4UTCA

Crystal structure of dengue 2 virus envelope glycoprotein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
395
structure length
391
Chain Sequence
MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSLNEEQDKRFICKHSMVDRGWGNGCGLFGKGGIVTCAKFTCKKNMEGKIVQPENLEYTIVITPHSGEEHAVGNDTGKHGKEIKITPQSSTTEAELTGYGTVTMECSPRTDFNEMVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFHLKCRLRMDKLQLKGMSYSMCTGKFKIVKEIAETQHGTIVIRVQYEGDGSPCKIPFEITDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIVGVEPGQLKLNWLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
molecule tags Viral protein
total genus 75
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4utcA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4utcA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4utcA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4utcA03
1ZTXE 2HG0A 4FG0A 5JHMA 1S6NA 2V33A 5AAMC 5KVEE 4AM0Q 1URZA 3UZQB 1OANA 3UAJA 3J2PA 1OKEA 2I69A 2JSFA 3I50E 1UZGA 3UZEC 5AAWC 1PJWA 5KVDE 5B1CA 1Z3RA 2JQMA 4FFZA 4X42A 5LBSA 3C6EA 4UTBA 1SVBA 1TG8A 3N41F 3J27A 1RERA 3UC0A 4BZ2A 5GZNA 2ALAA 3N44F 3N43F 5KVGE 3C5XA 3P54A 5IREA 5KVFE 2P5PA 5JHLA 4GSXA 3UZVA 4FFYA 3VTTA 3IRCA 1Z66A 3WE1A 4BZ1A 5LCVA 3UYPB 4AL8C 2R29A 4UT6A 4UTCA 2R69A 3N42F 4L5FE 1OK8A 4UT9A 3G7TA 4GT0A 3N40F 5LBVA 5IZ7A 4ALAC 2GG1A 3MUUA 5GZOA 4UTAA 2JV6A 2H0PA 5H37A
chains in the Genus database with same CATH superfamily
1FN4B 3G08A 1XGYL 4P2OD 2ZUXA 1G7JA 4JQIA 1MIMH 1V3KA 5TDNB 5TGBB 2DDQL 4HH9A 5FEBA 1WFJA 4JM2C 1UWFA 4G8GA 4BELD 4LXFA 5B1JC 4PG2C 1U95B 2X4PB 1BQSA 2NSXA 4CVUA 3WAJA 1B4JL 2P5WE 3FQWA 4QRPB 3BDBA 1G6RA 1QLFA 4H1LB 4NGHL 3L48A 2V7NA 3IFOB 3KMDA 4KXZH 3ZHLA 2ZX8A 4OQTH 1A4CA 3GSQB 4FYTA 1JYXA 2VLJD 2YWZA 3II2A 2NY5C 3KXFB 2Q3AA 1M7DA 1UQSA 1YCSA 2BHFA 5HHXL 4XMVA 2WXLA 4X6CF 4G9FA 4FULA 3B2MA 2R29L 1MPAL 