4UTCA

Crystal structure of dengue 2 virus envelope glycoprotein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
395
structure length
391
Chain Sequence
b'MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 75
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utcA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utcA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utcA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utcA03
4FG0A 3C5XA 4UTBA 1OKEA 5KVEE 5KVDE 1Z66A 2JV6A 4FFZA 5GZNA 4UTAA 3UAJA 1S6NA 1UZGA 3UZEC 2H0PA 1RERA 4GT0A 2V33A 1URZA 1OK8A 2R69A 3P54A 4UT6A 2JSFA 5B1CA 2R29A 4AM0Q 3UYPB 4GSXA 5JHMA 2ALAA 3UZVA 5H37A 3J27A 3UZQB 3VTTA 5KVGE 3N40F 3WE1A 2HG0A 4BZ1A 5AAMC 4UT9A 4BZ2A 3I50E 5AAWC 3G7TA 3N43F 3N44F 1ZTXE 4AL8C 3C6EA 1SVBA 5LBVA 3UC0A 5JHLA 4UTCA 3IRCA 3N42F 2P5PA 5KVFE 4X42A 1TG8A 5GZOA 1OANA 2GG1A 5LBSA 4FFYA 1Z3RA 5LCVA 5IZ7A 2JQMA 4ALAC 2I69A 3N41F 3MUUA 3J2PA 4L5FE 1PJWA 5IREA
chains in the Genus database with same CATH superfamily
1L9TA 3UAJC 4XO5A 5SV3A 2HH0H 5EUOB 1VERA 1M71A 1VFOA 3QQDB 2NT0A 4JL2A 4JX0A 4YHLH 4NRYA 2BIIA 4HGWB 2IH8A 2Q8BH 3LAFA 2D2OA 3O2DA 3DRQB 4HJJL 1NCAL 3L3GB 3VX0A 5PAZA 1I1AD 4JCMA 4Z7WA 1MJ8H 4ZTPL 4KFMA 4JRYA 5K69A 4Q9QH 2O30A 4K8RD 4AYSA 4ZG1A 3V79C 1FHNA 2VDQH 2VR9A 2YQ3A 5GISL 4U6VH 4DZ8B 1QSEE 1WZKA 4GLRI 2Q8AH 5CZVL 2VXSH 5B1CA 2BOCB 3BOVA 1V54B 1K5NB 2CIKB 3DVFA 4NENA 5DRXA 4BA8A 4BELD 2R2HA 3OXRA 1BWMA 3R7QA 2AQ2A 3F6IA 3ZTJG 5MENB 4E68A 3Q2NA 1A6ZA 4JJOA 1J1PH 4TRPH 2X12A 4FP8H 1HESA 3MRMB 4IJTA 2Z7ZA 1FN4A 5BW7A 1SHWA 2X7LB 3ZKMD 1INQB 3FQWB 1YY9D 1QRKA 1PKQE 4UANA 2VDRL 1GW0A 3SYQA 1U8NA 1KXQA 4NZ8A 4ZFFA 2Y25A 5J8OA 2J8UB 4R96A 4ODUA 3FQTA 1DJGA 5CEYB 4RWYL 2AKRA 2UZXB 5DQ9B 1AD9B 1NAMB 2DWSA 3FZUC 3MFGB 1FIGL 4HHWA 4I9WE 4TSBH 3VFGL 3KS0J 1E8YA 4Y2OB 1ETB1 3QRGH 1UWXK 1SBSL 3BQUA 4JQIL 2PO6D 5KAQG 1DVUA 2F7PA 1QI3A 3FUKA 5IHUH 4DFIA 3H9SE 1Z1WA 4N85A 5LGYA 1MFAL 1RULL 1XFPA 1RVFH 3K6FA 5C2BH 5JW4N 4KDTC 1C8QA 1THCA 3X1EA 5JPMC 2EIKB 4MMXA 2MPAL 1JV5B 5CUSL 3FBKA 4DGVL 3SGJC 4JFXA 4OQTA 3WHXA 1JZ8A 3KPSB 4UAOB 2H1LM 1DLFL 3CZJA 3FO9B 4FQXB 3BH9A 5IB2B 4JLRB 1NFDF 1D5XB 4WVRA 4PMFA 2NY4D 3R18A 4MNGB 2UY6B 4Y4HB 5EHFA 5GZOA 5KW9L 3L81A 5AW9B 4GUQA 4FFVC 1AYOA 3DX6A 4IRSC 5KVDH 3BSHA 1I7TA 3LH2H 4WO4B 4LRIC 4JPIB 2AMGA 4DIXA 5GGVY 3VNZA 3CVHL 1NFKA 3F12B 2JQMA 3OHXC 1ROCA 3CH1B 3WAKA 4ALAC 2EVHA 2H1PH 3HE6C 5DJCB 3KE0A 4PN6A 3EYOB 2YA0A 4HIXH 5EORH 1NGZB 1PJWA 1GPOH 5DJYA 5TPWL 1CD0A 2B39A 3DGGA 4YDKL 5FCSH 1UKQA 3SDAA 4A63A 3R4RA 3Q1SH 1M2OA 2WTRA 1ZWIB 5GGTH 3AWFA 5I17B 3T3MF 4RAVB 4XMPL 5DRZB 2ADIB 4GH7B 3EFDH 2VIRB 2HLFD 3ARBB 5DMIL 5LB1A 4YPJA 4KKZA 4N5ED 4BKTC 1EHKB 1JZ6A 4N1CA 1E9OB 1P9MA 2E76C 5CSBA 3SQOH 1BVZA 1R5VB 2C4FU 1AZUA 2VLJD 4XO8A 4G8FB 5ERWA 1I8IA 2J7LA 4GXVL 4W70A 4M7ZC 5KYWB 3MNWA 4NZUH 1Q0EA 1CGUA 4OGAD 4K8RH 5EWIH 2YSSB 1GGCH 1QFOA 3L17A 3D18B 1CYWA 4IIQC 3ILQD 4NQDE 1JGLL 5J11B 4D0BA 4G9FA 2RFXB 4P5TB 5LG6A 1IFGA 1F4WH 4BE5A 3W1ZA 1DBKL 4KI5E 3MYZA 1QQDA 1EJOH 2EH8H 1QP1A 4NKOA 2ZSVB 5L4IA 2XKSA 1IGYB 3RNKA 2J57A 4HUXA 4EN3D 4JFEE 1X5IA 2AQNA 4NPYA 3T2NL 3CSGA 1E4XI 4QYAA 3BD4A 3M86A 4Z7QE 4OVVA 4CILA 1T6VN 4GKNB 4HETA 3DX1A 3WIFA 1YUKB 5GGSA 3ZE1B 1Q9KB 1NM9A 3BW9B 3NH7H 3MUGA 4NKDB 1K85A 1HHJB 2UVEA 3KVPA 4GW1A 5I9QB 1YEWA 3D25B 2ZT9C 4PW3A 4QTHB 2AK4B 2HTKD 4KOCA 4PJCB 3INUH 3WNMA 2D4DA 4KHTL 3WNJA 2ESVA 4URTB 4PB9H 1RL1A 5DC9B 5I74C 2YJLA 3G6DL 2ZF8A 5EBLA 2JWYA 1XGYL 2EIDA 3CFQA 3KWXA 3TWCH 5JR1L 1A7RL 3N43B 1K4CA 2VMJA 1RU9L 2VL4A 3AU1B 2F74A 1OPGH 4IMLA 1N2RA 2DQMA 5HYIA 3CGTA 1KV3A 4NJAH 4D0DA 4UUJA 1XH1A 1F97A 3UBXI 3UXFA 4XMZA 3QDMA 2F53D 2AJVH 1LILA 2OCCB 1IGML 3Q8EA 3SEPA 2X1QA 1NGWB 2LQRA 1W72L 3IJ9A 4LSPH 1GKEA 5BZWA 4N3UA 1FZKB 4WI3A 1NOAA 4AWJC 1QFWM 3HNVL 3RA7H 5DHVB 5IOPA 5LUMA 1TETH 2K6YA 3FF8A 3TVMB 2BVTA 3IU3B 5C7XH 4I18A 5F9JB 3CDFA 2AAAA 1P4LB 4JQVC 3WXVL 3ZDXE 4IBVA 2H32H 3AREB 3QNXA 3QEHB 5DUML 5FDWB 3TGXA 4BQ8A 2DQFA 1QD0A 3HJEA 4PS8A 1ITBB 3SDDC 1E2ZA 2WSKA 3AB0B 1JWMA 1CK0L 1U30A 4OB5H 4NDMA 4HS6B 4WAFA 5I1IH 1RZJC 3DI2B 2QHRL 3QZWB 5LO7A 2E46A 2ZOKB 2B5IC 2X5PA 3QDAA 4AQOA 2YAQA 4YHLL 2HMIC 1CI5A 4TTDC 1R47A 1SXAA 3HMXA 2Q8BL 3LDBC 2H2PD 2Z4TA 3N5AA 2W91A 4MD0B 2XTJE 4NQCA 4L8BB 1FJ1A 2HJKA 4LF3A 2XX1A 3TNNB 1MJ8L 1BF2A 4KXAA 4Q9QL 1QYGH 2CIIA 2WLHA 3OZLA 4LMQI 3SO5A 3QR0A 3RZCB 4YK4C 3K2UH 2VDQL 5TH2A 4U6VL 1V3LA 3VTTA 2VXSL 1F6AA 1TU2A 2Q76B 5KUKA 2E7LC 3AG2B 4RX4D 3C5SB 2MQCA 4PRBB 1W15A 2C9AA 2BVEA 2PW2A 4YIQA 1RP9A 3MRLA 1JK9B 4TRPL 5B7FA 5JOFA 3DIVA 2PR4L 1HHGA 1UD3A 2ZG3A 3NVQA 3FTYA 4Y19A 5F6IB 3DHJA 4ZMTA 4ZPTA 2L7JA 4WHTB 4BD4A 2KQMA 2YUWA 3H4HA 2MCAA 1BXVA 2EE0A 1XTMA 3E9TA 3WTSA 4L0YA 2VN5A 3FSOA 4TLKA 4X4MA 2IFGA 1NJ9B 4WDIA 4KY1H 3CC5A 2FQGA 2ZSWA 3G04A 4E5XB 3SDCC 4TSBL 3SB3A 1EAQA 1I85C 4K7FA 4L0PB 5K1JA 1XGPA 3MYJA 2XYBA 3H9HB 2E56A 3H6AA 1BVNP 1GHFL 1T5XB 4OAWA 2WXFA 2WQXA 4HIEB 1OSYA 4G6MH 1HVXA 1AO7A 3LKNB 3QDHA 4P2OB 1KBGL 2Y2TA 4X9BA 1SJEA 1RVFL 2BOBB 