4UTCA

Crystal structure of dengue 2 virus envelope glycoprotein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
395
structure length
391
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
total genus 75
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utcA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utcA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utcA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utcA03
4UTAA 1UZGA 3N42F 1OKEA 5GZNA 5LCVA 2JQMA 3I50E 3UZQB 2JSFA 5IREA 1OANA 3G7TA 4UT9A 5JHLA 4UTBA 4AL8C 3J2PA 5B1CA 1Z3RA 3UYPB 5IZ7A 2I69A 1OK8A 5KVFE 4AM0Q 4UT6A 2P5PA 4FG0A 3N40F 3MUUA 4GSXA 4UTCA 4BZ2A 3N41F 3C5XA 1S6NA 4FFYA 5H37A 5LBVA 4BZ1A 3UC0A 4ALAC 4FFZA 3C6EA 1SVBA 5KVGE 5LBSA 1ZTXE 3UAJA 3J27A 4GT0A 3N44F 2GG1A 3VTTA 4X42A 3N43F 5KVDE 3UZEC 3P54A 1RERA 2R69A 5GZOA 3WE1A 3UZVA 5AAMC 5KVEE 1TG8A 1URZA 2HG0A 2JV6A 4L5FE 2R29A 2H0PA 1PJWA 2ALAA 3IRCA 5AAWC 1Z66A 5JHMA 2V33A
chains in the Genus database with same CATH superfamily
3SDAC 4CSTA 5HYQA 2HUHA 3SE8L 3CVIH 4A6YH 4WKZA 2D9CA 2O6EA 4OIIH 4L8CB 3ZGIA 1CL7I 3BDYL 4BFBD 1VSCA 4LSSH 3BT2L 3CXHK 2IPTH 3AXHA 4JFDE 5CJQH 1MHHB 3H9YA 4B7IA 5D1XC 4QT5A 4GS7C 2GITA 1S3RA 3N91A 3TN0C 3QYMA 3RFZC 3C8HA 4M48L 5GRJL 5JXEC 2XXMB 5FK9B 3G5XA 2L3BA 3CNKA 6FABH 4BUQA 1MCNA 1U8QA 1DQML 1QVOA 4MAYC 3LN5B 3UBHA 1KMGA 4ABVA 3K6NA 3V6FA 4Y4KB 4PJ8B 3HUJA 5T1MA 4JFHD 4LP8A 3P4OB 3A67L 4ZFQA 4YXKH 3R19A 1Z1WA 2YEZB 3ZR6A 3KBHE 3EOAB 4J3UA 3QUZC 4NWUL 5MI0B 5I76B 4OD2A 4LBEA 4LGPB 5BOJA 2FWLB 3OXSA 2XN9E 1FFNB 1I3UA 3FFCB 1RZ8A 2P5ED 3HOGA 4QKXB 2BIPA 4XWGL 4UIMA 1JSYA 3COOA 3RZCA 3BIBX 5E6IA 2ZWKA 1MNUH 4XCYB 4Y2DC 1M4KA 2E7BA 3SPJA 1H5BB 3A47A 4F37F 2QQKL 1XAKA 4HGMA 4GXVL 5I16B 3D25A 4YOKA 5PAZA 3D2UB 3BAEL 3OKMA 4C4KO 2YSSA 1B9ZA 1T1ZA 4JDTH 3S0PA 4H88L 1J87A 1CD9B 1J8RA 1ZE3C 1BVKB 4KUZL 2OMNA 2V7HB 3MBWB 1MZZA 4L4TB 4LCCC 3ZXAC 1FVEA 3LCYA 1U93B 3SJVA 1NDGA 2CAKA 3WN5B 1GZPB 5J1AA 3VFWB 4FZ8L 4MMZB 4XBPA 1T03L 2YQ3A 1N7MH 2J8UB 5AUMA 3SQOH 1LD9B 4FLOA 3JTSB 2XACC 3NCCB 1NAMB 1XZ0B 4PJGF 5LCVH 5DHVH 1RZIB 4EO5A 4GG6B 2X4SB 1NGZB 1QNZL 3QHZH 4OD1H 3V0VA 2FZ3B 2XU9A 2KZ1B 1FN4A 4YDNA 1JFQH 1L9NA 4WHYH 4LLVA 1CTNA 3ZZLA 3F5WB 2F19L 3U1PA 1SN2A 4KROD 5JW3L 3JVGC 1KCVL 2X6BA 5B7MA 1KGWA 3DDFA 4AGLA 3V4VH 4DTGL 5TK4A 1ZKAA 1JHTA 1IE4A 3IMUA 5J8OA 1HL5A 2QQQA 1QACA 4U1HA 3VFMA 5E2UL 5BMFL 2Y06L 4RFNB 1FORH 1Z6JT 3AW5A 1Z9PA 1FRGH 1YN7A 1WFOA 1DBML 2EC8A 3ATBA 3VFNB 3O9WD 5LN4A 2H5UA 3B1TA 4E2OA 1AZVA 1J0ZA 2OBGA 3GHEL 1R6VA 1WS8A 5K69A 1SVBA 5K9JL 3GKWL 5GRWA 3ATEA 2EXWD 3P3TA 3WJJC 4LPCA 5I75B 5ESQA 1S8DB 2PWEA 4RISH 5F9WC 3FB8A 4ZNEA 3U2GA 3PV6B 4AM0A 4GKZB 3OQ3B 2E7CA 5G4OA 5GZNA 2P5EA 2QSCL 4M3HA 2FYYB 2QR0A 1I7UB 3PUCA 4UT6L 5HVGB 4APQB 4KJWD 4XPBL 1QFPA 3P0YH 3MV8D 3QNZA 3CDCA 3VI4A 3WKNA 3GIVB 1FVDA 4NBZB 1W0VB 1H3UA 2NMSA 1YECH 1E9PA 3QDJB 4LCCA 3U0TB 1PX8A 5HVWA 2VXVL 3S5ZA 2DIJA 5IT2H 2FTAA 1YJDL 2IBGA 1AG0A 4Y1AE 4N9OB 3BKYH 3HE6B 4TSBL 4XO9A 3EBHA 1CFBA 1CURA 5IEKB 3BVNB 1WISA 2X41A 2ORBH 2I7OA 3OKNB 1G1CA 5BXFA 1A6WH 2H8PB 1UWGL 2X4OA 2Y5TB 1KXTB 2VSMB 2NSQA 3TCLB 2X2IA 5KVGL 4HUUB 3MLZH 4N8CH 4LSPL 1UT9A 2MWCA 2QHLA 3O45B 1BXUA 5I1CL 2Y2YA 1AXTH 5TDNB 4L3FA 4I1RA 3IMVA 4YVNA 4ELDA 4RFOL 4DUWA 2J2ZA 4HJGA 4Y19D 4P5TC 2AQ1A 3GMPB 4NQUA 1AG6A 1TU2A 4KZ0A 4W6WB 5CILH 5INCA 4DUVA 1OOAA 1LD9A 5L0QB 3VRJA 2XIBA 2FT6A 3AG3B 5FWRA 3MV9B 1I31A 2UWEB 1EO8L 4PVLA 3I2CH 3TASA 1JNHA 4P5KB 2EH8L 4HKXA 3WFCL 3O2WL 1FL3B 4OCWH 1I85C 2ATPA 4X9HA 2VL4A 4WAFA 5E94B 2BNRB 1GGTA 4JHAH 5FOBB 5AWNH 4Y2DB 5ACLA 3LMJH 4X98A 5KZCD 1MNUL 4N0FB 4JG1H 2PWFA 4R2GB 1VDGA 3RVWC 4O02L 1KB9J 3BH9A 3ZKNC 4NKOB 5C0ND 3U30B 1INEL 4H20L 4I48A 3NTCH 3NBNA 3T77A 3ZYIA 2Y7QB 1NGPL 1S9VB 3QDJE 5HYJA 1ET5A 3BAEH 4U1MB 1T04A 1I9IL 1U8CB 1ORSB 1QYGH 3PHSA 4C56E 2X4RB 2VDNH 1LEGB 3HBQA 1M56B 4Q2ZB 5FUZH 3KPTA 4MZ3A 4NUJA 1S9VA 2QZQA 4ZO7A 5DFVC 3ZVVA 2YOAA 1EGJA 1L9SA 4R4FH 1D5MA 3VFRA 2EXSA 3R8QA 3QQ4B 1KIRB 2ZKHH 3HAEG 4YX2H 4PG2C 3UTTE 1N0XH 2NY7L 5I1IH 4PJCB 2YBRA 3IPEA 4DKEL 5I8KH 1PF3A 4PR5B 3MV8A 4JFWA 4EBQL 1P4LA 3DOSB 3QRBA 2UWEA 4CAGA 5CWSB 1NANI 2FBJL 1U21A 2DLGA 3QXDB 3K91A 2RGSA 2PXYC 2XPYA 1T20B 5IMLA 4KO7A 4H8WL 3QNZB 1J7VR 4P9MH 5DUBB 3QHTC 1N59A 3FO1A 4EI5D 2JXMA 5E8EB 4LKXA 1N10A 1U8JB 1F6AB 4N20A 1I9EA 1DCEA 2MH4A 2VZ1A 1U8KA 4IKLA 5GSVA 4Z7UA 4JRLA 2TRYA 2AXGA 2I9LA 3G6DL 4Z6AT 2DLEA 3MUHL 1H8OA 4PJ8A 2MIZA 4AIXA 3TJHC 2CBQA 2QQKH 2IH3B 4MRBA 4TUJA 3IYLW 3DUSA 3RGHA 2K7PA 1E3XA 3NCJL 3NACH 1USQA 3TPUB 4I3GA 4OLVL 2B2XH 4XVSH 2FEJA 1VACB 4I77H 3EDKA 3QXWA 5JA8B 2RD0A 3VXTB 4Z3FA 2ZSWA 3BPOC 1U8PA 3VU2A 1FIGH 1PL3A 3CSTA 3CFEB 4NGHH 3SE4A 1R5VA 1L5GB 2KT6A 2XKNB 2VDQB 2XN9D 3ROOA 3TBWB 4K94L 1P7HL 3VMOA 4BE5A 4P23D 4Q97A 5L88H 3BXNA 4PTUB 4UMGA 2DLTA 3IT8D 3C6LB 4UT6H 3K2MC 4G6JH 5DC2A 5DQJA 4OZFB 5T3ZH 3PHAA 3U9WA 1F45A 4MNHA 4NQDD 4F93B 1NC4A 4B9IA 2R1YA 1J8HB 2K6ZA 3OM3B 3MUJA 1GYUA 2V17L 3HEIB 3KEDA 3WIIL 3B56A 4EAEA 2ENJA 4ELMA 4NM4L 1FZMA 4JY4B 