3JUYA 3LXCA 1ORQA 4HS6A 3R8QA 3DKHA 1DDHB 5IVZA 3TO4C 3WO4C 3DGDA 5E4IA 5G2NA 2ETWA 2RR3A 5I75C 3ZDYF 1CZ8L 1M6OA 3I9PA 1FVDB 5J1AA 4GG6A 4JDTH 3ARDA 4IBWA 5AAWA 1YAIA 1TQBC 1CFSB 2HT3D 4PRAA 1RFDH 4XP6H 2A77H 4HWUA 3LCYA 4OBSA 1S9YA 2EIMB 1M7IB 1AKPA 1JAEA 3J07A 3TF4A 1FNLA 5EC1B 2V17H 4PW3A 1YMMB 1T21A 2ODIA 1XH0A 4UAOB 3AADB 3QI9D 5DZLA 2L7UA 3MRQB 2VQ4A 3O4LE 2BERA 2GYSA 4P2QA 1GZQA 4P46A 3FW6A 2CO4A 4OZHA 3TT1L 4Z7NE 3HPLB 1EO7A 3AQZA 1S7WA 3ZT6A 1IIKA 4WEUD 1EAPB 5J9PB 5CZVL 3QXDB 4LSRL 5FGRA 4NLHA 1RUKH 3B8SA 1OM3H 1ZS8A 4U4BA 1IGIL 3KL5A 4U3SA 4ENED 2E75C 1RK1B 1I7TB 1MAJA 4YMPA 1HZHL 2X09A 3GDCA 1VZIA 1DBML 3PHSA 3B56A 3RTQC 4LGRB 3CFCL 1DL7H 4HK3N 3ET9F 3U25A 4WUUB 2PLTA 5HJDA 2GFBB 3NIGE 2PO6B 2WB7A 4WKZB 4X8CA 4KKAD 1YQVL 1AFVL 1R3IH 4CL7A 3B7SA 3QUML 1TSRA 1L9SA 2PW2B 4Y4HC 4C57C 3BXNB 5I1GL 3BSZA 2VJ0A 1J10A 1U8PB 2WBJA 3IJEA 1V10A 2YLHA 3TOPA 3L4VA 4FQIH 4JFXA 4KGLA 2FH6A 3EYOA 2VQTA 4NQDA 3SDXE 4JO1L 2AEIT 2CR3A 3FSAA 1MJ7H 1VIWA 3KGUA 3O9WC 3TVMA 1KULA 1AQKH 3GLEA 4KTEH 3FU7A 5A3ID 3RGVD 2Q8AH 1A1MB 3G9AB 3IMVA 4I0PC 5HY9B 2JSFA 2VDPB 1RPQA 3V4PB 3IDMB 3EOTL 3VSQA 3S9DB 1WG3A 5HTSA 5KS9E 5I9QC 4O02H 1K5NB 2XVLA 5EU6D 1G0XA 2ROXA 4AGPA 3D2UD 4GNKB 1OGAD 3TN0B 1BW8A 5CP7B 2FO4A 5I30H 5A2AA 4QJ5B 2B9AA 4LCYA 5BRZD 4F2MB 4C4BA 1FL3B 3O11A 3AQXA 4YHML 15C8H 1N70A 3ABLB 1E2VA 2W1NA 4JKWA 4YHIB 4HJ1A 4EE2A 2XSKA 4YDLC 1LDSA 1MY5A 4Q6IB 4D3CL 2ADIB 4AT6A 1ESOA 2XLLA 3LVTA 2H3KA 3D0VB 2PYFB 2CHWA 2DB8A 2OCFD 3JYCA 3UDWA 3ZL2A 3SDCB 3T08A 4AIZB 1UJ3A 4DTGL 3NK3A 4K3JH 5E8PB 5E1AB 5AW7B 3MNZB 2G2PA 5E4EC 4GAYA 4HD5A 4FZEH 5FYJD 3S37H 3TM6A 4K9JA 5FCUL 3TBYA 2PYEE 3QULB 1I8MB 1FHNA 3TJEL 4BSJA 3DHJA 1MH5A 3BWSA 4HHWA 4OZFH 3QQ4A 1CTNA 4XBPA 4X5WA 4FQ1H 1MFCL 3VG0L 3CHOA 1W6LA 3E9UA 5CP3A 1WZLA 3ISRA 4MA8H 5J11B 4HUCA 1NMCB 2O5XH 3W39A 4YDKL 3IMSA 1FAIL 