4UTCA

Crystal structure of dengue 2 virus envelope glycoprotein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
395
structure length
391
Chain Sequence
b'MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 75
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utcA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utcA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utcA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utcA03
4GSXA 4UT9A 5IREA 4UTCA 5LCVA 3J2PA 4FG0A 5KVEE 5LBVA 1Z66A 1S6NA 2JV6A 1OANA 2R69A 4UT6A 5GZNA 1ZTXE 3G7TA 3I50E 1Z3RA 4BZ2A 2H0PA 4FFYA 5KVFE 5JHMA 2JQMA 4FFZA 3UZQB 5AAWC 3VTTA 5H37A 5GZOA 2R29A 4L5FE 2JSFA 5JHLA 1PJWA 5IZ7A 3N44F 5B1CA 3N41F 3IRCA 3UZVA 4ALAC 3WE1A 3UYPB 1URZA 5KVGE 1TG8A 1OK8A 3UZEC 4X42A 3N43F 2I69A 3UAJA 4UTAA 4BZ1A 2V33A 2P5PA 2HG0A 4AM0Q 2ALAA 3UC0A 3C6EA 1UZGA 1OKEA 1SVBA 3C5XA 5LBSA 3J27A 4UTBA 2GG1A 5AAMC 3P54A 1RERA 3MUUA 3N40F 4AL8C 5KVDE 4GT0A 3N42F
chains in the Genus database with same CATH superfamily
4ZFOB 2B9BA 3GSNB 2OAAA 3F6JA 4JAMA 5JXED 2KQNA 2WC7A 3J8F7 4UQAA 3HFML 1FFNB 4WF7A 3I6SA 3QUZC 2FB4H 4GKNB 1X5YA 3MJ8B 3IKCA 5IB3A 1D3CA 5GSVB 3L1FA 5I1DA 4TSBL 2X88A 3DECA 5GZNA 1EZLA 4JPSA 3C5ZC 2RACA 1I75A 4IRJA 3U7WH 3IMBA 2HT2C 3P4OA 1G9NL 3TNMB 1HX0A 2LVCA 3LIZH 2WLKA 1INEL 1MQ8A 5DC4B 5DWUL 1SY6A 2HLFD 2K6ZA 3CNKA 3TF7C 3MV7E 4R0LC 4PTTA 2GJZB 1U8QB 1RUPL 2W07A 2ZJSL 3EOYG 3BP4A 2BIOA 2Q7YA 1VESA 3FU5A 3H56A 3N41B 1GC1H 2Z31C 5HHXH 1Q72L 2YUZA 3W39B 4FQHB 3U2JA 1D6VL 2BK8A 4LLUB 3TBVB 2CMRH 3KM1A 2AAVA 4UWQB 3ASWA 3L3IB 1KIUA 3QQ9D 4H0LC 5J1AB 4G8EB 4PJ8A 2WY3B 3ZRFC 3UADA 4PJGE 3I75A 3SJVB 2X1WL 5AYUH 1PYWA 3LPGA 3L2NA 4I18B 2AXHA 2EQDA 3QYCA 2AEQL 1IGMH 2VLRB 5F72S 5LAXA 1GSMA 1TTAA 4GG8B 4BFIB 5KYWA 4XO8A 3VSVA 1DQVA 3BDYH 3LKSA 4PS7A 2FWOB 4X8XA 2VLMD 5IVXA 3U79A 3S3CB 3RIFF 5DVOA 4LSUH 4U1JB 3NJHA 3SQRA 1EAPA 4IHBA 4R5VA 3SCMB 3EJPA 3QXDB 3H6AA 3MRLB 5A16B 5CBAA 3NCYP 3CU1A 5IEHB 1FNAA 4XN2A 5L2JB 4P4KD 3DV6A 1YYLL 1KBKA 2X4OB 4G1MB 2ZUXA 1V05A 5EUKA 4ABWA 5CD3A 1IAIM 1FE8L 2K70A 1KBGL 1NIAA 4KKLD 3C60B 2Z4QA 4DJMA 4LEXH 4N0UB 5EPMB 2FGWL 1TPXC 4QMEA 3UTSA 3RX9A 3RHWK 2ADIA 4XVUD 2H1LM 1F3DH 1H0DA 2IG2H 3RFRA 4F8TA 2YPLA 3D34A 1QACA 1QO3B 1FVDB 2Z91A 2J88L 3MV8D 4AENB 2ZUUA 4MA3A 4MNQE 5LDSA 3BIKA 3EXJA 2B5IB 1LE9A 2M26A 2VDML 4F9LC 1IM9B 1U8CA 2DQJH 4P23C 4QRRB 4GO6B 5AVWB 5IMOA 1H6FA 4KUZH 5IMMB 2BVQB 3HZ3A 1ED3A 2C1OA 1BVKB 3KPRB 4X6CB 2MPAL 4XAWH 3VJ6B 3FZUD 4PLJD 4Q74A 4RFOH 1NGXB 1FL6A 4QOKE 1EDHA 1REIA 1RZ8A 4L8DA 5EUOA 3VYNA 5A3ID 3ARBC 3MRPB 1GTFA 4POZD 2X89A 1YMMB 2XTJE 4GQRA 4M6OH 3VFGH 4XNBA 2P7TB 4KTDH 4YL4A 4YIQB 4ZUUB 2K8QA 4YSUA 5IQ9B 3VW3H 1ZT4B 1UZ8B 3OKMB 3FO1A 4BK8A 1GHFH 3RVTD 2K1MA 4NKMB 2E6PA 4ZUVA 2DM7A 3GSNA 5TDPA 3RWGA 1XD0A 1R47A 2ATAA 1E2WA 1U3JA 3LD8B 4K3GA 4QRFA 3SOBL 4L1TA 4OGQC 1COBA 3BD3A 2H6PA 3FOLA 3QI9A 3WS6A 3C5JA 4TVPH 4F58H 3FW6A 2JKJA 1UOVA 4JO3L 4N24A 2IDQA 4QGTA 3SKJH 2ZXGA 4XAKE 2WQWA 3ESNA 4YSRA 3ATDA 3NJLA 1CLCA 4KK9C 2IWGA 1INQB 3FQNB 5G5DA 4C59B 1JGDB 3JWNE 5LGKA 2BIHA 3BWAB 5IBTL 3KPPA 4YHOH 1U8QA 2KS0A 3IJHB 4JKPH 3JQOB 1MHCB 4K8RH 2PUQT 1RZIA 2KKQA 4RNRB 3EDEA 3LQZB 1TSRA 3ZN6A 3FCGA 5AW0B 4OVVA 1ZMYA 3VXRB 2X1PA 3TBVA 2V7HB 5FCSH 5F3BB 2C3XA 3GMRA 1AQHA 1RH8A 2QDWA 3OKNB 5CJOL 5CZVH 4DFHA 2E9IA 3L3IA 3PGDB 2JI3A 4L8SA 3MNWB 3MRRB 1C8QA 3MV9D 4LP8A 1T22B 1ILSA 4ODXA 5EZOL 5A2KH 4M6MH 1JGLL 2NPLX 1CO1A 1YEFH 3FRPG 5HPMA 4I8DA 5JHBA 4I18A 4Z95L 1L4IA 3ALPA 4OD3H 5BO0D 2X4PA 5HHQB 3IFOA 3U0PB 4IOSD 3T2QA 5F1KC 5IBUG 4HU8A 5KVDE 1MOEA 1QSED 2J8UE 3VFWB 1WWCA 1IKNA 4P5TB 4JMNA 3U1PA 3KGRA 1BFTA 1D5ZB 1WBZB 1YEHL 4JUSA 5BUPA 3TESA 3PHQA 4D7BA 1M2VA 4ENEC 1XCQB 2Y25A 3FHEA 4HKZB 4A2MA 5A16A 1DFBH 1L6ZA 1YMHB 4WIQA 4RX4D 5L2JA 4HKXB 3LXUX 5AAWA 1EHNA 4LSSH 4C4UA 2KUTA 1F8TH 4LGRB 3QRLA 1UXMA 4LCUA 5I5RA 4KJQD 4BV1A 1OANA 2R4SL 3T0DA 2ZONA 1OLLA 2N56A 1M56B 2F5BH 3ZE0F 3ABMB 2J4WL 4LLAA 5CD5D 5IVNA 5I1HH 2CJUH 3JWDH 4MD0A 5TE6L 5DJ6B 5EDSA 3WNOA 4A7UA 4NRXA 4DF9A 4XC3L 3WIHL 4PJBF 3CXDL 1IU1A 5HGAB 4QRBA 4HK0B 2ARJQ 2K4AA 3U4BL 2CH8A 1FVDA 2GYSA 1LO2H 2H5UA 3CV5A 3GXFA 3QEGH 4I7ZC 3TXAA 3ZKNC 3BYTA 1KCWA 2CA3A 5GGQL 1CFNA 2OQJA 4BE5A 3NG5A 4UQ3B 1HXKA 5F6IB 1YO4A 1WGOA 4QRRA 1OP5H 2UVEA 1D5XA 2BVTA 1U3HB 3UC0L 4NUJB 3AXLB 5GSRB 4JFYA 1HZLA 4HIJB 1MVFA 1WITA 4X4ZA 5FDWA 2VLKD 3V0VB 5TF0A 4O58H 3P77B 3BT2L 4FLOA 4F8QA 3MACH 5IT2H 2AMGA 4HQQL 1JXJA 4K9JA 5KVGH 4K2UH 5ICYA 4OUUA 3N1MC 3MRPA 4Q0XL 4XP1L 3WGUB 2APXA 1J7VR 2P45B 4AMXA 4A39A 1HL8A 1EANA 1QRKA 1DQLH 2VZUA 3D2UB 3KE0A 1BZQK 1FC2D 2RQEA 3TYGL 4RZCB 3BVDB 1VPOH 4HXAL 1UZ8A 3BN3B 1P53A 2X4SB 4FFWC 3OB0K 4OJCA 1T1YB 5SWQB 4DGIL 3F2LA 5I1LA 4PS4L 2ZX8A 3TT3H 4PB9L 4H8WC 5T5FH 4PLNC 3ORJA 1G7MB 4GBXA 3KHQA 5D6CA 4PWFA 3RTQC 4NQEE 2FVNA 4P2RB 4CDHA 1YN7B 1ZS8A 2DZEA 3U0TB 2W0FA 2BNUA 2UUDH 3BP5B 5ALBL 3N42B 2ICES 5I0VA 1FJ1B 4AZUA 2CUIA 5JZ7C 4MSWB 2UZXB 3NA9H 3VA6A 3MFFB 2GJ6D 4QUOA 4X0KB 3CPLA 5JOFA 2Y69B 3LZRA 1HH9A 2X70A 2BSSA 