4N87A 1XF1A 4PCSA 2IFGA 4N2KA 3E6HA 4P2QD 2PWGA 1E43A 2WQXA 2ADFL 4M9PA 4XP9H 5ILTH 2HLAA 2D2CC 2O5YL 4CDGC 3C5SB 3DIDA 2XFXA 3C08H 1CT8B 2WNXA 4PCKA 2FLMA 2Z35B 3BSZH 5DQ9A 3IFOA 3JXAA 3P3UA 3QUMB 4AVJA 1L3NA 4J8QA 3T1FB 3CDYA 3BC9A 5EG6C 3W38A 2J73A 4ZFZB 1QI4A 1WDAA 5D8JH 3OAZH 2VMDA 1WGOA 4NN6C 4FQIH 5D5MF 2A4EA 2IDCA 3RVXC 1KY6A 4UQ9A 3GRWH 5CILL 3FU0A 4GBXB 4LZKA 2WXKA 1AD9B 2X3AA 2BINA 1N0LB 4GSQA 1YEJL 5BPPA 3WIFB 2E7LC 2F6AA 1MWAA 5GRXG 3G6JB 4NI3A 3NZHL 5SWQB 2JI2A 4MCMA 4OUOA 1PG7L 3DIFB 3SHSA 4BZ1L 5KYXB 5ECGA 2EVIA 2VN5A 1D7BA 2DM3A 4KTEH 1HH9A 4E41A 3KD4A 5DEFB 3GZQA 4KPHL 2JJTA 4PCYA 4Y5VB 3U9UA 1BCIA 3ZL1A 3W2DL 1PNCA 3CFNA 1EV2E 3I6GB 1KNOA 1YEWA 5J6GA 2QTEA 1SEBA 3GHBH 3K80A 3LKPB 5B39B 2VXVH 3CHPA 1TYRA 3TT3H 3HMXH 4DQOL 3B7TA 3LXAA 5I8EB 1CBVL 3IFOB 3QUMA 4PUBL 4FCAA 4QRPB 5CKAA 4KTDH 4HXBL 2WLKA 3LSOB 3U30C 3AQDA 4XMKH 3V6OC 1XF2A 1PG7X 5L8KB 4JKPL 2NW3A 5EO0B 5JQHC 3QDJA 4U1GC 1HH6B 3F58H 4CKQA 2LAAA 4ILDA 4F9LC 5DA0B 1P9MA 4GT0A 2WY3B 5LNEA 4MCYB 5IW1B 4AZUA 1S9WA 3QUXA 3P11L 4FABL 3D85D 4G7VL 32C2B 5FA4B 4MVBD 3OLIA 2BRRL 5D7LE 4OTXL 3LKQB 2Z92A 4NQDA 1H3XA 4TSAL 1DANU 1GSKA 3UJIH 3EKCA 1S9WB 4B41A 2VDQH 1C16A 4KFZC 4X4YB 2GB2A 4P5TB 4PG9B 2ICCA 2HRPH 4KU1A 4ODBD 5I8OL 2G5BB 1ULVA 4NZDA 3DX6B 5E1QA 3QG7H 2DWEA 5DZNA 3PABA 3HFML 1AQDA 2J4WL 3SGEH 3U6XA 1XGQB 1M1XB 2BWDA 5E1IA 4GY4A 3JV6B 4UI2A 2VR9A 4PJ7B 3BP7A 3U4BL 3UAFA 4YHYC 1BDYA 3IFNL 4KKAC 3LMJL 4N4YB 2FD6H 3QQ9C 2A9MH 2Q1EA 4NNPL 3DROB 5HDLA 2EDFA 3IJ7A 3BZ4B 1XIWD 3ROLB 1HHIB 4OM0H 1MVYA 4ALAH 4N2IA 2DYPA 2FYVA 4MQTB 4PJGB 1Q1JL 2BS71 4ELKB 3ZE1B 5HD8C 4MDRA 4YHZL 2WQWA 1JD9A 1HXYB 3CK0L 2WXRA 1G6RB 1QTYT 1J48A 4HIHB 4P46C 4PRDB 1YEHH 3KCWA 2EDLA 4AQ1A 1MCIA 4ZBJA 3ES6A 1M9WA 3BZEA 3PXHA 1DP0A 3D18B 3NSCA 4WWOA 4Y4FD 3DO3A 2KI6A 4XPAH 1NKGA 1QTSA 2QVFB 3ISRA 3EBAA 3F04A 4K15A 1AD9A 1AQKH 5D1ZC 5EZLB 3VXSE 5F3BA 5FO7B 4OJFH 4LCWE 3H0TB 3LPWA 4MCNA 2Z31B 4EBQH 1ZV9A 3LZFH 5GGVH 5D4HA 5M95B 4S0SD 4DH2A 2WZPD 1VADB 1W8NA 1F4YH 4E68A 3U25A 1FL6A 2F0CA 1O6VA 3VQMA 1EHLL 3ZYOA 1O6SA 3VI4E 1XH3A 2BY0A 2E7DA 4PJDA 3RL2B 1WEJH 1FYTA 3EFOB 3RB5A 4P9ML 4ZMYA 3NRPA 1A7QL 1WLHA 4M4RA 5I71C 4PVNA 5ILTL 35C8L 1DQLL 5BJTB 1CMOA 3OWEA 5DS1A 2ROYA 3MLUL 3FU9A 3QJQB 3D30A 2FL5A 5J06A 3PL6A 1NEUA 1Q0XL 4UQBA 1G6RA 2Y69B 3CSBA 1AIFB 3GO1H 2RCSL 4OFIA 3LXCA 4WTZA 4WJKB 5EC2B 1UZ6F 3TC9A 1HNYA 4E5XB 3X1EA 3MRBA 5DHYA 4CVXB 2JF1A 4F20A 4E0RB 2F18A 3VNZA 4GRLD 2C9AA 1WQVT 3P1VA 5F93C 3T0XA 1SDDB 1FVEB 3LN5A 1LP9A 5GGSA 3AT9A 3K5SA 2YKLL 4HAFA 1PFCA 4JKLA 5IB2B 1UD4A 2Y7SA 3GXNA 1XIWC 3GXFA 4D9LH 3FUKA 3S8GB 2OYMA 2HMIC 4OCRL 2Z31A 3VAEA 3B6SA 3ETBJ 2YLKA 2YPLB 5E2TH 1T1YB 1JF6A 2XI9A 4OUUA 6PCYA 1P4UA 3L9RA 3DX6A 4P49A 1HT6A 2JCCF 4LEXL 2D9QB 2DQIL 3TPUA 4FQLL 5ITFB 3B4NA 3HE7A 2E27H 1W0YT 5FFOA 2QFPA 3FT3A 2YRZA 2WWKT 1Y07A 3IJ9A 2FJGB 4JJ5B 4XRCA 2PXYA 3I75A 3R7RA 3IMTA 5D1ZA 3FQRA 3C5JB 5KSVB 1A3ZA 3VXME 1EHXA 2DQJH 3OKNA 3OXRA 4PJIA 1H5BC 1Q0EA 3U83A 2CGRL 1GZQA 2YAHA 2GUOB 3LY6A 2W80C 4P4KB 3SQBA 1ETZA 4Y4FA 4E42A 1QSFB 2CGZA 1XEUA 5TGBB 3VFNA 1CDYA 1T7XA 4S11A 1HNFA 3M1OA 4M1DH 5DEJA 5TF1H 1HX0A 1T7YA 5JIKA 3QUZB 5MI0C 5E03A 4ZFGH 2EDYA 4WENB 3TBTB 4BBWA 2E6QA 3FB6A 3EYVA 1UCBL 5AKTA 3L95A 4LHUB 4DP9X 4FQIL 4M00A 5D9SA 5A2JH 1DUYB 1SOSA 1J5CA 1IAIM 4DCQB 3MJ6A 3RWFB 1MY5A 3TU6A 4KROB 3PV6A 3TN0B 3EGXA 1K8DB 5PCYA 4JFQA 4G8GA 2YR3A 1AE6H 1TMCB 4XVUD 4TL5A 3OGOE 4UF7C 2PYFB 3Q6FB 4NXKA 4PJEB 4QRQB 3FYEB 5JDSB 1HHKB 1L7IH 5EBMA 2XBDA 2AI0L 3BO8A 2A73A 4Q8BA 3KWUA 1N67A 2FX7H 4NSKA 2APFA 4UM9A 2ITFA 3W11C 1IQWH 1KLFA 2G4EA 4MHHG 4M4RB 3W2DH 4AGOA 1G94A 2WO4A 1YN7B 3GMOB 1B88A 4WI0A 2CUAA 3SBRA 2B8OT 4ZS6C 4FQJH 4J27A 1NCJA 5L7XH 3H9HB 1MW1A 2R1XB 4CMHC 3X1FA 2C1OA 2JWYA 4WGWB 2A0LC 5F9DC 2WKLA 3BPOB 1FC2D 3HNTH 2P28B 1DQDH 3ULSA 5LN8A 1F3JA 3F7QA 3PJSA 2ZG1A 2I27N 5A6MA 3WFDH 4F5CE 2IWEA 4N2GA 3OKKA 4A7QA 3RIKA 3TZVC 4MJ5A 1ZGLA 4IRSB 2A6DA 5FHAL 1N4XH 2CG9X 1VFBB 2EDBA 4R7NB 1XR9A 1OPGH 1X4XA 1NAMH 3U9PH 4OKDA 3BDBA 5ICZA 2FWOA 3ZDYE 4YGAB 1CXLA 4OTXH 4QXUH 1F6LL 1Q9WA 5DRWA 1OOWA 4GRMA 5C07D 5KBPA 2EEDA 5FM5M 5EIIG 3TV3L 3WEAA 5IHUL 3KWTA 5HI3D 1WYJA 5DD0H 1BQHA 4RX4A 1U33A 1HYSC 1KF9B 1Q1PA 5D2NB 4RAUA 4CVZA 4DN3H 4TPRH 5F72S 4NZUH 4RSVA 3I6LE 3WMSA 4YHLL 5IB5B 5F88A 1U8OB 4OGXL 1VPOH 2VE6A 2J6EH 4Q74A 4O02B 3WKYA 3QJHA 3HG0A 3O2DL 2R1XA 3RLSA 4JRXA 2YD7A 3S2CA 4YHNB 3QNYB 2CBPA 3FRPB 5TE6H 3AQZA 3D52A 4PLJD 4C56A 3T4YB 2CLVB 4NHUB 1PQZB 1TSRA 1OY3B 2IOMA 4BZ2L 5HBBA 2BVOA 3OAYK 4KK5D 4EUPB 2QZ5A 5INCB 5F70A 1F4AA 3QS2A 3DJRA 1UGNA 5LO7A 1EAOA 3IETA 2ADGA 1BXVA 3Q6GL 4G5ZL 1X9LA 3B9VA 3IMSA 3U6RB 3L4TA 3MRIA 4V1DD 2VDMH 2VZOA 3WIAA 4F3FB 3EO0A 4L4VB 1OW0C 3SSGA 2WN3A 5KW9L 1TTAA 3GI8L 3LS5H 1CB4A 4PI2A 3RQ3A 3FDWA 2DDQH 1HAUA 4XN2A 3H7BB 4GBXA 5IEHB 2KPNA 3GMNA 1OVZA 5I66B 1DBAH 4OFDA 2C7FA 1ZLSH 2XTSA 4BFJA 2E27L 2B1OA 4XX1G 5IVOA 3BZDA 1TO5A 4JHWL 1NIAA 4O9HL 1I4FB 1TZAA 2QV2A 5EU6E 4Q9QL 3X13B 3CVHH 4EN3A 3AGWA 4NQEA 4F33B 3O0LA 1AGDB 3K81A 