1T1XB 3CH8A 3QORD 4I18B 5GS0D 4XX5A 1MCKA 3QFJA 3IGAA 2QQNH 1JZ4A 2OXGA 4CNIB 3HNTL 3QA3B 2YJQA 3GSNA 3U2SA 3K6DA 4L3CB 2X0WA 2YXFA 2H32A 2UWEE 3RX9A 2VDNH 5IMMB 3EH4B 4TULL 4R0LC 5T5NG 4X6EB 4CU7A 3H0TB 4O5LH 3EG9B 3DV4A 3EFOA 4NHCH 5C09B 4JFTA 1NL0H 4I48A 3SPVB 2FX9H 1TZIA 3L6FA 2VRAA 4X80H 4S0SD 3IJ8A 2XTLA 3C5ZB 3EYUL 1LK2B 4H20L 2CJUL 1HDMB 3UAFA 3PWNA 4NIKB 3TONA 1GCYA 5EC2B 5CGTA 1T4KA 3EGXB 4YDIL 4BQ9A 4CKVX 4XO4A 4HVBA 1A5FL 3ZDXF 2X3AA 2VZVA 3PL6D 3CFIC 3UJTL 3HZMA 2ED6A 4LP5A 3VM7A 2V33A 2XDHA 3I6GA 2ITCB 3KH4A 3MLYH 1XR8A 4QNPE 1CD9B 2H26A 2K8QA 3BWAA 1KN2L 1JIBA 3ASOB 4CA4A 2VUOA 3UTSA 3VX1A 1NAML 5CINH 2E9WA 2NY6C 4Z78A 2J1WA 3B2UD 1WTLA 2OR7A 3CV5A 5HYFA 1A6AA 2IDCA 3BP4B 3FF7A 3KYKH 3LZFL 3MLVH 2NY1D 2DEXX 1E8YA 2W65B 2EECA 4FTVB 3MNDA 4HGWB 1ZLDA 4NUPA 5BVJA 4R96B 4WI0A 4IU3B 2ESVE 2DQFA 5MERA 4G3YH 3CHPA 4U1LA 5SWZA 3AS1A 4DN3H 3K5RA 5CXPA 3JWNC 4XI5C 4TVPL 1NC4D 4PJAF 1SEBB 3G6AB 4J3OH 4M1DH 5F0LB 3T65B 2GEQA 1Q8MA 4WJG3 5KSAC 3FQXB 4F92B 5DEGB 3FQUA 1JHLL 3FQTA 3RGVB 3V4LA 1M1SA 4G7YH 1RI8A 3IDUA 3KYMB 5I15L 3R06B 2V7HA 3MV01 5C86A 4N2AA 3CFJB 4TQHA 4J3WA 4AYFA 5D1QB 1M2OA 3P4MA 4KO7A 5GGTL 1AH1A 4YH6A 4L8SB 5CAYB 3VWKC 5EU6B 1E90A 1E5AA 4ZTEA 4RGND 5IR1A 1GC1H 2VN3A 5IB3B 3V6FB 3P0YL 2BWQA 1UM6H 4L8BA 3QPKA 2D3NA 2HT4D 2DBLL 3WJLA 4XVTH 5F9DC 1RURL 1L0XA 3UYRH 3IS1X 4AEEA 1YEHL 1TDQA 2SEBB 3AUVA 4LKCB 3LN4B 5BRZB 4JDZA 3DIVA 2A77L 3CDZA 4UM8B 2NCEA 3LNHA 4N6RB 1U9KA 1UWXK 1CLVA 1XV8A 2V17L 2AKRA 4JO2L 3UH8A 4A6YH 1CIDA 2BSCA 1N3NA 3ARBB 35C8H 2YJLA 2FEJA 1D7BA 3L4UA 4K2UL 2NZIA 1KBGH 4JGMA 3WBDA 3B8YA 2Q6WA 1HXYB 5D7JA 3VFUA 3V0JA 1ETB1 4UZUA 1Q1PA 4HZAA 3VXNB 3QS2A 1IGTA 4NQTA 2M83A 1BVKA 3ZSSA 4PAZA 4U6HA 3SCMA 1GOHA 4HCGA 4JAMA 5TF0A 1KJ2B 2WSDA 2EXTA 4WFHE 3GKZA 3NACL 2GVYA 3QJSB 4NZRH 3TC9A 1I9JL 3IFPA 3KJ6H 1A4KA 1MAML 5D8JH 5FUZL 