3AREB 2ROYA 1G6RB 1IX2A 3OM3B 2V2TB 3JWOH 5C9KA 2A38A 3HRZB 4OCSH 3IJHA 3S35L 1LO4H 2R15A 4TSAH 4OLZH 2IH8A 2ZYHA 3EHBB 1CICC 2Y36H 4YBLB 4APQD 2D7MA 4LPVA 5KSAD 4Z77B 3FCUB 4J6RL 5HHVL 4RGNE 3QZWG 1F4YL 4AEIH 1J1PL 3OKNA 5LLIC 2JK5A 3OAUL 4NZUH 3LRLA 4U1NB 2PP7A 5D2LE 5C3LD 5E6RB 3OKDB 5J6SA 5EZLA 2X4QB 3RGVA 5E0QA 1T5WB 2Z8SA 1OAXH 3EO1B 5DD3L 1RZGA 1EHAA 3AB0C 3NQKA 3IN0A 2EIEA 3S5ZA 1BXAA 3RNKB 3VFWA 4AV5A 1YEWA 4L1SA 2X87A 4P5TA 4MMZA 3WDJA 1OT2A 2NY3B 3H53A 4N9GB 4O02H 5AFAA 5D7LE 1VDGA 1WFJA 4H13C 4HPHA 4N26A 5E1QA 4HKZA 3VFTB 2P5WA 4JM4L 1YMHA 4KI5D 4KHXH 2OYMA 3IGFA 3UZVA 4XP6H 5IW6B 1JNHA 4KKPA 1PIFA 1UJ3B 1VGEH 2LU4A 4FNLL 1KYOJ 1K8DA 3MR9B 2O6PA 1G1CA 4C47A 1X9UA 5LG1A 4XNMA 5KYUA 3GD1C 5M94B 3K2KA 1U93B 1T7YA 2KERA 3EFFA 4AXWB 3V4UH 4HIEA 2OMWB 1A7RH 2IWKA 2WSPA 4WK0B 3MX0B 3GO1H 3V55A 1YAIA 3QWRD 4H1LA 3O3AB 3KXFB 5GGTL 3F01A 5K59F 2P44B 4N2MA 4HVBA 4UQ3A 5LNDA 4LLDA 5A43C 4JVWA 1JXGA 3TPUB 2DQCL 3TC9A 2E7BA 3QXUA 4YOKA 1U3HA 1C16B 4NUJA 4V1DB 3HR5A 4XXWA 35C8H 3D25B 1U8KB 4U7MA 2FBJL 1JWSB 3BUIA 1ZXQA 4FKEA 3V0VA 2LT9A 4XR8C 1IGJA 3GRBA 2QR0B 3BZ5A 4DTGL 2DWEA 4GT0A 4BSWB 4N90E 1SLXA 4TXVB 1MQKL 3HBQA 4FI7A 3S97C 1TR7A 5F21B 4P46B 3QZPA 1MCRA 4M7JH 5IVOA 1J9CT 1JS4A 4ZO8A 5AW4B 2X4SA 2Q8BH 3DVFA 3OGCA 3TO2A 3Q9PA 5D2NE 2JELH 3FQTA 3T1FB 4AIZB 1LWHA 1HC1A 1Z9SA 5BPPA 2W1NA 4LB8A 3MRFB 5AW5B 3GIZH 5FWRA 1KULA 2XFGB 4PJ9C 4BWUA 1HEHC 4P2RA 3VI3E 1R3JA 1YN7A 3MV8A 4MXQD 2GIYA 4K3DL 4Y5YA 2Y5TB 3U0TA 1DVYA 1T20A 4DUWA 1M05A 3T77B 4G3YL 2QTVA 4LF3A 5AL0A 2ZCKL 3FH5A 3L13A 4MCZB 3AG4B 5DFVC 4WO4C 1PBYA 1FL3B 3UGEA 1OOWA 5MI0B 5GS2D 4FA7B 3HVNA 5F1NB 1BEYL 4PRAB 1A21A 2HVBA 1G6RA 4EZKA 3RU8L 5ACLA 3ENEA 3DSFL 3HRZA 4HUXB 5MENE 1KCUL 1RJLB 3CLFL 2E5EA 4PRBB 4NUGH 4BFGA 4JCLA 4LSDA 3APDA 1F1AA 4KXAA 4JHAH 4HG4J 4Z78B 3WFCH 3WE1A 3LZLA 4GAGH 3VE0A 4QRPA 1N8ZB 2VSCA 4GXVL 1U2HA 2YD9A 3OSKA 4RCAA 3GZPA 4UQDA 4PBXA 4XNYL 2VT0A 2WCSA 4QJ3B 3NFPA 2EXYC 2X4TB 4KZ0A 4OZGB 1XDTT 4B5ZA 2E8YA 2CRYA 1CXKA 3CJJA 4QPEA 1QSVA 4FFVC 3W3BA 3CU7A 1OAKH 2I60H 2UX7A 1V55B 2BCMA 3GSOB 1CVSC 4CW1B 4QT5B 4G8GD 1S2EA 1AC0A 2QVTA 1UYWL 3G6DH 2X0UA 5E99L 3RNKA 4NRYA 5A6LA 1SLVA 3EYFA 3PWJA 3U48A 3BFWA 1KT2A 4OIFA 3O81A 2ZF8A 1F90L 1Q9KA 3KPQA 3VFTA 2EADA 3B2PA 4N2KA 3HA0A 3C12A 4G6AD 4MA1B 3ULAB 5FS5A 5DHVH 5IGXH 3BWUC 4W9HC 2IH9A 1NAMH 2L0DA 5GGVY 1QRND 3ES6B 1S7WA 2C3VA 4FXLA 3WI9A 5C07B 5IW6A 4NQUA 1WG3A 3IVKA 4NOBA 3T2NL 2JKWA 3KJ4C 3MR9A 4NBXB 4BM7A 1MJJA 2DIJA 1CDCA 3D4ZA 1R3LB 4PJGF 3HIZA 3RX7A 1I9RL 2J7LA 2ZXQA 4KDWA 1XF3A 1H8LA 3RY6A 4LCIL 4PV9B 2NYYC 3S3BB 4AXWA 3QJZA 3WUZA 4N8VB 3SGKA 3NJKA 3VG0L 4M62L 1HOCB 2Z7ZA 4RVBA 1FHGA 4NAQA 2WWNA 5D7SH 3EJSA 5T3ZD 4JY4A 1X5HA 5LHDA 1E8YA 5LBVA 1OAZL 1QVOB 1U36A 2IC2A 2JXMB 4HUMB 5CSGA 5I28A 3VXUB 1SOXA 4KXCA 4MB5A 3M1CA 5DUBA 2JTDA 3KLSA 1A6TA 4EN3D 3HNSL 1NEZG 1KCVL 2J5LB 4I0PD 3FSVA 4IOSA 5EU3B 1C16A 1F58L 4W9CC 5FKPB 1RZ7H 2ITDA 3B9KD 4HEPG 4V1DA 3ZJAA 4AQAB 3D25A 1U8KA 2EIBA 4J28A 2DJSA 4U6VL 4BSJA 1JWSA 5B7FA 2B2XH 5I5JA 3G08B 1EBAA 3ROLB 5C0IA 1SGKA 1UURA 2UUDK 4JDVB 4UNUA 3ILPA 2A1WH 5I0ZA 5IQOA 4MB4A 2LLGA 1UADC 3BGFB 3JTSB 2J25A 3TBSB 4JFDB 3MLRH 4R97C 4YX2L 3VFSA 1JOIA 3L95B 3BAXA 1RJYB 4IM8A 3IE9A 3JSSA 4V2BA 2ZQKA 2DQGL 3GXDA 2CR6A 4Y1SA 4DP7X 2EAEA 4L18A 3UFIA 3UMNA 4K7PH 4WWKB 4YHIB 4Y16D 5DVPA 4RGOL 4PJ7E 5CXPA 1QTSA 2A9MH 4LOVA 2GC4C 1A9VA 2DWDB 3Q6FB 4PJCE 3NRFA 2R4RH 1GJUA 2EE9A 2G5UA 3PDOB 3MNVB 2KT6A 3WAKA 1USQA 5E6IC 5J7CC 1OCCB 3DX8A 4J2XA 4Z0XA 3ULVL 2VCOA 3HCVB 2Q3XA 4P5MA 5ENWB 1TTUA 5EBWA 4TNVK 4D0DB 3QUZD 1JF5A 5T1LB 4MCZA 4YWGL 5CKGA 3UG3A 5I17A 2VDRB 1XBRA 4O02B 3FB7A 3LIUA 1K9TA 1QLEL 3E80A 2Z65C 4E9YA 4PRAA 2P80A 1N67A 1YQVH 3B9EA 1V7NH 3QR0A 5AW3B 1ZA6B 1WV7T 2EDHA 1HIML 3BP6A 3SQOH 3VXMD 7PCYA 5J11B 3C5ZD 4ZOBA 4FQXB 3E6HA 1ZSHA 4XN9A 2HT2D 4H2CA 4OLVH 4NCC1 5J0BA 5KN5A 2ATKA 3NJXA 4LIQE 4WEBH 1A4JB 3ZDZE 4K5OA 3W0WD 5EF2A 2G2NA 3OMNB 4QO1A 3ASNB 3ARQA 3LEYL 1OVZA 1RUQL 1QTPA 4GMTL 4Z78A 4YSTA 2Z0UA 3VQ2C 4P5KA 1CYXA 3LHPH 5I8KL 1J5CA 1N8ZA 1OSZA 5F0LB 1S7XA 4PBVC 5ID0B 2Z31D 2X7LB 2OYPA 4GI6A 1AQKH 1XBDA 1V54B 4G5AA 3V6FB 4ORGB 3WFHB 3BGAA 3SHSA 3W57A 3I02B 4YGVB 1OY3B 4XVTL 4B9YA 4M6AA 1W80A 1X5GA 4WY7L 3D9AL 4O9HL 3ML8A 1UC6A 2P3YA 3IDGB 3WDHA 3UO8B 2K7PA 1NWOA 2F8OA 1MN4A 2F54A 2VYRE 4XHJC 4Y4HA 4J2QA 3NJJA 4YNYA 3T6WA 1T7WA 5E1AA 3BPOB 3V0EA 2IGFH 1NIBA 4QHNA 5ALCL 1B2WL 1C12B 5IVXE 2NR6C 3D12B 5E6ZA 4POYA 3L9BA 3N43B 4QJ5B 5T1MA 2JB6A 3Q1SH 1CC3A 4YJZL 2R2EB 3MLSL 2APFA 4F15B 4KO6A 1ZLVH 2C9UA 4GG6B 1UT2A 2Z6FA 3ZDXB 4XZUA 3U9UB 4XWGL 3NFNA 3GSQB 4APQA 5LKNA 4EF3A 2Y2WA 4N8VA 1HOCA 2NSQA 3BUYB 2E6JA 2J8UF 4MDRA 3SDDC 3BQUB 2FJUB 3LXBA 3PV6A 3UTSE 1E67A 4ERSH 4KMLB 2OI9B 1QBLL 2XJKA 4GW1B 3T4YA 3DK0A 1KDJA 1F3RB 2YPLE 3VXUA 3U83A 2EDJA 3H9HB 4MRBA 4RBPH 1JYVA 2P5ED 4WWPA 5FYLD 1TG8A 4PJ5B 5HSFA 1CFQB 2VDKB 5FKPA 4AQAA 2Z9TA 3VFPB 1H9VA 2OV0A 5MEQB 1E6JL 4AQ8C 2O5NA 2AK1H 4P23D 3F5WA 2Z64C 3G08A 3MU3A 1M3JA 5E56A 3ROLA 3VB8A 4HETA 3AUWB 