CN4A 5DHVH 4HFWA 2KT6A 4G59C 4HJ1A 1UFGA 3LEVL 2W8CA 2VDNH 1NH6A 1YC7A 1UVQB 3GK8H 3BHBB 1JD9A 3VXRA 1HAWA 4H1LH 4YBLC 5DQ9A 3NPZB 1MQKH 3NDYE 5AVWB 5ID0B 1MIEH 1KLUA 1TTFA 5A6LA 2OR9L 4LSUH 3U9PH 3OKNA 1TTAA 4OD3L 4GAJL 4XBGB 1CFSB 3BCDA 4RGMB 5EBWB 2LLGA 3VH8A 4M7LL 3C8KB 4QCIA 3MOBH 3ILQC 1PDKA 1YN7A 2DQ6A 2IH9A 2MOQA 4HUNB 4UTBA 2OZ4L 3UTTB 4ZG1A 1LK3H 4H88L 1QW8A 5C8JA 4HX1B 2E76C 3C08L 5IMOA 4WWKC 3WS6C 1RLBA 2O4EA 3VSQA 1I8IB 1KY6A 3HZVA 3MACH 2HMIC 4G7YL 3MCG1 5CMAB 2D8KA 1E4WH 5K9KA 3L48A 1CYXA 4Z7UB 2QMJA 4TLTA 2W59A 2MCG1 3CBKB 4DUXA 1RUAL 3GUTA 4N87A 4XN8A 3V0FA 5ICUA 2VLJE 1U41A 1KJ2L 1NAKH 1S9WA 3P2TA 3OKOB 4ZMWA 1K4DB 2B1AL 4PW9A 4J3SA 1UD4A 2R0LH 2IH1A 1KEGL 3CDYA 3L54A 2NLJA 3IMVA 3L3DA 2XU9A 4APXA 5D7JB 2WXNA 4NKMA 3JWDH 4QRQA 1LO2L 1LWHA 2AJSL 4KMTL 4AL8H 4PJCA 3IK2A 3OXSA 4ORGB 2EIDA 4S10A 2MMXA 1NEPA 5FOBA 2NQCA 1HHJB 1MRFH 4FLSA 4G7RB 4IHBA 4Y5YC 2NR6D 3DRQA 5E8OA 5I8EA 3I9GH 4U6YA 3SSGA 2AJYL 4N0UA 4OBSA 1UTDA 3IDJA 3NIFE 1XH0A 3FFDB 3QXDB 4HUCA 1M3JA 2VO5A 3DOHA 3RB7A 8FABA 3V5KA 3TVMC 1ZLSH 1F4HA 4G9FD 5B39A 4EBQL 4BXSV 5D7LB 1RLWA 4WNQA 1ODUA 5JXEA 1TKWA 2WQAA 1BFVL 1WK0A 1JGUL 2IF7A 2NY5C 5FGBA 4MRCA 4X6FB 4XNYL 1KCSL 5BRQA 3UC0H 4ZZFA 1IFGA 1DSWA 2RHEA 4FEIA 1NFAA 2G5RA 4Z18A 1RIVH 4X80L 2BVEA 4X8JB 4C54A 3WS3B 5ICZA 4FFWC 1L7TL 4OVUA 2XWZA 2JKXA 4U1MA 3TIDB 1J8HE 3V7AG 2ITEA 5IBUB 3C5SA 3DTDA 4WHTA 1F11A 2HRGA 5IV2B 3TH4T 4P5MB 1PTZA 2R29H 3EFOB 3QQXA 4NUMA 3MV8A 1A1OA 3PRZA 4H5SB 1LEGB 5DGQA 3AQDA 4AEHH 1OCWH 2GPZA 3PV6A 1YMHA 4N8CL 1SF3A 1W16A 1BLIA 1CGYA 3FQXB 5DURD 5EFIB 5I16B 2EYRA 2FGZA 4HIIB 4NZTL 3EJCA 1YEDB 1N67A 1X44A 3SGKA 1OTSC 2PO6D 4BQ8A 3FO2A 4MYPA 1DJYA 5GGTL 1XGRB 4E0RA 3PWLB 2YPKB 