4ZNEE 1EGJH 4N8PA 4HCRL 2F1EA 3PUUA 2LFEA 2WXGA 1SHSA 4JW3A 1UM4H 4BM7A 1TFHA 1ACCA 3FTGB 4PREB 3INUL 4N0FA 4U49A 1O6VA 4E9VA 1DCLA 5BZDA 1JV5A 5FFOA 5GRJH 4BK5A 4B50A 1AJ7L 2JI3A 3HC4H 4JJ5B 2AZAA 3OZ9L 3UC0H 3M1CA 3TZVA 3L1EA 3WFBH 1FJ1B 1OP3K 3S35H 4JFFA 4OJFH 4W4OC 3STBA 4G6FB 3L13A 4PTTB 2GHZA 4UAOC 2F8XC 3GIVA 2ZUYA 3S5LG 4ZS7L 1NPNA 2KZKA 3UBXB 3CMGA 4MQSB 3TEYA 1P69B 2NMSA 2A9NL 1L6XA 2D03H 5AOLA 5I8OL 3NBNA 2A9DA 3Q7JA 5I6OA 1JF6A 3RVWD 4XMUA 1I7UA 3SN6N 3PAUA 1FZOB 3SGKA 5C0FA 2P45B 3K2KA 1MFBH 5FYKU 3TL5A 3ZE0E 2X6AA 2R4SH 2BVUA 4KPHL 4B5ZA 1SJEA 3DRTB 4JANA 4XAWH 4Y5YA 4GQRA 3TH3T 1TO4A 3QO0B 4K7PX 5IP4A 2R69L 4JM2F 4OUOA 3RBSA 4XMZA 5DD3H 5D6DA 3BZEA 3NJGA 3HS9A 4XNYH 3RNKB 4IMLB 4Q4IA 4MSWA 4QTFA 1D9KD 3CBKB 4DPCX 1X5AA 1QSFD 3BT2L 1JNLL 2DLHA 4KVNL 2PO6C 4C83A 1W6WA 3HFFA 5LJYH 1R75A 5E9DE 4B6ZA 1OP9A 5K9KB 1BCIA 5IQLA 1RJLB 2IDFA 1N4XH 4A2EA 2DKMA 3KM1A 2PPFA 4BFKA 4PM1A 2NX5E 4JK0D 3LZNA 1KIRB 3EJUA 4Z76A 4BA8A 1ZSDA 1I8IB 4MWFA 1YNTB 3ECQA 2MCMA 1YQ2A 2B4CC 1NC4B 2EC8A 1Q94B 4RIRB 5INCB 1XEUA 4HK0A 3S37L 3CVDA 3OHXA 4PJHE 2ZSWB 3GHBH 4JFDE 2HUHA 2JCCF 2CLVA 2JXMB 3FO0L 5M94B 1ITBB 1MFNA 5DVOA 3K5SA 4TNWK 5E1GA 3EYVA 1RK0B 3K2IA 2F61A 3LRGA 4IRSA 4JM4H 1PNDA 5ICZA 5FKPB 2VYRE 2O5XL 4ZPTA 3T0BA 4S0HA 1HQRA 1NMBH 2ZAIA 4ANKA 2CIIB 3NMEA 3ZZLA 2X4UA 2CKNA 3TN0C 1TFPA 2QQNL 4JO3L 4LIQH 3UBHA 5I6PA 2F54E 5DSCA 3AG2B 5CZKA 3WNKA 4WWPA 4NPJA 1UENA 2ZKWA 1BX2B 3NTCH 4Q6IC 1G7MB 1JWMA 5DUBB 2IDUA 5CJBA 4PS3A 3MOAH 3SDAB 1E3ZA 3VH8B 2AJSH 3MGAA 3V2AR 2FX9L 3BKYH 4RFOH 1IKOP 3WN5A 1EHXA 2HFTA 3VXME 2VLKA 3GS0A 2DI7A 2IWGA 3OLEA 5DJ8A 4PRNB 3K4DA 2WXQA 4M61B 3TV8A 1F58H 4PG9A 2C7FA 3K8LA 1JTPA 5LAXA 3I50E 1T2JA 1QFWI 3Q6GL 4QDGA 2WN3A 4X5PA 1U91B 4LNRB 1MCEA 4UDTA 3DTDA 2DQJH 3AXIA 3HS8A 4CW1B 1HINH 1I1AA 3LSOA 5GJSH 4PMEA 5TE4L 1QSEE 2G4EA 3I75A 3V6OA 