3MOBL 2QVMA 5C2BL 4JFSA 5F1SA 5IQ7H 1BZ9B 2FJGB 4NM4H 1LNUB 1TKWA 1BF8A 4PTTA 1B3IA 1OAXH 3QQ3B 4RIRA 2F19L 2XN9E 1D7DA 4MXVE 3IN2A 4KY2A 3N9GH 5JPNA 2GB2A 3T0EC 3BP7A 5JIPA 3U4BH 1ESOA 4DGYH 2WO2B 5KVDL 2EIMB 3QXTA 5T5FH 4IU2A 4QAMB 4L4TE 3HAEA 2P44B 3PL6C 1N10A 3QIWA 4N28A 2Z64C 4XMLH 3SYPA 3T09A 2J5LB 4WTWA 1M1XA 2CLVA 2R2BA 5IJVB 3QGVA 3CAFA 5KZCB 3D07A 5KN5B 4HIXL 4X5WB 1MCQA 4Z9KB 5EORL 1ZHNA 4TF4A 1GPOL 5I30H 3RYMA 5EC1B 1G7QA 2XWJA 5EIIB 4KU1A 1AGCB 1FFNB 2N7BA 4HWBA 4DAGL 1FNGB 4AUJA 4F7TA 4HA1A 2XV3A 4L1LA 5ICUA 3SCMC 1WQVT 5GGTL 2XZAH 3MR9A 2GSGA 3NZ8B 1FC2D 5JPMB 2ZX6A 5F0MB 2N0MA 4JFPB 4AIEA 4YSQA 3ARGC 4NNXA 1HHHB 15C8L 3AXHA 5EPMB 1B2WH 3EFDL 3WIHL 4LPUA 2ALWA 2C7FA 4QXUH 3MV8B 3VGAC 3RWEB 4Z8FH 2PPDA 2FD6H 2A6KB 3SQOL 3U1PA 5I1AA 1KTCA 5CJXA 3LKPB 5LVEA 3F3HA 2CG9X 2P43B 1SHSA 4KZEH 5BS0A 1P7KB 4NZUL 5DZ9A 5EWIL 4GW4B 2QT6A 2D8KA 1JI1A 3H4FA 3KWWB 1AMXA 5E1AB 1MWAA 2BRQA 2MNJB 4OQ1A 1PAMA 2GY7B 4WGWB 5LGHH 2WZPA 3SY6A 3B1TA 3OHXB 1WSST 3CFKB 3K7UA 2GJJA 3Q48A 4PYGA 3HE6B 5E2UH 4A2LA 4H1LH 4HFWB 1F4WL 4PJEB 5DMKB 1EJOL 2EH8L 5D7IF 1QPPA 2V9TA 4NCC1 1KCSH 4OW6A 1FNEA 3C9NA 1Y07A 5FWQA 1RZPA 2C7UB 3L4CA 3H1ZA 5DS8A 2EYSA 4D0CB 2YPLA 4TS6A 4U3XA 3VXOB 3K6SA 1F3JB 1MCRA 1AGFB 4H8VA 3WEXB 3QXAA 4XCCL 5IKCA 5AW0B 2WBJA 3GDCA 3GMLB 3IDJB 4NFBA 5LBVA 4EMZA 4FTDA 1P53A 3C5ZA 1WFJA 4G8EA 2JI3A 2P47B 1S9WB 4JVPA 3LX9A 3BC9A 3ULVC 2CBQA 2ZNWA 1BD2B 4OY9A 2OW6A 4KTDH 4M29A 2BX5A 1AH1A 1N12A 3INUL 2ZKYA 1KTKE 1L4IA 4PB9L 4ZDHA 3ECBB 2UUDH 3FN0H 2VLRA 4ABUA 4LFHG 1KPRB 2QPSA 3Q2LA 2ZG2A 2JF1A 3TWCL 4UM8B 3GGWA 5D9SB 2DQUH 1DVSA 4FXKA 2WGXA 4KBPA 4LQFH 5IJKC 4JPWH 4YZFE 3KPLB 4OCYH 5IQ9A 4OU3A 3KLKA 3X14A 1KGJA 1RLWA 1P6FA 2A0LC 3NACH 4Y5YA 2GT9B 3PWPD 4KNQA 1JZJA 4P4RB 3TV3H 3VJ6B 4P5MB 2AJVL 1BLNA 2R1WB 2JJSC 5LLIC 2JCCF 3V0GA 4AOFA 4QRRB 3BUIA 5JHBA 2PP9A 3CBJB 5FM4A 1CE6A 2GJ6D 4HSQA 5MEND 4N90E 1XGZA 3KM2A 3UYOD 1EHNA 2D7QA 4JKNA 3BT2H 3UJJH 4PGCA 2EXYC 1S7RB 1TETL 2AJUH 3KGRA 2OYKA 5C7XL 3CN0A 4KJPD 3ARUA 3TF7C 5IG7B 1KDIA 3DV6A 4AIZA 3ULUF 4AM0Q 5I1KH 4I0PD 5D93C 3MO1A 1UT9A 5BQDA 4PRHB 1L7TL 2I60L 2ZUUA 3LRSB 3WKNA 4ABVA 1UA6H 4CGUB 2PCPB 1KYOK 3E7JA 3UC0L 5KBMA 3IFPB 5I1IL 1BFVH 1P1ZB 4R4ND 5F21B 3F05A 3X17A 2PYEA 1DN0B 4IJ3C 5I6XC 1FV1B 3SGKA 2XU9A 4ZO8A 5DK2B 4UNIA 3UTZA 4HVBA 2CO3A 3PWVB 4I1RA 1QNZL 3PXLA 2ERJB 4HCGA 1QYGL 1T1WA 4EQ2A 4FG6D 4NJ9H 1TQVA 2VUYA 2CKBH 3K2UL 3LRLA 1PY0A 4HJUA 4JFTA 2RAMA 2ZUXA 1FFTB 4LKCB 1GZQA 4FQXD 2AXWA 2VH5H 3Q5YA 2FGWH 3EBIA 2O6CA 4J3OC 3UDWA 2ATKA 3DROA 4Y4HD 2ZYRA 4RFOL 3Q1EA 3U1SH 1LEIB 1JWUB 4WO4D 4TL5A 2P8MB 3NJJA 3WS3A 4AT6B 1UH3A 3KPPB 4GBXA 4JO2L 4YL4A 3B7SA 3CVBA 3T4YA 4PJHF 2VLME 1Q9OB 1U4FA 2EYTB 2NY7L 3D69B 2DWEB 3IRCA 3PWJB 5E7FA 3BWZA 2B15A 3EHBB 4KY1L 4Q14A 3K71A 3P11L 4N2HA 5TDNA 2Y0SA 4ZZKA 1CC3A 4CNIB 1TMCB 2W80C 2HMID 3OMAB 3O4LA 4HIHA 1RJZA 4N8VG 3SE3C 3T65A 2Z3FA 1UXWB 3TO2A 2X89A 3MRJB 2XETA 1XBRA 1A7PH 4YK4B 4NP4H 3KYMA 3M8OH 1MW3A 3ARBD 4BXSV 3P4LA 5IBUG 5CEXA 5JORA 1YEEL 1VAHA 3N0AA 2RACA 4TUOB 3L9YA 1JZ5A 1EANA 5C97A 3STLB 1DBAH 1QLRA 3FTVA 5IQ7L 3DJ9A 4NM4L 5JW5B 1LQBC 2KYIA 3KPOA 1OAXL 4DK5A 1U42A 1XH3A 3DRTA 2VXVH 4FQLH 1F02I 2BCMA 2MQ3A 5C0CB 2W07B 1E8WA 3A6BH 2A1WH 1G7JB 2YRBA 3N9GL 3A24A 3P0YH 3CZLA 3MLYH 4OKVA 4Z7UF 4G6JH 4XOEA 4BSWB 3FN3A 4N6RB 2MOGA 1XVSA 2WB1A 4P5TD 3U4BL 4DGYL 1R75A 2IG2L 4X6BA 2Z7UA 1BG9A 1P84K 3GMPB 4X8XA 3ZKXB 4LDCA 5IB5B 5A6LA 3NBNA 4XMLL 1GZPA 1XGUA 3OKMB 2NTSP 4GSQA 4NZRH 3TBSB 4HPOH 2P5WB 2CCVA 1I3RA 1CI3M 5I30L 4GOSA 3FL7A 2P8PB 1SN0A 5T3ZD 2O72A 5ALBH 1ONQA 2NQDA 3ZIMA 3L9RA 2WLMA 4ZFOA 5GGTA 1NAMH 3VYOA 3QIBB 2QMKA 1DVYA 4WI5A 3VFRA 3KYOA 2HKFH 5CILH 2W88A 4X5QA 5KG9A 1WS8A 4D3CH 2AK4D 4PJGB 2H4EA 1B2WL 2JKJA 1RIHH 3QJFA 5TDPB 4OD1H 4H0LC 3WY4A 2AV7A 5FC9A 3JWNE 3UPCA 1QKZH 3T0EB 4Z8FL 1I1AA 1K3ZA 2FD6L 2G5BA 5F9OL 5B7EA 5JA9A 1ID5I 1JPST 3ZSSA 1ZSHA 2KC0A 3FMGH 2YPVH 4KZEL 3KR3H 1K3IA 5CGBA 1XTLA 3PJSB 5KOVC 5LGHL 2KI6A 1A9BB 5DHXB 1PY9A 35C8H 5D1QB 4GQRA 3GLZA 1DP0A 1KCSL 2NZIA 5KBNC 3V4UH 3EDDA 3CSFA 4KK5D 4LL1A 3U9UA 3UBFA 4Y7MA 4HIIB 4LAJH 4OGXH 2M8XA 3S2CA 2C4XA 2YEZA 4A7GA 4H26B 1S78C 3TVMD 1EEQA 2YAMA 4P2RB 5B4MC 2XOTA 2QV2A 3GM0A 2CA4A 2BXZA 1J88A 1UVQB 4KK8D 2XPGA 3WKYA 3ARED 5IVXA 4YHOH 4A68A 2FNWA 1IEHA 3SBQA 3FNKA 3QO1B 3QUZC 3V6OA 1HL4A 1UGNA 2FECL 3LN5A 3VGAB 1FNLA 4IYKA 5F93C 5D4QA 3BDBA 5E1HB 1HILB 2E74C 4KTDL 3RWFA 5TGBB 2PO6A 2NX5D 2F7QA 1ACZA 1EEYB 2V8MA 1OOWA 3QSKB 3EO1B 5E2VH 2IDSA 2NYYC 3C5XA 1E6OH 2W94A 3PXJA 4MJID 3PP4H 5SX4H 1UWXH 3EZ8A 4Z77B 3EJPA 1KFGA 4P46B 4O4YH 2DQUL 1JJUA 3UX9B 4EUPG 1IFHH 3Q2WA 3PFUA 2WNWA 4LQFL 4JPWL 4NQSA 1FUNA 4OF8A 4PG9A 1RJLB 4AQ1C 3GYRA 3KEHA 5EBMB 3FQXB 3JT2A 3UZEA 2EXSA 4OD3H 3H53A 1S9KC 3KXFB 2VC2L 2BP8B 2WWMC 1ET5A 2WVVA 4G43B 3P54A 1G4RA 1YC8A 3QXVA 1NGYA 3OC5A 1BAFL 2XN1A 5F7DA 4OZHF 2ZOTA 1S7WA 4K94C 4E9SA 1CICC 1QNIA 1IM9A 2BIHA 3D0LA 4XNZC 4JKKA 4JZOA 1FZOB 4K71C 2Y2YA 3BT2L 2FO4A 4XAWL 2AJUL 2HP4A 2XWTB 4ZNEA 2H32A 4QT5B 2OMTA 1YYLL 