4QXGL 2WINB 3WD5H 5GS0D 3EDDA 4PJ5B 1EANA 3VI4F 5AD0B 1M7IA 4PV8A 4NDMB 1HDMA 3EH2A 1NBZA 4JRYB 2YZ8A 4U1SA 3I85A 1R9FA 4G70B 1DVFD 4E5XB 5KBPA 1B90A 4OGQC 1YA5A 3UBXB 3LZOA 4M9PA 3T0EE 4RQQA 1Z0MA 2DV6A 3QDHA 2AZUA 2VJ0A 3VFVB 2B39A 3B9KA 2X10A 3C60B 5BOJA 1M7DA 4XMUA 4X4XB 2EXWC 3OJVC 1I7UB 4F7KA 4YMPA 1ES0B 3VI3A 1A0QH 1TFHA 5LAXB 4PJ7F 1TQCC 2UUDH 5J1AB 1K3IA 2HVJA 4MD4B 1BYPA 3QUYB 4I7ZC 2FB4H 2UYLB 4KPHL 1NAMH 1NLDH 1URZA 1INEL 2VKXA 4PRIA 4GUPB 1HNFA 4Y1AD 3D2TA 3Q6GH 1EERB 1SY6A 1FFPA 3GSOA 4GW5A 4ZI8A 1ZLWK 3BAKA 3SDCD 3THML 1RZFL 3A67H 2QSCL 4PY7B 4TF4A 2XBDA 3WFHA 1JGLL 2A7BA 2E74C 3BEWA 5DFTA 2Q1EA 1DR9A 3KM2A 3V0GA 4RAUB 4Y4HB 4UCFA 2NPLX 1JWUB 1QWUA 2FBJH 2ROXA 2BLFA 3MMEB 1PY0A 4OFYD 5GS2D 5KSBE 4Y4KA 3CN1A 4OZGA 3LPWA 3UCRA 1DO5A 4OZIA 3QIUC 1OGSA 1Q8MA 5IOPA 1P0SE 5TPWL 1JNNH 1EXHA 1CLVA 1V27A 1YEIH 4W9HC 4DVRH 5DK3A 2CLRA 1RHHA 4V11A 1OAUL 2D9QB 2ZNXA 2YLKA 4YDJA 2HH0L 3I9IA 3SKNB 3N42F 1A6AB 1NKGA 3LPGA 2KS0A 3VXMA 4ABQA 1F13A 3AY4A 1NA8A 5D2NB 2C9PA 5DEFA 4ABUA 1P5UA 5A3IC 2HCZX 1K8DA 1DBJH 5I9QC 5JIKA 1MRDH 1P9MC 1ZT1B 2VZ1A 3STLB 4XPAH 3JTBA 1CGXA 4MXQD 2WZAA 2MQCA 3MRLB 4JRXA 4XVUC 5BW7C 2E7LC 3K2KA 2XLLA 4YPJA 3E80A 1E4KC 4LAQL 2VDLH 2WYIA 1AMXA 1HWHB 1OGAE 2PPFA 2YPLB 2O5YL 2ICWJ 2BWDA 3KJ6H 4OCWL 3D5OF 2CHWA 3GSXB 1MHPH 4PS8A 1KWKA 4R8WL 2XJKA 3LXCA 4JO1H 1TETH 4ZMPA 4DP8X 4Z7AA 3KE0A 3IDGB 2W65B 3DUUB 1NDGA 5TDPB 4LE8A 1PSKH 3SPHA 1IGJA 1YEKH 4B9FA 1UZ6E 4FQLL 2VMEA 1GVIA 2JKSA 4RISH 4CSZA 1JZGA 4XR8C 2X0WA 5FO2A 3AU0A 3X12B 4UIMA 2J25A 4YLCA 1N0XH 4IU2B 4BRVA 2PPCA 4B97A 3FRPB 3Q8FA 4F7TB 3MGOA 3C9NA 1L6ZA 3DLQR 3FT2A 1DSFH 3ET9F 5JW4N 1RZ8B 3UTSA 1RZ7L 4WTQA 2ZJSL 4NQDD 4XMPL 5F88B 1ONQA 4H13C 4JPIA 