4NO5A 4M5YH 1BD2D 2WGNB 2ENYA 1A6AB 2VXUL 3UTSE 3DX2A 1RJLA 3KLAA 3LD8C 4OGQC 4QMEA 3MNZB 4K9EL 4WK0B 1XHHA 2YRBA 4FRWA 5MENE 2EYRA 2WB1A 4E9LA 5DJZB 1NAMA 2W9DH 4XNUL 2BFGA 3WFEL 1TPXB 1T5XA 5FUCE 2AXWA 1NGQH 3EFOA 5E5RB 4MZRA 3SZKC 2WBJA 2C3GA 1E90A 1SOKA 3GEWB 1NDTA 4WV1C 4M6MH 1YYCA 2D7QA 4RGNC 1HOEA 2DAVA 3ULVL 3FONA 4JY6A 3MOAL 2Z8VC 3W9EA 3TWCH 2YBGA 4AYDC 2NT0A 1QFWL 5IOKA 3LN4B 3MOQA 2OAAA 4ODWA 1V7NH 1IGIH 2ZPKH 3TBBA 4QJ4B 4ZMOA 4G83A 4WV1A 3OJ2C 1Z9MA 2MCG1 3L5XH 4N3UA 1TJGL 1MN4A 4WWKC 3WNLA 1BXAA 4RH4A 5I0VA 1A0QL 2G75A 5JYLA 2J8UF 4P2RD 2YFNA 4AVHA 3QDMB 2Z65C 4PJHA 3Q9QA 1MVUA 1OB1B 3CPLA 3EG9A 4G11A 4YUEL 3CHSA 5D1XA 3SDCD 4TNVK 2GJJA 2Q3AA 4GQ9L 1T2QL 5FV2A 4EKXA 1X5KA 4LKCA 2VR7A 1E5CA 3R0MA 4G6AC 3LKOB 4HJ1A 4Q7DA 4WRLA 1TEFA 2XG4B 3L54A 4TQEL 1KTBA 3DMMA 4G72B 4LAQH 3QWRA 3PF2A 1ZGLP 4G1EB 3S97C 4O5LH 4GKSB 4P46B 1CDGA 5E2WH 4UU9B 3ME0B 2WW8A 4LGRB 4XNZC 3G04B 1BZOA 1CN4A 3AWEA 3RGVB 3RIFK 5C0FB 4LHJB 5FXCH 2B08A 3BH4A 3O3DA 1V7MH 2AJSL 2E9JA 1OP4A 4OKVA 4XO5A 3TONA 5FR3A 4HV8B 1NEZG 5K1JA 2GUOA 4P4KA 4G5AA 1JHKL 2BIQA 2OMVB 5BUPA 2CKBB 1M7IA 2J71A 1W0WA 4D0BB 3EJYC 4TMPA 2MHAA 4YHML 5EF2A 1HEJC 2WTRB 2FIRT 4XXWA 4LPWA 2WQ8A 3IGAB 2R0KH 4YDZA 4RGND 1IGYA 4WNJA 3SDCC 2H0EA 3NSYA 2AJ3A 4L9LA 5F8RC 4F8NA 5ANME 4WNQB 2COQA 2FE0A 1TQWA 3WTYA 4AJVA 2YJLA 1M2VB 3H3PH 4NZ8A 4QNPF 5IK3B 1XSJA 5EO0A 1JGVH 4GIOA 2HJKA 3QJZA 2UYLB 1M3JA 5FA3A 3GKZA 1EMTL 1RZ7L 8PAZA 2KUTA 5IBUG 2XJLA 4IIQA 3WFDL 4XAKD 2IPTL 4FQXC 5DRXB 3RVVC 2GAZA 1KWKA 1E4JA 3L2MA 1F8TL 3B2VL 4J7RA 4PR5A 4F7PA 2HJFA 1HHGA 3L1GA 4MAZA 1U58B 1TTFA 2ATKA 5AENA 3TIEA 3L3HA 2HG5B 1YMMA 4QRUB 4PD4J 2G9KA 4KX9A 2X4UB 2VRQA 1UA6L 4PEEA 4XXDA 4UTBL 1EZSA 3W0WA 3S96B 4Y4KC 1K4CA 1EBAA 3AQYA 4JDEA 4KVPA 4TVUA 2X4UA 4JREB 5AYUL 4J39A 1HL8A 3QC5X 1SDYA 2R83A 5IQ7H 3U0WH 4L0PB 1NFAA 4N24A 3ARSA 3MLXL 5GGTA 1S3KL 3UTOA 4AQ1C 3V79C 5IJDC 1F90H 3FUFA 4FHJA 4G9FD 1GYCA 3UABA 2XRAH 1FDLH 3SB3A 3K6SA 1WFUA 2X09A 1GTNA 5JW5B 4G9DB 2VC2L 2VSKB 4N0YH 1XGTB 3A6CH 3B9EA 2ZOWA 2AXHA 4UNIA 2PABA 5DMYA 2B1AH 4PTTB 3KWWB 1NIFA 5ALBH 4R7DB 4MA8H 3MI6A 5E4IA 5ESVB 2XN0A 4UT9H 5HGBA 2Y9RT 4PJFE 3LV3A 1UT1A 2P24B 1A65A 3D39E 4NQEE 4LSQL 3ETTA 3D0VA 3I9GH 4Z3IA 4G42A 1U8IB 2K4WA 4YHIA 3MREA 3MZTA 1EEZA 3PGFL 2FO4A 1B3IA 1LO2L 4HUUA 1NKOA 2ICEC 5EC1A 1QSEE 4WW2B 4YQXL 4W9DC 4WFGE 4H1LB 3WXWH 4YR6B 1GVIA 2YEZA 3N0PB 1DBKL 1N70A 2FB4L 2AFNA 2DJMA 1HK6A 1WS7A 5J11C 1PZ2A 2V5SA 1U8NB 1MCFA 4GEJA 5EDXA 3L7FB 3M6DA 1A3LL 2HKHH 3HRZA 2V5TA 4NQXB 2QKIB 3T65B 4WFHD 4YXLH 4JE4B 1IM3D 2ZOOA 1RHHA 1MHEB 1A6ZA 4KNSA 5EUOA 4AK1A 2EH7L 2CIKA 3I3EA 3DBXA 4Z7IA 1NGXA 1C7TA 3RWGB 5ANHA 3FRUB 1I8LA 5D71H 5HVHB 4MLIA 2VZSA 4JRYB 2V2WA 3QORB 3EYOB 5T1KA 2P8LB 1LVEA 2ED9A 2BNQE 2NW2A 2PTTB 4IBQA 1QSFA 4RZCB 1C8PA 1TZIB 3N5AA 5MEQA 1I1RA 2E0PA 2VXUH 2OTPA 1KEML 3US0A 1E9OA 5AW1B 1LO4H 2X4NB 5CSZA 2DJSA 2CU9A 3ETSA 5D6CB 3BGAA 4UNUA 3MRQB 3MACH 2HVBA 5JIDA 4X80L 1IAKA 2K6YA 3PS6A 5I26A 4ETYA 1CK0H 4YHIB 4DW2H 5GGRB 3ZDZF 1JZ5A 1MWAB 1LO0H 1OGAD 1SJEA 3DPBB 5A2AA 2VDLL 3HS0C 5J7CC 2YPLA 1SDAB 2ZOKB 3DTXB 3HG1A 2JKTM 3L3JA 3WHE1 4E9WA 2KERA 4JO1L 3V5DB 4GIPD 1A6TA 1PAZA 2OXGB 3EJUA 5IB1A 1TTUA 2ICEB 4P9HL 4WGVB 4PJCA 3RWCB 4CNIB 1DQIA 4RMBA 3GPSA 1OSZB 1MHEA 2KHAA 3KJ6H 5A3IC 3KPRB 2XPZA 2XG5A 1E5BA 4AIEA 3Q13A 3BKYL 1WA0X 3I9PA 1IAIH 1ECYA 1MLBA 3P9LB 2TAAA 2RBLA 2AEWA 2C9XA 1MEXH 5AAWA 2VR3A 5CHNA 3LYRA 4ODVL 1G9NL 2VLKE 4IYKA 1MY7A 3ZE0B 2Z6FA 1IC5H 2D7NA 2WWNA 1NMAL 1L9QA 3ECWA 3NDYE 4H7VA 4OLYL 4QHUA 4N8UA 5DS8A 1Y18B 4M62H 5DS2A 1F6AA 1HE7A 4AH2A 2NXZC 3LPPA 5I1CH 3EF7A 5IVZB 3TIEB 3CE1A 5A2CA 3RWHB 4D8OA 1N68A 3HUJB 3CCHA 5F0LB 5DJ6A 4OCXH 5AUMB 4Y8DC 2AQ2A 1GGBL 2O6DA 4JFFD 1VLXA 3HNSL 1YPZA 2ZX8A 4YSTA 5EU6B 3W1ZA 4MDIB 5T33L 1QSFE 2NY2C 4JO4H 3P73B 4QRTA 4PJXA 3BE1L 1UA6H 4MNGA 3X1NA 3I2CL 3TEXA 3L5IA 2FNBA 4UTBH 3MMEB 3MUGB 5IJCC 1IM3A 5ALCH 2EIMB 5IHWA 1P5UC 1K4DA 3CX2A 4AQ8A 1RJYB 1OIOA 25C8H 1JXDA 3TFBA 1CR9L 1ZT4B 2HFGH 2R51A 3D4ZA 2WXHA 3FCBA 3HG1E 4NAMA 1MIEH 2JJWA 3US9A 2AV1B 4QY8A 3QCUL 3U1QA 3WKMH 3L3DA 5DR5H 3HZMB 5D70L 1ADQA 1ETZB 1FGVL 3MLSL 4HUXB 4JZJB 1AHWB 3VD0A 5KSUA 2VQTA 3BPLB 3VD3A 3JVFC 3IXTA 1E27A 1SJXA 4FQXB 3REVB 4J8RA 2EXYC 4ZQKA 1DDTA 1QPXA 4Z76A 5EEWA 2OMVA 3QYCA 4TSCL 2YPLE 3TYGL 2QPSA 3ALPA 4Q6YA 1Z9NA 1U92A 2FJHB 3MNVA 4JRXD 1E9OB 1P6FA 2WAQA 2A3TA 1XCQA 4YPGA 1PBYA 2P47B 1BZEA 5DRZA 3E8UH 1MDTA 4ALAC 4HX1B 2EVFA 2C9SA 3LQAC 4PLKD 4CMMA 4LLYB 3T04D 4IBLT 2OJ1A 2BY2A 1A4AA 3L5HA 1ZE3H 1LO2H 1RZKC 2WVTA 3BUPA 4PJXB 4C59B 4NQXA 3B9KB 1YQVL 2YBRB 3M7FB 3SKOB 3DECA 1TJMA 3SPCA 2UXFA 4Q9RL 4GJTB 4U6YB 2LGNA 4IMLA 3FJTA 2HWZH 2M83A 4IDJH 4M61A 4OGAC 4NC2B 1SUJA 4GG8B 3THMH 4I2XB 4G2AA 4PJEF 4QOKE 4AQAA 3MODL 5DJ2A 1QAWA 3T2LA 1JOIA 1FE8L 1U3YA 3PAYA 4TVSa 5HHMD 3RVTD 1JGDA 2BNUA 3GTTA 4OF6A 3VVWA 2DEXX 1AZRA 1E27B 3NA9L 1JS4A 3RRQA 3SKUD 3LHPH 4MAYA 4NC0B 4CU8A 3LJ3A 1S3KH 5HI4D 3QIBD 2EC9U 5TF0A 1UZGA 2WYIA 3N42F 3QJRB 4R7NA 5KAQG 2IVFC 4M93C 1EEUA 2O5XL 