1ZDQA 3T0DA 3P4OB 5CMAB 5TQ2H 5HHPB 4F33A 2HWZL 5T3ZH 3UAEA 4F7EA 2J6EH 4MASA 4QDGA 3VFTA 1HKLH 1UA6L 4PJAA 5FOBB 1L9RA 4NZJA 1ILUA 4FHBD 3EYUH 4H20H 5DJ6A 1BFVL 2VRAA 4F8TA 2DL9A 4YSDA 1BSIA 2OXHB 5FA3A 2XIDA 1Q1JH 1JTOA 3B2VH 3OZKA 3ZDZF 5ISZB 3CUPB 2VLJA 5LNDA 2VE6B 3KZ8A 2X41A 1MCNA 3CHQA 5JHLL 1H6UA 2DLTA 5ADPL 3B9VA 5ACLA 2IGTA 2YD3A 4FJYA 1KCUL 3SKOA 5B39A 4YLQT 1MHHB 5I8CB 3OKNB 2VQ4A 1CLOH 2WO3B 4PVMA 4OKDA 3EXLA 2VH5L 4W9LC 5H37H 5GRVK 3C09C 2OLDA 4U6XB 4Z7WE 4JRYE 4XNYL 3OR6B 1SDAB 5TE7L 1W6WA 3V8CA 2BMKA 4YDZA 3U1SL 1QEXA 1JZIA 4EN3A 4J4PD 4ICWA 4NKMA 1QFUH 3PDGA 1OZTG 4WHYG 1DQJA 3FZUD 3LY6A 1BQHG 4LHUA 4WEUD 4OFDA 3T04D 3IJHA 2X6VA 2J88H 3DX8B 5KZCD 3FT2B 2FX7H 1VENA 4YO0A 2J25A 2WYHA 1DBML 4IJ3B 5IGXL 1USZA 1M6OB 5DUBA 1BZDA 1R3KA 4FDWA 4L3AA 5C2UB 2EYRA 1DQQB 3GIVA 3FO2A 4ZAKC 1KXQE 4DW2H 1FRGH 1OP3K 1PGRB 1XBDA 3FHAA 3L5HA 1FE8H 2JKSA 4JVWA 4NP4L 4QHUB 3SKNB 3UZVB 2NDFA 1F2QA 2GABA 3ILDA 3M8OL 5D4JA 1VHPA 4PBXA 5K59F 2LR4A 5BUPA 1ZGLB 3VI4B 3FQRB 3U46A 3MV8D 4MNQB 5ID1A 2DPKA 2K1MA 4X7FC 5ITBH 3DXAD 1DBAL 2NT1A 4RVBA 2OBGA 4FFVD 2XFXB 1KIPA 4IBSA 3MBEC 4FQLL 2VXVL 3BD5A 5C0FB 4Q9BA 3A6BL 3P0YL 2F53A 4APQD 3MLYL 1JE6A 4HLZH 4WI6A 4G6JL 4PLJC 2ODHA 3HE6D 4HQQH 5T5FA 5ENWB 5A16A 4AI7A 2PABA 1BXAA 4LHJB 1EBPA 3F7VB 1E8ZA 3RIFF 1EHAA 4X98A 3QS2A 5KVGE 1PF3A 1VFBA 3WJJA 4EKJA 5I24A 1G7HB 1JV2A 1KCRL 1Z7JA 1G7LB 4FCHA 4NZRL 2QQLL 4HS8H 1M42A 1WUZA 1OB1A 2XN0A 5DDHA 4M8VA 4A7QA 2YBRB 3NCFB 3LRHA 3CJJA 1BIHA 3CFEB 4QTFA 5ALBL 5F72S 5DD1H 1XGTA 1VLXA 3SHSA 1A4AA 4HLZG 4YMPA 1FL3B 4OF6A 3X1NA 4DPRA 3TZVA 1FCCA 2F54D 4WUKH 4M7JH 3TBVB 1BD2D 2RR3A 3G7TA 3HLAB 3FH7A 4OH2A 1NCHA 4U2ZA 5CILL 3VNYA 4F7PA 5C6WH 4ODBD 4C8XA 2WV3A 1QX1A 1A0QL 1RIHL 2WN3A 3GSRA 3BZDA 3IXTA 4YDIH 1NL0H 4RMWA 4YHIA 3UGEA 3QDGE 4A6YH 5D1ZA 3H0TA 2BNUA 1XSKA 3WTVA 2NW3A 2A74C 4HS3B 3K81A 1ZLWK 3WL9B 3FTUA 3WO3B 3WJLC 4B27A 5CN3A 2Y6TE 3FT4A 3V0VB 5EO9A 2QR0B 4QF1A 1X5AA 4H1LA 2Y1YA 1WH0A 3F5WB 3X3FL 4RX4A 3D8MA 35C8L 4IMKA 3NESA 1KJVB 3VYNA 3O3EA 4MMZB 4PBDA 2BHUA 5J9PB 1DZBA 2R2EB 4QRRD 1UYWL 2GSIA 1NC4D 2R69H 3BMWA 5DEGA 5K9OA 3PAYA 2JB6B 2XWEA 1FP5A 3QNZA 2G75B 5E9DB 1FL6B 2RQEA 2PWGA 3NIDB 5AW3B 1D7BA 4OGXL 2BIPA 1KTDA 3WXWL 2OJZL 1YQ2A 3BIKA 3GXNA 2P5EB 4AV0A 4KTYA 3HB3C 4XXWA 3WNOA 3RFZC 4CJ0A 3W2DH 1UZGA 2OTWA 5FHAH 4PRHD 2YUVA 5ESQA 2HX7A 1DN2A 3QEUA 2AQTA 1E43A 4ETYA 1R19A 3FCTB 4KKRA 5ICZB 3TEWA 4ZPVA 5E2VL 3HC0B 1E6OL 3JWOC 1FAIH 2HVKA 1IBDA 2DAVA 1C9SA 3OV6A 1U91B 1AACA 3E3QC 4O4YL 5BRZE 2BVOA 4KXZH 1ET8A 4E2OA 1IFHL 3G08B 5CAYB 1KLFB 4I4WA 5FYLE 3T2LA 2ESVE 2OSWA 1HCZA 3WEOA 3ZXAC 5JOEA 4DCQB 2EADA 5L4FA 4IOSD 4NPKA 5GGUA 4ADJA 1HEHC 3QCUH 4EQ3A 3DX9B 3OWEA 5HI4C 2ORBH 3NQIA 4X9GA 3W82A 4G59C 4Y5XB 4XB3A 3EBHA 5C0AB 4D9RD 2ZCLL 3NSDA 5I6MA 1TZGH 4M56A 3KGSA 3D09A 3PE9A 4PP1C 5C8JB 3RAJL 4ZW6A 3QDME 1UA3A 2C1OB 1I7UB 2NCEA 1QMUA 3AU0A 5F7AA 3JWDC 1UG9A 3OQRA 5E6IA 3S7GA 4L8SB 3FUFA 3PCYA 4RWHA 2HX9A 4QKXB 4UOJA 3OQ3B 2ZXEB 2P28B 5A2FA 4EBQL 1SEBA 4XOCA 1WEJL 5T3ZL 3D3VB 4ZW8A 1U92A 2J6EL 4TTDD 4WFHD 1FH5L 1HKLL 2BSTB 5EEUA 2J1ZA 3RUGF 3BH8B 4S1SH 2P7TB 4H20L 3EYUL 1SVBA 5FO7B 3DSNB 3BX7C 2O5YH 3COOA 3DO7B 5HPMA 1WWWX 2VDOH 3OC8A 5HYQA 1NGPH 1Q1JL 3B2VL 4LCCC 4YHML 4FQ2L 1MI5D 4M3HA 5EOTB 5AOZA 5BXFB 3KCPA 4EAEA 2W0FA 2WWNA 4E0RB 2QADC 3L1OH 3BYTA 1CICB 2CKBA 2ZP0T 4KKPA 1NUDA 1T7YA 5IVZB 1XSIA 5L9DL 5JQ6H 3REWA 3MACH 4JG9A 4MZ2A 5F3BB 1RXLA 1C12B 5C0CD 4NQCE 4ZO9A 1NFDB 2WYTA 1YG9A 1ES0A 4YVUA 4OZIA 1WT5C 4GXUN 3KWTA 1I1YA 4OCRH 5L8JB 3O11A 1KXHA 1X9QA 1WA0X 2R7EA 5CSZA 3ZR5A 4LBAA 3PDOB 3HRPA 1CFSA 4XH2B 3OJVC 2WBKA 1E27A 3EYVA 2IWGA 5IM7A 2J88L 3JQOB 5DD5H 2P5WD 1RZFL 1NDMA 2BY0A 1T20A 4ODXB 4ZUUA 4E9LA 3P3RA 3U6RB 1CIDA 2VMCA 4WSKA 4HXAH 4Y19E 2KBGA 1SYSA 4JHBA 2NUTB 2ZKXA 4Q52A 5HHQA 3QIBD 3NCYS 1SFDA 2DKUA 4DW2L 1WBZB 4X4ME 1A4KB 3FONB 1T4WA 4KVNH 1XL6A 3QQDA 1FE8L 3HFMH 4JFUA 5EUOA 4PP2B 4PV8B 3ESMA 1GJWA 4HGWA 1SDYA 4N20A 2B1HH 2ZP9A 2Y5QA 2HX8A 3DRQA 3GBLA 5CSGA 3UMNA 3WD5H 5ITBL 3L3GA 1F4AA 3PIQB 3T0ED 3GHBH 5I6OA 2D3VA 4CW1B 3GPEA 1KCBA 4O2EB 4UIMB 3VG0H 1AO7E 1EGJA 3BZ4A 3PWPA 3PL6D 4XE0A 3HG5A 2CBPA 2BOCA 5KVMC 3HBGA 5F8QC 5MI0C 5DZJA 1K5NA 2CIKA 4HQQL 4JDEB 5D1QD 4YLBA 2J5WA 5MENA 4GXUM 1IE4A 3FDWA 4XNBA 3WEAA 4ADGA 2P80D 3FQNA 5D1XC 1B9KA 3MRMA 4MD5B 3TA4D 4N2DA 4KKCD 2LHAA 5CCHE 1L9NA 4LCUB 2X7LA 2DBJA 3SCMD 1INQA 1C5BH 1OGAB 3FQWA 4AG4H 4HS8L 4ISVB 1V05A 4ZAKB 4U4IA 4KI5C 3QUMH 3C6EA 1RZJH 4P2RD 2J8UA 4I0PA 2DOCA 1UEYA 4XC3L 5CEYA 3RY6A 1CU4H 2UZXA 5DD1L 5DQ9A 1NAMA 4QRSB 2K6ZA 4KMQA 4BQCA 1MUJB 5CU9A 2WOYA 2OI9C 5AYQA 4M7JL 3O3DB 2OX5B 2EABA 2QPUA 3HC3L 4XVOA 3TBWB 5K5YA 4G8GB 2EUZA 5A40E 1QHOA 4BHUA 3DI3B 1UOLA 4YDIL 1NL0L 2ZTBA 1K4DB 4A6YL 4F7CB 1ML0A 3ETSA 4GLRH 4P46D 3UOAB 2YPVA 4TVUA 2OL3B 2Y06H 1JV5A 2NSMA 4JFOB 2FT8A 5ILTH 2GQHA 3S35H 3KPSA 3FO9A 2WUCH 4FQXA 3LKRB 4GJTB 5IV2B 5IB2A 4JLRA 4BUQA 5K1NA 1FH2A 1D5XA 1LMIA 3KXFD 2UY6A 3QULB 4Y4HA 4HKXB 4QEGA 2DQTH 3P2TA 1NKRA 4FYSA 4LVHC 3NPSC 5BS0E 5LKNA 