3LEXB 3L3DA 4RMSA 3U36A 3Q6FA 3MNMA 1F6LL 2RJMA 4QXGH 5E6ID 2QPFA 4WF7A 1Q72H 1OW0C 4BUQA 4RX4A 2V2XA 2WIMA 4DP9X 1Q9KA 2HTLD 1ADQL 2ZCKH 2F8IA 4F8OA 3CVHB 1CR9H 3NA9H 1ID2A 5LGYA 1TPXC 3TCXA 4N68A 5JMRA 2YMOA 1A6PA 1GS6X 5DD1H 3NRPA 4RAUA 3VFSA 3IF1B 2YXWA 3BUIA 3TYGL 1QBMH 3GBLA 4DN3L 1BFOB 2PW1A 3PP4H 4U6XA 1UKQA 4KZEH 4MA3B 3REWA 5DZ9A 1E4KA 1QKZL 1WLGA 3FCUB 4K7FB 2DWTA 2NLJA 4XH2A 1NDGA 3LV3B 3BP7B 2XWXA 4J4PA 4M8UA 3Q44A 5FCSH 2V6HA 1A6TA 2ENQA 5GSRA 4KRLB 4AC4A 2VN7A 4DZBA 4U1JA 1H0DA 4ENEC 3VE0A 1CDUA 1DVQA 5I1EH 4OZIF 4OIIL 3RKPA 1J1XH 4DGYL 4LAQH 2OXHA 2BP8B 4GLRH 3EGDB 4Y1SA 2JIXD 3SY6A 1NFDA 2CPUA 2VR5A 4HUNB 1BPLB 3JWOL 4K94L 5E03A 5I8KL 2JB6B 3PWUB 4KKAC 3EJRA 4L5FE 4QPEA 1XH2A 4LVNB 4P2QE 4WWKA 3T2NL 2ZZUT 5IB5A 5IHZA 3BZ5A 3H9HA 5J0BA 1BLIA 2Q7NA 1W9XA 4NAQA 3RZCB 4I7ZC 1SVZA 4CVZA 4NZDA 4D94A 1NCIA 5ESVA 1JPTL 4Y5VA 5ERWA 1OLZA 4NPKA 1V5JA 4GOSA 2AANA 4HS8H 2GBVA 4IS6B 1ETA1 3TCLB 5L88H 3OKLA 2YAMA 5HJBA 2BOCB 4XVJL 3MZGB 1UD8A 1UG9A 5FIEA 5HYQA 2Z34A 3ZT7A 3NJKA 4A2LA 1HI6A 4K07A 5GGQH 1N9PA 1SYSA 2ICCA 3RGVC 3VDBA 3CDFA 1JV2A 5DVMA 4Q9BA 4EKXA 1UXSB 3N9GL 5CEXA 1IC7H 2VT0A 4L8SC 4DGVH 1JPFA 4YL9A 1M6UA 2HRPH 2PP7A 4DERA 1T7WA 4JGNA 2Y7QB 4ZAKA 3EFDH 3RWGA 3QEQD 4RSYA 3T8XA 4OTXH 4R4BB 4AQ8C 2VWEC 3TTYA 3RPBA 1SXNA 3UTZB 1KZQA 1CFTB 3WNOA 2XYBA 3QSKB 5EFIB 1HCZA 1U3HD 1UOLA 1KXVA 4WO4A 2OZ4L 5LBSA 3W2DH 3PREA 4NUGL 4M3HA 3VQLA 2W95A 3AG4B 1BWWA 3ARBC 3X1FA 4MJ4A 2UV3A 5EIIG 2XWTA 4Y16B 3ZE2F 1WF5A 5E00A 2AV1B 2OMTA 5IEHB 3SIKA 3D3VD 3U9WA 2GITB 3MKKA 3RIAF 1TZGL 1W72L 5D7KD 2XNAB 4F9PC 2EXWD 2WCPA 4ZDHB 2J1XA 3CC5B 3ZQ9A 3WS3B 1HL9A 2IANA 4OLZH 1D7FA 3E3QE 1D5BB 1DO6A 2NNAA 3B2DC 5TH2A 1U92A 4XAWL 2K6WA 2LFGA 3RL2A 1KPUA 3S4SG 4BYHA 2OK0H 3FSVA 3NCFB 3VWJD 2WVVB 4UT7H 4PR5A 5CHNB 2XVBA 1P2CA 1GAFH 2PF6A 4OCNC 3KBEA 3MUZ1 3QORC 5GS0C 3NCYP 