2CDEA 1CZ8H 2ZOLA 1J0YA 3P9MA 3LRMA 4C55A 5T3ZD 1A7OH 3HZVA 3A6BH 4ZXBB 5HPMB 3JV4B 4PWJA 3BGFB 5B1AB 1CLOH 1JYXA 5GGSB 5EA0L 5J6GB 1DVXA 2UWEF 4XH2B 3RVWD 5I6KA 1WIUA 3D3VB 5CLYA 3CCHB 3I3BA 3ULUC 1OTUC 2FQDA 4LSUL 2I5YL 4ZPVB 1PD0A 2EEBA 5CZVL 1TTRA 3O3EB 5MHSE 2IXQB 4KRNA 1LNUB 2BVTA 4LEOA 2A77H 5FM5O 1MFDH 1S7RB 4YSQA 5CLWA 1Q94B 4BD4A 4LLQB 4YDIH 2OZ4L 4NN7B 3QDME 3MRDA 2EKJA 4QYOB 3K4ZA 5A1AA 3ZY7A 1KIPB 1F3DJ 4XGZA 3FU3A 5CSBA 2W07B 2YIHA 1S9YA 4ZTOH 4ESKA 3BP5A 4ZMPA 3UC0A 2X4QA 1E4XH 2CNYA 2Z4TA 4OT1H 5DJXB 1J0JA 3RPIA 1QFUL 2Y4SA 1SXZA 1SGKA 4S1RH 4L5FL 4BWUA 3B2PA 1H8SA 2HG0A 1OTTC 1H15B 3EJTA 2APBA 4JR9L 5EZIH 3A21A 4B9ZA 1G9NH 1TPXC 4NQEB 3W3BA 4F33A 5DJ0B 3O6FB 3PGDB 3ARBB 1QPKA 2YSSB 5C6TH 1FG9C 3OAZK 3WOVA 1P7QB 2VMEA 5GGTL 4LB8A 5FF6A 4KKCD 3RWIA 1H15A 2JKLA 3O6ML 2E9GA 2UUDK 4PJ7A 3VXTA 2E86A 2HVJB 5TTRA 1PYWB 3QPQC 3KNBA 1FWXA 5LKNA 3BEWA 1NCBH 5D6DC 2APVA 4PS8A 5FYJD 1M2VA 2AQQA 1UENA 2B2XL 2Q7NA 3HRZB 1E5ZA 2V5YA 1DVUA 4R8WH 1T0MA 3MTRA 3CAFA 2G4GA 1WLGA 2QHRH 2WVVB 3TO4A 5FFLA 1RZ8B 4JO4L 4XO4A 3CFJA 1GXEA 2OFQA 2B0SH 3V5HA 1FGNH 3FT3B 3C5ZC 3F7RA 2V4LA 5KANG 4LLUA 1A5FL 4A7VA 1ZLWK 1EXGA 2VJ0A 5KBDA 5I6MA 2HJFB 3KLHD 4KPHH 1RUQH 5FK9A 1BEYH 3HHSB 3NJVA 4R4NC 4IBTA 2ITEA 4LCIL 4H0GA 5IF0B 3LHAA 4XR8C 1WFNA 2VXQL 2DBLH 1HZHL 2ZX5A 3LOWA 2VR4A 2R2EA 2KL6A 2KLRA 4U1HB 2EE0A 3OR6B 4XP4L 4G8FB 4X7TA 1NIBA 5DMIH 5SWZB 1URLA 2WO3B 3QXUA 4TSCH 5ICXA 4Y19E 3PWVB 1RP8A 4DPAX 4AGQA 5GS1C 3LIZL 4MJIB 3T09A 2E56A 3HS0A 4ZS7H 2CHWA 5GHWL 5E56A 5KS9A 3PWNA 4JHBA 4PJ9B 3KXFE 3L5WB 3QORD 4OIIL 3BVWA 5T3XD 4ERSH 4HLEA 4NT6A 5JPNC 3Q43A 3HFFA 4X9IA 5H37G 2E8YA 2LU5A 4K7PH 3WBDA 2LTQC 3SPVA 4IMLB 3G6JA 1P5UA 2D0GA 4RAVA 4X0KB 5KG9A 4YS4A 3ARGD 2GW5A 4HSCX 1GGBH 1XGYL 2P24A 5E6YA 1OQOA 5AVZB 3U0PA 4IKNA 2OX5A 3CWGA 3EJCA 3FTXA 4JHZA 4IHOB 1S7UB 3GSNB 4DP5X 1LE9B 3VXRA 1XGRA 3UACA 4J3XA 1B90A 4I4WA 1NOLA 3ZRCC 3KGSA 5B7FA 4P23A 5I8CB 3R7QA 3KM2A 3NGBB 1ADWA 5DUPL 3RVXD 4M7LH 3TNNA 2B4CC 3QEQD 4DAGH 1XGRB 1YEEH 3GSUB 3O8XC 1UWEH 5C3LD 2OK0H 3UCQA 4Z18A 4TTGA 1OD9A 3FOMB 4OI7A 3WKML 1CICC 5IJVB 2BSBA 1NC4D 3UP6A 1PY9A 4N25A 4R0LB 5GRVK 4M5TA 5BZWA 1KBVA 3H4HA 4NHCL 1Z2KA 5JPMA 1CTMA 5DZJA 4JQIH 4KTDL 3UZEA 5T1LA 2NUPA 1MHCB 3T3MB 4YFEA 2B4CH 4FYRA 3IJSB 1RIUH 4HIIA 3P77B 4QGYA 3MO1B 2V8MA 4FXGC 4F15C 1BLNA 5KVDE 4F8LA 1NCWL 3CVIL 1U9KA 4CVUA 3SGKC 3GXDA 4J5VA 5ADOH 2AK4E 1HHGB 3NN8A 5SX4I 4JY6B 4PRBB 4MB3A 5G5DB 5I9QC 3LZOA 4WCYH 5EOCL 1HVXA 3WEXA 2HH0L 5CM1A 4D0CB 3Q2CA 3T08A 5L2KA 4KQ0A 1ADQH 1DHKA 4E42B 4O51B 3DJTA 1WUZA 3VFUB 3GPEA 3DXAD 3IF1B 4RWYL 1G1OA 1QFWM 2MCPH 5BVJA 1E4XL 1XF5B 4PG2A 3MRKA 3FULA 3N1FC 1AYOA 4KZCA 1EUUA 1RK7A 3TZVA 2CK2A 4TUUA 3BHBB 4JR9H 2VLRE 1CIDA 4JK0D 5FB8B 2N56A 1NFDF 2WQSA 1FE8H 3D39B 3G9AB 3MLUH 3EG9B 2W88A 5E7FA 5D7LB 4BSVB 1RUAH 1UH4A 2YAFA 2G9HA 5JIMA 1FORL 1G5GA 2BDNL 3LZQA 5IM7B 3UGUA 4ETQA 3QEGL 3QULB 4ALAL 4UOW1 5JW4R 4JANA 2DQEL 3C5ZA 4TOYL 1YEKH 3K3QA 4QTIL 3SBWA 3ZIMA 1Q1JH 3IWVA 5HGAA 2C9QA 1S7SA 2NY3B 5CLTA 3GHEH 1YAIA 3CK0H 1U3JA 3NJLA 5D7JA 4UB0L 5EOTA 3BWAB 4N9GB 4LQFH 1OAQH 3O9WC 1EFXA 4KUZH 4N3TA 3KS0J 4BCXA 4D9LL 3FO9B 3PXJA 1Y7VA 3IFLL 4YE4H 5KEZA 3CBKB 4WO4B 1MI5B 3EHBD 4WLCA 5J13B 1F3DH 1KGCE 3H9SA 4N2AA 1DJZA 1WUNT 3LEYL 1GGIL 4UOQA 3SCMA 5DVMA 1JTOA 2BZCA 1J8HD 2G0KA 2OMTB 3JUZA 4X2UA 1JWUA 2YXFA 1ZWIA 4MQ7B 4P46D 1Q9LA 1RZJL 2Z7YA 4TLKA 5EN2B 1HZHH 4KI1A 3MRLB 1FLRH 4J3BA 2VZVA 1JPEA 3BQVA 4PW4A 2R8SH 3VACA 2VDPH 2B3RA 5CXPA 2EC9T 5K9KB 3CXHJ 2EIZA 4XCEB 1J1OH 4EUPG 1KELL 3II2A 1JK9B 1L6ZA 4QXGH 2AAAA 3CDZB 1XMWA 4PS3A 4OZGE 5F0JB 5KS9E 1KJVB 3HVDA 1WICA 2UY7B 2XZZA 1INDL 4P48A 5C7ZA 4FI7A 3B9DA 3DX7A 1AACA 5LHDA 4DO5A 5EHFA 3EH3B 2VKWA 4MDJB 4ANKA 1DUZA 4LSPH 1RZGA 4DP6X 1SF3A 1JERA 1MAML 1OPOA 1E8WA 4AEHL 4ODSL 3HAEA 3E9TA 5KVEL 1BVNP 5LCVA 5TPWL 5GGVY 3SDYH 2VDKH 3A3YB 4PYHA 4QRAA 1F13A 4TQHA 3RWEB 3KPLB 3G6AB 2ARWA 4CADA 4X5WA 3Q2VA 1NMCB 3QR2A 3TNMA 2R2BA 1HZLA 1ND0A 5F7AA 4V11A 2DQTL 5GSRA 2N59A 4PWIA 2AMUA 5TDOA 1M71A 3E6FB 1AANA 1F97A 2IDSA 3SBQA 2QSCH 2EE2A 4AXWB 5FFGA 1JPFB 3B34A 4KOBA 1WAAE 2H1XA 2IGFH 3X11B 3LXUX 4OZ4A 1MSPA 3T4AB 2O5ZH 5MEQB 1FFRA 4HBQA 5I1AA 5G4NA 2WZAA 5IVXE 5JW5A 3FO0H 2IALA 2X1PA 3AY4A 1JRHL 4HU2A 5D7JD 4P2QE 1CS6A 4WI6A 1AMXA 5FHBH 1F58L 1I9IH 2FUQA 3QZNA 1IQDA 4Z8FH 2HJKB 4LVHB 3E7JA 2WO2B 4S2SA 1P7BA 4W1TA 4JM2D 1YEGH 4PBDA 3PWPB 1NBZA 1KDIA 1ED3A 5JTWA 2C1PB 3PGCB 5FYLH 5ADOL 2X28A 2ZXCA 3VFRB 1J8HA 5E08L 4N2MA 5JOPE 5C0EA 4JFQB 3ZKQD 1SYVB 1NA8A 5FUCC 4RDQG 2F8IA 4GW4A 3HI5H 3HKZA 3BXNB 1TITA 2B14A 3ABLB 1U0QA 2OJEA 1KXQA 3OKOB 3GT6A 4JM4H 4ZMNA 4Q0XL 4U4IA 2BPBA 2JV6A 3ARDD 4Z7UE 4RMVA 1HOCA 3ZGHA 3NPSB 1ZY9A 2UUDH 3VXPB 5I28A 5LGKA 3BD4A 1E5AA 4M7LL 4DZBB 3U4EA 3U0TA 3VFMB 4QRPA 5JR1H 1UC6A 3MV8B 4F7KA 3BP6B 2C1OB 2YAOA 4PJAE 1MRFH 3BKJL 4IKIA 1GZQB 4K3EH 1J5OL 1SDDA 4WF7A 1JXJA 4UINH 1EX0A 5AZEL 2BHYA 1ID5I 2FJFA 4Z76B 2HCZX 1YEKL 3UTPD 3MNVB 2Z4QB 1RURL 4P59L 1KLGB 4K3JH 4WNSA 3JUYA 3U46A 5TDPA 1ECZA 3NP3A 