4WO4A 2FEDC 1A1NB 2BSCA 1YNTF 4IW4C 3TTSA 4B9CA 3KBFA 3BWSA 4ESKA 3TX4A 1U8LB 4X99B 5D7HA 3F12A 3CH1A 2EDFA 5E5RB 5AALA 1KJ2B 5DJCA 1V8HA 3ESPA 5HJGA 3ATAA 3EYOA 3ESUF 5H4YA 4K5LA 1FAKT 1NGZA 2Z8RA 3T2OA 4GMTH 3BLBA 4X7DC 4BDVB 1UZ6F 2JSFA 3MC0A 5HVGB 2YPLE 1WITA 4UOW1 5GHWL 5FHAL 4N0CC 6PAZA 4HZ1A 5I17A 4RAVA 5C7ZA 5TK2A 2EDKA 2YAEA 4IS6B 5CIPB 4AEIL 2V3DA 4NWTH 2ADIA 5DRZA 2VIRA 3ARBA 4I85A 1FAIL 2OPCA 1JYNA 4PQXA 2A0LD 3ILPB 2XICA 1XF1A 2IAAC 1E9OA 1H8OA 3OLDA 4G9DB 1R5VA 5ISZD 4TVSa 1DJZA 1RI8A 4G8FA 2ZX7A 3MLXH 5J12B 5KYWA 4PYHA 4KUZL 4WTZA 3DHPA 4RGOH 4OJFH 1NCTA 2YSSA 4Y8DC 5MERB 4L2LA 2VLRE 3QCUL 3C5JB 3QJXA 2RFXA 1T89C 2XTJC 2IPKB 4P5TA 4KK9C 4ALAL 3QRFM 2E9GA 4NAMA 3X2QB 2FGZA 2G4GA 1I8KB 1SVZA 2ZXAA 1NBVL 2ZSVA 1D6EB 1QSVA 4YDJB 4ABQA 1IGYA 1TZGL 2BS8A 3HB3B 3RFZB 5CWSB 2EDQA 4NN6C 4U2YA 3RPKA 3FB5B 3LNGA 4FG4A 5BVPH 4UQ3B 4O2CA 5E6UB 3JZ7A 3SE9H 3QEQD 4F9PA 4GKNA 4PWIA 4YOKA 2J6EA 4K3GA 5HHMB 4XX1G 4F2MB 5I0ZA 1Q9KA 3BW9A 4NKDA 1HHJA 4JKWA 3V0HA 2UXTA 3D25A 4BA0A 4LPXA 4MMYB 4QTHA 2AK4A 1F3DJ 3FTZA 4PJCA 2O5YL 3FN9A 2VDOL 1X6LA 2VN3A 1EZUA 5LGKA 4AQ8A 1NGPL 3MUHL 2W92A 2FQFA 4Y4FC 3D4GA 1B4JL 2AABH 4LSSH 4J3OD 4MNQD 3AU1A 5CO1A 3L1OL 4HUCA 2H8PA 2WZAA 3MRNB 3RE0A 4AYFA 1YN6B 2FBRA 2P45B 2PYEE 3DTDA 4WHDA 5JQ6L 2FLMA 3MACL 4U1SB 5FYJD 3CSTA 2XXCB 3LPPA 5KVEH 2OTPA 2R1XB 4LVNC 1Y7VA 2X09A 2H0PA 3K80A 4PWKA 2Q7AA 3TIEB 1E4XH 1FYHB 1LHZA 2WXJA 3OLIA 3QUKB 5JIDA 1NGWA 4OCRL 3MJ6A 2HFGL 5DA4A 4BH8B 4CAGA 4J12A 4FYQA 3PG2A 1FZKA 4NC2B 2D7NA 4P2CG 3WI9A 4GUCA 5DHVA 4C83B 3TVMA 1N59B 1J5OL 1LDPH 3ULVH 5KSUB 5F9JA 4HJIA 1P4LA 3S88H 3GQFA 3AREA 4G1EB 1WWBX 3QEHA 4R0LC 4RESB 5FGSA 5FDWA 1YPZB 2WQWA 3ERXA 4ELMF 3ULSA 4HXAL 1JD7A 1DANT 5BOZG 4MZ3A 2NX5A 3WKQA 5CCGE 4WFFD 2W60B 4WV1C 4HS6A 3BZEB 4U7MA 2PUQT 3OMIB 4Y5VA 3QZWA 4KKQA 3L3HB 2ZOKA 4KVNL 1BZ7B 2BINA 3HFML 2XI9A 2VABB 1JXJA 1OALA 1V10A 5HXMA 4MD0A 5TF1H 3DO4A 3O4LE 4L8BA 3IMTA 5HHOB 3GHBL 4QPEA 3TNNA 4CMHB 1ORSB 2JI1A 2QV4A 2XSKA 2OAAA 3KPNB 1WZLA 3LCYA 4MB5A 3D4ZA 4UQ2B 3VG0L 3W38A 1I3UA 1OAUH 1WD8A 4G80B 3ZRCC 5IHZB 1SOKA 3HN3A 1LO2H 1G9NC 1P5UC 2Q76A 2VO8A 4ENED 3L13A 3LQAL 3C5SA 1AGEA 4H0HB 1EQWA 2P3YA 4HCRA 5CEZH 1XH2A 4F27A 5ALCH 5E9DD 4C55A 3A23A 4K2UH 3FOLB 3FOMB 4LIQH 1EV2E 4WHTA 4AG4L 5FGCE 1UD5A 2YD6A 2QVFB 5HGGS 3BMVA 4FXLA 3QUML 3UROR 2E6JA 1RZJL 1T21B 3CQPA 2X87A 3GXIA 4MCZB 1A22B 1NJ9A 1TVBB 4M5ZH 5D4HA 5AQ0A 4XMWA 3VXTA 1CU4L 3RWJB 2P5ED 4E5XA 2LVEA 3BP4B 4TM9A 1I9RH 2H26B 5K9QG 5DMYA 3APFA 1OWRM 2DDQH 1GS8A 2R29H 3H9HA 2IAND 4RNRB 1Z9MA 2QKIB 3QAQA 1ZLSL 3QJTB 3BPOC 1IQWH 1T5XA 4HIEA 1KIRA 1NIBA 1MVFA 1X5GA 1RZ7L 4B9YA 3LKNA 3QFJB 2E6PA 3KH3A 4YFDB 4P2OA 1ZLDA 2ITCB 2BOBA 2JLLA 1AY1L 1BZ9A 2XZQH 4J3OH 3ZVVA 4R2GB 2FJGA 1OW0C 1LNUA 1R5IB 2VQTA 4FQHB 4PJXF 5IFHH 1ETJA 3QQ3A 5ILTL 5D1XB 2Q7NA 3WLBB 2WUCL 1ZHKB 1PEWA 5KYNA 5DZVA 3QYMA 1GC1C 2OS7A 1WF5A 3BKJH 4UINH 2DQTL 2DEXX 2JCCB 1U41A 1VRSA 2R69A 3ETBJ 3KBEA 4J4PA 4M6MH 2GI7A 1H6FA 5E8DL 3DX4A 5C0AD 1XX9C 3RRQA 3TJHC 2CH8A 3DOHA 4AXWB 2X0WA 4JG5A 4XMTA 5FW8A 3WHE1 3LEVL 3B8SA 3F84A 3KDMB 3QUZD 4DKEH 2OI9B 3OKLB 3PS6A 4IOIA 4BCZA 3OZ9H 2W0KA 5KN5A 1L6PA 4X5WA 4XTRC 1TEFA 4Z1PA 2AJZB 5EC1A 4GMTL 4ZUVB 3OTTA 1AGCA 2NYYD 1NCCH 5HY9A 1VEPA 4MAZA 3D3VD 1DSFH 3D2TA 5ABZA 5AKVA 3NZ8A 5JPMA 3HKFA 4JFPA 2IPTH 1HHHA 2HPOA 2ZWSA 4H13C 4NWTL 5EPMA 5IVXE 3SGJA 4OZ4B 3QJQB 3QXUA 4B3VA 1OP5K 3V6OE 4AC4A 1TZHB 2LT9A 3MV8A 2X2JA 3NIGB 4GS7C 4LAQH 3RWEA 2EXWC 2WWMD 1DVXA 2A6KA 5E9AA 2FX9L 1M56B 2LAGB 3LKPA 1NPUA 3MJGX 4LVHB 4NLHA 1SPDA 2F68X 3MLXL 4LRIA 1JVKA 1P7KA 3GF8A 4RGOL 4HWUA 5KWYC 4GW4A 1CICD 1J9CT 4XGZB 3RVXC 3KWWA 4APQA 5E1AA 4QTIH 4RRPA 3VFPB 5D7KD 4WJKB 1H3PL 3L9EA 2DH3A 3OHXA 3CFKA 1T04B 5A3IC 4LDEB 3HE6A 2WKOF 1PZSA 2QEJA 4FNQA 3GUTB 4HFWA 1X5HA 5DMKA 3TBTB 1ZLEA 3O6FC 2EIJB 1Z6JT 4E9RA 4ZMLA 2Y22A 1AAJA 2C7UA 4HUVB 1IZJA 2Q20A 1TZOA 3IFLH 4NBXB 4D0CA 3VXOA 5M95B 5BVPL 3U0WH 1F3JA 1AGFA 1FCGA 3WEXA 1FNHA 3SE9L 5LGJB 4PJHB 5B38G 1EERB 1U8OB 1A6PA 3GMLA 3IDJA 3CXHJ 1YAIA 2R4RH 1D5ZB 2XWBB 1S9WA 3UO1L 1T80A 2R2CA 4NRXB 1BD2A 4ZNEE 1SYVB 1IC5H 1D5BB 2IAMC 5DFWH 3BVDB 3QWNA 4PY8J 3GJFH 5EG6C 5DVOA 1ZY9A 2KS0A 2C9SA 1REIA 2EDNA 4WW2F 5GS2D 1NSNH 2CHXA 3QUYB 1KPRA 2RA1A 4PJAE 4NZTH 3CBRA 4UM8A 1INEL 3I2CH 4LSSL 5D9SA 3QE5A 1P4IH 1U36A 3QJZA 4BUGA 3S4SA 3KPLA 4N6QA 1H6TA 2K45A 1B6UA 3L1FA 1JGIA 1X5LA 1V55B 3DVGB 4OIFA 2GT9A 4B9JA 4CSPA 2XV2A 3WN5B 1B0WA 2VLJE 4P4RA 4Z7UB 1ZLWH 3VJ6A 4B9GA 4MQXC 4P5MA 2R1WA 1RZKC 3V0FA 4AUYA 4QRRA 3L2LA 3S5LB 3BUQA 1T6WA 2VDNH 3CDGB 2IQ9H 3ZRSA 1OF0A 1S7RA 1KN2H 2P1YA 2VXUH 5CD5C 3ULVL 3BO8B 1OGAD 2H6UA 3S88L 3BAEH 3JV4B 4ZAKD 5IG7A 1LO5B 2KERA 3N1MC 1I9IH 2GTZB 3L95B 3ZX1A 1TQWA 4N87A 3FT0A 2FAUA 3LRSA 4PRHA 3NQKA 5EBWA 3QHZL 1E5AA 3O8XC 2A6IB 1CLYH 1EAJA 2PCPA 2F08A 2A99A 3WUZA 2MH4A 1DQVA 3CFUA 3IFPA 1WVZA 2KH2B 4ZFZB 1P1ZA 3BVNB 4O02H 4LL4A 1OEZW 4G8GD 2Y7OA 2VMDA 4QR7A 1DN0A 4IHBA 4MNHB 2BVYA 2JVUA 1JGVH 3B1UA 4LVNB 1FV1A 3DMMC 5DK2A 2NUPB 1E6JH 3NEEA 4PLJD 