4PGCA 3GLDA 4NKMB 4RWHA 1OCWH 2VISA 3VXSE 7PCYA 5HDWA 4F8QA 5AYUL 4IRJA 1BEXA 1NCHA 2P5EB 4FQQA 1GZPB 3M86A 1OAYH 5AKSA 5E8OB 5K9JL 3DURA 3S8FB 1OPGL 1JMZA 5CN2A 1T0MB 3AT0A 3RDJA 3VI4F 1UACH 5K69A 1JDDA 1HH9A 3MU3A 2P44B 1EFXD 2J20A 3FO2B 4JQVA 1SHXA 4YLBA 1DBKL 2ICES 2HX7A 5DU7A 2XXMB 5KSVA 2WKLA 2WQ8A 1TQWA 1JWUA 2FQFA 5HBBA 1T0OA 5FYJU 3FCSB 1IRAY 1G9NL 1IFRA 1YJDL 4LCWD 5LNEA 3UC2A 4R9HA 3MBEB 5C0CD 3PL6C 2C3VB 2G2NA 3AWGA 1LK3H 4JM4L 4YEEA 2H0PA 1BD2B 2NZ9D 2IQ9L 4Z7OE 5T1JA 1DYZA 2KL6A 3KPRB 4IHOB 2JIXB 1CTMA 1NMBL 1JK8A 2V2WB 1DJGA 2GSIB 4YIQB 1L5GB 3OAYH 3VXTB 2BC4B 2VZ3A 2BFVH 3G5VB 3GMRA 5AVXB 1TQSA 4FAAB 1J0KA 3CN3A 3FUIA 2DQGH 2DPKA 1OHZA 3AMLA 4WFGE 1J87A 1P4IL 5B38G 4QYOB 2PWDA 3IRZA 4P5MB 2P43B 3B2UC 4NQCE 2GJRA 5J57B 1NH6A 1DSWA 1WIUA 4JHWL 2NY1C 4P07A 3T71A 5JYMA 1UXMA 5DRWB 4MLIA 3A4EA 3TIDA 5JLZA 4OM1L 1AGEB 4FMFA 4UQ3A 5EUKB 5CMAA 1BF8A 1ES0B 5JHLH 3MR9A 1RPKA 4Y19A 1H3WM 3MLUH 2D7TL 4FGMA 1GGBL 4N9OB 1KB3A 2AJXH 1MW3A 1F58L 2BSTA 4NBZB 4WEEA 1TQCC 4IBTA 2KERA 2YUXA 4JG1H 2ZKMX 2Z31B 3UTSE 3MA9H 1EJOL 3VB8A 4B9IA 3ZE1B 4D9RE 2W0KA 3Q8EA 4HX1B 4DQAA 1EZUA 4MCZA 1TKWA 3NT0A 4RGNC 5E1IA 3N44F 1FYTA 3RUGB 5KJ7E 5E5RB 2HT4C 2QHRL 2Y7MA 2WJ5A 3CFQA 3L3IA 4PJFE 1AZBA 3GSWB 3W9EB 2F2HA 2YD7A 3OG4B 1QO3B 4PGBA 4OQTA 4HIXL 1IBGH 4HWBA 4PVLA 1IM3A 3TPUB 1A4JB 1NLDH 1PMYA 2VN6A 4M48L 3RVUC 1VEPA 2XIDA 4LF3B 4LHJB 2ZCKL 1S7QA 4FS0A 5DRNB 1BFTA 4QXWA 5IMKB 4YGVB 3PRZA 4AW4A 5B1KA 2OMVB 2C3XA 2ZJSL 4QLRA 3KM2A 2EUXA 3HMWL 3RFRA 1QD0A 3V5DA 4FP8L 2VDOH 2K7PA 1OY3B 3RJOA 2GC7C 2CKBL 4L4TE 1ZPUA 1S9KC 1GR7A 2WXJA 5CEZH 1B0IA 2IMNA 4C56A 1T1WA 1QTPA 5EOTB 5LUMA 4MB3A 2VZOA 2UY7A 4N2BA 4N2LA 4QHKJ 4U0RC 1JZ3A 4J2XA 3ZDWA 5J7CC 4YDVA 3X11B 3VCLA 5GGVL 3UAAA 2YA0A 1Z6JT 5I76B 3HHSB 2WZPA 3IJHA 5EU7E 2Z7YA 5CBEA 3CSFA 2KS0A 2NY3D 4GUPA 3G5WA 2C9RA 2LAAA 1CGWA 