3VGGA 1O9VA 3VFVA 3DIFA 4JZOA 3UTSB 3QNXB 1AS6A 5CLXA 5ESQB 1OAQL 2R0ZL 4GYBA 5F7LB 2ISDA 4AK2A 4HIXH 2ZONA 2NY5L 3D33A 4JFPA 3RAJH 3ZDXB 3PREA 5K9QI 5JO5A 5LLIC 1ZHKB 1N4XL 1JV2A 4UIKH 5DJ8A 3UG4A 1YQ2A 3KYAA 3TNMB 4BRJA 5FDWB 2HFFA 3ZYJA 5KWYC 1L9PA 4OU3A 4DEUA 1B0WA 3TV8A 5I8KL 4Y9GA 2HP4A 1IKFL 3PWUA 2D4DA 4OY9A 2CO7B 5EIIA 2AERT 1AR1C 4FTVD 3HN3A 3WE1A 5I18L 1KB5B 1TQSA 3F3HA 2WGXA 4PGBB 2WNKA 3SY0B 2HFTA 1N3NB 4LSTH 3HHMA 3SE4C 3OC5A 3X11A 5TGBA 1XB3A 4L3ED 4GRWF 4D9RD 5HHOE 5MEPB 3GS7A 2AEIT 2CM6A 2P8MB 4K5LA 4PWFA 4WW1A 4XBEH 5GS3A 4IS6B 3KPOA 1CXIA 3I50L 1YUKB 3TWYA 3C60D 3MRNA 4AH2B 1QHPA 3P4MA 4OIAA 2QDWA 4O4YL 2A9AA 4A55A 2QVIA 3TTSA 1G9ML 3K2UH 2PWDA 4L8SA 3NEOA 4HT1H 4QTIH 5C1MB 2MQ3A 4G8GB 4ODXA 1T5WB 3DV4A 3EGSA 3O4OB 2VLLB 2AJUL 2JJTC 3O81A 2VDLB 3LIUA 4FQHB 1D9KB 3WO3B 4F7MB 2CK0H 2VLRD 5IROD 2DQHH 2VM3A 4W9HC 4GXFA 4XCCH 1OAUL 5ICYB 5BCAA 2FT7A 5FA3B 3TA4D 3ULVH 3LQZA 4PV8B 4BZ1H 1OZUA 3VXSD 1O0VA 4MRCA 2R23A 5ES4B 2WBJB 5C3TA 4F9LA 1TVHA 2OMWB 2IF7A 4WO0A 2HYMA 4G6JL 1LXMA 2OJEB 3GM0A 4KRMB 4EIZC 2WCSA 2NYYC 1SMOA 3OHMB 3HI6H 3MA7A 3KBFA 5DLML 5CBAA 2IGFL 1CYGA 3OJDB 3QO0A 3VO0A 2XCMC 4M03A 1OGPA 5IFAH 1DN0A 4YDVB 1CFQA 4ZQKB 1JMXA 3X17A 3ULUF 1RJLB 3RJQB 2LU4A 5D6CA 2AABL 2TRHA 5D4QA 4DGVH 4EDWL 5IMOB 3ZTNL 3TBSB 1IBZA 3IDXL 1ZA3B 2PO6A 2XZCL 2H26B 1CU4H 3SCMB 2V2XB 3KWXA 3ATDA 2JB5H 3UYPA 2JMRA 1MHPL 2K45A 1KCUH 3L4UA 4PRIB 5E00B 1OZTG 2YPVH 2QQNL 4XVTH 4YC2B 1MJ7H 3DOSA 4C54A 3CC5A 3L3JB 4GXUN 5SV3A 2A2QT 2VAJA 5AW2B 4LARL 4NRXA 4C58B 4JJHA 4FFYA 3DRTB 3IJHB 5DCCA 2VDQL 2V6HA 3V4PH 3VWJC 2X05A 4HEME 5IB5A 4L1SA 3APDA 3ML9A 4X6EA 2Y1YA 3OX8B 4LLUB 1NPJA 4A7UA 3QPKA 4K9EC 3UZEC 4FXKA 1VZGA 5DU7A 1BLIA 4V1DA 1XSIA 1Z32X 4RMTA 3ARGA 3LS4L 1HI6B 5CEZE 4CSZA 2FL5B 1YC7A 5EFIB 2VDOL 3ARBD 4NQVB 5I1EL 2WN2A 3WTTA 4X8JB 2GCYB 1H3WM 5I1JH 5D7IA 5DEGB 3P2TA 4HK0B 3BSZA 5A2FA 1X5ZA 3MRHA 4FYQA 2Y7QA 3MVSA 5DF0A 4P04A 1IX2A 1DFBH 1PU0A 3I02B 3NABH 4MZ2A 5DFWH 4WW1B 3QI9D 4OF5A 1VEPA 3V0AC 2BCMA 3HMXL 1XD1A 4OGAD 2BSSA 2PW2B 2V7HA 4BHUI 5BVPL 2PYED 4PGCB 4G7SB 2HJLA 3AM8C 2DQGH 1GS8A 4MBOA 1UM6L 5B4MC 5BW7C 4OZ4B 4PH8A 3T4AA 2F54D 3N0AA 4IEFA 4P4RA 5DLLA 1HILA 2F5BH 3ENEA 4HEPG 5H8DA 4M3KB 3B2VH 4HIEA 2Y07H 5I17A 2GHWB 4H8HA 1YN6A 1M9SA 4Y5YB 4JFOA 2XX1A 5CFAA 4C83B 1I53A 3M17B 1EJFA 1YLBB 3U7YH 4RFEB 5IIEB 2X4SA 4PBXA 5GISL 3RZCB 3FCGA 2AXFB 5DUJA 4EDXA 3AU0A 4PRDA 1G4MA 1JDAA 3WIFA 3HC2A 3CGTA 5JDSA 3AY4C 1HXYA 3HC3L 4OLZL 4R96B 1IGTB 1JCKA 1T2XA 5IWLC 1TZGH 1GHFH 1QPPA 1WCQA 1ZTXH 3FH7A 1FFOA 4KK8D 2ZUSA 4I7ZC 5AW9B 3O0RH 1A7QH 3ARYA 2AK4A 3OLGA 3PWVA 4XMXA 4CGUB 4L8SC 1K9TA 1I7ZB 1S7QB 1SXBA 1FNEA 2A6JA 3QIWA 3BAYA 5CP7A 4QHKJ 2V3FA 2H1PL 2VUYA 1EAQA 3FSAA 4U3XA 1VFOA 1F4XL 1UWYA 2EYSA 4GUPB 2F61A 4YIQB 3G3LA 2UYLA 1VHPA 2ZKWA 1VACA 4QWWC 3AG2B 1MCLA 2VYRE 1Y6MR 4NIYE 3UZQA 1AHKA 5AG9A 1S7SB 3Q1SH 4R26H 4FEMA 1OAXH 3SYPA 3V0DA 3G7TA 3D48R 4RRPM 3K2IA 5IESH 4PJEA 2Y0SA 1BD2B 3N9GH 2L7UA 4PJ9D 4AM0B 3AG4B 1AR2A 3H8NA 3DHJA 4GRLC 4LU5L 5EV7A 3U36B 2EVHA 5GGSY 3NVQA 2VISB 4HPYL 2JIXD 1ZANL 3D85B 4WI7A 3D0VB 5AW7B 4AKOA 2XNAB 3BCDA 3TBVB 1NIDA 4TTDD 2NXYB 1NBQA 3KPLA 4HBCH 1R47A 3MX0B 2R1WB 4QCIB 3SO3C 4J23A 2D2OA 1QLRA 3T0AA 3QDHA 3TEUA 2DLFH 4BEIA 3S35H 3TX4A 4NI6A 3S88L 2ZG3A 3GI9L 3UTPE 4KZDL 1BEXA 2CO6B 3MRGA 3NCMA 4UOW0 1FYHB 1K2DB 5AW3B 5I1DA 5DVOA 1OSEA 4XMZA 5IG7B 5K59E 1JXFA 1JJUA 4JZNA 4FFZA 3ZJAA 5LAXA 4E9RA 3O6FA 2MJWA 3PGDA 3MXWH 5F6HJ 4HAKA 1E65A 4ODHL 3LKOA 2GJ6B 2VDNB 3EFDL 4KV5E 1AY1H 3IJEB 5DRNB 2F54A 1G6RL 4CSSA 4KVCL 5JXAL 3HI1A 4D3CL 4XOCA 3T5WA 4GMTL 3PDGA 5FGBA 1KCUL 1TLKA 2VLJE 2WYTA 4FMKA 5D5MA 4A7GF 5AOKA 1DBBL 3D4YA 3B8YA 4HIJB 1KPVB 4JZJA 2PR4L 5B8CA 4FG0A 3UZVB 3F7YA 5E9DB 3GZOA 5AKVA 4IS6A 2G30A 3RWEA 4R7VA 4X5QA 1YN6B 4Y5YA 5KJRL 4GI9A 1ES0B 5KVGE 1ZTXE 2JCCB 2PCFB 4AEEA 4L3EE 2YZ8A 3Q5TA 1ODUA 4YSRA 1KY7A 3HC4L 3RURA 1WWBX 2FECL 5E94A 4LDOB 1XR8A 1B2WL 3QA3A 4QHNA 4P2RE 1AS8A 4GUOA 1QX1A 3ASWA 4S1DC 4POZD 5DQ9B 3GUFA 4XMVA 4I85A 5AZ2L 2JVUA 5JHLA 2V37A 2X3BA 4MVBC 2CCWA 4AC4A 2YEQA 3DTXA 1N19A 1VESA 1EIBA 2A4CA 5FDYA 1GOGA 2P5WB 2XQ0A 3UROR 1II4E 4E41D 4Y2NA 4BQCA 5K9KA 1IBDA 4OLUH 2XVBA 4YSDA 1RLWA 3PFQA 5E2JA 5CZKA 3V8CA 1A7PL 5AOZA 3UMTA 3MRIB 4IBUA 1CF1A 1MW2A 2ERJC 4U33A 1D6VL 2CO3A 2EYRB 2P46B 5GGQL 4GPVA 4LOVA 3VGAB 4NAQA 4DGVL 4EDWH 3PAZA 4PJ9A 5E9AA 5FYJH 2UXTA 4BXSV 5LXGL 1CU4L 4KJWC 5C0IA 3KPSE 1TZHB 2FHFA 1ACXA 1UM5H 1J18A 3SE9H 5IB3A 1KWGA 5MEND 3HCVA 1JGUH 5TF1L 2I26N 1A6VH 1L9OA 1X9QA 1M7UA 1ZEAH 1IT9H 1JP5A 3OAUL 1J9TA 1ZLUH 1ZCRA 1IBBA 2EXWC 1IEAA 3MGTA 2IQ9H 4BFOA 3HE6D 3P9MB 1CPUA 5F2FA 3KYOB 4Q52A 5D4JA 2BS9A 2VZUA 1DJHA 3J07A 3PABB 4QR7A 3TBVA 6FABL 4HWZB 3U48A 4RIRB 3OKOA 4KXDA 4QCIA 4WI5A 2OL3L 4KZEL 3BLPX 5HY9B 3MGOA 4YBLC 5EBWA 3OKLA 5DR5L 3VDBA 3MV9E 4JJOA 1SN5A 2DI7A 2EDWA 4Q58C 1RUMH 3DURB 4X5XA 5F3HB 1FFNA 3WS3A 1LHZA 1MFBL 3FB8B 4OQTH 4XP6H 4YHOL 1O75A 2CDGA 5DD5L 4FAAB 5A2BA 4HCIA 4PJHB 1XB6A 2BW5A 5GZOA 2DYPB 5AW6B 2MSPA 1E6OH 4W9JC 