3LS5L 3PWVA 5DJZB 4R5XA 2H7WA 2WP3T 4IOSA 4G5AA 4K94H 1N0LB 4QD2E 1N6VA 4DP0X 1OAUL 3NK3A 1WP6A 4LKCA 5I71C 4JK0D 2CGYA 3DA0A 2GG1A 4MJ6B 1LO2L 3RQ3A 4XNDA 4ZOEA 4JQVA 5CGYC 4CU8A 1LEIA 4L8CB 1JWUA 4AY0A 1OAQH 3QZPA 1ETZB 2CRYA 4B5EA 2F53E 2P8MA 5CEZL 4AT6A 3BWUF 4UDUB 3KPPA 5JXEC 1DVTA 2A4ZA 5B1AB 3MJ9L 4JN1H 1XB8A 2BS9A 4ONHB 1Q9OA 2W0PA 2DLFH 2EYTA 1DCLA 2DWEA 3D69A 3PWJA 4X6EB 1UCBL 1LWHA 1YLBB 1IILE 4HV8B 4FNPA 4EOWL 3CE1A 4XMVA 1UM5H 4A1RA 2EEAA 3DTUB 4CNIA 2H45A 3GIZL 2DDQL 5EEVA 1KBWA 1KCVH 2MWCA 1UXWA 4OIAA 4MD4B 3MRJA 1U58B 3K8KA 2UYLB 3QC6X 1L5GB 3NRFA 4ODVH 1OQXA 4BZ2L 2YN3A 3NEXA 1BXXA 1A2YB 4TUOA 4OD2B 1U3JA 3WJMB 3RWHB 1S5IH 1A5FH 2XZQL 3STLA 5C0BB 1DFBH 2AK1L 3V8OA 5JW5A 3RJDA 5IFHL 2GSMB 2IVFC 2QDVA 3NJKA 3L7FB 2AQ3A 3PU7A 4ILDA 4XCFH 5C0CA 2W07A 5C3TA 1FVDB 1B9ZA 3CN3A 1AXSB 1G7JA 1O9ZA 3KYKH 3CX5K 5DFVD 2ADGA 4I2XB 4S1QH 1AQDB 4N6RA 1M7UA 4YX2H 1I8LC 4TPRH 3BKJL 1M9SA 4UINL 4M6ML 5EBGA 3MV7B 3WGVB 1LQSR 2JKTM 3GMPA 1Z9PA 3VCLB 1OP9A 2JK5B 5IB5A 1MHEA 3HB3D 5ELIA 3U7WH 4C58B 3OKMA 5LCVL 1N8ZB 4NKQB 3OZ9L 4JO5A 3BPLC 3TBSA 4DO4A 3KMDA 2P5WA 2OFQA 4X4ZA 3MTRA 5BZDB 3A6OA 3BPOB 1MJ7L 1DQKA 2P8PA 1YO4A 4F91B 4N24A 2YA2A 1JXGA 1NCCL 4XP1H 3BT0A 5HHMD 3QIBA 4QY8B 4A2FA 5K33A 4M7LH 5BVJB 4NSKB 4U3CA 2IPTL 4NX0A 2ENQA 4PJGA 4M7LT 1MRFH 2K78A 2XRAH 2J8HA 3D87B 3EOTH 2JJVA 5TDPA 3EG9B 4UM9B 3MCG1 4Z7QF 3ZDZB 1FFPB 3WTXA 3KJ6L 4LAQL 4IKKA 3T0EA 2BH0A 2G5UA 3OKKB 5HI4D 1EA9C 4YDLC 1AIFB 4CDHA 5E5UB 3HG4A 4Z3IA 1V7ML 3T3PB 3GZPA 3PJSA 4QTIL 5DWPA 1WFTA 1CBVH 2PXYC 2VDPH 3IJEA 4YSCA 1A9BA 1O7SA 3RIFK 5D1QA 5DS1A 4P4KB 1FSKC 3A21A 3GO1H 3QI9C 5EU6D 4V1DB 5FYKD 5IJDC 4HG4K 1EJ8A 2YQGA 2P80A 1PX4A 4RGNB 2VGLM 5IMLB 3B2XA 3US0A 4HIIA 1DR9A 1T5WB 3U0WL 1EX0A 4WNQB 3V9FA 4H26A 5D71H 4AJWA 4MRCA 3V5HB 4P2RA 5E99H 2YRLA 2NYZA 4OLVH 4LCYB 1YEKH 1KEGH 3NGBB 1UVQA 5CN1A 1ETA1 4YPGB 4ENZA 3QYCA 2GK2A 5IHBA 2B77A 3QO1A 5HGAB 3D9AL 4JKPL 4Y9CA 5F1OB 3EBAA 2A6DB 2PETA 5EV7A 4CADB 2UZIH 1HILA 2WVUA 4X8CA 2QLVB 5TGBA 1R3IH 2R1YB 2ICWJ 1EEYA 2HKAA 3QPKA 4OI8A 4N0UB 5KSBE 4HAKA 3EO1A 3Q6FB 4KK6C 3BYYA 5CIPH 1GRWA 4LPVA 1BREA 1JZ4A 1PZ3A 2XZZA 1G6VK 2EDXA 3BI9X 1NSNL 5A43C 3HBZA 4Z77A 3ZDXF 4P46A 1TUPA 1ZIAA 5G5DB 4KROB 5EB9A 1P4IL 1QBBA 3BAKA 3O6FB 2YD1A 5CLYA 2ZAIA 2IDCA 3ECVA 3GZOA 4WI8A 4YE0A 1RJLA 5D96B 2XKNB 2K7QA 5DHMC 5EBMA 5AW6B 1GOGA 3I6GB 3FQXA 4HWZA 4EI5B 4CVUA 4UB0H 4XNMB 3KXFA 1KYAA 2BP8A 3QJRB 5C6PB 4G43A 2R4SH 3B7YA 1JF1B 5E23A 3QJVB 5BV7B 1A8ZA 3BQUC 2F8XC 5DZPA 2Y72A 3KL3A 2VDNL 1FZOA 2IQ9L 2FATH 5KTEL 3UGUA 3NOIA 1KN2L 1E7VA 1SNRA 2WUBH 2XWTA 2VXUL 5J7CC 4QT5A 4OZIE 1QTSA 2DLEA 1R17A 2VWEC 3P4OA 5CMAA 5DVNA 2DYRB 2G2RB 5HHPA 4MJJA 3WEBA 1I9IL 4ATWA 3JWOH 4Y1AB 1CLYL 3AXIA 5FOBA 1R24B 5GZOC 1KB5B 4A7VA 4FQJH 4YE4L 4RBPK 1GGIH 4O02L 2OXHA 2Z93B 4F8OA 3FFCB 4NO3B 2FCBA 2ETWA 4YFLF 1RUQH 3UBXA 3ARDC 3QFJD 3DJTA 4R97C 5DYOB 5ISZA 1TTAA 3CUPA 4FFYA 2MTPA 3B34A 5F3FA 1J5DA 3ZIYA 2JJSA 4L3FA 1XCWA 2VE6A 4CSTA 3TJEH 3FQ1A 4OV5B 4RH4A 5HJ3B 1I82A 4JFWA 4R2GD 5EUOE 3TYGH 3EZJB 1M2VB 1XF5B 2X4TB 4K94L 4QHKI 5LDUA 4U1IB 4Y1SA 2NY1B 1MHHA 5D1XD 4EZMA 3OKNA 5I8CA 3SDAC 4Q2ZB 4YHNB 4ANVA 2WOBA 4U6XA 2WQSA 4XPAH 3OR6A 4OM1H 3W0WB 1OAQL 4Z7OF 1SN2A 3PWPE 4ES8A 5I8KL 3QZOA 4UTAA 4MCMA 2BLFA 3ES6B 1A02N 1P9MC 2WBWB 4ADIA 3GSVB 2GJ6E 4UQEA 4JN1L 5I1LB 5MENE 3NFPB 3DX8A 1XD0A 1JXDA 4MXVF 1TQCC 3FT2A 3K74B 4BZ1H 1MY7A 4Q9RH 2D0GA 3ULUD 3MJ7B 1IX2A 2LTQC 5SX5H 3DMMB 1M6OA 2R29A 1UM5L 4FULA 4ZOBA 1CTMA 4JHZA 1KCVL 1DQQA 1SOXA 3H42H 3MKKA 5BOJA 2NXYC 2EDDA 2J8UE 4MA8H 4DZBB 4M8QB 2QVKA 4X6FB 4ODVL 4QHUA 5AKSA 3SKNA 3EFFB 1IGCL 2A2QT 4M9OA 3UZVA 1SJXA 5I71B 2Q3AA 3GI8H 5ABAA 1OSEA 4KNUA 1ZGLA 3UC2A 1FWXA 1MAJA 3TBBA 1A64A 1H3VA 3GD1C 2XVLA 3FQRA 4MNQA 4R7DB 3VI4A 1S5IL 1A5FL 1DFBL 5DJAB 2WQ8A 4M1CD 2XFXA 4NXKA 3ECUA 2FEDD 4XCFL 5DR5H 4AGMA 5F7LB 5C0FA 5CGMA 3II1A 3GSNB 4D8OA 5JYLA 2AS5M 4S1QL 4JZJB 3GB7B 4TPRL 4DNLA 5ENWA 5AVQB 4IDLA 3I75B 1ZVYA 3F7VA 3CIAA 1Z2KA 5HGBB 2IDUA 2ITFA 1W8OA 1Y18B 2VNCA 4YSEA 1JCKA 5DJ0B 4F37F 3U7WL 1IO4C 1WZAA 1G7HA 5ESVB 1I9JL 3N40P 3LMJH 1R34A 3SE3A 1G7LA 4N0CD 3DJSA 3GLEA 2Y9RT 3EUUA 3VAEA 1OAJA 3D6GA 2YBRA 1DJWA 2DYPB 3CFEA 3DVNB 1DQDL 3K1DA 4BFJA 1WA1X 3Q5TA 4XP1L 1FL3A 2LVCA 1N19A 2V6HA 4X42A 1CS6A 1AIZA 1G7MB 3RUGB 3CD4A 3HG1B 3M6DA 3TBVA 4XCNB 3HLAA 2IDTA 2YAOA 3BRGC 4Z3GA 1MFEH 4QRQB 4PJ8C 4R8WL 2EVIA 1MRFL 2XRAL 3LH9A 1NCNA 3ZY7A 5L8KB 4JANB 4WWPA 5CJOH 3QUYD 2YMXH 2KPNA 4GP5B 4M5YL 5IROC 4I18C 4HS3A 2GEEA 3WL9A 4OLZH 4N0YH 4NHCL 5TFSH 3KH4A 3E2HC 43CAB 4OJDH 3V0VA 2QR0A 3T77B 3ZHNA 3WY3A 2VDPL 2DL2A 9PCYA 3L1EA 3UCQA 1JIBA 3KGTA 4HXBH 3F5WA 2OCJA 4QHMB 4FNLL 1F90H 1KJVA 1YNKL 3GO1L 2YD9A 4P3WA 1M7XA 3RVWC 5ACZB 4MMZA 3N2JA 5J9PA 1Q1PA 2R2EA 3L4VA 1E28B 3PGCB 4JO1H 1JXKA 3F58H 1VZIA 5CP7B 2JB6A 1UWFA 2Z31C 5EU4B 2G75A 5E9DA 1FL6A 4KKBC 2HZHA 4TQEH 2Z7WA 4CKVX 4WFED 2V5SA 5D71L 4ACPA 5EU3B 4GUOA 2HFEB 1BEYL 1UCTA 3M1OA 5E99L 4FAAB 4OLVL 4JREB 1YEKL 1KEGL 2IF7A 2J4WH 4HPYH 4JRLA 3U25A 2P5EA 