1CF1A 4JDVA 3BH9B 1VA9A 4Q6KA 3JTSA 4TVSa 2PYFA 4N8CL 1TUPA 2NY6D 2YAPA 2PTUA 3Q2VA 3CN1A 4FQCH 4KKQA 2KH2B 5F9OL 4WI0B 1OE2A 2YGQA 5EIQA 3GM0A 1LEGA 3ZE1B 4MAZA 5EUOE 3HZKB 1LDPL 1U8PA 2BVOA 4YHIA 2Y07L 3TZVC 3P73A 1NIEA 1MIMH 4EI5B 3P2TA 2NNCA 4UQCA 3LRMA 1CT8A 1NKRA 1A6VH 3ROOB 2XWBA 1TNNA 4OZFG 3BCFA 5C92A 1ZV5A 1AZUA 4JREC 5CEZE 3MNVA 4QTHB 3QRFM 4WI3A 4HGMA 5FHAL 1LO3L 2VMFA 4CMHB 4D7PA 4IBSA 5IV2B 4ZMLA 1KEGH 2BZDA 3FQUB 1I31A 1FNGB 1HCYA 1XGYH 1SJEB 3OJ2C 3WEMA 3U7YH 4D0DA 1BJ8A 3CFMA 4OSUL 3BUPA 1A7OH 2WOBA 2YJQA 3OKEB 3BZ4A 2EO1A 2ISDA 4GS7C 2F7OA 2QPUA 1Z3GH 3Q9QA 4DT2A 5J6GA 2EVHA 2EIDA 1H3XA 5JHLL 5KVEH 4NC2B 3VFVA 2E7LA 4HAGA 2YK1L 4FQXA 4JPIB 4DVBB 1TJHH 1L9MA 5DHVB 5FA4B 5IK3B 3U36B 4YHYB 4KK9D 1NAMB 1HJCA 1OPGH 4QXGL 1KPRA 4I3SH 3AM8C 2BY0A 1KFAL 3ELAT 4H8UA 5D1XD 1RIUL 3VGHA 4FFYA 1UM5L 1AACA 5C0GA 2NY4C 1SLUA 2P24A 1WJ3A 2AQ1A 4GRLA 4ZX5A 5JXAH 4JK0D 2P43B 4PRDB 2HLAA 1MI5B 3A6CL 2F53D 5DRWB 3SGJC 3V6FA 4ORGA 3WAJA 3WFHA 2CQVA 2WTRA 3GMOA 5IJVA 3I02A 4NWUL 1A4CA 2PR9A 6PCYA 1S7SB 1LO5A 1OAYL 2AXGA 2FLBT 1CIUA 5PCYA 1KCKA 2VR8A 2V8MA 1X4YA 5KVFL 1RUAL 1PZUB 1DVFA 2FZ3B 1UACH 3FU0A 1LEKB 4NQVA 5FO7B 3E3QC 3BSZH 3HC4L 2IAND 2DKMA 4FP8L 3NCJL 3KPNB 4WHYG 4Y7OC 1WWWX 3VUAA 5AENA 1F00I 3D0VB 3L2MA 1E28B 3GBNL 3OVUB 1IM3A 4XO9A 3STZA 1KJVB 1FYTA 1E5CA 1E7VA 2LE9A 1HNFA 4GB9A 1KGUA 1PG7H 2FIKB 2E7CA 2OJZL 2TSAA 1RVFL 5HHMD 4ENED 3MJ6A 4LAQL 1FYHB 4UV4L 1CXIA 4KQ4H 5E5UB 3J07A 4IIQA 3SGEH 1AHWB 3KW8A 5D2LF 5IB1A 4OCRH 4XNXL 4CGUB 1FVCA 3P0VH 3V7MA 2AERT 4LARH 4HBCH 4JM2F 3FN0L 4W9KC 5BVPH 5J8OA 2NQDA 3Q48A 3HLKA 1NL0L 4HFUL 4MMXB 1MWAH 1QG3A 1WD9A 1W8NA 2ZWNA 2AJVL 2WBJA 1U42A 3HHSB 3V4LA 2PR4H 3HAEA 5TDOB 4WWNA 2EIMB 3E9UA 3HB3D 3PHSA 4U3CA 3U2GA 1ID2A 3M1BA 1X5JA 3ESPA 1L5GB 2Q87A 3UAJC 4APXA 4ZFOL 5HYEA 1E9OB 1T89A 5EO1B 4EXKA 5KYYA 1RUKH 4GRWH 2DYPB 4PIRF 1TZ8A 3V4PA 1RQ5A 3WNLA 3OPZL 1MG2C 3OAZH 3LNDA 3T09A 3D69A 3ZKND 4UYPA 4M5SA 2FE0A 4PJ5A 4C56D 3H42L 2BP0A 1G6VK 1ODAA 2VDOH 3PAVA 4XPTL 4DKFL 3LPWA 1ZGLB 2YA0A 1HCZA 3WCYA 5ILTL 4FQ2L 1NMCB 4S2SB 4QRRE 1AANA 3FXIC 4HUCA 5I24A 5IQ7H 4JHBA 4LLYB 3QHTC 2IQ9H 5E1IA 5E00B 3NSDA 3MUZ1 4DEPC 2F15A 5KJ7E 2E27L 3F6IA 3ULUE 1B0RB 4H88L 2DW5A 4MNGB 2C26A 1AMYA 1EXGA 1G84A 3T6VA 3HZKA 4KXZH 2BNRA 4XXCC 4GAJL 2WQRA 4EI5A 1LJMA 4N2CA 4EVNA 3NIFB 2CBQA 5IQNA 1HSAA 3DO7B 4QWWC 5F88A 1UZ6E 3B3IA 4JRFA 5HY9B 1EXUB 4MJIB 3O8XC 4L9LA 2IALA 2P47B 3FFOA 1IKFL 3A6BH 3P3TA 4KY2A 2DM2A 2DQUH 1FNGA 2NQ3A 2EZ0D 4QF1B 5T1DH 3CFDB 2MMXA 3CSTA 5TQ0L 1GGIH 2W0PA 4A1RA 4YAQA 5B8CC 1RFDL 2MNWA 4UTAL 4GXUN 3QJQB 3UZEA 3KYNB 1FP5A 1XH0A 1QFUH 2AQRA 1RK7A 4I0PA 5SV4A 1KJ3L 1JV5A 3OR6B 5FGRA 1WCBB 3WIFB 3ZXAC 3TGXA 1SOQA 4PEEA 2AJ3A 2ICEC 3CH1A 4DVBA 3U36A 5AG8A 4K7FB 4KHTH 3Q2NA 3MYJB 4F2FA 4JO5A 3VXSD 1AGEB 4BWWA 1TQCC 4CVWA 2QL1A 4J4PA 4M43L 4JN1L 3U1SL 4Y19B 3EKCA 5FWQA 5E6YA 5C0AB 3VI3F 2V4LA 1CICD 1D7DA 5J13C 3NJFA 1RLBA 5GRVK 1MI5A 3CSBA 5DRWA 1IFHH 2NXZC 4Y16A 3QQDA 2G5RA 4LBEB 4HCRH 1A1OA 1ZLVK 1E8ZA 2DD8L 2GUOA 4RA0C 1VFAA 2CO7B 1IKOP 2BP3A 5EC1B 5HJ3A 2IMNA 2XWRA 3ZKSD 3IJYB 2MIZA 1LEIB 5IB4B 4Z8FL 4CN4A 1OZUA 1JXDA 2COQA 3RDJA 1JK8B 2ATPB 3IXTB 3FTSA 5TFSL 1YZZA 1ANUA 2VRAA 2DQIL 3KPNA 4BFOA 4HIHB 1BVLB 1EBPA 3D0VA 3QUZA 1U95A 2YBRB 4P57A 3GRWL 3EFOA 4RISL 4NN7B 2R29H 1E40A 1N0LA 4N6RB 2FECL 3IJEA 4MGXA 3H0TA 3V5DA 4YHLH 4DAGL 5LG6A 3DYMA 4GAAA 2VL5A 2QSCH 5C0JB 3NRQA 2E59A 2YD0A 4X5WB 5L9DH 4J3OF 2QVIA 2P5WE 4OLWL 3QQXA 4P9HH 1JGEB 3WY3A 3NCBB 2C4XA 3CVCA 4F3FB 2VXUL 3S8GB 4XMZA 4GOSA 5IKCB 2WVTA 1CE1L 4GY4A 3W0WA 5GRZA 4MMXA 1QUPA 4R0LA 2OMYB 3FUFA 3HG0A 3HHSA 5E8DH 5FO9A 3ZYJA 4XGZA 1HI6A 4JRYD 3TN0D 1P7QB 2UVFA 1MHEB 5TDOA 4YQXL 1NC2D 2GITA 4PREB 2YPVA 4WVRA 1VCBC 4HWBH 2Z31A 5I1GL 1PCXA 4ZFFB 4ZTEA 4HLZG 1E9OA 1GCFA 3QPXH 5KSUA 4A37A 2W81C 4OVUA 4NXKA 4KTEH 1ECYA 2UXTA 3MGOA 4CADB 2WLHA 4K5LA 3UPRA 3CDGB 3N1GC 4GRMB 5D7IB 5DJAB 1E50A 1I8AA 4FNQA 2A99A 2FQDA 3JXAA 2DQHL 2QSVA 2NZIA 2TRHA 1JZ7A 3MLPA 1ZGLA 4OCNC 4CDGC 3FFCB 4N2NA 3KD4A 3UTPD 4K94H 1MELA 1MPAH 2YJLA 4H8VA 3V4VL 1H8SA 4F2MA 1PJ9A 4PP1C 1CLYL 5E00A 2NNAA 3N85H 3WNKA 2VLME 2FEJA 4MNGA 1WTLA 1SFHA 2NNXA 3Q13A 4YSQA 3KH3A 4M8QB 4G1EA 5I23A 4IS6B 5HYIA 2ED7A 3CVBA 4ZMAT 1KTDA 3WFEH 3WD5H 3MLZL 1WRFA 5JIHA 3PP3H 5E4IA 1CLOH 2BH0A 4K71C 3DO7A 2PYEA 2CU9A 1HEZB 4BQ6A 4X42A 3WTSA 2YBGA 5AQ0A 4YPJA 1I1FA 5LGHH 4GAYA 1OCWH 5HY9A 4OM1H 3IETB 2G4GA 3F58H 4MJIA 3LRHA 3S96B 3B5TA 3FYIB 1H6EA 1YJDH 1IFGA 3ALWA 3MJ9L 5DYOB 4KITB 1VFBB 1X5IA 1D5BA 2XZAL 2ZOTA 1W0VA 3F84A 3MXWH 2PPDA 1JPSH 3LNFA 4WNSA 4N1EA 4KVPA 1A9EA 1AR1B 4P2RE 4MDIA 3MV8E 2YIHA 4PS8A 4A04A 3ZR6A 5E4EC 3QEUB 4X8CA 3X13A 3MSPA 2XN2A 3NZUA 1SXBA 4WO4D 4E42B 4F9LA 1DDHA 3PUUA 4PJ7F 4K7FA 4P23A 1FRGL 3O11B 15C8L 1KENL 1BLNB 2CIIA 3BH8B 4PJCF 2Y06H 3FQRA 5BUAA 3CBRA 3JV4B 2WWMD 3HLAA 1MCEA 4RIRB 4LHUB 1BA9A 4LL1A 3TA3B 4BXSV 1Z5LA 3RVXC 1TXKA 4G43B 5BCAA 2A0LC 3BRDA 2YD1A 2OMVB 1G7JA 3QO0A 4KO5A 2OL3H 3KYOA 2AKRB 5AVSB 4GKSB 3HMXA 3ARBA 3MREB 1EFXB 4PWHA 