1UCBL 3SJVB 1UJ3B 2RFXA 4BZYA 1U8MA 2K70A 1OAKH 4TUOA 4JBSA 3BKCH 3RTQB 5FXCH 4M7ZC 1DO6A 4EIGB 1DLHA 1MCEA 1QRND 4CRPA 3BP7A 3QJZA 1YRKA 3BLKA 4KI1A 1NMBH 2HG5A 4LCIH 5C7ZA 2VDLB 5DJ2B 1U8PA 1T4KA 3VGGA 1NCGA 4F20A 2ZWLT 1KELH 4ZFQA 1FNEA 2EIKB 1BXVA 1MWAL 3O3EB 3V5DA 1DL7L 1R75A 2XKNB 3REVB 4OUUA 4V33A 1EH9A 2IADB 4X4ME 4UB0L 2A2QT 1KV3A 4HG4K 1C5CL 5CCHE 4TVPE 3IJ7A 1DE4B 1MREL 5ANHA 4QO1B 1TCRA 1YHPA 4UM9D 3SGEH 4Z23A 1PEWA 3F65A 1WG3A 2ZXCA 1TZHA 4OSUH 4UU9A 3B3IB 1NGZB 5KANI 1JPEA 4U1HB 1XH1A 2X53A 2H1LM 2X09A 3ES6B 2W0FA 3MV7B 5EH1A 2DM7A 4NQCD 4ELME 1MFCH 1KTJA 2Z7ZA 3NA9L 5IEHB 3OX8A 2BVOB 3UJIH 4M1DL 3TWYA 2J5LB 3EFDL 4NRXB 4OD2A 4I13B 4ZFZB 2XWXA 5ADOL 3WEXB 2FJHA 1B3IA 1WS8A 5E9DD 3PAVA 3H54A 5D1ZI 3WXWH 4LNVA 2DQJL 2I85A 3P2BA 2HUEA 2WYHA 1JYVA 1FFOB 4AWJC 3LN9A 2K6WA 2JI3A 3OM3B 3H9SD 3S4SB 1BX2A 3CDZA 3MJWA 3LKRB 4IRSB 1DFBH 4XNZB 3H4FA 3N0PB 4UYQA 1U92A 5ICXB 4JPVL 3ZRSA 4NJAH 3PXHA 1A6UL 2W94A 2DJSA 3A6BL 4HUWB 1NJ9B 4JKLA 1F6LL 4O2FA 3WV0A 2AW2A 2DWYA 1CE6A 4NC1E 3QEUA 4KQ4L 4NX0A 4UQ9A 1E42A 1HINL 4Y8DC 4KOBA 3N43F 4WHCA 2VXVH 5JOPE 2KC0A 4UQDA 4LSPL 4DOHB 1AKJD 1GAFH 3KG5A 3BZFA 3EJRA 3Q6FB 5DK0B 4F5CA 5DJAB 5EA0L 5ERWB 2VLJB 3BOVA 1BZ7B 2C3XA 2XZCH 2FX7H 4H8QA 2GQHA 3RX8A 1UWEH 2F54E 3ESNA 1W72A 3EO9H 3UPRB 2UWEB 2NR6A 2YGVA 1EHLH 1VA9A 3C87A 2R2EB 3GS7A 4F37F 1YDPB 1E6JL 3WSQH 5GGSY 2EVJA 2MKLC 1C7TA 2FT7A 3O3AA 2B5IB 5LWYL 3GPSA 1KGCE 4OH2A 4W9KC 5EPMB 3ARSA 5FHBH 1BZOA 2AEPL 2DDQL 4F27A 3OSVA 5DD5L 5KUKA 5T33L 2DD8H 2ICEB 2OMWA 3OQRA 1Q9LA 3LEXA 5TDOA 5B38B 1OOAA 4EE2A 4MQXD 4Y9BA 5TJWK 4ZMZA 3EUDA 4OB5H 3CMGA 1PKQB 5AW0B 1LO4L 4D0BB 3BDBA 4LEXL 4Q52A 3ZDZB 4BZ2A 4TVPL 1HFUA 1E6OH 1AE6L 2ICCA 4DAGL 3D4CA 