1WT5A 3QR0A 4Z7UE 4UM9B 1XCXA 1FH5L 3HN8A 5I2IB 5KVDH 4Z3GA 5HYJD 3VFVB 2Z4QB 1G9HA 4TUOA 3ESMA 3NEXA 4OJAA 3ZZ1A 3ATDA 4Q14A 1Q9WA 4NO2A 1KCWA 2VMEA 1Z5YD 4KHTL 4JFHD 4MNQA 2NY5L 3PPEA 3OF6D 4M62H 3RVWC 1F3JB 3ETSA 5D2LB 5DWUL 1IC5H 5FAAA 4PRDA 2O6DA 3M46A 2V2TA 4FQLH 3AT8A 3F5WA 4BH8A 1X4XA 3DXAE 5BOPA 4XXWC 2VXSL 1A21A 4NKOB 2IQAB 2ZCHL 1P5UB 4ZUUB 3HG1A 1KLUA 2WSKA 5L2KD 2EE9A 1Y1UA 1DJZA 1B2YA 3MV9E 2CGRL 5DZNA 1AI1H 4O2EB 1QNZL 2APTA 1D9KC 4Z7WA 5D70L 4WEMB 3NZ8A 1SVBA 2AXGA 4ISVA 3ZBMA 3UEQA 4AEHL 1MCFA 5FA3A 4K7PY 5IIEB 3ROOB 4LVNC 2B8OT 2WPGA 3VGGA 1WS7A 2N3JA 1FRGH 3BAWA 1UD6A 3EF7A 3WEBA 5BV7C 3CC1A 1ASOA 3FU8A 3WD5H 1FE8H 1M4KA 4GJTB 1ZTXH 3H2WA 1VKXB 4O02A 2H45A 2Q0ZX 3K71B 3UROR 5EZIL 3ZVVA 5SX4I 5HI3C 1AQDB 4JUSA 4PB0L 4HIJB 2WXIA 3P30H 4NKIH 2LAGB 4PH8A 4E68A 1NKGA 3MCKB 4OLZL 2QQKL 4NENA 1S5IL 3L9RA 1E8ZA 2CRYA 5C0BB 1Q9OA 2LTQC 3DVGA 4LRNH 5EZOH 3DOSA 4L0YA 2CRMA 3X3GH 4KKCD 4UT7L 3GHEL 1BQLH 4MXVE 3O3EB 1INDH 3B9KA 5AOMA 2C1PB 4S1QL 1RZ7L 2CDFA 5IK3B 3OQ3B 1YDPB 2EIZA 2O30A 1N26A 2DD8H 1FZKA 3GSOA 4EPSA 1WA1X 1K85A 4BINA 5E23A 1MHPH 4GKZA 4MB1A 3BRGC 2FR4B 1P6FA 2VR8A 4FG6D 4Z5RA 5BOJA 4OZFA 4X7SL 4XNUH 5K1VA 1VFOA 1AZUA 1A7RL 3CZFB 4ETQB 3FRUB 3TBBA 1QW8A 1EJ6A 5AZUA 5AZEH 1FLTX 4NSKB 1PGRB 4ODHH 1ZD6A 5ID0A 3BWUF 2WO2B 1E2WA 3QXAB 3QIBB 3Q05A 3IU4H 2X6CA 4UV4H 2BDNL 2N56A 3JTSB 3NRFA 4PMFA 3M8OL 1UT9A 1KJ3L 4N24A 3COOA 4PUBH 2AK4A 1U8QA 4K3EL 1UZ6F 5E8NA 2C1OB 4ZX4A 2O93L 5TQ0H 1JPSL 3MGTB 4OFYD 2WYHA 2B08A 4GXVL 4YSDA 4GAJH 2G0KA 3VXOA 4I1PA 3V0VB 3CN4A 4HU2A 2NY2B 4MAZA 1U8NB 1JPGA 4B9YA 2AJZA 4ZUWB 5E6IC 4WU7B 1T83A 2BHZA 4G9DB 4YXLL 5AD0B 5DJ6A 1CFQA 3DMMA 3OKDB 4F8LA 3QQDA 1X7QB 3B3BA 5K1JA 4R6UA 2FATL 3ECWA 4NUMA 5HD8D 2Y5QA 3UIYA 4DQOL 3EGSB 3LS5L 3SBRA 4L4VA 1A9EA 2JB5L 1HHKB 2OKMA 2FZ3B 2BVOB 1SDAB 4UT9L 2NW3B 4XX1E 3UBXI 1KBWA 