1K5WA 1ZVNA 2HTLC 2Y1ZA 3S3JA 3NFSL 1OK0A 1RJZA 2Q86A 3EOBA 1OF2B 5FO2A 4NZRH 4XNYL 2FDBP 3RVVD 2BLFA 2LU7A 2ZJSH 4OZHE 2NXZD 3SYAA 1UD5A 4G6KH 3U6XS 2W60B 1SMDA 3IDGA 4I0KA 4RVBA 4ZRGA 3GS0A 1SBSH 1XCXA 4L3EB 1NGYB 3LH2H 4YGVA 4MD4B 4KK6D 1HSAB 4JMXA 4XB7A 4KO5A 3TEZA 2GBAA 1YNKH 1P2CA 3UAJC 4IOIB 2P52A 4DQAA 4F8QA 3MX0A 1T7VA 2DYPD 4NP4L 4UNVA 1E6JH 1JBJA 4PW3A 3LS5L 2E8ZA 3EJRA 3L45A 3L3OC 3DPDA 3G08A 3S48A 2CRIA 3QISA 1HE8A 2XTJB 3ML8A 3NA4A 3MPCA 4XE5B 2W9EH 4OM1H 5CAYB 1LJMA 4U3CA 3S36X 1S5HB 1A4KA 4GP4B 3QC6X 4HS3B 3GBLA 4QLWA 5DGQA 4HXAL 5AVWB 4JFOB 1K3IA 3OHXC 4U1SB 4DK6A 4ZUSA 5DYFA 3SN6N 5ID0A 3I9AA 4RFEA 1W15A 2X0WA 4UUJB 5HYFA 1AZZC 4S2SB 5D7EA 1ITCA 5F6IB 4UCFA 5L9DH 4JQXA 1KCVH 1OV8A 5DJAA 4FXLA 4FL4C 2EVGA 5DWUH 4KVNL 3E2HB 3MBWA 4L4TA 3HG3A 1QRKA 4J1UB 3C09C 2WPGA 2IANB 2J8HA 4KJQC 1W2KT 1IC1A 3RFZB 3V6ZA 5BQDA 3S3SA 4M9OA 2EUZA 2HFEB 1JF1B 2N1TE 2XKUA 1NAKL 4KK5C 4OLEA 4FQCL 5E95B 3KZ8A 5T5NF 4JRWA 1F56A 4PCTA 5AAMC 4YK4B 1AOHA 1CICA 1OAZH 1VRSA 4RISL 2I32A 2VDML 3FSVA 4JPKH 3QARA 5EEXA 1KCLA 1X5XA 7TAAA 1LL1A 1I1AB 3MA9L 3PQYA 4TXVB 3FW6A 1LNUA 1UOVA 2KBGA 2CM5A 2LW3A 3ORJA 5CHNB 4ZTOL 5D1XE 3PL6C 2YN5A 4PB0L 2WINA 3LRGA 4MJHA 2HRHA 4U1JA 4M6OH 1VJSA 4X50A 1MFAL 1MG3C 3TCTA 5JOFB 2A7BA 1OCZB 3BVTA 4AIZB 5CEZL 2AQSA 1CFMA 3M1CA 5BO1L 4BH8B 2GTQA 4BDVB 1TT6A 4MA3B 1KJVA 3QCVL 4Y4FB 1FBIL 2QLYA 4XAWL 1DVQA 5E2UH 1IGMH 1QLRB 2Z91A 2OX5B 3EFDH 1N5AB 1QRNE 2PXYD 3UYPB 5CD5D 2NNRA 1GZHC 3NP4A 4ODUB 5D1ZD 3T0EB 1A8ZA 5JIQA 4J6RH 4HH9A 1G7MA 1O5PA 4JPVH 1C5CH 4YZFF 4K9EH 1QW9A 4OZFG 4PP2B 1GKEA 3IGLA 3EOAA 3GKWH 3I6SA 4O5LL 4RNRB 4BWWA 5H35A 4PI0A 4NIKB 5ITFA 2FO4B 5I1KL 4W9IC 4XN9A 2PPEA 3MYZA 4LLQA 4FLQA 3CHOA 1Q9OB 2BNRE 2EDMA 3BUYA 4NQQA 4IMKC 1A4JA 4RA0C 2LVEA 4ZSOA 4MXWH 1RXLA 5E99L 3IDIA 1N12A 3VXOB 5I73B 1I8IB 2DQFB 3AADB 2OMUA 5IR1A 5ISZE 3C60B 3MOAH 5CGMA 1IO4C 1IGCH 3KH4A 1GGCL 3DSFH 2GI7A 4X4XA 1F2QA 4O02A 1IL1A 1JV5A 5AKSA 4AIZA 3K72A 3UAEA 4HJEA 1PLGL 3QFJB 2QPDB 1XCQB 3ARBA 4YPGB 1SEBB 4A68A 3ULVF 4XC1H 2W0PA 4G8GD 1G7JA 1FFOB 5CZXD 3EYSL 2JCCE 4ZTPH 1K8IB 1KTKE 4OLUL 4NZRL 2FX9H 2YFOA 3KVDD 3MGAA 4NQTA 4UQAA 4D9QE 1F2XK 5B7EA 4HUWA 1EVUA 3E6HB 1CGSL 1D9KD 2D03L 4EOWL 5IESL 1OM3H 3PWLB 4UM9D 5EZOH 2YAPA 2LLGA 4S1SH 1LWHA 4YUEH 1I8KA 4U6VL 3QIBA 4WFFD 4P2OC 1F02I 3PPEA 1UQSB 2HKAA 4ZAKC 1XO8A 4ZPVA 1ZV5A 4G8IA 4LEOB 1TEGA 2V7NA 4L1BA 5B1BB 2N7AA 4DKEH 2DMBA 3STZB 2ZP9A 4WEUD 1DN2A 2TSBA 5EIQA 1TIUA 2FH6A 4PJ5D 3T2NH 1K6QH 4WSKA 1F3RB 4C8XA 1FGNL 3PWJB 3RWCA 3BIKA 4S1QH 5E4EC 3IDNA 3VGFA 4YDLC 1E42A 2X1OA 5TFSH 2WLIB 1S7UA 3GBML 3ZIYA 4LCYB 1JHKH 3KPSD 4JRXE 3RP1A 3NCEB 1ML0A 5J9PB 3GWJA 2FEEL 5EF1A 1MRDH 4JFZH 5IHLB 4ONGL 2X4RA 2X40A 4AX3A 2Y7LA 3I9IA 1B0RB 4YHKL 4N90D 4JAMB 2ZXAA 2XOTA 5DWUL 4I2XE 2YWYA 4U2YA 5KYWB 1OT4A 5KUKA 3L1OH 2B16A 3NJHA 3FQUB 4K3DL 1JWUB 2BHFA 3BN3B 1Q90A 3KYMB 2IPUG 5FW8A 3WL9A 1DFXA 2IXQA 3NIGF 1CGTA 1T3FB 2ZUUA 1NL0H 2FATL 4W9LC 4BE6A 4FQCH 3AXLA 4H0IA 4C56D 3F65A 1LGVA 2OCJA 5KVDH 1MCCA 3NESA 2PWHA 4E36A 1J9CT 5I1IL 3SKMB 3L81A 5K33A 2QADC 2OS7A 2V5RA 4GMSL 5ENWB 3SDDC 3NEEA 4RFOH 2MQGA 5GXBB 4TUKL 3HIZA 3JYCA 2QPFA 4TTDC 3WTSA 1A4JB 4JFEA 4EVNA 2ZKMX 4PREA 1JWMA 5DT1H 1GY1A 1SJEB 1YEIH 1OF2A 1ASQA 2M8XA 4CRPA 4M1CD 4DEWA 1IJNA 3BGMA 2ODHA 2FSEA 2RH0A 3ZDYF 5HYQB 5C70A 1EJ8A 4FFYH 4JB9H 4LF3B 3B2MA 4QXTB 4Z7NE 4D2NA 2EDRA 4XZUA 4F8OA 1JG9A 3WAKA 2CJUH 2X70B 5T3ZE 1MFCH 2DB8A 4FOMA 1MVUB 1OB1A 3O4LD 4ZOBA 4OFKA 4QXTA 4Z7QE 2XWRA 2WXOA 5I74B 3TO2A 5EU7C 3P3SA 3EDDA 1XTLA 4PRHE 4X4ME 2P4AB 5E8NB 2B7DT 3OG4B 4ZYKA 2OR9H 3ZUNC 5EF3A 1GMIA 4KGJA 1UH3A 3NRFA 2NZ9D 3G5VA 2VC2H 3I74A 3WLWD 1WT5A 4JPSA 3VDAA 3QWNA 4QRPE 3UO8B 2FBRA 1CE1H 5J12C 4B53A 1QLEH 4L3CA 5DC9B 5C3IA 5HYJD 3HHSA 5A3ID 5LJYH 5C07E 4NQCB 4TNGA 5LQBH 2ZSVA 4YX2L 2QVKA 2QV4A 2VDOB 2AGJL 4CILA 4I1PA 5IBLC 2J20A 3UXFA 3N40F 3U1SL 4WY7H 4M7ZC 2H2SD 4OZIA 1A14H 3I6LD 2GCYA 4UV7H 1BG1A 4HETA 3X3GL 3AT8A 1HJCA 5TQ2H 3AVEA 4F2FA 4MJ6A 4MA1C 3WUWG 2C1PA 2VL5B 5EH1A 5FGCE 4NQDE 2WXJA 3TCLA 2I9TA 2EECA 3QUML 1Z66A 4KAQL 2W9LA 3RDTC 1CFSA 1NDGB 1YYLH 2ESVE 1HDMA 2AEPH 5GS0C 1O6SB 4HWNA 3J8F7 3LNFA 3VI3E 5C09E 3BJLA 2WUBH 2NR6A 4MCZB 2NY6C 1EGJH 3HZ3A 1KGYE 4N2FA 3HLAB 4XXCA 1C12A 4JCWA 1RUAL 4F57H 3KPRA 3CIQA 3JV4A 2P26A 3EYQC 3DVNA 3ZDZB 1NLDH 3KYNA 3PP4L 3V0EA 4PN6A 3QDAA 1LILA 1BBJB 2YKKA 3IDYB 4AYFA 1M53A 1GCFA 2VLJA 1TTGA 4G71B 5D1XD 1XCTA 1TJXA 3DI3B 3QAZC 1WZMA 4PJ8D 3VUAA 2BFVL 3WUWA 3U2SB 3P11H 4FABH 3WIHL 1E4KA 3HMWH 4RBPH 5C0CB 2YUZA 2FYYA 2QR0B 4WTQA 4ANWA 4YDKH 4UZGA 4B5EA 3HKFA 3SDCA 1LP9E 3CSGA 1LTXA 3VA6A 4XCFH 3GJFK 5BW7A 4IOSD 4YE4L 2DQTH 5I23A 2RIKA 3HB3D 3S3DB 4FXKB 3O41A 2PF6A 2GTWB 3CBRA 5ESAB 2NY0B 4KNUA 4HCFA 3WLWC 3DMMD 5E5MB 5HY9A 4MHHI 5IFHL 3FN9A 1YDPA 1RKRA 4PWGA 2W0LA 3S37L 3ZRFC 3CSPA 1GGCH 3DSFL 4TN9A 5DHEA 3W39B 2BSTB 3DX1A 2QQLH 1BD2E 1ACYH 2R27A 3K6OA 3ARRA 2EYSB 4K94C 1A6ZB 5EUOB 4AE1A 2FD6L 1DEEB 3GMLB 1N6VA 5E6SB 2WBXA 3DBXB 4G1EA 1I8IA 3WEBA 3UO1L 4QXGL 4YO0B 1I7RB 2MEJB 