1GMEA 4LSSL 3KYMA 4X4YB 3IVKB 5E00A 2NX5D 4GKOA 2ZG3A 2NY3D 3HVDA 4L5FE 4B7LA 2CK2A 1HL8A 3SKUD 1NDMB 2A3TA 5E2UH 5HVFB 3P40A 4E9LA 4LF3B 4CVUA 1ND0A 2DQMA 1UA3A 3GSQA 1I8LA 4G9DB 2EC8A 4MQSB 4HOMA 2Y7OA 2OYKA 4JZOB 1OGPA 5FYKE 4V1DE 5L88H 4LCUA 2E46A 2PO6A 4I18B 1E27B 1U8LA 1SOQA 3LIZH 2J2ZA 3IU3B 3QJOA 4GSDH 3QHTC 2OMUB 3L4CA 4WI9A 1JXJA 1KCKA 1SXNA 1ZKAA 1G7QB 4K7FA 3EJZC 4ZSOE 5LLIC 1AD0A 1D7CA 1OEZW 4A6YA 3D34A 3K0WA 1FG2A 3QUMB 3GMOA 3V52L 1DVFA 3QNYB 3T77A 4N2NA 2UX6A 3GMMB 2XWTA 4HOXA 1U3JA 1NC4B 4EOWL 5BOZG 5J6HA 4JCMA 1YNLH 1KBVA 4MBRA 3UACA 3V0WH 1LDPH 1JN6A 3VFPA 4YJZL 3HCVB 4L4VE 2WWKO 3GJEB 5DC2A 1IGIH 3X13B 5HI4D 5ETUB 1FHNA 3MFFA 3IPBA 3ULUE 5L4JA 1Z3GL 1J5CA 3AW5A 4NGHL 2CA3A 2ICWB 3TJEH 2GT9A 1K9TA 3V0VB 1KOAA 1RJYB 2O5XL 3SDCA 2NY6D 4JDZB 4HUUA 3O8XD 1R3LA 2GSGA 2Y9RT 3CFBB 3DTUB 3QCVL 5HI3D 4IHOA 3BSGA 5IVXF 5IKCB 5T3XH 3K0YA 1YYCA 3BEVA 3OXRA 2ZUYA 2EIMB 4J3OC 2AJUL 4AUYA 2X12A 1UH2A 4K4KA 2OTWB 3DVGA 3ZGHA 1GKOA 4OFYA 4M93C 5D7JC 5DLML 5ELIA 5CLYA 2KHAA 5AYQA 3X3GL 1RZJL 5BVJA 5D7IF 3RIFF 2GABA 3IKKA 2FO4A 2AQTA 2H45A 1KBKA 3RWEA 1R3KB 3P0YL 3WKQA 5KG9B 32C2A 4LLVB 4YBQC 2N0MA 1F1GA 4LESA 4J3OG 3IDMA 4AGPA 1FORH 4OJYA 3QULB 4YHMH 3Q2CA 1RUPL 1KYDA 4GP8B 5E94B 2NSMA 5D5MB 4D0CA 2EACA 1BM7A 5AWNH 3PWPB 1PAMA 1YPZF 4FQHB 3ALPA 3RP1A 4OLUL 3BQUA 5FHAL 4EZLA 4L5FL 4X9FA 4UQ2B 2D3VA 4FFVC 4HHWA 4XPGH 5I24A 2X1XR 4JG0H 1JHLL 3V2AR 4UT7H 4IMKA 5KTEL 1CLOL 2AEQH 4ZD3L 2QSQA 1A9BB 5DS1A 3W38A 1G7LA 4HPHA 1I3VA 1YECH 2GIXA 2HLFD 4GMSH 5FYKL 4P2OD 1XZWA 2F7OA 3VXOB 4ZAKD 1Q1PA 2BP0A 3RWGA 5JO5B 1CBVL 4K23L 4EQ3A 1CGUA 2IDCA 2DIAA 1EXUB 2VIRB 4ERSH 4Z7WA 2DQCH 3PL6B 3A47A 1T6WA 3QNZB 1K8IB 2J6EA 5DJYB 3ALXA 4JM2F 2V7NA 