3NJGA 2DQHH 2EP6A 1E7UA 2WTPA 3AY2A 4GSXA 3FSWA 4JR9H 3SGEI 2EH7L 2ARJB 2UZIL 1O6VA 2IANA 4GRWB 4Y4FD 2FH6A 1E9QB 2KUTA 2YGQA 4G7SB 5EIVA 2R51A 4RFNB 1KB9K 5T3ZE 1JHKH 5CJ5A 3FCTA 3HE7B 1GGTA 5ICZA 4ZX5A 2GAZB 1SY6H 5E6SB 1OSPL 3CSYB 5F7FA 3FS9A 1TO4A 3HC0A 1WFNA 3L3IB 4NCC2 4MA1B 4WQOA 3ZE1E 4DQAA 3C8DA 3QJUB 4XBPB 1U91A 3UTPD 5I28A 3RWGB 4FFTA 1FSKB 2AK4E 1KYDA 3G08A 5FGRA 1N6QH 5L0QC 1KLFA 4M93C 4WWOA 4E9VA 2VSMB 2WIIB 5AVRB 4AH2B 4NNYB 4DCQA 3VGEA 3GI9H 2YLHA 1HHKB 4UB0L 4MDJB 1B0GB 3BEWB 3DX9A 4ES9A 3R0NA 4W9GC 2R4SL 3S48A 1BQSA 3KEDA 4Y5XA 3BLPX 2YOAA 1WFMA 3A3YB 3GZQA 4JCLA 3M7FB 5C0AA 3WU1A 1NOLA 5JIMA 5J56B 4HK0B 4HJ0D 4N0RA 5C8JA 3IBEA 4UILH 5FIEA 4BGDA 2C1OA 1I7UA 1O5DT 2HUHA 5CJ8A 4U49A 2ADJB 3MOAH 1MEXH 2W5PA 2CJUL 5KBLA 4PGBB 3EYQD 5AVXB 5E2WL 1TVHB 2CO7B 3CCHB 5BMFL 3D3VA 3VDCA 5JPNC 3JWOL 5KSAC 3WV0A 2BSTA 4RMRA 4JDZB 1NA8A 3BH8A 4UV4H 2P7TA 3CZNA 4ZFQA 4O02A 5FO7A 4FQJL 5J3HC 3DSNA 5D70H 2HVBA 5FX3A 1GGIL 3DO7A 3IWUA 4M4PA 5E8EB 1BEXA 5E8NB 1R4XA 5DYFA 4AYDC 4MAYB 3QIWC 1QHQA 4CA4A 1ND0B 1U4EA 1NLDH 1RUQL 5L7XH 5EOTA 4PH8A 2C9PA 2NX5E 4MX7B 5BXFA 3RDJA 1MAMH 4E0RA 3TJEL 3N1GC 5C0BD 4PCSA 1CICA 4MJIE 1A1MB 2J56A 2Q87A 3STBA 4JY6B 5CINH 1ODUA 3U6XA 5F3BA 1C12A 1FL5B 5AVYB 2FJFB 1NFDA 1YQVH 2FLRT 1JGUL 4Q6IB 3JWDL 3S3BB 5I1HL 3VFVB 4OM1L 3THML 2AQQA 2HG5B 2FEJA 1PBYA 1YNTB 2G60H 3LHPH 1D2OA 1UD4A 3K6NA 3PDOA 2F1BA 3EJCA 3MRIB 4MJ2A 4XH2A 2ED8A 1E5ZA 3WO4C 3G5VB 3DGCR 5CJXC 4YDNA 2ALAA 3BZ5A 1AZZC 1LXMA 2W9EH 3MRKA 4ODXA 1LEGB 1CDBA 5DURB 2DMKA 3GFUA 5FM5O 2B3RA 3Q8AA 1PZ2A 3FB6A 4QWWC 4XNQB 3U6RA 4F80A 2O1AA 3ARDB 2HRGA 4R97B 1NLBH 5J1AB 3WE1A 1DBBH 2NUTA 3H42L 1ERNA 5ID0B 2YMOA 4QRTB 1WBZA 4MA8L 1A4KA 2XQYA 3FONA 3RBGA 5CBEB 1T6BX 4ETQB 4R84A 2EVGA 4PP2A 4PV8A 4K7PH 4PB0L 1B0IA 3CHSA 1AD0B 4JFYB 3JV6B 4UM9D 3WTTA 2CMRH 5BOPA 3U1QA 3PIQA 1NBCA 2ZUSA 3VH8A 3BQVA 4CW1A 1WCQA 3ZT7A 1NMCC 3ARQA 4XAKD 1JFQH 1YMMB 2WBJC 1VPOH 4O2EA 4UIMA 5DR5L 4TKWA 3A4DA 3TJHD 1BVLB 1NCDH 3C5ZC 4F9LA 1ZTXH 4FQ1H 4P0DA 5DF0A 1HN1A 3U2SB 4JDEA 2H41A 1IBYA 4FFZH 4P4KD 1TQCB 3ME0B 4XTRD 2VMFA 4V1DD 1NZRA 5IHHA 1OCWL 4Z7VB 3N42F 4JKLA 4E41B 1O0VA 4MD5A 2OZNA 4H8WC 2WXMA 4ONGH 4WKZB 5C08B 5ESAB 4LCUA 2QLYA 1QLEH 1H3GA 1OGAA 4YC2B 4ISVA 2NNCA 2WD0A 4X5RA 4ZAKA 5IK3B 4JFZL 3O3AB 2UVFA 2NXYB 4FL4C 1ED3A 3ML8A 4CDGC 4XPFH 4MS8C 4KVCH 4XP5H 4QRSA 3QDJB 1N7ML 4Y5YC 5E2TH 2EILB 1MUJA 2ED7A 1JNJA 2CM5A 5AOLA 1J0ZA 2EXWD 3O3DA 2OX5A 1RPKA 5EOCH 3TBWA 2WK2A 3HTLX 3FYIB 4G8GA 1HEJC 2PW1B 4LEXL 4U1JB 3TXAA 4JO8A 2FWLB 3LNDA 4PRPB 3OR7B 2KL6A 3RVXD 3BGFB 5CJOL 1IKNA 1K4DA 4F7CA 2YMXL 5A7BA 5A3ID 2DQDH 2LFEA 1UC6A 1G9NH 3OMZA 4KROD 4MGXA 4AK1A 4OLZL 3O6FD 2OL3A 3OKOA 3OX8B 4N0YL 5TFSL 4TVPD 2HRPL 4NCDA 4JFOA 4GEIA 1JDDA 3LKRA 4YBQC 4EI5D 3MV8E 4FRWA 5IV2A 3DXAE 5GS0C 3IJSB 1DJYA 4HXBL 2QFPA 3QULA 5FB8B 1BFTA 1JRHI 3ROLB 3UTQB 4O51B 1A6VH 4HMDA 4JO1L 3T71A 3F58L 1IGTB 1A1NA 2Y1AA 3VQLA 4OLEA 1I8UA 5FS5A 3GMOB 5I15H 4BWWA 1U3HC 4ZD3H 1U8LA 4X99A 3K4ZA 4PEEA 3HPJB 3SGKC 1T0PB 3VFMB 1KJ2A 3WE6B 2OQJB 1NPNA 3VD4A 2J4WL 4PJ8B 3IK2A 3I9PA 4NQXB 4BDVA 5IP4A 2DQHL 1JDCA 1Q38A 4LVOB 4NC1E 2Q86B 4ELMB 1GCYA 2OR9H 3NABH 1HNGA 3IF1B 1JHKL 3B9KB 4IS6A 5CIPA 3E2HB 4KRMB 3WJLA 2V3EA 1AHWB 3KW7A 5BQ7B 3KLSA 5K9JH 1J11A 1Q72L 3FFCD 3ILPA 4WENB 2YXWA 3O4OC 1BD2E 4GBXC 2OYMA 4KJYB 5AAWA 4LLDB 4G9DA 4I8DA 4APXB 4HCIA 1GC1H 4MQXD 1J1OH 2E0PA 3DV4B 3RL2B 1HC1A 3MU3A 1BCIA 1Q0YH 5MERA 4TOYH 1FO0H 4NO5B 3MX0A 3C5JA 2IPKA 1AJ7H 4G5ZH 1XCXA 1IC7H 3QG6B 4XVJH 4OGQC 2JNZA 5B1JA 5C86A 4HKZB 1D6EA 4YDJA 3W0WD 1UJ3C 3RFZA 5CWSA 2XPZA 4NFCA 4UILL 2OMXB 3FB5A 2I69A 4UT6H 1BM3H 4JPKH 1J87A 2N7AA 4UQ3A 4X80H 3MOAL 4QRRE 1MEXL 3ZTCC 4AIOA 4JY4B 1NGXB 5AW1B 4F2MA 4DN3H 5LG1A 3W81A 4AYBA 1Z66A 1WAAA 2RB8A 3DMMD 4UV4L 1DDHB 1NCOA 3PPSA 4MMYA 5L0QB 2NXZB 2F58H 5JIKA 4XCYB 4L18A 1YEIL 3ORJA 2MPVA 3DK2A 3PQYB 1JTPA 2GKIA 3V0DA 4PRHE 1NLDL 3FCSB 5L7XL 2IGFH 4QGYA 4WKXA 1MAML 1A4BA 3A5VA 2FHBA 2Z4QB 4LLWB 1QWHA 1LP9B 2IEPA 4LEEA 3MRNA 4PJXB 1CT8B 1HOEA 2CNZA 3AT0A 1T1ZB 1YN6A 1H3UA 1OT2A 2FQEA 2Y1ZA 1A7BA 4TVPH 5AYTA 5CINL 4KJQC 3WNNA 4U1SA 1MDAA 1TTCA 2R1XA 4ABWA 5JXED 5EU6A 25C8L 4L4VD 4UZGA 3T9WA 3TIEA 4ODHH 1HFUA 3VRIB 3QUKA 4KKLD 4LNRB 2SEBB 4BH8A 1OOAA 1OP4A 2G60L 1OHQA 3LHPL 1F41A 3QZLA 4L9LC 5D1ZI 5DQDL 3Q6GH 2Y7MA 4J8RB 1N59A 4R4BB 4C83A 4D9RE 3PNRB 2F8VA 2FT7A 3V4PL 3NA4A 1TMQA 1J9QA 4LL9A 4S11A 5KSUA 4KGJA 4BZ1A 5DC2A 2NSXA 4I3SL 2W9EL 2WCGA 3PHOB 2DMGA 4G1EA 1KELH 3VB8A 1HT6A 2J1KA 1YPZA 1TITA 2WJ5A 3IEAA 5MEPB 4B5ZA 2DYPD 1MRDL 5FGBA 1NLBL 2IMMA 1TPXC 2XQ0A 4PREB 2W60A 2JJWA 3BZEA 1NIAA 3HG1D 3EH3B 1KB5H 4WFGD 3L3HA 4DF9A 1GGYA 1LJMA 1UUNA 2WXOA 1BZ7A 4I9XA 4UWQB 4WFHE 5J13C 4FF9A 2VABA 3IDMB 4LLMA 4L1TA 1JGEB 2CMRL 2FDBP 3NT0A 3E1F1 1ORSA 4NN7C 1RZKH 3KPNA 2DW5A 1VPOL 4UQ2A 1IMHC 2DLHA 1MI5E 4FOMA 4HBQA 1NGQH 3SZ6A 1NCDL 1ZTXL 1ADQH 1F4HA 4G80A 5IHZA 1EHXA 2BRRL 5IB1B 3VRJB 1TCRB 4FQ1L 2G5RA 3WO4B 3UBGA 3UEZA 2PO6C 1XAKA 4MCYB 3VUAA 3NIFB 1OE3A 2CLZB 5C0CE 1XGRB 