3EAKA 1J0YA 3EH5B 2D2OA 4QRPE 3SY0A 4KAQL 3KYAA 3E0GA 4U1KB 1O5PA 1JRHH 1M6OB 1SDDA 1DJHA 1XR8B 2F0CA 3O45B 4H0IA 1P5UB 4JFOA 3HN3A 4GRWB 2EXYD 5KVMC 1UWEH 2PW2A 3LSOB 3OMIB 4XBPA 2FB4L 5DK0B 1HNYA 4FFVD 3H2QA 1GPOH 1KLUB 1UATA 2VDOB 2Y9RT 1BVLA 4HIHA 3ZDZF 4BBWA 1E3XA 2O6CA 2YBRA 3BCDA 3LZPA 5EEWA 4N6RA 3UEZA 2HJFB 3BN9C 1ETZB 3OAZK 3HR6A 5ISZB 5ERWA 4X4XB 1XGTA 4ZZKA 4QCIB 3U7WL 3V9EA 5IFJA 5AB1A 2H0FA 3IMRA 4X98A 4XTRC 4AQ1C 5JPMC 4AL8H 3RKPA 4Q9RH 5B1JC 3IK2A 1I1YA 3LIZL 3VH8A 1JGEA 1RPKA 4ZS7H 3PAZA 2JKTM 2XG4B 3ML9A 4JJOA 4NNYB 5ABZA 2ED8A 3I2CH 3TVMB 4F3FA 2HJKB 4RSYA 3A24A 3WENA 3LKRA 1NC4B 1OF2A 4M1GH 4V2CB 1AOZA 3OMZA 1PSKH 1UH3A 1PG7W 1GC1L 2FUTA 2OMYA 5F7FA 5HHXL 1NBZB 1OWWA 4L4VD 5AYTA 5HVHB 4U1GC 2NW3A 2NYZA 2CMRL 4XPFH 5J1TC 4W81A 4QTIH 2NYYD 1U8MB 5F9JB 1FSKB 5K5YA 4IW4C 5DMIL 5BNXD 4IMKC 1R3KA 1AS6A 2L7JA 4PGCA 1ND0B 5CAYB 1Z32X 4UT9H 4X83A 4S1QH 2IAMD 5BV7C 3H9ZA 1K5WA 4GRMA 5AYUL 2FQFA 3N1FC 5D7IA 5IVXF 3ARGB 4G6FD 4EUPG 1EJFA 5C0RH 4P06A 2X3AA 3QDMB 1IGML 1AG0A 3ZHNA 3ZYZA 4B96A 1A7NH 3IFLH 1QR1A 1HAUA 3FFCA 4N6QA 1WHPA 4ISVB 4RRPM 3LN9A 3OX8B 3BDYL 2APVA 1AZVA 3WFZA 5I16A 3QJXA 4V1DE 1G7LB 2EH7H 3IDMA 3GS4A 3VO0A 2JKLA 4LSUL 1VERA 3CZUB 2GFBB 4J8RB 3FB6A 4JFPA 4MX7B 4B3VA 1JZJA 3PV7A 3Q1EA 4WEUD 3QQNA 2NCMA 3D06A 2PWDA 1P84J 2ITCB 4U0RC 4WU5A 4N2DA 4Z18A 1N6QH 4LEXL 2ESVD 1VHPA 2F8VA 4P05A 3UMTA 3X12B 5DVNA 3DXAB 3RFZC 1IGCH 5B1AB 2GTZA 1HT6A 1FAIH 2IG2L 3MRCA 3WTVA 1CGTA 2DMCA 4A7GA 2Y1VA 5I8CB 4H26A 4OF6A 1OTTC 2XQ0A 5FF6A 3P30H 2G2RB 3MCG1 1XGZA 2YXMA 2HTLC 1T0OA 4KUCF 4HHAB 3T9WA 1BWMA 3MPCA 2JWYA 4UILH 4KROB 3FQWB 4W9IC 3W56A 3WO4C 2DQJL 4C56A 3E6FB 3QJFA 4PJFB 6TAAA 1U92B 5EUOF 2JKSA 3RGHA 2GSMB 4KUZL 2EDKA 5F9WC 2PW1A 4XAWL 2BOCA 3Q5YA 1KEMH 4WTXA 3MYZA 4NC0B 3BH8A 2GEEA 1NCDH 2CKBH 3M45A 4P2OB 4GAFB 4RFOL 2CDFB 1PX4A 3WYRA 1YNTB 2GC7C 3KWUA 3FQ1A 1RZKC 4L5FE 4ZFGH 1WZ1H 4MS8C 3CDZB 4OUOA 3T3PB 2AP2A 3CIAA 4NQCB 4M6OL 5DTFB 3VFGL 5HYQB 4KTDL 1EFXA 2H2PC 1I4FB 3RKDC 1KCSH 4Z6AT 3VW3L 4XB3A 5E2JA 1GHFL 2DJUA 1BYNA 3CXHJ 5DWPA 3W2DH 4LKCA 1BW8A 1EHKB 2ADFH 1FFPA 2HT4C 1ACXA 5KJ4A 4K7PY 1OF0A 3EBGA 1MJUH 4S0HA 3H3KA 3LPOA 3DI3B 4TVPL 3BAEH 1FFQA 32C2B 1KN4H 5D1QB 4F58L 1MLCA 3SKJL 5F0PB 2Q76A 3RTQA 2F54E 4M61B 5FB8A 2ZP9A 3CBKB 2CO6A 2N4IA 1ETZA 1G9NC 4X4XA 1VACB 1DQMH 5I18H 1U33A 3D0LB 1P2CA 3IBEA 4NNYA 4CA4A 2I9TB 4YHOL 2NR6D 5CLXA 1JZFA 1NC4A 4JKPL 4UM8A 4K8RL 4AEHH 1IVLA 2WINA 4LSTH 1QHQA 5DQ9A 4HWUA 4G80B 4UTBA 2N7SA 4M4RA 5D6DA 5H4YA 3TBBA 5F0MB 5DD5H 1ERNA 3KS0H 2OMUB 4YLCA 1U8MA 5F9JA 4N2HA 5CZVL 2FJSA 2PP9A 4XCCH 2Q6WB 2WKOA 3CVIH 3SDDD 1ND0A 4M6ML 4JFQB 1YEFL 1E6OH 3Q6GH 5HYSB 3WUWA 4NKIH 3TFKC 5IB2A 4IKKA 3TH2T 3ARGA 2YD6A 4OD3L 2FSEA 2X9WA 3RZWA 3VXUE 4N3UA 2LABA 5C9JB 1KG0B 3D39B 3QUHA 1DBKH 1NBYA 4HS8H 3S98A 4ISVA 3OZLA 3RBGA 4RQQA 1SJHB 5ESVA 3EOAB 5MEOA 4H25A 3UP1A 1OD7A 4OF5A 3CBJB 1FG2A 5FYJH 3QUXD 3JYCA 4UZSA 1LK3H 3SDCB 3PCYA 1I8KA 1KLGB 1DFBL 3O3BB 1NPUA 1WFOA 4NYLB 2V5YA 4HJSA 4LSSL 4AM0A 1F8TL 4KWUA 2D9QB 3GM8A 1JDAA 4EDXA 5GIRA 3DX9B 1HHIA 2OL3B 2V9RA 4FCHA 5A2BA 4C8XA 1DLHB 2F5BL 2O61A 4PGBB 3TZVD 3X12A 3MNDA 4Z3HA 2JSFA 1PZSA 2CJUL 2VLJA 3JWDL 4JRYA 5I1HL 2X40A 4MWFB 5C71A 1JDDA 1Z7JA 2DI8A 4WUKH 3VWJB 3V7AG 5L4JA 3PF2A 1ACYH 1LO2L 3BW9B 1VGKB 2W95A 2X0VA 1AIFB 2I9LB 1P7BA 1XGUB 1EEUA 3MRHB 3VCLA 3RWHB 3ULUF 1QFPA 3V0DA 3UCRA 2D7TH 5EO0A 1U4EA 1BFOA 3E6FA 1U92A 3B6SB 4OBSA 2IOIA 5B3SB 3GMMA 1YEKH 2W5PA 5IQMA 2BIPA 8PAZA 1F45A 1YN6B 1URIA 4W9ZA 2EEXA 2NY0C 3DROB 4JY5H 5H4ZA 4H7VA 4O58L 4W9JC 1UZ6F 1DANT 2XKUA 3MACL 5IT2L 3KLHC 4RA3A 5KVGL 5TQ2H 2ZTBA 4K2UL 3QFDA 4M48L 1H15B 2VR9A 4CC4C 1RZJH 2YRZA 5E23A 3ARDB 3OGOE 3OB8A 1DQLL 2BS9A 5AB2A 4R97B 5CWSA 5HYQA 2QEJA 4WU7A 3FBKA 4NCC2 1VPOL 2WVUA 3WLWD 2WNWA 4Z7NB 5F3FA 1FC1A 1JWMA 3QJRB 1E27B 3OAWA 3BSHA 5J6HB 3TT3L 5TGBB 1A7BA 5T5FL 1FN4B 3GSUB 5LUMA 4X5QA 1YY9C 3DHJA 4H0GA 1TZHA 1BQHA 4W6YB 2WYHA 4F1ZA 2EEDA 3KPOB 2R1YA 4QHUA 4XX1E 3VGEA 5D1QA 5HYJA 1K85A 5FLUA 4BHUA 4NWTH 4PJ9A 2H2SC 3CH8A 4BEIA 3F8UB 4M61A 2FJGA 5DO2C 2NT0A 2VL4A 3NA9L 1J87A 4QKTA 3PE9A 4FG0A 3W1ZA 2WXJA 2J57A 3PNWB 2JCCB 1FYTE 4WO4A 1NINA 1B4LA 4PR5B 5CP3A 3JWOL 3RDTC 3QYMA 4Z0BH 3G6JB 1UQSA 1UVQB 4JO4H 1VEOA 4P4KB 3TO4B 1WLHA 4OCSL 1LO4L 4TSAL 4OLZL 3T0EB 4Z3GA 2XCMC 4Y9GA 3RL2B 2BERA 4N2FA 2Y36L 4RGMC 3E1F1 4BKTC 3BAIA 1J10A 3I50H 3QUYB 3QJHB 3OPUA 2MQ3A 5DXWA 5IESH 3QPQD 2CBTA 3C8HA 3RVUC 4B50A 1BLIA 4LCVA 5CMAB 4AEIL 5GGUA 4WNQB 2GBAA 1R5WB 4NZUL 1F6LL 4CU6A 2YFOA 1U58A 2Q6WA 1S7RB 4JHZA 1IO4C 1W15A 2GB2A 5GISH 4WGWB 5HJBA 1AKJB 4A2FA 1MCCA 3O3EB 2H3NA 5LVEA 1Q8MA 4HDIB 1J9SA 3FCSB 1OAXL 3D3VB 3N44F 2X3BA 3AT9A 3WE6A 1SXNA 2EDOA 2DWYA 1P4IH 3MRQA 4PJ5E 4PJAA 3NUKA 4O02L 3HG1D 1OSYA 2IFFH 1JVKA 3NJVA 3GTNA 1ONQB 3K6NA 4HUKB 1J9TA 3K5SA 1DVUA 1XT5A 4MJJA 2H0JA 3SYQA 2VSMB 3O3BA 4M5ZH 2CKBB 1QEWA 2KDGA 4NYLA 4KHXL 3VYPA 2XSKA 4ELMB 4XP6L 1P4BH 2BW5A 1J8SA 1VGEL 4BQ8A 2CE6A 3F85A 1AXIB 3TJEH 5I75B 1BM3H 2ZG1A 3QNZB 1I3GH 1DQDH 1FZMB 4U3SB 