4QT5B 3D3VD 1MFNA 1CK0L 1EEYA 5CCGE 2P24B 3M86A 1WBYB 2XN9B 4ODSL 2G60L 2Z4TA 4Z95L 3SGDH 5T5FL 4JN2A 3ZKQD 1P6FA 4ONGH 2H0FA 3CDFA 1EEQA 5F2FA 3FU9A 1T21A 2VLRE 2B9AA 3WHXB 2LVCA 3SOTA 3X14A 1ZJBA 1W0VB 2P8MB 5C0CD 3OKLB 4NQDA 4AEFA 4FKKA 3ULUL 1FRGH 2EEFA 3OV6A 4N9GB 4X7SL 1OHQA 5AVQB 3ZO0A 2IFFL 1I8MA 4QNPF 3R19A 1GIGH 3RY5A 4AMXA 2EYSB 1Q1JH 2E7CA 1A3QA 1I3UA 1QRNA 1R33A 5I76B 2FQEA 4L2YA 3QPXH 4QXVA 3MUZ1 4FTVD 1ZK9A 4KVNL 5TGBA 4J3XA 1BAGA 3UBXG 4N5ED 5ANME 3NIDB 4Z0XA 3FQRA 4JFDA 3LDBB 3E1F1 1YUKB 2FHBA 5DWUL 1KTDA 4AYEC 2FLBT 4W9FC 4XWOD 2CK0L 2VZOA 2WXRA 4O58L 1QVOA 4UM9A 4XH2B 3EG9B 3I3BA 3GRWA 4JJOA 4POZD 4ANVA 4WFFE 1WT5C 3NCMA 3PWVB 4XX1G 5IB2B 3NCBB 3QRBA 5CP3A 4RFNC 4X6DE 4XVSL 4NQCA 2R1XA 5AVYB 1RAMA 5LNGA 3D39B 3LX9A 2P80A 1I7ZA 2C7UA 1JSYA 3NESA 2JVUA 3ARWA 4K94H 2XX1A 3T8VA 1E8ZA 2PR4L 3EYUL 1U58B 4P3CL 1D6VH 5JYLA 4XN2A 2LW5A 1U95A 4K8RL 3L5IA 3H55A 5FUOL 2R7EB 5DZOA 3ZQXA 4PG9A 2LFEA 3GBEA 2OS7A 4GBXA 1VERA 4WKZA 4N2GA 4Q14A 5IY5B 2AJ3A 4KI5E 5AVSB 3I2CH 1NGWA 3QNXB 4MTMA 3S5ZA 2WVTA 4DJMA 1INQB 3HNVH 2YEZB 3MRNA 5SWSB 1AGFB 1THCA 4BFIA 5HGHB 3CFNA 3BFQG 3WNLA 2O93L 1KBPA 5LHDA 1CFBA 4MNHB 3VYOA 3ZE2F 4TXVB 4LLYA 3WUWB 2GSMB 3T6VA 3BLBA 5I5RA 1G6RB 2E9BA 3ZE1F 1AKJA 4Y5XA 4I77H 1CJYA 3LOWA 4JB9L 3VACA 4ZFOL 2CZNA 2CRZA 2MWCA 1Y07A 5GGVY 4B5EA 5KBMA 3IJEA 3VNZA 5MEND 1DFXA 2GTWA 4XNDA 3LKQA 1Q94A 1S7RB 2W9EL 4J2XA 1B9ZA 2JKNA 2EIZA 4IRJB 2ARJA 2R8SH 2AKRB 3TEUA 1QBLH 3CCHB 4QRTB 1AP2B 2WWKT 2NRDA 2JELL 3WGVB 1IGTB 1M7UA 2VQ1B 4Y2OA 4PSRA 5SWZB 2COQA 4HT1H 4G7SB 4LSVL 3HE6A 2J73A 3KYAA 2ZX9A 2ZWKA 2B8OT 1O9ZA 2VLLA 3VFNB 2C9AA 4DHLA 1UJ3C 1FBIL 2CUIA 2QT6A 2IQAA 5IROC 1L9TA 4JFXA 2F7IA 5C0BD 2JXMB 3WTYA 4LFHD 