4NKIL 4GRWE 4BFKA 5E4AA 3BWUC 4M1GH 2RMNA 2YD1A 2MOVA 4S10A 2DI8A 2B15A 4CN1A 2P1YA 2WBJC 3F7PC 3T6ZA 4KQ3L 3HPJA 4MWFB 1TNMA 3PP3H 3FTWA 3QJOA 5CJQL 5EC1B 4Z78B 2JNZA 5DUBA 2DWDA 1ND0B 1KGXA 4LKXB 2K8QA 1QEWB 3HTLX 3P02A 4R4BB 3UMNA 4BFGA 1FG2A 1L7TH 1MLCA 2R59A 3QB7C 5CD3B 5T33H 1HKLL 3AUWB 1RUPL 3EJJX 5EF0A 4LLYA 1AO7D 1WC7B 3H9SE 1QI5A 1DVFB 1A8JH 1S9KC 4WUUD 3RHWF 1HN1A 5IHBA 3U4BH 2NTFA 25C8L 1I7ZA 1WEJL 3F6JA 4WFED 3VCLA 3STZA 1YMMD 1JYNA 3M1BA 3OZ9H 2Z93B 3VRLE 1MCRA 1JPST 2AVGA 3CDZA 4L05A 1HHJB 5AZEH 1YPZF 4GQZA 1EHNA 1FQ9C 3FOLA 2Y23A 3NG5A 4MXVE 3DMMC 4U1KA 5TJWK 1JPSH 3L4YA 2R69H 4PJ5E 1JGDB 2BNUB 2AS5M 1AMYA 1A7OL 3QPQD 3O11A 1F1GA 4UMSA 1HWHB 3L3KA 3LKSA 4JFDD 4LMQE 1O7DE 1ROWA 3FU7B 3HBGA 8FABB 4KMQA 2UVFA 3GSNL 2JSFA 1JK8B 5I5MA 3VGBA 4QNPE 2BVYA 5FYLL 4N1CA 3WENA 4AUYA 3F12A 3W9EB 1CD8A 1MFEH 1AQMA 1KCWA 3BN9C 2IWKA 2HPOA 3OGCB 2BP8B 4B9PA 4P2OD 2OI9B 3V4UL 1CYXA 3VFPA 5E1GA 5EUKA 4JFHE 3TFKC 1HYSD 5LG6A 2BXZA 5D1QC 3HI5L 1CF8L 1C1EH 3BH8A 2PW1A 4KJQD 3GMNB 3O3AA 5DHVA 1PS3A 5I66A 4U0RB 2DQIH 5H4YA 1RJZB 1F86A 2WP3T 4R97C 1TCRA 4JB9L 3ETBF 4NENA 2MQ0A 4RGNE 3KYKL 2X4PB 5KS9F 2NQDA 3B7YA 1JL8A 1UOWA 2AEPL 3DUSB 2ENPA 4NT6B 2VJ8A 4JLRB 4QHUB 1OTUD 2EABA 3H4FA 3DETC 4XWGH 1UD6A 3U7WH 3WO4B 2Q2LA 3NA9H 4MD5A 3HI1B 4U7KA 2OSXA 1FV1B 1MRFL 4FQXA 4ONHA 4JDVB 4LDCA 5TDPB 3F7KA 3L2LA 1QKZL 1UJTA 3O6LL 3N43F 1HNGA 1E4WH 1ZXQA 1NBZB 2PTUA 3VWJA 1TOXA 4Z95H 3ZQXA 3BGMB 1FNLA 1TMQA 3X12B 1QBBA 5I1LB 3G04A 4B96A 5IFJB 3SGJA 3O3DB 4JRXB 4IRJD 1QLEL 4Y1AB 4UBDD 4AG4H 1B4LA 2JQZA 3OZLA 4PRAA 5CR1A 1AO7A 2G5RA 3X12A 1DTUA 1JDDA 1RHHB 5LUMA 1P4LB 4ZSOB 4LVEA 5B39A 2CCVA 1U6AH 2LV4A 3HNVH 3DYPA 4HZLA 2IJ0C 4PJFF 4DK5A 4FMFA 4LPUA 1XGZA 4XHQA 5TDNA 3SQRA 1NCGA 4XMLH 4ZQTA 1DDHA 1BECA 4FQLH 3TO4B 3DX8A 4UV7L 2OULB 2A38A 1R3LA 3M45A 4YSUA 2APSA 3VXQA 3VQ1C 4HIIB 1WFMA 3QJSB 2K78A 1U8JA 2OYKA 2CJ3A 4I9WE 2AQNA 2VM9A 1JFQL 1P7KA 3PWPA 4WO4D 2YUXA 4DP4X 1WK0A 5DUMH 3C6SA 4MMYA 2UVEA 1NTDA 3QHFL 2CA3A 2IAMC 4C4BA 5EZIL 2ZWNA 4H4NA 1YY9D 2Y6SC 1K72A 2IFFH 4QHLB 3SJVB 3ESMA 3C2AH 1PSKL 4KY1H 5F7WC 5HGHB 3LNEA 1LP9F 3EH2A 5HDQH 4LEBA 1Q0XH 1UKTA 4OF3A 4HUNB 3HR6A 2V0AA 3JWNG 1D9KA 4L9LC 5KBNC 1YEFH 4G8IB 4ZUUA 5LB1A 5ADPL 2H4EA 4WI3A 5EORL 3QRFM 2WQAA 4Z0XA 3AQXA 2IGTA 4X99B 2C3HA 1Q9OA 1AIZA 3KR3H 1K4CB 2E9IA 4H5SA 2VTFA 1A4KB 2OP4L 4NRYB 4NFDA 3RZWA 5EN2A 3RVUD 1NC4B 3RJOA 4U0QB 5D7JC 4EJ1C 2Z31D 1PY4A 3OJMB 3WFBH 3ZHNA 3GIZH 5DO2C 4I5BA 1P4IL 3D34A 3HI6L 5D1ZI 3TYFA 3W9DA 4JFVA 2DTMH 3GJEA 1KT2B 3ZDXE 2P8PA 2EDOA 4FJZA 5GS1A 1F3JB 2BSRB 2KZKA 1G7JB 4NHCH 4OFYA 4E9YA 1KCSH 2NNCA 4NPYA 1YJDH 2DKMA 1A22B 3HE7D 4YDMA 1JUFA 1L0PA 2Z8SA 4X4MA 5K59F 3QS3A 4KQ4H 3RL1A 4BHUA 3F8UB 2ZUQB 4KJYB 3H0TA 1JZJA 3WHXA 1A9VA 1M05B 2WXGA 4ORGA 4M1GL 4BWTA 3JTTA 1H8LA 2G2PA 4JANB 4XT1C 3GSNH 4GAYB 3T6WA 1MW0A 1LLAA 1QABA 5HDBF 1RSFA 2WV3A 1A7RL 1MXGA 4NO3B 3U6RA 5IMMA 1I9RL 2YGOA 1LK3L 3AS3A 4W81A 3CZGA 3S3CB 3ZUCA 5B21A 3EO0B 4L4VA 1HINH 4GRWH 4FNTA 4J2XA 3ULVD 1WF5A 2EJ1A 2PNDA 4NKDA 4B95C 4HZLB 4NO3A 3QUKA 1MF2H 2AVFA 2QLVB 5F7FA 3ZPDA 4W68A 1I7RA 2QKSA 3FT2A 2OMZB 3KH3A 1WCBB 4MSWA 3ZT5A 3VWKA 2DWYA 2PKDA 3FHEA 3QH3A 4YHNA 4ISVB 1G1YA 2UZXB 3RX5A 4DK3A 4JE0A 1AXSB 3SBWC 3VXSA 4GUCA 4JX0A 4MA7L 5BV7C 3NIGB 4CSPA 2H9GA 3E1ZA 4L8CA 1GY2A 1TJHH 4FCHA 3NOIA 2ZWYA 5AWNL 1BM3H 2AK4B 1JWSA 4OBRA 3WHE0 1RAMA 2BVQB 3FKUS 1GC1C 4H13C 1L0QA 1FNEB 2A6JB 3EGSB 4QIRA 5ITBL 3MN8A 2IBZX 3PHQB 3ZKSD 4EIUA 1CFSB 4NZFA 4JY5H 4NOFA 1VKXB 1S7VA 1ZRUA 2QGBA 3MNWA 1QYGL 2O1AA 3E1F1 3KPPB 2W38A 3BAJA 4J28A 4YFLF 5BRZD 3EJYD 4N85A 4XNUH 4R7XA 3I3DA 3N9GL 1F00I 4EI0A 5HYSA 5F7KC 4LSDA 5DMJB 4PB9L 1GIGH 4R4FL 5FYKH 2Y2WA 2F5BL 2R0LH 4KTGA 5I6LA 1L9RA 1Q94A 3BWZA 4LDLB 3DRQB 1D5ZB 2WLIA 3LPOA 1NCTA 3QGVA 4KBPA 3VQ2C 1OSPL 2W0FA 3OPZL 4P5RA 2P45B 1KXHA 4UT7H 5KSAC 1J1XL 4WDIB 2VAAA 5D93B 2HH0H 2YAEA 4P2QB 3TF4A 4YPJA 5FUOL 1E28A 1M7DB 5HHNA 3ULUE 3PJSB 4UV4H 2CR0A 4JHWH 4BK4A 1S7QA 3LTVA 2I25N 2R8SL 3CFBA 2HKFL 5FO9A 4RQQB 2BP5M 5T8IA 1T66C 2W65B 4FC3E 3W9DB 3I02A 1PZ5A 3O0RL 3DSNB 4E5XA 2XHNA 3Q06A 1BPLB 1CLZH 4X6BB 3UC0H 5E8NA 4CA4A 4OZIE 3QDMA 1T4WA 1FFPA 3S5YA 3WD5L 4KITB 2ATAA 2J25A 1X9UA 5EEVA 5I2IB 1D7DA 4FXKC 1WA1X 1SFDA 3KPPA 2CNZA 3L9EA 3F7LA 4KO6A 4HKJA 4XB3A 4NS0A 1K8DA 1WAPA 1GOFA 3UTSD 1JN6A 2EKSB 2M26A 2VKXA 3D5OF 5F7BA 4IGBA 4Z95L 4MD0A 5I17B 4PJDB 1PX4A 3RL2A 1INQA 5JZ7D 3VRIB 5KJRH 3V10A 1CFVL 4OZHF 4I77L 1UJ3B 1J10A 5FCSH 3L9RB 5JA9A 3IDYC 4CJ0A 3MRFA 1RZGB 4DIXA 4I4WB 4QJ5B 2WIIB 4EIBA 1J0IA 2XZQH 5DFVD 4DF9A 5ID1A 2XXGA 5I8CA 1NGYA 3GMMB 1C08B 3BUDA 3PAVA 2XV0A 5EMYA 1DBAL 1GKOA 1ZSDB 2IEPA 4QPEA 3RDTB 4WU5B 1ZLSL 5C09A 4AQEB 5HYEA 3V2AR 1H6FA 5D7HA 1E5UI 5BNXD 3HS9A 2ITDA 2YK1L 4B9JA 3FO0L 2FEDD 5GZND 2J72A 3KLLA 5GS2D 4ZDHB 3DO7A 2ID5A 4K71C 1LWRA 3ASNB 3ZE2B 4AMKL 4L48A 4ANVA 2R2HB 1KELH 4LL1A 3V6FB 3D51A 1T2QH 3EGDA 3VA2C 1T4KA 4WVRA 5TE7L 4EZJA 1V3KA 4P23C 4LHQB 1U2CA 4DN4H 1MUJA 5I5JA 1NC2D 3RGVA 1SBBA 4DFHA 2BIOA 2PR4H 1JAEA 4UQEA 