2BNRE 1DCEA 1B0IA 2Y3AA 4L4VA 5GJSH 4MWFA 3V4UL 1NGQH 2K6WA 1A7RL 2X9YA 5I9QB 1BP3B 3GO1L 3V0AC 3VWJA 3K8KA 4QWWD 5CCHE 1UCBH 1PZDA 3O2WL 1J5HA 4Z7UA 1AIFA 1JWUB 3NJMA 4BQCA 3FUHA 5T3XD 1XGUA 3O8XD 5EZPA 3QAZB 4XMVA 4QLRA 1PKQA 3RIAK 5FC9A 2UX6A 4IBZA 1CFBA 3ALXA 5AW7B 35C8L 3KGSA 1YN6A 1LNUA 2XWZA 3NYKA 3DROA 2YGPA 2IWEA 3OZKA 1KXHA 2X4NB 1M1XB 2OTPA 4XN5A 5E2TH 3ZE2E 3L3KB 3S5YA 3AS1A 3CZEA 4R2GC 3IJ8A 3G5VB 4ZS6C 5I0XA 2YWYA 1EVTC 4PGEB 4LCCC 3DUSA 1N19A 4OD2B 4R96A 4QJ4B 1W72B 4M7JL 5F7WC 3POCA 4N86A 1J9RA 1AYRA 2MRYA 1EIBA 2OSYA 2Q8BL 2UYLA 4RMSA 4XXDA 1FVEB 5C7XH 1MI5E 2IFGA 5FYKD 3QFJB 4KNUA 3GXIA 1MCBA 2NXZD 3UBXA 3MV9B 2JELL 1FN4A 1U8HB 5F1SA 3MRDA 3SD2A 4FX5A 3GIZL 5FHBH 2BVYA 3KPOA 4D9RD 1QSEB 5E6IA 1NZRA 4JS7A 4BXVA 2C7UB 4M1CC 4YDLB 4ZMVA 1RKRA 4J1UB 1U8IB 5BRQA 2EYSA 4W9EC 5GS2H 3S35X 5JPNB 1G1OA 3PFQA 5DMJB 4X7EC 2VN6A 1TO4A 4TV3A 3DRQA 4TQ8A 4NI6A 4B7IA 1G4RA 1XEUA 4TUJA 3BPLC 5FECB 1NKOA 2FX7H 2YD3A 1UVQA 2VKWA 1MZYA 4JJ5B 4JANB 3DDFA 1E5ZA 3O6MH 3OL2A 3T0EA 4AKQA 3RL2A 4NUGL 1QW9A 4XNUH 2F08A 4PY7B 1EO7A 1JXKA 3QUYA 3QJHA 4XOBA 4Y1AD 2FD6H 3ETBF 3BISA 4JHAL 1FUNA 3UYPA 3WFCL 4F7EA 2CBOA 3LEVH 4GAGL 3W0WE 2JIXD 1X9RA 4FYRA 4LOEA 1R5WA 4IBYA 4L1BA 1IGTB 1CI5A 4H0HB 4K5MA 1G9MH 2NY4B 1AE6H 1AKJA 1UHVA 4JZJC 2PCYA 3UBFA 2WLIB 4HDIA 4DP6X 3AY2A 1OM9A 5IIEB 1UWXH 4Q52A 4Z5RB 3SPVB 3CSGA 5KG9B 1VFMA 4OJYA 2DICA 2Y7LA 2NSXA 3G6DL 5IOKA 4DETA 4QI3A 3K46A 3DX7B 2DL2A 2BFVH 1SJMA 2E4TA 1P1ZB 1HHKA 5BZDB 4HUWB 3ZT7A 3PXHA 4MD5A 2CO4A 1CJYA 3AQYA 1J12A 4KKRA 5I1AB 5IGXL 4F2ME 1NAML 3S88H 2AVGA 4R4BB 4MNGE 5JQIB 2NR6A 1JL8A 2Y0SA 4H2AA 1NCAH 4JFED 2DLTA 4CU7A 1MW2A 1G7PB 3MNZB 4IKNA 2CCLA 2FUQA 4QXTA 1DANU 1PNDA 3NIFE 5DSCA 4FG2A 1F3DJ 1D7BA 4NKDB 5INCA 1Y7VA 1J8HB 4NBYB 4PV1C 1GGTA 5JMOC 2DOCA 2PYEE 3R18A 4IRSB 5GRXG 2A6JB 5I73C 1N70A 5DMGC 1GA2A 3MLVH 5JO5B 5D7SL 5T3ZH 1MCJA 4MJIE 1NDGA 4WKZA 3SDDA 2QPEB 5KZCB 1G1KA 2C9PA 2R2HB 4HZ1A 5E6SB 4ZG1A 5CLYA 3IWUA 2C9QA 1GVIA 1EJ6A 3LNHA 2UZYA 3FT9A 3VVVA 4ILDA 3U2SA 2EKJA 3HE7C 2QVFB 1RZ7L 1MLBB 1EDYA 2WWKO 2GJ6B 1D9KC 1KPUA 4QRUB 1OGPA 2PPEA 4LK4A 2WMPA 4QR7A 4YE0A 5I6XC 3EDKA 2B2XL 5JHDB 1BVOA 1E30A 1M1XA 3FTGA 5EIIA 1JNJA 4M3JA 2A1WL 3SGEI 3K2MC 4HYTB 3CFCH 3CZJA 3MLRL 4HJ0C 2DQEH 5ES4B 3G5VA 3P4NB 4BCZA 1XB3A 4OZHA 4ZMYA 3ECVA 4P4RB 1OWRM 1J1XH 4PGEA 4OD2A 1X5LA 1W72A 2OMXB 1Y6MR 2A0LD 4JFVA 4K7PL 3QR2A 1E4WH 1PLCA 2A9ML 3UTOA 3PFUA 5D9SB 2HT3D 3RJOA 4LEOB 3O4OB 2R4RL 2ZSWA 2NW2A 3QFJA 3TJHC 3TZVA 5L7XH 4F1SA 5L2KD 1MCPH 1N3NA 4LL9A 4GFXA 4PPTA 1CD1A 2WW8A 1X9QA 1M9SA 1F97A 4UAOC 4E0RB 5ESAB 3A23A 4XNZC 1AGBA 3QAQA 5JUEH 1QBAA 1FG9C 4DP1X 3MUHL 2I7OA 1AJ7H 1NGPH 1OCOB 3QT2A 1R4XA 2OM5A 3OXRA 3ABGA 3SKOB 2YEQA 2AV7B 4FERA 4HOZA 3HRPA 1JK9A 4ZYKB 2VDNB 3GHBH 2FX9H 3VXNA 4LPYA 3P9LA 3WN5C 1YQVL 5ETUB 1I7ZB 3WS3A 1V7NL 3B2UC 3D85A 5F7BA 3SQOL 4KKAC 5FECA 2HSIA 2WWOA 3BN9D 3UYRH 1JYWA 4JJ5A 3CN3A 2B1AH 3HVDA 1SF3A 1BOYA 3QO1B 4A2EA 4U7SA 3ZDYB 3T4AC 2B3IA 1T0MB 3ZUCA 3DOSA 4WEBL 1U2YA 4KXZI 5IB5B 4OI8A 4WV1C 3SE9H 1U8JB 1HDMB 2WXPA 3NTCH 2APBA 4MFHA 3KGUA 3RX8A 4ADIA 2YSTA 3EO9H 5D4IA 5FOJA 2XWXA 4FRWA 2ZWSA 3LHPL 4ZD3H 1BAGA 2EH8H 3ESVF 1ZSDB 1SF5A 5LQBH 1AQKL 1UD5A 3VXTA 3ZVVA 1B0WA 4HJUA 3ECWA 3BJ91 3KLLA 1IIKA 4WI2A 4DZ8A 1LTXA 3ZRCC 3VXOA 4AUUA 2CKNA 2JI1A 2OSLB 1QUNA 3CSPA 1BD2B 4OJEH 5DO8A 5LN4A 1XGPA 4FYTA 1KIPA 5IIEA 3MBEC 1XCWA 3AITA 1NWPA 3ULSB 3ZMRA 5KG9A 2PCPB 3AAZB 3QORC 1DVTA 1Z9NA 4YO0A 5FUCE 3G7TA 2W60B 1L9PA 2CGRH 5D7IE 4AQEB 3BX7C 2WZPA 4DCQA 1I9EA 4HIPA 5IR1A 1BZ7B 1P1ZA 1JF6A 3FFCE 5BZDA 2UY6B 1IILE 3K7UA 3LRSA 1G0YR 4U1MB 2IGFL 4TUOA 1QFWM 4NSKB 5IUSA 4P48A 3KVQA 1VZGA 2LLLA 1MCOH 2PN5A 4IEFB 1FA4A 1A3ZA 4YHMH 5GRVL 3DJSA 1EV2E 3MGTB 2A83B 3DIVA 3Q1SL 2OMTA 4HUNB 5E9DA 1XGQA 4UDUB 1I8MB 1G7PA 1KIQB 4XN8A 4BH8A 4NPYA 3KR3H 2ICCA 3O3UN 3BEWA 2WN2A 3D48R 4Z7WB 4KQ3H 2C1PA 1AP2B 1SJVA 1U30A 1X5KA 4FA8A 1KV7A 3MLWH 4MAYB 1OARH 4KRPC 4N5EC 1JN6A 3WTYA 4IRSA 4L37A 3QULA 4PGJA 4ERSL 4ZW8A 3C2SA 4MDJA 3TTSA 1RK1A 3CHOA 5C6TH 5GHWH 4JN2B 3O4LB 4FLQA 1D7FA 1NFIB 5C1MB 3FUIA 1N6UA 3R06B 4CVUA 3G9VA 3UAJA 2NT1A 5FYLH 4F7CB 4X6DA 5FKAB 3EG9B 4U1HB 1C1EH 4YSOA 4ODUB 2M8XA 5DQDH 4QD2E 5AZUA 4NO3B 4QRUA 2GJRA 2AK1L 4C56E 5C97A 3TM6A 3HG1A 1JV2B 4LLQB 5C09B 4ZUSB 2R69H 4NN5C 4IU3A 5MHSD 2ENJA 2RHEA 4FQCL 4HULB 4IGBD 4R4FH 4U6XB 4OJAA 4TNVF 4YFEA 4PFEA 3IDIB 1MIML 2B16A 1BIIA 4K3JH 5CEXA 4OLYH 3DUUA 1A6VL 2F6AA 4XXCA 2LAAA 1MFEH 4RDQF 1NCJA 3D4CA 4WFED 2FJHA 1EO8H 3RKDD 4K15A 5ESAA 5DJ2B 5DRNA 3RI5F 1SVCP 2EYTB 5ITFA 5H2BB 3ULVC 4PCKA 3AACA 1KEGL 4G8GB 5I1JH 1IC4H 3B9DA 3LRKA 1V27A 1XGYL 3UAAA 1M53A 3U7YL 5BRPA 5KBPA 2X4UB 2PCFB 3QXVA 2QHRH 3KH4A 4ZYKA 3IGLA 2HB0A 5DHXB 1Z3GL 3F7QA 5CLTA 3WXWH 1IBGH 4XC1H 1UWXK 3GMNA 1HHGA 3M7OA 4BIKA 5AVTB 2NY1C 5KVEL 2NUTB 2AQSA 1NQBA 1KELH 3QO1A 4QY8B 1TJHL 1R75A 2XN0A 3C2AH 4BRVA 2P8PB 1TMQA 1T0MA 2X12A 5HI5C 4MZ2A 1NBQA 2ENQA 1OPGL 2VERA 1SHMA 3G5YB 3RVWC 2BVPB 4I3SL 3RWDB 1NGYB 2ICEA 2VDQH 4BH7A 4ZAKB 4Q56A 2OCCB 