1JZEA 3RTQC 1B88A 3FRPG 3D87B 1OZTG 3LKPB 2YO3A 3EDKA 4GB9A 1JDAA 1I9RL 1YY9D 5C08B 3S8FB 3KHOA 1VFAA 4QOKB 1DHKA 3TBTB 3SE4C 5A6MA 2NX5A 4I4WB 4NQVB 1JF1B 4NRZB 1AGDA 1P2CA 5IHWA 3G6AA 2XDHA 3UIZA 3MUGB 3A4FA 3IYLW 2P5WD 4M5SA 4ZDHA 3RGHA 4F1SA 5LO7A 5FB8B 1DQIA 1AHMA 3KDPB 4JZNB 3TCXA 3L1OL 1MJ7H 3GJFK 4U0QB 1FC1A 1RZIA 2IWFA 3OB8A 5BVPH 3DOIA 1HAUA 2AQSA 2R4SL 1SJEB 4YXHL 1BMWA 5E2VL 2DIBA 4M5TA 4U6XB 1B4TA 4TKWA 3BDYL 4DEUA 5AB9A 4GYBA 1G5AA 2BDNH 4CN4A 4LOUD 5IQ7L 3RB5A 3UAFA 2CUHA 2ZX7A 4UMGA 4WW2A 1HYSD 3NACH 4HWEH 1TZAA 3WENA 3HS0A 2ZCHL 4FFTA 3L95B 4NZRH 1P1VA 2ROYA 1MQ8A 3BH9A 5FO9A 5B7FA 1LO5B 1AIFA 1U30A 2FNWA 2CIKA 5EDSA 2R0WH 1CIUA 2QKSA 1NL0L 1BZ9B 1ZEAL 2OTPA 3ISWA 4FG6D 3QQ3A 3TV3L 1MCBA 2OMVA 4AM0A 2W92A 2A6IA 4K3EH 2X4UA 3PHSA 2V2WB 2YQGA 5A2IH 1T7ZA 3MHZA 1CFNB 1DN0B 3O8XA 2WCPA 3WY2A 1R4XA 3QCTL 4XC3H 5EO9A 4NRYA 3QISA 1AO7E 2QGCA 4PGDB 5KOMC 3IFLL 3JUYA 5EUOE 2AXHA 4LK4A 3TFKD 4XP4L 3D9AH 2Y07H 2ADJA 1D6EA 1Q90A 3ZUNC 2B20A 3PWJA 1PG7H 2H9GA 3CFKA 4HK0B 5ALBL 2NNCA 5E4OA 1QBMH 5E8PB 5C0AB 4MJIB 2FL5B 2DRUA 2GI7A 1Q0XL 3UO1H 4EVNB 1E9OB 5D7SH 5JOFA 2BSRB 4M6OH 1EO8L 9CGTA 2E4FA 4FFYL 5KJ4A 1JPTL 1P5VB 1JWMB 2Y0SA 4OAWB 2GJPA 3BT2H 2NY5H 2H26B 3FAWA 3NFSH 2IALA 1R34A 3L3JA 1QSFD 2N56A 4QHPA 1A7PL 2DTSA 4J6IA 3ZUCA 3GHBL 2WO2B 3V4VB 5EU6E 2ICEC 1X5ZA 3DSNA 4QTFA 5H94B 2G2RB 2WYTA 3FB7A 3V0HA 4ONHB 4MA1C 3UBHA 4OZHE 3UTQB 4UI2A 5DUPL 5HYEA 4D9RE 1PCSA 1JUFA 3BKYH 3E6FB 4P2OA 1OP3K 4ZAKA 4KQ0A 2UY6A 4W9CC 1BA9A 1AZRA 4XCYA 3G3LA 2A73B 4OV5A 4HMCA 4B9CA 3SDDC 5B38G 4RWHA 3SE9H 2AXFB 3IWVA 3MJ7B 3VJ6A 1M1SA 4F9LA 4I0PA 4APQC 4AY0A 2P3YA 5EHFA 4UINL 2PWGA 3S36H 4CUCA 1PL3A 3D3VA 1CZ8H 3BP4B 2LLLA 3NA4A 4OLYH 4FHKA 