4ONGL 3MUY1 4P3CH 3D5OF 3EF4A 1QLEL 3FOLA 3FOMA 4DKTA 1HL9A 4OLYH 3SPIA 2ZKHL 1T21A 4NZDA 5D5MB 1TVBA 3FCGA 2X53A 4L8DB 1V7NH 4XPFL 4ZRGA 3RWJA 4KVCL 3V4VB 4XP5L 4AZUA 4L48A 3UZEC 3BP4A 5E2TL 2NY4C 2H26A 5JIQA 1ZT1B 5C9JB 2P5WE 2L3BA 2PWEA 5IW1B 5EOCL 3MNVB 4RNRA 2QKIA 3N1FC 4HWNA 4ORGB 3HE7D 1SM3H 5TJWK 3QFJA 1T2QH 2CUMA 5E6RB 2ITCA 3IWVA 1ZGLM 5DSCB 5KYYB 5IY5B 1GR7A 4WUUB 5IHLB 2DQDL 1G9NL 1R5IA 3NFSH 3GRWA 4FQHA 4GAGL 3L8QA 2Q0ZX 4PJGE 3VD0A 2KT6A 1J05B 4ZOAA 5D1XA 4WJ5B 4FMKA 4JJHA 4WTXA 3WLBA 2E3VA 5FECB 1ZHKA 1EVTC 2BNRB 3T0EE 1INDH 4MWFB 2BERA 2QL1A 3BSGA 4I77H 1TTGA 1PLGH 3WFDL 2VZUA 4M7KH 2Y1VA 2JCCA 1A6VL 5KEZA 1MCIA 3W57A 3KBPA 4PJ7E 2DKSA 4AXWA 1TZ8A 3F7YB 1B90A 1S3RA 1SXNA 4XX5A 1WPCA 1YDPB 2BFGA 3KDMA 3O41B 4LOFA 3OKLA 1PU0A 5D1QE 3JWNG 1CGXA 3GSWB 5J06A 3P3UA 5C1MB 4PRDB 1HE7A 1QSEB 2AJZA 4PSPA 2J1YA 3WMSA 1LD9A 1B6DA 1TT6A 4ZUVA 4KK6D 1E8XA 3VWKC 3MRHA 4CSZA 1RKRA 2X2UA 2UWEF 2OR9L 3NABL 4X5XB 1MELA 4P2RE 5CGTA 4DUXA 1SY6A 2X1WL 4LOEA 1BJMA 5HDBF 3T0BA 1USQA 4OZ4A 2FUTA 3TEXA 5I1EH 5K9JL 1Z5YD 2QZQA 3C2AH 5GRWA 3OJ2C 1TZHA 4MAYD 4NQUA 3E80A 3FULA 1GC1L 1J1OL 3EYFB 5C9KA 1SXSA 2B9AA 3FRPB 5DZAA 1MNUH 2DM4A 3LRGA 1A8JH 1Q0YL 2F1EA 3DIDA 4OCMC 4XGZA 2AQ1A 2PR9A 4TOYL 5BRPA 1U3HB 1FO0L 1L7IL 4HGMA 4X83A 8CGTA 1P5VB 2L4OA 3RU8H 1P4UA 1T04A 1IGJB 5A6IA 3VMNA 5DGRA 3GUTA 1AJ7L 4G5ZL 2HTKC 3CFDB 3QARA 3TBTA 3S8FB 4GRLC 3CPUA 5AZEH 4XVJL 4RMBA 3HG2A 5KVEE 3LOWA 3PYCA 2XXFA 3EADA 1UASA 4LSUH 4BUHA 4HUVA 2DS4A 3IGUA 3A0OA 3KXFE 4R4FH 3V0AC 4UT6L 1G6RB 1BM3L 1N18A 2W38A 4TQ8A 4X80L 5ACMA 4UT9L 1QI4A 1EO8H 4U1GC 4PJHA 3SBPA 1T0NB 2VM9A 3WIAA 3MRPA 4ZMPA 1U8OA 4NBZB 1W0WB 3BCFA 3ZDYB 2KHAA 4N2EA 4TNWF 1D5ZA 2XWBA 5DURD 4FFWC 1S4IA 4DP1X 4NRXA 1SYVA 3ARDD 4J3WA 1D5BA 2IV8A 2ZIDA 5T8IA 4GRWH 1MJUH 2F58L 1IFRA 1B0RB 5JUEH 4ZXBB 1G0YR 4H5SB 1F0LA 2C9XA 3MLSH 3QUYA 4N2OA 4F8NA 2K9FB 2WNXA 3WJJC 1T89A 1EEZB 4M61B 3EGDA 4FN0A 4N8CH 2AQRA 4M4RB 5DFAA 5IMMB 4NEHB 1E50A 4NKIH 4TVPL 1UJ3B 2H2SC 1OM3H 2LLGA 1YMMD 3DVGA 4PI2A 4MVBD 1R3JB 3WN5A 5ISZE 2XVGA 4Z7UA 3NCXA 3TZVC 1QA9B 3ZQWA 4P04A 2MNUA 2H6OA 4TNVF 3H3KA 2RQ8A 4ODHL 3S5LA 5CZKA 4RMSA 1IQDB 3CDGA 2WY3B 4PCKA 3FQ4A 3Q6GL 1EMTL 5D1ZC 5C08D 1OTSD 4G9FD 3SKMB 5IMOB 3BO8A 3JV4A 2NXYD 1KELL 4PTUB 4GQPH 1LO5A 1A7OH 4JFFB 1DBJH 1RIUH 2GTZA 3L95A 4GO6B 4LIQE 6PCYA 1OGSA 2X0VA 3H3PH 4B97A 3QDJD 2DQCH 2FIRT 2A6IA 1KLGB 2HYMA 2B2XH 2JH2A 3CU1A 3NG5A 3QEQE 2P5PA 3VSVA 3ZUCA 2XHNA 1GS7A 1X5ZA 3EH4B 2G4EA 4ZW5A 2OMVB 3C87A 1CPUA 1HAWA 1KB5L 3BVNA 1QUPA 3FCBA 4NHUB 2VT0A 1CG9B 4OJYA 1ECYA 2E8ZA 2FNBA 1D3CA 2DWXA 2V17L 4FS0A 4M48L 4JM2C 3K0YA 4MNHA 1JN6B 2EDYA 2F2HA 4XPTH 3TT3H 2NUPA 1TJGH 4M1GH 3TEZA 1DYZA 5DJZA 2DICA 4NO0B 1RZKL 4GAYB 4M8UA 4LMQE 5EO0B 2IBBA 2I26N 1K9TA 2VISB 5EOQL 1H8SA 1N0LA 1NGQL 5I1GH 4L9LB 1RQ5A 2PWHA 4JHAH 3VI4E 4MNQE 2E4TA 2WO4A 5FDYA 4OCLC 4FFZA 5AVUB 4L8CA 4X7EC 1HXMB 2XY2A 4TL4A 5FYJE 1UH4A 2EEDA 1ETZA 4I89A 4J1UA 4LGSB 4QRUB 2EIEA 5HI3C 5D72H 4UDUA 3OJDB 5KVGH 5BCAA 3CWGA 2GCYA 3A6CH 3DDFA 4ONHA 5F7BA 4P9HC 4OLWH 4ZS7H 3WLWC 1CTNA 4X6EA 4MJ4A 4F1ZA 4PJ8D 5J13B 2EE6A 1V7NL 4K15A 3IGAB 4HV8A 3TIDB 1O5PA 3ZSTA 3MA9L 3BUPA 1MREH 3CX2A 5LN4A 1MKFA 3UO8B 5BZZA 1BFOB 1GIGL 1MCLA 1E2WA 2FUQA 4MD4A 4NN7B 5FLUA 5IROD 1U58A 2QELA 1CLVA 2UYLA 3S5ZA 4B0MM 1CE1H 5DXWA 2ILLA 1L5GA 4L3EB 4KRLB 1SM3L 4U1HB 3A4AA 1BPLB 1TQBC 2LLLA 3ARFB 4WFFE 3ZDXB 1CXIA 4K0OA 4OD2A 2PYFB 4Y4KB 3WJMA 4G42B 3HUJA 1OARH 5E6IC 2FYYB 3RWHA 5C0BA 3NFSL 2XX0A 1N68A 3RVWD 5I1JH 5JZ7C 1D6VH 3L7FA 3O6MH 1ZK9A 4IBUA 1FVDA 2H47C 4H0GA 1AXSA 2Z31D 1NMBH 4W9IC 5FAAA 1INDL 5IESL 4I2XA 1AQDA 1QOKA 4I77L 1PLGL 3F7RA 5K93A 3I3DA 4HJGB 4M7KL 3QYNA 3BJ91 3HVDA 3IGFA 3PP3H 3Q8BA 2I27N 5I8OH 4AL8C 2PF6A 3VCLA 2JK5A 3GKWL 4MLIA 4IBZA 2CWRA 2ZXWB 4Q8BA 4YDMA 1Q4NX 4KRNA 3RKDC 4GNKB 4MAUH 2AAVA 3WNIA 1N8ZA 3MLTB 43C9B 5BZDA 2B1OA 4HOXA 5E9DE 2GTQA 1J5IA 3CLFL 3NIDE 3L5WB 4KITB 5DZOA 3GBNH 4AW4A 4CBPA 4ZSOB 2FWOB 3MODH 1E5BA 2BZ7A 3BGMB 2ED9A 4QY8A 1OW0A 1M6UA 3TC9A 4BQBA 5BVJA 4NSKA 1EDYA 5IMKB 2P5EE 5I1EL 2ZOUA 3A4EA 3DDGA 4X5LA 4UM9A 2F61A 3EG9A 4EN2A 2X4UB 3LD8B 4Z95H 3H56A 1FFPA 2IANE 2AI0H 3ETBF 3BPCB 4LOVA 3RX5A 4UQ9A 3OKKA 4XHJC 2H3XC 4M8RA 4IRZA 2DIJA 1MNUL 2LU4A 1AIFA 1FO0A 3MXVH 2DJ4A 3L1GA 2HLAB 3LIZL 1G5AA 4X9YA 5D7JC 4OJCA 2HN7B 4LPWA 3RU8L 4XI5C 4EIBA 2VSKB 1FFOB 2NYKA 2E27L 3OVUB 4P4KA 5AZEL 1D5MB 3WTUA 1Q90A 1IL1B 4V1DA 1OO2A 2VKXA 4XB8A 3T6VA 3N1PC 5GSRA 1RMFH 1U33A 4H8QA 4F37K 4Z7OB 1SEQH 5HGDB 3VWKB 1E3FA 4FI6A 4UT6A 5IMLA 3D06A 4R4FL 4X7SH 1T5WA 3BP5B 5KSAD 4WNQA 4S10A 3F04A 3DYPA 1VFMA 4GMSH 5C0IB 3V5HA 1EO8L 5C0AE 5F7KC 4LCYA 4OUOA 3ARZA 4BFKA 5J3HD 4BRVA 2ZYHA 4OZFB 4YPGA 5HGAA 3QIWD 5AD0B 2A6DA 3MRRB 1N4XH 3ZTNL 1U93A 3K6DA 2R1YA 1MJUL 3R4DA 4N0UA 4TV3A 2K4WA 1GVIA 3AC0A 3Q6FA 2WZ5A 3D3VE 2AJYH 3DOSB 2FZ3B 5F7NC 3MLSL 3N91A 3HN8A 2A9BA 5G5DA 5LBSH 4BWTA 4GRLB 3O6FA 4KO7A 1QRNB 4FLHA 4PJFB 3LKQB 3LTVA 4NKIL 1DEEB 3BCDA 4NWUH 2XKNA 4EI5A 3I6GA 3RY6C 4FABH 2X4NB 2WXQA 4L9DA 5CLTA 4XNMA 