4N8UA 3UBHA 5KSVA 4ODHH 5IROD 2EICA 1YLBB 1UUNA 3GTTA 1FH5H 5JXAL 4JPVH 1ZSDA 2BO0A 2PO6C 4OFKA 3BWZA 2AGJH 4E5XG 1IL1A 2WZ0A 3GZQA 3BZEB 5A2IH 2F58H 5D1ZD 2WP3T 3ZGHA 5C08D 2YN5A 3WHE0 1XWVA 2OSLA 3PWVA 1DSYA 1EDQA 3QWOA 3KCPA 2PCPA 1GGBH 1N5AA 2DH2A 5H37G 1UACL 4Z7OE 3QNXA 2ZUVA 4EN3B 3TFKD 2OP4H 3BSZL 4KJYA 3Q2CA 5EDXA 5BMFH 4XVOA 3N43F 3FTUA 2I69A 2UY6A 1EEZB 3NCWA 3SSGA 2AXWA 5ICXA 1Z0NA 4X7DC 5HYFA 4UUJA 5B3JE 4JG0H 1FV1B 1A02N 1SEQH 5AOMA 2VQ1A 2JKNA 1PG7L 1R3IH 4AGNA 2FBRA 1G5AA 5E6UB 4KQ4L 3QG7H 4DEUA 1HSBA 3D33A 4A67A 1KIRB 1QSFB 2APWA 4OCRL 1CDUA 3BLBA 2B7DT 3P0VL 4RMVA 3TWYA 4LARL 5HGGS 2NZ9C 1OHZA 4HBCL 3GBLA 4LSVH 5BVPL 1ET5A 4KY1H 1UOKA 5HXMA 1ET7A 1NOLA 1BG1A 1AP2A 1MWAL 1D6EB 4MYWB 1NUNB 4Y1AA 2PR4L 3LDBB 1JRHI 4MAYA 4O5LH 4ADGA 3E1ZA 3VA2C 5K9KB 3WN6A 1HN1A 2VLJE 2R59A 4JRYE 2E9GA 5F97E 2FGZA 3VQ1C 4M7ZB 3K6IA 4L4TB 5IM7A 4EI0A 1RUKL 2NDGA 2AAAA 4XRCB 1MFAH 2MH4A 5FKAA 3EG9A 1LWJA 1MFUA 2WBXA 1ZE3C 3CFNA 5TE4H 1T21A 4NO0D 3MJWA 2VDOL 2QQLH 1QNZH 1B0GB 1BZ9B 2EEBA 4PSRA 1AQ8A 2VR3A 5C0EB 3L3DB 1OOAA 1JV2A 2WB7A 4P3CH 4JGMA 1TENA 4GP4B 5FCUH 4HAFA 5IQ7L 4LOUD 2NX5D 3F7KA 4FDWA 1UASA 3CGTA 3O6FC 2HJLB 5K1NA 2Z1KA 4Z7VB 1KJ2A 1XEDA 2IQ9L 1O9ZA 2XOTA 2YPKA 1FGNH 1ZTXE 3IJSA 3NABH 4ONHB 4K23H 4ZTPH 2A6KA 4BZ2A 1DSFH 2EP6A 2NY0D 4I89A 3NZHH 1XTLA 3QEHB 4U6XA 4X8JB 4XMXA 2Y7QB 3JYBA 5K9OB 4PRIB 4J3OG 2A6IB 4LESA 4ODBD 3KLHD 4FFZA 4TM9A 2D7PA 1G7HB 3II1A 5FXCH 3BZFA 5IJKC 1GKOA 4JFEA 2MCG1 1MCNA 1TDQA 3AS3A 2Z7UA 2FHFA 4WTZA 2RFXB 4FG6C 2QMJA 1XD1A 5AOLA 1IZJA 2OJEB 3IDUA 1WLGA 4OU3A 5FFOA 5LBSH 1JZEA 5H2BA 2KC0A 3P0YH 1KYOK 3A6BL 4G7VH 3QIWC 5G55A 2DQUL 5JA9A 3ZQXA 4Z1PA 2MKLC 3ZHFA 3FRPB 4F80A 4Z95H 1JVOA 1H8NA 2Z8VC 2X4UA 2VR4A 2DI9A 4J3TA 4U7KA 3ZE2F 1T1XB 2NYKA 1F18A 5HYJE 1QFUL 5D1QE 1A2YA 4AJWA 4MCYB 1WH0A 2G9HB 3LKNB 3CHQA 2GTWB 3QHZH 4OIAA 1U21A 5IBUB 2H2SD 1FGVH 4MB1A 2NUTA 5KEZA 5CGTA 4WFGE 1UD8A 3B43A 3EGXA 4MCNA 5ACZB 4KHTL 2Q10A 1HXYB 3L8QA 4YL9A 1I8IA 4KZDH 3VFOA 1NCWH 1JUFA 3G5YA 3RWDA 3HE6D 4FQQA 1P5VA 4FI6A 3RDTD 5L8JB 3OJDB 3TJPA 4X99B 1KB3A 2FT7A 3GINA 4PCYA 1TZAA 1I3UA 1N64H 1PGRB 1IFHL 3IPBA 3QEQB 1TEYA 2NXYD 4HCRL 2WXRA 3O41A 1UH4A 4ZPVB 4Z7QB 4NQDB 5GPRA 3KPSB 2V2XB 4HU2A 4MNQD 4AT6A 1GKEA 3H7BB 2NMSA 2CHZA 4NZDA 1MCIA 2WXLA 4AGOA 2P5EB 3F62A 4QAMB 2CUHA 3WOVA 2XVLA 1JNNL 3EYSH 4AYBA 1S7QB 3AU1A 1RK0A 1IGYA 3GIVB 1X5MA 3S6CA 2EDXA 3VRIB 2CDGB 5DS8B 2YMTA 3LN5A 4I9WD 3T65B 1WHOA 2GK2A 1JZ8A 5CLZA 1TU2B 2EXWC 2Z92B 4PJHB 3MO1A 4PJAE 2R29L 5C0ND 1KTKE 4JFZH 4AYFB 2CJ3A 4YHLL 2PTVA 4X5RA 2QSCL 2XXCB 1UWGH 2CCWA 3KBHE 3KLAA 4QOKD 5L9DL 1B9ZA 2NY6B 3QIBC 4P9HL 2XVBA 3F7LA 4ODTH 4ODWA 1DO5A 4JQVA 4U2ZA 5JPMA 2XTJD 5DRXB 4FLSA 4AQ1A 4NQSA 5B1JA 1A9BA 3PQYA 3WL9A 1CGXA 3JV5A 4PJDA 3INOA 3RWCA 4JX0A 4B0MM 5E8DL 4DP8X 3UJTH 2WYZA 1UD6A 3B9AA 4HWBL 5JW4N 1BZ8A 4L4VE 3KW7A 2BX5A 1SYSB 2XN9B 1OZTG 3QPXL 4ZOAA 4L4TA 3C9NB 5E4AA 3BDXA 2IMMA 1MCDA 4KTEL 4G9DB 4N2GA 2F7IA 4Z7UE 4XRCA 2ZCHH 5E8OB 3VQLA 4IMKA 2CG9X 3VQMA 4IIZA 2IDTA 1F4WH 1F1DA 4XAKD 1B0GA 5C0EA 5GGSB 3ZZQA 4K94L 2HKHH 1M1SA 1PKQE 1MPAL 1RURH 3GUTB 2C9RA 3BUQA 4S1DC 2IGTA 3VFRB 3NIFF 1IAIH 3N85L 2HVKA 1T5XA 1AG6A 2PXYD 1EK3A 1Q38A 2M2DA 1A4BA 4PRIA 2BOBB 3ISWA 4I4WA 5E1HB 1SBBA 1ADQA 1XH3A 5LCVH 3V79C 5D1XB 2HZHA 4GUPA 2HVJA 4R2GD 2N7BA 2VXTH 1TQBB 4ZS6D 4ZMZA 1RUMH 3WFEL 4KNSA 3WD5L 1A8ZA 2IV9A 1CLOL 1TCRB 5AD0A 2F53B 2BFGA 1RIVH 2P5PA 2YGVA 4J6RH 4Y2NA 5KBMA 5A7EA 2R1XA 5LGHL 3N40P 1SNRA 1OCWL 2L3BA 4OM1L 1CB4A 3F58L 3QZWB 3NIGE 1J0HA 4WW2B 4BCYA 5JIIA 1YJDL 1MH5B 3B8YA 3KNBB 4I18C 2CLZA 4KVNH 3MXWL 2WLLA 3U4KA 1JPSL 1OE1A 2ZSVA 4NAMA 2XTSA 1MHHB 2WAQA 4WCYH 3PYCA 5AAPA 5FV1L 1IKNC 4RH4A 1AGCB 1T5KA 4HXBH 4KKBC 5IF0A 1I9IH 2GTWA 4AIXA 4RMRA 4TOYH 3SCMC 1AO7D 4M1CD 4W6WB 2ZNWA 5KSBA 1YC8A 1GJIA 1FZKA 3BESR 1ZRUA 3HOGA 1J8KA 2Y06L 1FF5A 3CZSA 4JRXB 4HOXA 5C0DB 3JTTA 3FB5B 2O30A 3Q3GB 4WDIA 4IDLA 3C60C 5FO8B 5LXVA 1THCA 4MVBC 3T0EE 4X99A 3X11A 5FM5O 1EUTA 3FTZA 3WTTA 2OL3L 2NY5C 3LV3A 2RCSH 4HC1A 2QQKH 2X1QA 3FU7B 3HB3B 4CUCA 1E5AA 1KYDA 4ZPVA 3NVQA 1JRHL 3FUMA 1I1AB 5IUCA 4NQDA 4JPWH 1PNCA 5DZNA 1ZXKA 4QDGA 4BZ1H 2B5IC 1QPKA 3ZZLA 1R34A 1ZVNA 3POHA 2MPVA 4OIIH 1UWEL 3FOMB 4ONGH 5I5IA 4V33A 2YSSA 1UB6B 1S7QA 4R84A 3PREA 5AZEH 3HZYB 5DJZA 1GPOL 4FQJH 3ZRSA 1VIWA 1G94A 4W9DC 3GB7A 2AQNA 2Z92A 4PJHA 5CIPH 1XMWA 3BP7A 3BO8A 3ULUC 2HUEA 3DTXB 4AYFA 3DETD 4PCTA 1ID5I 4Q9RL 4AL8L 3T0VA 4HGKC 4ZS7L 3ZT5A 2BVUA 2HRLA 3EF4A 4F7PB 3I2CL 3L4WA 1KUMA 2DMBA 4EN2A 4M1GL 3FQXB 1PZAA 2GT9B 2VR6A 5DEGB 1GGCH 5HHOB 1PSKL 4FZEH 3A22A 4DO4A 2AITA 2EINB 4OF3A 3C6SA 4XPFL 5D7IF 1EVUA 2Q5BA 3CZFB 3NCEB 4LQ1A 5CHNB 4RGMB 4DGVH 4QTIL 5E03A 3ATEA 3DVGB 3LD8C 4G9DA 2NY7H 4EKXA 4UT9L 4S1QL 1BQRA 3NESA 5DMGD 4E41B 3PHOB 5E8OA 3EBIA 4ZXBB 2VZSA 1PLGH 4KDVA 3EO0B 5C0RL 1BREA 5KW9H 3I3EA 1A7NL 1LHZA 1U4FA 3IFLL 4G8IB 5INDB 3KDPB 3DVNA 3QZLA 4ZODA 3V9CA 3BVTA 1XGRB 2XV2A 3FRUA 4E9WA 4ZO6A 3SKMA 3WFDH 4Y2DD 4YHNA 2EH7L 1D9KD 1RERA 4DH2A 2H6OA 1M57B 2IDUA 5EORH 