2KLTA 3H7BB 1TOXA 2IAAC 1U21A 4N9OB 2CGRH 4L2LA 7CGTA 1DQQB 4J3WA 2Y7QB 5JPNB 2XWJA 4XC1H 4PV9A 3IDIB 4RVBA 3UFIA 1FIGH 2X4RB 3FB8A 4GXUN 1BJMA 3QFJD 1KT2B 1LQBC 4E9YA 1A7OH 1UD5A 1KDJA 2FEDC 2HT4D 2UWEF 2I25N 5HHVL 1WLHA 4X42A 3TC9A 4B5ZA 4MWFB 2WM0A 3BAEH 1CURA 1T0NB 3K2UL 3KPRD 4F8QA 5DJ6A 4FNQA 1KCUH 3RPKA 1XB6A 4PCSA 1OP5K 2LE9A 3GKZA 3VXQA 4NLAA 1JRHL 2PP9A 4G6ML 5KZCD 1BGXH 2F58L 3HG1D 4FA7B 5IP4A 3BGMA 3PP4H 4PJAF 2AK4A 2G5BA 2IH8A 3GSNL 4FTVA 5C1MB 2Y06H 4OGXL 2QVMA 3W1ZA 1CLZH 3NJFA 1IJNA 3DX8A 3PCYA 3ZDZF 2VDKH 3L3GA 4AXWA 4FJZA 3S88H 1LE9B 3AS3A 3SE8L 3VG0H 4U1IB 3SBPA 4A2EA 4WJ5A 1UQSA 3QI9D 1MHEA 3UPAA 1D5RA 1I1YA 4N90E 5JIPA 4OLEA 3MROB 3WLBB 2BZ7A 4NO3B 3AACA 2V7HA 2Q0ZX 3IF1B 1EZVX 4BE5A 4MCYB 4S2SB 1RULH 5DI8B 4D9QE 1UWFA 3BSZL 2D7QA 4LLWB 5EZOH 4GFTB 3JSSA 4P9MH 1DBBL 3Q44A 3ZRCC 1WP6A 4HKBA 3CZLA 4YLQT 3EJTA 3TO2A 1WISA 3KLDA 1U8CB 2C3VB 4K3HA 4AYFB 5B8CA 1ZLUK 5I1AA 3JWOL 1TTCA 2IG2L 1NGYA 5T1LD 3MLYL 5L6YL 4UNIA 4OI8A 4BSJA 3OKYA 1JPFA 3GXFA 3WFZA 2P7TA 2QDWA 4QHNB 4IQHA 4MJ6A 4IMLB 1S7VB 1GGBL 4LASH 5BQ7A 3HC3H 2DY2A 2CIIA 2GBUA 1IKNA 1Z5LB 2E7DA 1TENA 1LHZA 2DKSA 2C3GA 4JAMB 2XKSA 3L4TA 4RFEB 1J1OH 1TZGL 2VDKB 3RVVC 1YLBB 3V8OA 4DO4A 5EUKA 5JORB 3SKJL 1T1ZB 1U3ZA 3TT1L 2A6JA 3WTWA 3MRDB 2J8HA 5A7BA 1MDTA 5CGMA 3II1A 1WAAF 2UXGA 5B7EA 2D4FA 3QIBD 5K9JL 5A2BA 4PJHA 4ATTA 2GJJA 4GLRH 4BDVB 1I9EA 5ADPH 1A14L 2LABA 4TPRH 3RIAF 4NAMA 5DQDH 4IKNA 4UT6H 3IAPA 1MLBB 1Q72H 4J2QA 3GIZL 5FO7A 1J87A 5MENA 2P44B 2Z8WC 2QQKH 1BZDA 4TS6A 3QUXB 1BAFH 4XO9A 1ZGLA 3W0WD 4AQAB 2EDDA 3FBQA 1FNSL 1S5IH 2MQ0A 4N3TA 5F0PB 3VXPB 1E90A 3ELQA 4PGBB 5E1QA 2BOCB 1B0RA 3CG8A 4L3EE 3HI1B 3VRJB 1FIEA 1U91B 4A7VA 1RJLA 1E4XH 2RR3A 5I8OH 