2E9JA 3EJSA 4N2GA 2DI9A 2TAAA 2OK0L 1E9PB 2VSCA 3CDCA 2J72A 1JF1A 4U1GB 3MREB 2UXFA 5D7KE 1S7TB 4XOAA 1GAFL 2VDLH 3BE1H 5I23A 1YEJH 1J5HA 1LMKA 4U3HA 1GTFA 4QWWD 1NFDE 3B8YA 2BW4A 2WYZA 3FO1B 1PLCA 1AXTH 3IS1X 3AG4B 5HGHB 3GMNB 4W1TA 2G2RA 2D03L 4XVUC 1DBJL 1UXLA 4P2AA 2EEFA 3Q9QA 4Y1AA 3H3PL 3BPNB 2DQCL 4Z7NF 4WCYH 3T0WA 2B2XL 3APNA 1R24A 4XBEL 1KB5A 4IEFB 1C1EH 4WGKA 1CXKA 1ZANH 3L5JA 3QAZB 5B22A 2Z93A 4MLSA 2WBJD 1P69B 3FFCA 4NO3A 4PVBA 3J7HA 1KGUA 3IJYB 1V5JA 2YGNA 3GMMB 4FLRA 5DYOA 4XPTL 3TT3L 3H6JA 3MRDB 3OBAA 4M1GL 2HVJB 1PAZA 4OV5A 4WUUD 5HJ3A 4ERSH 3DJZA 5F96L 3O81A 5AW2B 1CVSC 1M2VA 1XF5A 2X4TA 5IJBC 2VYRE 1ADQA 2DEWX 1TTUA 4U1IA 5I1GL 4Y2DC 5AZ2H 3L3DB 3BP6B 4LDOB 1FVEB 4JHAL 3FJTA 1MLBB 1LYQA 3T2PA 4Q2ZA 4YHNA 3UACA 1PW3A 1KDJA 2MCMA 4KTGA 3VD9A 1COBA 2CGZA 3BIBX 3UYPB 3W0WA 3B2MA 2ZJSH 5TE4H 1M05B 4MBRA 1D7CA 4Z23A 4AQEB 4MS8D 5D72L 1CDYA 1QWUA 1U8PB 4B6ZA 1ACCA 3M88A 5B8CC 3ES6A 2FR4B 5C6TH 5KVGL 1B4LA 1BMZA 1NWOA 4F5CE 3WAJA 1UFUA 3GSVA 5I1LA 3A6CL 5IWLA 3NFPA 3CZGA 1R3HB 2ED6A 4OLWL 3L4XA 2QVIA 2A9NH 2UZPA 4H2CA 2HKHH 1RPQA 2NY6B 4CVZB 1UT1A 2PCXA 4JM2B 5D6DC 2Y3AA 2LOEA 3VD3A 3MJ7A 1A9EB 3DMMA 5J11C 1MREL 3P4MB 1OGAE 3R0MA 3PAVA 3ZR6A 3ZKQD 4NO2B 4KV5E 1QR4A 1UXSB 3HZKA 1CE1L 3BDXA 1X5JA 3NSCA 3Q2CA 4DZBA 1FZMB 4X6FA 2O6DA 2IH3B 3EFFA 3P1VA 4BJLA 3BLKA 4YBLB 4YXHH 4QRPB 5GS0D 4R7DA 4GUPB 5T1LB 5DJAA 3MMEB 4DVBB 4G8GE 2WZ0A 4JRWA 2XV6B 5I1JL 1D6VL 1RUKH 5FEBA 2Z0UA 3HAEG 5FA4B 4W9HC 3GSNA 5AUMA 2OSYA 1NMBL 1F4XH 1U3HD 2D7TH 2BS71 4IQHA 1DEDA 2VJXA 1BM7A 1AXIB 2APFA 3JVGA 4JZJA 4XO9A 5I9QC 3GB7A 1PZDA 4ZMZA 3LKOB 1BIIB 4ZYKB 3D7PA 1R3LB 2X4RB 3I75A 2VDMB 5E8PB 2RGSA 5HGBA 2VJ8A 1T2JA 3NYKA 1Y18A 1RIVH 3V9CA 4TULH 2QMJA 5DJ0A 2IQAB 4Z5RB 1BVNT 3DURB 5ESVA 4MAUL 2UX7A 4AYGA 3EYSL 5J57B 5C0JB 2XFGB 2YXMA 3M07A 5SWZB 2OV0A 1AYRA 1T7ZA 2DYPA 4H4NA 1MFVA 3DVNA 1CZ8H 3GS4A 3NRQA 3D85B 3K4AA 1UM6H 4YSAA 2QGCA 2OW7A 3GBNL 4MHHG 2R39A 2CBOA 1YEDB 1G7MA 3LNIA 3DKHA 4GBXD 5EZPA 3RUGA 3HG1A 2VN6A 1WAEA 1EO7A 4OJEH 4XCNA 1ITCA 2Q6WB 5FK9B 1QBML 4N9GB 4QRQA 4A2HA 3KVQA 3GT6A 2H9GB 4ZXBD 4JANA 4Z95L 3PY9A 2AI0L 3ASNB 3BAWA 4WSJA 5I8EB 4PLOB 4HBCH 5D4IA 2X89D 3OAWA 3GS7A 3U2HA 3MRQB 4L4JA 2K8MA 2Y69B 3SQBB 43CAA 1HYRC 5DWUH 3T77A 4U3SB 2VN4A 3AB0C 5HJBA 4H8WH 1U8QB 2PPEA 4R7LA 4QHMA 3OAYH 3I9AA 5ACZA 1B2YA 1I3VA 4XN1A 5B21A 5DO2C 3HZ3A 4ORZC 1E28A 1J12A 3PGCA 3PWUB 1GY1A 1M7IB 1RMFL 5CP7A 1SEQL 2I25N 4AE0A 5EU4A 5I18H 4X7SL 1A21A 1JHLH 4X7CC 3BFQG 1PZ5B 5EZOH 3II3A 4J6RH 2FSEB 5EU3A 2L7QA 2HFEA 4GMSL 4GQZA 4KZCA 4PJDF 1IARB 5BUAA 1QFHA 1U8CB 3RZCC 1I1RA 2AEWA 4JFFD 1DCEA 2WLIB 4PJBF 2ARJA 2LU5A 4LB8A 1E9QA 3F00A 4BKLB 1F42A 1ASOA 1I1FB 3HE7A 4WTQA 2GAZA 3CSYA 4S1RH 3DBSA 1BBJB 5HHME 3L3IA 5D7JB 4BSVB 4F2ME 2EE2A 4JUSA 4KJQD 3H2PA 1WAAE 4XBPA 4XPBH 4A55A 2J6WA 1JTTA 3RWGA 3G5WA 5LBSL 5GS0H 3I84A 2CD0A 4PRNB 2ZUYA 1F86A 3HNSH 4U1MB 5EU7C 2WIIA 4NO0D 4AH2A 1KWGA 4N2MA 4NNYA 4NWUL 4XXDB 5DT1H 3ZQXA 4WWID 1HHKA 1AQHA 4MDJA 5DHEA 1B0GA 3BEWA 4OT1H 3HMXL 4C4BA 3I3BA 1CD8A 3IDNB 2EDBA 2G3ZA 2C3VB 2ZPKH 4EIZC 3P2BA 1IBGH 4JFDB 2GITB 4L3CB 1NCBH 2EDMA 4HK0A 1OAYH 2VDLL 2WNKA 3BE1L 3KYAA 3N42B 4NQVB 4XMXA 4B53A 3Q05A 5GGVH 2G30A 4P2OC 4JM4H 1HNYA 4P05A 3UERA 4F3FB 1IUZA 5EU6E 4W4NA 5FYKE 2J8OA 3ESVF 2ADJA 3SGEH 4RAHA 4MB3A 4DPAX 4PGBA 1AXTL 2VZOA 3BDYH 3CFJB 3ABGA 1TVHA 2CO7A 4DN4H 3VG9B 3CCHA 1I8MA 2AQPA 3CXFA 4PLKD 4U7KA 3VWJB 1Y1UA 4KX8A 1UXMA 2X9XA 4JDZA 4WCYL 1KB3A 4LSRH 4NI3A 5DD0H 1C1EL 4DJMA 1UENA 1MCOH 2N1TE 4Q4IA 4J4PC 3ECWA 1RZGB 3DECA 1YPZE 5E8EA 1ZANL 1DJSA 2Z1PA 5E8NA 4MAYA 4DGUA 4L3ED 1HK6A 2GJRA 1CURA 3DIFB 4W9FC 5AL0A 1MH5A 3ARFD 4MX7A 1RK7A 1OD9A 2J5LC 3DC0A 2VZTA 2X70B 3RWCB 4ERSL 1G0DA 1ZEAH 1A1MA 2RHEA 2V7NB 4LO9A 2HPTA 2CJ3A 3EJJX 3VD7A 5AZ2L 8FABB 3FUEA 1FL5A 1WZMA 4FYTA 3BVTA 4JPVH 2FJFA 4X0KB 2JIXB 2WWOA 2X4PB 4Q6IA 4AQAB 2XT1B 1XHHA 2M26A 3MTXA 3VFVA 1JPFB 2HG5A 5PCYA 3TA3C 1YNTA 3KLAB 4F92B 3SJVB 1EFQA 1H0DB 4L29B 3AT9A 3MRIA 1MJJB 3VXRB 5C6TL 1ZT7A 3G5VA 3W39B 5ANHA 3ZUNC 4JGNA 3MLVH 2EDHA 1XT5A 2A9NL 3ZHLA 2Q2LA 2HKHL 3KPRB 1LEGA 3ZOAA 1OTTC 1IM9D 4APQC 1QPKA 4XNQA 3ARDA 1ZLVK 2IFFH 5E56A 4WRLA 5J1AA 1F18A 5E4OA 5A2BA 1PZBA 1U8HB 2YQ2A 3LZFH 3O6KH 3P9WB 5ID0A 1R9FA 4QRTA 1W2KT 3E6HB 3VXNB 5CBEA 4ETQA 5CFHA 4YH6A 3T1FB 4Y2DB 4YXHL 4FERA 1AD0A 4NC1C 4JFYA 3JV6A 1J48A 4HWBL 4N1HB 2X40A 4OGZA 4ZUWB 3LPGA 3RFRA 3VXPB 1TFHA 1MIEH 1KWKA 3B3IB 1RUKL 1YMMA 4KDVA 1FZJB 1JZGA 4NI6A 3QFJE 2X9ZA 1BVLA 4WI7A 5DHYB 1PDKB 5ITFB 1F4XL 2D7TL 3LXAA 5B8CB 2FBOJ 1K8DB 4F7MB 4YGAB 4P2QB 5JW4M 2Y5TB 4LESA 2MKWA 3U2SA 3T8MA 3SDXF 3MNDA 3ME0A 1QEWB 1JUFB 1LO4L 2MTAA 5D1XE 3SE8H 3WFZA 1XGQB 1VADB 3W11C 3D34A 4E41A 4Z7VA 1UD8A 4TULL 4Z7IA 3HHMA 1A65A 2R8SL 4WKZA 3VWKD 5FW6A 5C08A 4V2BA 1MWAL 5ESAA 1TCMA 5F6HI 5F0LB 1SQMA 2JCCE 4K3JL 5IK3A 3O3AA 3B7UX 3PFQA 2GIMA 2IOMA 5E24E 3ARVA 1CZ8L 1CXFA 1UM6L 2RD0A 3QDJA 5MHSD 3OAZK 1KGCD 1WIOA 3TOPA 5GS3A 3M1BB 5FFGA 3QWOB 4LHUD 5IW3A 4J8QA 1TTFA 1JZHA 2GUYA 2PW1A 4GG8B 2E7DA<