1CK0H 2AJYH 3VXSB 4NOFA 1QWHA 2BY2A 1QASA 3RIKA 2V2WB 1KCUH 4HJ0D 5DJXA 1V3LA 5FOBB 4F91B 1CD0A 3LKPA 3CLFH 4OZHE 1HKLH 4TULH 4RGND 5EBLB 1IAKA 1Q9OA 4IKLA 3SPJA 4A7GF 2V5TA 4IJ3B 5HHPB 4AVKA 2BSDA 4GEJA 1NPNA 1TCRA 4EMZA 4P2YA 1N6QL 4NO2A 2V9QA 4P5RA 4Y88A 1CQYA 4UIMB 1X5AA 1IGCL 3TCTA 3C5SA 9CGTA 3QZWA 1FAIL 4LT7A 1NLBH 1ZK5A 4FAAB 3GMPA 3MJ7A 5E2VH 3QFJE 1FL5B 4WJ5B 1SN5A 4TQIA 3P30L 1DE4A 1NFAA 3FMGH 1MHHA 2FQEA 2XYBA 2Z8WC 3DTDA 1D5MB 4P5TC 1AGCA 4UILL 5D7LD 1OALA 3NJGA 1XR9B 1CYGA 4NO0A 3SDAB 1KGIA 4R3SA 3EH1A 3BI9X 1KEML 1CLZH 4L0YA 3Q06A 4JRXA 1NCDL 2CKBL 3DGGA 4XH2B 5C0DA 2NX5A 4X6BB 2J73A 1X6NA 2DWXA 1XHHA 4ZFGL 3EYOB 4K73A 5D7JB 5DJYB 1WZ1L 3VFNB 1DJYA 4TL5A 3QPKA 5ADPH 1VKXA 1MCKA 1KBPA 3N0AA 3C08H 3TN0B 3CFKB 1BBJB 4QHMB 1CDIA 3FU7A 4ZUTB 3W9DB 3CN0A 1KCSL 4RMWA 4TF4A 1I1AA 1WSST 3KJ6H 5I0DA 1DHKA 5HJDA 1U8LA 3W2DL 2ADFL 1E43A 2JF1A 5CR8A 5D55A 5HGHB 3GJFH 1XL4A 3BFQG 1UWFA 3FOMA 3IBOA 1WC7B 4JDEB 1MJUL 1A3LH 1T1ZB 5F6IC 2H32A 4N0CC 4ZFZA 4N0YH 3TBWA 3SE8H 3KLKA 3JV6A 1SBSH 3OR7B 1U3HC 3BAEL 1PY9A 2P4AB 1KN4L 3QORD 3FU9A 4XXWC 4EIGB 1I7TA 1PFOA 3CFTA 3NH7H 3NRPA 3VSTA 2X05A 4Q89A 1SMAA 4DP4X 3BXNA 4KK8C 1AVAA 1NEZB 2LVEA 1RPQA 4LMQI 4MYPA 3MLUH 3RRQA 2HMIC 4AV0A 1DQML 2BRQA 4OLXH 3E3QE 5D4QA 5I18L 2YRLA 1L9RA 2IDSA 3AUVA 3QQ3A 5E5MB 4N90D 4YK4B 5AKTA 1A3QA 2O5YH 1A7PH 4AQOA 4F7PA 4M4PA 3DX3A 4K5NA 4Y4FD 5DEGA 2I24N 3UDWC 3LNEA 5E9DE 3TU6A 2WKOF 4AEHL 4FLHA 1KWGA 3TCLB 1XCTB 4LSTL 4Y9FA 1P6WA 3M1OA 3IE4A 5EZJA 4E9XA 4LVOB 3I9AA 1IQDB 4Z7OF 1MAMH 4P2QB 5DD5L 2F74B 3CZFA 3AMKA 3VXPA 1ZT1B 2F8XC 2VQUA 5IHBA 5DEZA 1PQZB 3DVGA 3FS9A 4UF7C 4XCCL 5FK9B 4A66A 4N5ED 4NDMA 3CVIL 3IDJB 3VWKD 3MCYA 1SMDA 3Q6GL 5B3JF 3I9PA 4NKIL 5BJTB 2FH8A 3EO0A 4AVHA 2F1AA 2BP8A 3EYQC 3W9EB 1F3JA 7TAAA 1S7VB 4O00A 1DBKL 4HS8L 4X6DE 3TOPA 1IEHA 2XZCH 1XGRA 4HX1B 2R0KH 3QDGA 2CK2A 3AREC 1BOGA 3LJ3A 4BDVA 2BIQA 1UXWA 4ZO7A 3PABB 2XVGA 3HRZC 2WGXA 5F1IB 2VAAB 3WNJA 3HG1E 1S7UA 3ZTDC 5BS0B 5MEND 1LK3L 4PHXA 4PRHA 1ZWIA 2PWEA 3HG3A 3EHBC 5DJ8B 3BAYA 5DHMC 2GK0B 4F7MA 2BHUA 4YBLC 2V2WA 4R7XA 1H3PH 4NZTH 4WW1B 4ZDHB 1NLDH 1ODUA 3EGDA 3SQBB 5TDNB 2UWEA 2FQGA 3MROB 1CQKA 3MCLH 5I30H 3S9DB 1CGUA 5J9PB 1ZKAA 4IBWA 1YUHB 1B4JH 5I8EB 1S7TA 1H6UA 2FNWA 1TVHA 4UM9B 3GWJA 3EGSA 4PG9A 2HG5B 4B5EA 4GXFA 3WNNA 4UNTA 4WUKL 1HESA 1UD4A 2KL6A 3RY5A 3WIHA 1ACYL 4OQTH 1A47A 2R2BA 4I2XB 4KPHH 1WPCA 4WUUB 4ZSOB 1D5MA 3E7JA 5SX4I 3R7RA 4RRPA 3ULVD 1ZVSB 1ROCA 2NY3C 1WDAA 3UTZA 1IC0A 2FT8A 1Y6KR 3PLYA 4G8FA 4JGJA 5T3XE 5IEKA 1LILA 3V5HB 5CIPB 1ICTA 1YEKL 5F9DC 4E36A 3UC0A 3UACA 2A77H 1EGJH 4BK5C 5KYXA 1UZGA 1IBHA 2B9AA 4JY5L 1UJ3C 3HE7B 2NY1D 1IAOA 1CLVA 4XBMA 4X6BA 1PVHA 4KNQA 2GSIB 3IDNB 2NCEA 5TQ2L 5FA3B 3EYOA 5D7JA 3TP4A 5HI5D 1R24B 1RZJL 2VUKA 3HI1A 4Y2OA 1VADB 3RVWD 3RY6C 2WIIA 2G75A 3L4TA 1HINH 4YN3A 3SGKC 1OO2A 4A6YH 3WTWA 3W9DA 4H1LG 1YYMH 4LCCA 1A4AA 2F9BT 3FTYA 3KYMB 3LEXB 2PO6D 3MA7A 3VD0A 1AQDB 5F9AC 3LYRA 4CNIB 4PJ6A 1L0PA 1SPDA 2IAMB 4C58B 1XF4B 3EOTH 1T1ZA 1R46A 3ELQA 3SDXA 3Q44A 4P04A 1RJZB 4L3AA 3PWPB 3OR7A 2X6CA 3WNMA 3APFA 5JOPD 4WEEA 5A2CA 4NWTL 1CFVH 3ARPA 3C6LB 4AGQA 1A6AA 5DMKB 4DHLA 3PGFH 3AC0A 1AO7A 4J3SA 5ANMB 4MZRA 3CC5A 3BGMA 2R1WA 5F7UA 2FL5B 2OXGB 2G9KA 4Z0BL 4JJHA 4P46C 4JO4L 4XHQA 1KPVB 3LN4B 2MEJB 3I85A 3OV6A 3FFDB 3U2IA 5AVQB 1ZLEA 1XCTA 2VXQH 1MVUA 1N68A 3I50L 5IESL 1EUUA 1JPEA 3QCUH 2NQCA 2NZ9D 2F74A 2CDEB 1HQ4B 3F00A 1ZT1A 5D5MA 1BXUA 4Y1AE 3TF4A 1PQZA 2HX9A 1AS8A 3RA7H 2OSXA 3IDJA 4XCFH 1BQLH 1K4DB 1TLMA 4U31A 1WFUA 1NFDB 1S9YB 4PJAF 5GISL 5BVJA 5I76B 2NLJA 4OZFB 2Q86B 4AE0A 5BJTA 1JZHA 3QDHA 3HC0B 4MHHG 4HLZH 1U3NA 1RHHB 4LSRH 3EUUA 3W9EA 1LK2B 4JZJA 4BK4A 2EC8A 1KTRL 3MZTA 3VD7A 1XH1A 3WNIA 1G43A 1TTBA 3NACH 5IW1B 2I5YH 3TBCA 1EO5A 3OLEA 1P4IL 5IQLA 1U91A 3ASOB 5MI0C 2H26B 3MBEB 1P4LA 2IFFL 3LX9A 2QGBA 4ABVA 5EFIB 3E2HB 4I88A 1Y1DA 5GZND 2VAAA 2DJMA 3BQVA 4Y5VB 2FRGP 2OJ1A 1PF3A 4M5ZL 1Y6NR 1Z9MA 4PJIB 2H6UA 4TKWA 5CN2A 3Q8EA 2BWIA 2GK0A 3D08A 4LL4A 1E9QA 5EU6A 1P4BL 2R9HC 3AW5A 2IQAA 3N2JA 2ODHA 5TDNA 4HLJA 3TJEL 1BM3L 1I3GL 1DQDL 4Z7UF 3JWDC 3X17A 5BZWA 5J9PA 3RUGB 5I8EA 2O5XH 2YQ2A 4L8BA 5GJSL 4JFEE 1PEZA 1NGQL 2IPKA 3P02A 1OGAD 4JZNA 3RP1A 5IP4A 3A6CH 1FNEB 2HLEB 1UCBL 4GFTB 5F8RC 4YDJA 4UANA 3OXSB 4L2LA 2MWCA 3GJFB 1N26A 3M46A 4NI3A 5FFLA 1CDGA 4GLRH 4OJFH 2Y6TE 5GGTA 2WB1A 5FV2A 4AC2A 3RWIA 4JKLA 4M1DH 3C8KA 4LEBA 3V5HA 2W0KA 2QFPA 3GJFK 4NFDA 4MA1C 3AS0A 3QIUB 3P1VA 5DC2A 3TBYB 4HH8A 2W88A 3GC3A 3HE7A 4MQSB 1ZGLM 3HKFA 4DPRA 1D9KA 5E2TL 4Y4KB 4ZMNA 3IDNA 3BMWA 4P3WA 1EHLH 5FA3A 3NIGF 3T2LA 3PWUB 3CSYB 4OTXH 3STBA 4N3TA 2FLRT 2PTTA 4XNQA 2LFGA 3GGWA 3ZKMC 2AQQA 2P42B 3IGUA 3UBGA 1FDLH 3MN8A 5FYKH 3UTSD 5C7XL 5GGRA 1VAHA 4G7YH 4R4NC 2YD8A 4ONOA 3D4YA 3QBTB 3G5WA 2Y2TA 4JL2A 4JLRA 2YPLD 5B4MC 5LXGH 5FHBL 2J5LC 5GZOC 2IPTH 1O7DC 3C6LA 3TEZA 1FO0H 2X10A 1YC7A 4ZJ9A 1XXFC 4FOMA 2EIJB 3QDAA 3JWOC 2EXWD 4KUCD 4HIIB 3QUXB 1QLEB 4YFLI 1HCFX 2K7QA 2GIXA 4J6IA 1XIWC 2Y6SC 5H94B 2ZUYA 4NKQB 3UXFA 2FX7L 1KPVA 4ZMPA 3WN5A 