3FQNA 3GXIA 3WXVH 3D4ZA 3LCYA 4RIRA 5KVDE 4GSRA 1E4XI 5HHNB 3UBGA 1IE5A 1BXXA 4AQEB 4KHTL 1MZZA 4KY1H 5C0BA 3FFCA 1WFOA 5CGYD 4FABH 3IJHA 1QUNA 1MJ8H 3FQUA 4Z0BH 1BD2B 1KB5A 4HF5H 1HU8A 1JFQL 3T4AA 1FGNH 3DARA 4MNQD 3CHRA 4QJ4B 3OKMB 1FZMB 5H4YA 5LQBH 1EZSA 1ZXQA 3MGTB 5LN8A 4BFRA 4GKSB 4F57L 1RUQH 3R7QA 1PIGA 1BEYL 4BIKA 4KK8D 4Y2DB 2P5WA 2WVVB 3ARFC 1X9UA 4XX5A 3C5ZD 4LRNH 4OI7A 2FEEL 2X4NA 4C4KT 2L7QA 3H53A 1CDHA 3HR5B 4L8BB 1UXMA 4TQHA 5I1GL 5A16A 4TYUA 1ZV9A 4G6AC 1CLYL 1NCNA 2FZ3B 1I1RA 2ZCLL 2BNRD 3ARBD 5I1EL 5BS0E 1HEJC 5C0FA 3ISRA 4XMXA 3MA7A 4NHCL 2VISB 4NFBA 5D2LB 2YD7A 1HN1A 3E6HA 4JRLA 1WRFA 2HKFL 2WBJA 2XG5B 2FGWL 3AC0A 4L1HA 4MXWL 1H0DA 4XVTH 4XP6H 5F89A 3UG3A 3ESMA 4LSTL 3CSYB 4Y89A 3MODH 4ZX3A 3MJ9A 2COVD 3CK0L 3W2DH 2BP3A 5I1LB 1PQZA 2BINA 1QA9B 4PJCE 5F7MC 4O02H 1N9PA 3D48R 4QHUA 4RWYL 5ISZD 4TQ8A 4GAGL 5CD5C 1T89C 2DLGA 4M4RA 1OTTD 5I2IB 1CG9A 2OA9A 3LN4A 3GSVA 2ZXEB 2FR4B 2B4CL 4Z76B 2EVFA 3R8QA 2DICA 1XR8B 5T1KD 1RSFA 3PQYB 3FU7A 1EK3A 1ACXA 4E41B 3FTSA 3ATAA 4JHAL 4HHAA 1Z9LA 4PBVC 3ULSB 1FN4B 4M7KH 2IPKB 3ZR5A 3DX4A 2F1BA 5BRPA 2OM5A 4ZUSB 4BEIA 3CBJB 3QS3A 1F58H 2X2YA 5CN2A 1EBPA 2IJ0C 3C12A 4CVWA 3KLHD 4XCEA 5KVDL 1FHGA 1XAUA 2O5ZH 1URIA 4HSAC 4YSTA 5HPOA 1XAKA 1GGUA 1GCFA 4X5RA 3DWTA 1VCAA 3O4OB 4XZUB 2VAAA 3MV8E 4CW1B 1TJIH 3CHSA 4OJCA 1L9QA 5EBMB 4MKTA 4O5LH 2UZPA 3CFDA 2C1OA 3DGDA 1I9JH 1QSFA 4OCRL 4GMTH 2ZYSA 3IRCA 5EZIH 4DPRA 4BSWA 3OMAB 2NY0D 4PRNB 1AZCA 3ATEA 3G08A 3ZSTA 1B6DA 3L5XH 3EYFA 4ADIA 5IQLA 5FGCE 4EKXA 5GZOD 4PJBF 4WI0B 1A1NB 5I0WA 1RK7A 1TYJA 1RZJC 2Z92A 3ZDXB 1G7JB 4HS6A 1QAWA 3T71A 1CXLA 4MXVE 4U4BA 4I1NB 2EE2A 4KTEL 1IQWH 2YPVL 4NHUA 4EI5B 1G0XA 4GKLA 3EYOB 4GQPH 3VDCA 3A23A 1KN4