3CXDL 3TESA 5AALA 1A66A 1TR7A 2DKSA 1MUJB 2NYKA 1WCBA 3ARFB 4PJAB 1U4EA 3SDAA 2R56L 1YPZB 2CBTA 5EU6A 2XPGB 3Q48A 1RH8A 5ESAA 2JKRM 1B0GA 2AJXL 3GSOB 5E6RB 1AGEB 3B8SA 3HB3C 4PRID 5H2BA 3BW9B 4BKSC 2WHVA 5A43C 4UBDC 5BRQA 1JIBA 5E2VH 4HDIA 5F1KC 2J4WH 4KHXH 3TBYA 1AJ7L 3KDPB 4Y2OA 4IK7A 4ZFFB 4KTEL 3GNMH 4R90L 1X9RA 4A7TA 4MNQD 1TEYA 4MJ4A 4AYSA 4HW6A 1BF2A 1AC6A 3CU1A 5JPMB 2J8UA 3VXRD 4CC4C 3AREB 5ITBH 2R2CA 1HEZB 3CUPA 3GEFA 2VLJB 4AKPA 2WQVA 4N0UE 4JDZA 4G9DA 4PUBH 5ICYA 1PLBA 3FONB 3JWNE 2PP8A 43CAB 1WWCA 4QDGA 5KVFH 1CTOA 3DX7B 4ZW5A 4LPVA 3GJEB 1JZ7A 4PP1D 5DMKA 1G6VK 4LLVB 2UV3A 3NIDE 4FTDA 3HE7C 1KB9K 1BYPA 2VITB 4NPKA 3RVUC 2JCCA 4KKNA 4JQVA 4AE0A 5KANI 1XQ4A 1YHPA 1ZHBA 4JKMA 4XI5D 4JFDA 1IAOA 4UTAL 2GJZB 4HC1H 3W0WB 1H3VA 3UYRH 4X4YA 4BXVA 1RZFH 3MREB 4P99A 4J4PA 1SXNA 5HTSA 2CR6A 1AKJA 1JVOA 4BSWA 2WZ6A 4NQVA 5HYJB 5A6IA 4AC2A 1F4YL 1R0AL 2PYFA 4O2FA 5B1CA 4HOMA 4H2CA 5EO1B 4X6BA 5DDHA 3CFQA 3QEUB 2F54B 2A83A 4XMWA 4YSAA 4JPIB 1G7QB 2NYYD 2V3EA 1D5RA 4MTMA 1ZIAA 5ETUA 2G3ZA 1J5IA 3VCLB 4NN5C 4WUUB 5EWIL 1SNRA 1PQZA 4PJXE 4XBEL 2EH7H 1RI8A 1FZKA 2BSSB 2PW2A 4HKXB 4Z7WB 2ZYSA 4XWOC 3V9EA 4FKHA 3KL0A 1TTBA 3KXFD 2BHZA 1A1OA 2P3YA 3ULVE 3GO1L 3TZVD 2YMXL 2ZYRA 2EE3A 3ARGC 4J3OD 4TKWA 3FQYA 1G9MH 1W0VA 3GMQA 3SODB 5IW6A 3MAWA 1T5KA 1G43A 3BZEB 3LH2L 3MZGB 2VH5H 3BPNC 4FQQB 2ADYA 1EEYA 5GZOC 4OZGB 5EFIA 1CXKA 5AVSB 3KAAA 1MCKA 3OF6A 2ADIA 2AQTA 3Q8EA 2VLKA 4EZMA 1A7NL 3QXAB 5FYKL 3C6LD 1NJ9A 4BM7A 4L5FE 2B5IC 3FUHA 1RLBA 5DRWB 2PPAA 4PSPA 1Z3GL 4GSRA 3CX5K 1T0NB 2C7UA 5C9JA 3QWOB 3OPZH 1M6OB 1QNIA 2CLVA 4HPOH 1T83C 4NHUA 2XWTB 3OKEB 3UAAA 2XWJA 3HA0A 5FKAB 2GT9B 5AZUA 3LZFL 5HGDB 3B5GA 4AGMA 3V4PA 3V6BR 3RB7A 3PQYE 2HPTA 3IPBA 3ZKXC 4EN2A 2BSCA 3BPLC 4FXTA 1KC5H 2NY1C 1OHZA 3FCSA 5IFAL 5KN5A 2MNWA 1RZKH 1G7PA 3SCMD 5JOEA 3D09A 1KN2H 4RCAA 3HLKA 3RY6C 1XSOA 3DA0A 3DMMB 4ELME 3L4CA 4I5BB 1ZLVK 1D5XA 4ZOCA 2HT3D 2J7LA 4ONHB 3QK0A 1PMYA 2YSTA 4PJFA 4Y9CA 2OMBA 2WYZA 2EXYD 3SE8H 1WH0A 4XOEA 2X4TB 3HBPA 5DVLA 3WN6A 3LRHA 1I1CA 3INUL 4N68A 4WI4A 1KLFB 4FG2A 2PCPA 2XWXA 5GSVB 4GQQA 4P2RB 1I8LC 4BZ2A 2QQNH 4LSSL 2RCSH 4G42B 1ZHNA 1TETH 3V6OE 2X0UA 5A16A 2EDDA 4H1LH 5CJXA 2DJUA 4OGYH 3LRLA 3UADA 1N6QH 3NIGE 2OLDA 4NKOA 5HJBA 1WJ3A 3BH8B 3QZMA 1HILB 4IRZH 1X6NA 2GJZA 4X99A 2ZG2A 3HNSH 5F1NA 5BZDB 1SQ2N 2NX5A 2JE8A 5INDA 4TS6A 5E8DH 4EQ2A 5A6LA 5F1IB 4GW1A 3SOTA 4DKDC 4UDTB 3MA9H 1IGCL 5CR8A 3CFDB 3MLTB 3P9WB 4NWUH 5EBGA 3B5TA 3T1FA 4QD2E 1RVFL 3ECVA 3QUXC 4IMKA 2Z9TA 4IGBB 4NOBA 1UA3A 5LAPA 1O7VA 1I3GH 3G5YA 1QWHA 4G70B 4L1DA 4W6XB 4F80A 2WXMA 3MLSH 4AI7A 1MEXL 5L4MA 1FPTL 5KSBF 5BS0E 4PJIB 3RX9A 4X8JA 3RNQA 2AQ3A 4DPCX 3MRDB 2BCKB 5D2NE 1B4TA 3ZHFA 5GIRB 4JUSA 1G9MC 3RA7L 3KLAB 4HIJA 1MI5D 1JPGB 3EHBB 2DQJL 1BMWA 4OSUL 4PP2A 1JYWA 4HFUH 1YMMB 2CGRH 2VLKD 2DQDH 5ACMA 3V0WL 4X8CA 1EJOH 3C6LA 4N6RA 2JXMB 1QQDA 4Y4KA 1P84K 4L4TD 5B38B 4HS8H 1E7UA 5C86A 1ZLEA 3TJEH 4EQ3A 4Z78A 1MJUH 2OSYA 3BT2H 1VADA 1K2DA 2CXKA 4HC1L 3LKRB 5DK0A 5BV7H 4X80H 5INDB 2X2YA 2DQFA 1U8LA 4Y4HB 4JM2A 5IB1B 4MB5A 3TV3H 3OMNB 3T8XB 1BQLL 1DQQA 5I6XC 3VJ6A 2ED8A 1L6PA 2R56H 5GRVL 3WYRA 2K9UA 1BJ8A 2IMNA 3D85A 3B2XA 2XWJB 1UURA 3EGDB 5FKAA 2WINB 4PJDF 1HQ4B 2FIKA 5C8JB 1NEZA 1S6NA 5CJOL 1LDPH 1U3HA 4K2UL 2QGEA 3FFOA 5TQ0L 3QORC 3R4RA 4YXKL 4A2GA 1WBXA 3N44F 5FO8A 3NJJA 3UJJL 2X1QA 3VFGL 1VAHA 3HG1D 1F11A 3IRCA 3FRPG 4IIZA 2NOYA 2I07B 3T6QC 1JXGA 4JG0L 4YDVA 2BCKA 3L1OL 3WJJA 3ZMEA 4NP9A 1D9KC 2JI1A 2WKOF 2J6EA 1BQUA 4XBGA 4NFBA 3EFFA 1DBMH 4ODVH 4QLRA 4HH9B 5L7XL 3QJTB 1NOAA 4WWKA 2WWMC 5L2KB 3PDDA 1OM3L 4ENZA 5EZOL 3QQDB 3P69A 3IF1A 4MJIE 2Y7MA 4GAJL 5I6PA 1KOAA 4X7CC 4ICWA 5I8EA 4EN3C 3DETD 3FBKA 4XVUC 5SWZE 3RU8H 2GHZA 3QIWC 4OF7A 1J05A 2XWTA 3OKEA 3TJHD 5BV7B 1VZHA 5C71A 5KW9H 1CWVA 1FFTB 3VG0L 3QQ9D 2H3KA 3HRPA 3MLYH 1DJGA 1KNOB 5F1NB 3VTMA 1I7TA 5BZDA 4UTAH 1WA2X 4FFWD 1WZ1H 4LLMB 1UOLA 2P49B 4HBCL 4M8QA 1T5XB 4G80A 2ITCA 3CSFA 3BKML 4XMUA 4IGBC 5KSUB 3FOLB 1CCZA 4U1KB 3BUQA 2ZD0A 3OKDB 4HIHA 3EF4A 3TPKA 3ASOB 2P8MA 4R84A 1MIEL 3ZKXB 3NT0A 4MNGE 1XEDA 3LDBB 3ZO0A 4L4JA 3WHXB 1EZLA 2NDFA 2CRMA 2WZPA 3QNYA 4JREC 4BH7A 2A6DB 3R06B 3C9NA 4Z7UF 2EO1A 1C8QA 1CFNA 5JHBA 1YNTA 3LZRA 5AAMA 1T22B 3TF7C 3TEYA 5LNDA 5A40E 1JI2A 2B9AA 2W0KA 4BH7B 5I1DB 1NGWB 2LU3A 4FMVA 3RI5K 1NL0L 4N2CA 1ORQB 1OAXL 1G7QA 1R4XA 3GMPA 3KMDA 1EHAA 4DGYL 4DVRH 5ANMB 4R8WL 4IRZL 1E4XI 4AEIH 2I60H 4OCYL 3PL6D 4QRQA 4LLDA 2VSDA 2AP2A 5T1LB 2CDGB 4M43L 1HXMB 4XX5A 4W9GC 4GAGH 1EXUB 3SDDB 3GI8H 3GQFA 4I2XA 3O2WH 1X4YA 2ITCB 2YUWA 3DK0A 3FC8A 3IFPB 3ZE0E 4PYGA 2DDQL 5B3JF 1DQMH 5H37H 4UAOB 3V4VA 4CN6A 1J1PH 1U3HB 2CMRH 4MCYA 5IW1A 4N0FA 2RA1A 3QDGD 1C7SA 4L5FH 3BSGA 3L3GA 5L6YH 1A4CA 2JB6B 3L5XL 4K7PX 4OKVB 4JBSA 2B59B 4YNYA 1HSAA 4HCRL 2EYTA 4WWKD 1ZGLM 2YLHA 1IQDB 5LWYL 1JZEA 4QF1A 1RZKL 2A9BA 3MBEC 1IILE 5C6TL 4TQIA 2IDTA 1Z3RA 4G1MA 5DZPA 2B5IB 1QFOA 4HHGA 2VDNL 3A4AA 3AS0A 4RETB 3EFFB 5KTEH 2DEWX 3LPFA 4MYPA 1XF4A 4LP4A 1FRGL 5CEYA 1Q4NX 1UXSA 2LOEA 5IVXB 4FLRA 2PPDA