3L7EB 4MNHA 4AK2A 1Q9WB 3O6ML 2FATH 3LZOA 3PP4H 4WWKC 4OM0H 1ORSB 4EPSA 4XNUL 4NT6B 2X89D 3WHXB 1Z1WA 2WBKA 2BWQA 2FD6L 3D8MA 4HGWA 2YA1A 4UCFA 5ICUA 3PQYE 2FEEI 3DDGA 3LEVL 5E08H 2ITEA 3RE0A 4WV1A 3L5HA 4PJDE 3O6LH 2OSWA 2EDEA 3WKNA 3BEVA 5CEZD 1HHHA 2XPGB 2ED9A 1IV8A 4DW2H 1G9ML 1OL0A 3FL7A 3VD9A 1S9YA 1AE6L 3CHPA 2HCZX 2E9BA 4OZFA 5A6MA 3BAKA 1BAFH 1YPZA 1WA2X 1V7MH 5T1KA 4D0BB 6FABH 3S4SA 3HC0A 4Q97A 4L4TE 5D71H 3A21A 2ADGA 4KJPD 1D2PA 1LK2A 4HH9B 3PWLB 1BYOA 1AFVH 2DS4A 2YC1B 1FFOB 5EO9B 2TAAA 4M7LT 5IW1A 3QI9D 2UY7B 1MG3C 4OGZA 2XV0A 4YSDA 1H3GA 1QWNA 3CZNA 3HZMB 2WNXA 3MBEA 4EDWH 4EUPH 4G6JH 4YZWA 1BX2A 5E94B 3QORA 2BFVL 5EEXA 4AYGA 4PH8A 4UINH 5J11C 1NANI 4FQXC 1AAJA 1NJ9A 1E9PB 1ZY9A 4XWOC 4HD5A 3QE5A 4S1DD 9PCYA 5TD4A 4BFEA 5A7BA 3S88L 4PVBA 4FFZH 1VZHA 2VITB 5EF1A 1R3HA 3LRGA 4PRIE 3F7RA 5LAPA 1NCAL 3MRGA 3UJIH 3RIAF 5B39G 1RSYA 1MVYA 1OGTB 2G60H 3KLDA 1WBYA 2EIZA 2WXHA 1W0WB 2FYVA 4MJ5A 5F71A 4A6YB 4XCEB 1S5HA 3FUKA 2R7EA 1XSOA 3QC5X 3QDJB 4KK6C 5D4HA 2EKSB 1N59A 4BQ9A 4OV5A 3MLVL 5T3ZL 1IARB 2VXSH 1ITBB 5CCKH 3O9WB 4GKZB 2DTMH 3P0GB 5EOTB 4X6FA 2PP8A 4L3FA 2QKIB 2XA8H 3QJSB 5DFTA 1A8JH 5HHNA 1AH1A 3BPOC 1Q1JH 1I3VA 2B0SH 4A2GA 2CXKA 5GGVH 4EI6B 1S78D 4GO9A 3EJQA 1H3VA 4O2FB 3SBWA 4FQLH 4GIOA 4OZHF 3ZMNA 2FO4B 5KANG 4OB5H 2GHZA 4LGSB 3MKKA 3SCMD 2LU5A 5DRZB 5KSBE 1KBBA 2CHXA 4JFFB 4HWEH 1A6ZB 1IFRA 1JZDC 4Y9CA 3CFCL 4F15C 2DQEL 4IKIA 3V0WH 4OLEA 5MHSE 1UGNA 4YDZA 1J1XL 3O6FB 4XMLH 2WCPA 5E7FA 4J27A 5CEYB 1SXAA 2ADJB 3LOWA 4RFEB 5CF3A 2C8NA 4NBZB 1E4WL 3LKQB 5HD8C 1YDPA 3BQUC 2OZ4H 1FFRA 2OI9C 5L7XL 1CZ8H 3ZO9A 4OCXH 5EF3A 1MCPL 1T89C 1CXFA 1ES0B 3CFUA 3HUJB 4Z7QE 3K2IA 3U46A 1LVEA 1CFTB 4NQDE 4WFEE 5JUEL 5E24E 5SWZB 2B14A 4X8GA 1AJ7L 3MLTA 3J27A 1NGPL 4QRTB 5JYLA 2BC4A 1UCTA 2XXGA 1P84K 2YGOA 4U1LA 1N0XH 3CHSA 5I1EH 4JO8A 4GUCA 2E0PA 3ETTA 4ZUWB 4QRRD 3QIWB 3GHBL 1IEAB 4F7TA 2FX9L 2D0HA 1HQRB 3SPCA 3WHE1 3BC9A 3PJLA 1TYJA 2ZOKA 2XJLA 5H94A 2A6DB 3ULUD 3NOIA 3PUCA 5D72H 1DDTA 3UYRL 2LOEA 3NFSH 4XPHH 2B1AL 4LDLB 4FTVB 2UXGA 3CUPA 4Y9EA 1ZTMA 5HGDA 3SE9L 3S5LA 3NTCL 3SKNB 4EI5C 1YMMD 3WHXA 2P1YA 3EO9L 3QS2A 4N1HB 5DD6B 3WJJC 4BZYA 3KS0J 4ZD3L 2PWGA 2AZUA 1M71B 2EH8L 3CHRA 1X5ZA 4EZMA 5LQBL 4XBEH 5AKRA 2PPFA 4WHTB 1AGFB 3NZ8A 4P59H 5EG6C 4UV7H 4LFHD 4AX3A 3ARVA 5DEFB 4RDQG 4L3CA 1GYCA 2PO6A 2YQGA 2Z93B 2R83A 2WQSA 2BHZA 3AABA 2YZ1A 4HH9A 4GSRA 3ARSA 1MCWM 2E76C 4G42B 1FFOA 3JZYA 5EO9A 3S3PA 5I71B 1J05A 3B2VH 5C8JB 2CGRL 3BUBA 3HZMA 1E2VA 4Q2ZB 2IH3B 2R23B 1C5DB 4WI8A 4HF5H 1JCVA 4NZRH 1ZDQA 3IN2A 3CFEA 1E9PA 4F2EA 4YHYC 3S36H 4KKNA 3F12B 1MCSA 4FMKA 1SEBA 3FT4A 3RZCB 4H40A 4NKOB 4YHML 1NCUA 3G6AA 15C8H 3TCXA 2VITA 1MFDH 5B1BB 5E8PA 1USZA 3DIFA 5F7NC 1OK8A 1BQSA 3APCA 3KR3L 2GBUA 2IH1A 5CJQH 1W0WA 2NTFA 4KQ3L 4DK3A 3ARFB 3T0WA 3MLWL 4JQIH 1OARL 2WTPA 2DQ6A 4M7KH 2EKSA 4X6DF 1NIDA 3RIFK 4XX1G 2BHFA 3AQZA 4PCSA 2X1OA 2OW6A 4XP5H 4MXVE 4NO5B 4WFHE 3O9WA 2EDQA 3VG9B 2ZAIA 5C6TL 5GHWL 3Q05A 1ECZA 2L7EA 3ARTA 3RGVD 4FD0A 2XG5A 1DJXA 4OIBA 5FYLL 2GTQA 4P2CG 1C1EL 4ORZC 2O6FA 5T1JA 4EI6A 1IC7H 4P5TD 2WLZA 3CDCA 4O2FA 5DQDL 5IVZB 1FO0B 2BSTB 2IPUK 3V0FA 4MJ4A 3UAEA 2OTWB 4MMYA 4YE4H 2R69L 5DRZA 4RFNB 2XNAA 4JFFA 3H4HA 2P5WD 4PMFA 4S1SH 1AHWC 1AXSB 1Q94A 3FT2A 4K7PX 2Y22A 4JRXE 1F0LA 3GXTA 5LN8A 2NX5E 4R4FL 4HS3B 3O6FA 4MMXC 5EU4A 1KDIA 1RZKH 4GSXA 4NS0A 1S9VA 2LW3A 3HAEG 5CEYA 25C8H 2K9FB 4UTCA 3L48A 1RI8A 5ECGA 2XQYA 5CGYC 4K3JL 5I8OH 3LB6C 4OLYL 1GR7A 2FEEL 1QLFA 3DRTB 3IS0X 3L9RA 1MFEL 2N0KA 3LH2H 4PP2B 3FO9B 1FLRH 5IJKA 1EO8L 5AOZA 1OGAA 5B3NA 1JHLH 2W9LA 5DMIH 2GY5A 1BVNT 2LR4A 5SWZA 2QADB 2FR4B 1JXFA 3T71A 4QRTA 5AUMB 5I1JL 4QXUH 1IC4L 1C8PA 1KNOB 3LKOA 1NMCC 4PVLA 4N0CD 2QHRL 3QIWA 3U7AA 4EUPB 3WXWL 1U3HD 1LP9A 1IBGL 3L7FB 4XC1L 2YWZA 3VI4A 1IAII 2WQ8A 3UTTB 2A6DA 3CN4A 4EKJA 4UOZA 4KK8D 4IKJA 3VXQA 5JHLA 3T2PA 1KELL 3REWA 3C2AL 2ZPKH 4FTVA 4J3UA 4YR6A 3FT3A 3US1A 1BDYA 2EIKB 1GOFA 5KAQG 1HOEA 1ZA3B 2Q0ZX 2VDQL 1T0NA 4LVHB 3N04A 3GLEA 4ODHL 3UIZA 3KPLA 3L4CA 1M71A 5ID1A 1S9WA 1FH5L 1K5NA 4JPVL 1GY1A 4DZBB 2X42A 5C0BB 4LSQH 3MODH 1ZHLB 2AGJL 3AXHA 1A7QH 4P3DB 2F58L 2FK9A 4UU9B 3REVA 2XICA 1MW0A 3NP4A 4JY6A 1WVZA 5HGBB 1XB8A 3IFPB 2PPAA 4YS4A 5IMKA 2CGZA 5DHYA 1GGBL 3I3BA 4G42A 4P2RD 2ZOLB 1OV8A 4Z7IA 2K0RA 1IGFH 2GUYA 2QGEA 2V33A 2OP4L 4O2EB 3ERXA 4OFVA 5BMFL 1GZPB 2R23A 3I6GB 3EYQD 1A1NB 2RH0A 5HI4C 5K39A 1RPUA 1QI5A 1T0PB 1KC5H 3HNVH 4K9EH 1ETA1 4JG0L 3QDGE 3F12A 1SEQL 4YEFA 4I9WE 4CVXB 1S9XA 4F8OA 1R3IL 3ILQD 4OY9A 4NKOA 3QWNA 5DK2A 5HP5A 4N0FA 3COOA 3TIEB 3QG7L 4PRHE 2OMZB 3U0WH 3QNYA 2WXKA 3EHBD 1T3FA 4PRNA 1LD9B 3EJYC 3QIBA 4LSVL 5J4MA 1PX3A 4FKHA 4KY1L 4JNXA 4BJLA 3K6SA 3K71A 1NIFA 3ARFA 3EXLA 2UWEE 4CVZA 4QRPD 3CFBB 3CVHH 4HOMA 4O5LL 4DERA 3IGAB 5L2KB 1DVXA 3U4AA 3QUMA 1LYQA 1ZHKB 1KXTB 4PW3A 4ZFOA 2EC9U 1XFPA 4OFPA 1YECH 1MFAL 3IYLW 3MNMA 3LQAH 1FFNA 1OW0C 2OXHB 1XF2B 2VABB 4KMTH 5TE4L 4GKNA 4PJBB 3D18B 3K8MA 3UC2A 5JA8B 3KPMB 4IRZH 3MJ8A 2A4EA 2QQLL 4NN7C 3W38A 2NY3D 3T2OA 2JKIS 1QNZL 5DD1H<