4Q4EA 5C8JB 2C26A 4IMKC 2VN4A 2AJXL 2YD0A 4TPRL 1BAWA 1KCBA 2X28A 2R27A 3TJHC 2QGCA 3LTVA 1AG0A 4P48A 2DOCA 4P2YA 1ZT1B 5JIQA 3PQYD 4R7XA 5C0AD 1JK9B 5E6YA 1QUPA 3F85A 5KVFE 3T4AB 4XP9H 5HYIA 3SPGA 4KI1A 5KZCB 2MPAH 3CAFA 2A83A 2DQEH 3Q2WA 3UZVA 3A67L 2I60L 4PSPA 3QDGA 3O3BB 2R1XB 3BAKA 4AW7A 3ULUD 5CWSA 3FO9B 4R3SA 2J8UA 1MLBA 2ZKHH 3GXPA 5T3XH 2YN5A 3VSTA 4QOKA 2B5IB 4KDTC 1IFHL 5HHMD 1QUNB 1KB9K 4PGDB 5KBMA 2GJ6D 3WCYA 4RMBA 3OKEB 1NLDL 1M3JA 4JO4H 1I53A 1GRWA 4U6YA 3QUYA 5JORA 3BO8A 3CFDB 1SEQL 3TT3L 5ISZE 2YQGA 2FSDA 3PV6B 5EDXA 2O5ZL 4WRLA 5DD5L 1BF5A 2CBQA 2IIJA 1FFNB 4P3WA 5I5JA 5EZPA 3H6JA 3Q2VA 3PYCA 1X4YA 4QJ4B 3P4LA 1NFDE 3F6JA 3MYZA 1MCPL 4HXBL 3OZLA 2P80A 5CEZL 4EI0A 1EWHA 2OCJA 1OCOB 1XIWB 4QIRA 1DFBL 5IQ9A 5KYWA 3FB7B 3SKUD 5BZXA 3DA0A 4A6YA 5E2WH 5HGHA 5IW3A 3WFDH 5I6XB 1PZDA 4BK4A 2BSRB 3AREB 4KBPA 1I75A 4N2MA 4LCCC 3AGVA 4P5RA 4LEOA 1U42A 1DE4A 5JQ6H 1AS7A 3OJDB 3HS0B 2IGTA 1OQOA 2P5WB 1J5DA 1R3HA 2IH8A 4FNLL 2HVJB 3WS6A 1DSFL 2J88L 3E6HB 3QUZB 5I1CL 4GW4B 3IU3B 3CPLA 1U3HC 3RE0A 5EBWA 2AJYH 3BQUB 3RY6C 3AB0B 1EZLA 2Z8RA 1XR9B 5BQDA 3DX1A 3HLAB 3Q0HA 5F3HA 1JZDC 1P7KB 1EO8H 2IBBA 2BH0A 1EGJA 1P6AB 4APXB 4KVPA 1PW3A 2EXWC 4H40A 7PAZA 4IEFA 3NCCB 4JKPH 1YUHA 5HGDA 1M2VA 3F7VA 3BEWB 4K73A 1J9RA 3S96B 4ODTH 2GTWB 1EUTA 3GMPA 4XAKD 3UC0A 5JA9A 1H9DA 1OAXL 3S48A 2ICEB 3IKKA 4BA0A 3AJ7A 3VWJC 3IVKA 5TFSL 5JW5B 1IEBA 4G2AA 4X50A 5L2JB 4X4XA 1JN6A 4LU5H 1WCBB 4Z7VA 4TTGA 2ZAGA 7CGTA 4Y4KB 5FYLE 2Y2TA 5T1LB 3QXVA 1YNTF 2F5BH 5DZVA 2YD1A 4G5ZL 3SYQA 3DTUB 2AJ3A 4X0NA 2PTTB 1UVQB 1ZVHA 2AJVH 3O4LB 5A40E 4L9LA 1AE6H 3DTXA 2IXQA 1RAMA 1MVUA 3KLAA 4ODWA 4Z7NB 4IKIA 3VFNA 4LGSB 1MWOA 1R4XA 2ZCLH 5FYKL 3N1FC 1WFUA 1K4CA 3VXPA 5CEYB 5GISL 4B9KC 3D39E 4JHUA 4WV1A 1IQWH 3Q1SH 2JK5B 5EPMA 5D93B 4TUJB 1GGIH 3FFCA 1NFAA 3NGBB 5I0XA 4AJVA 4ZTOH 1JTTA 1DJHA 1AACA 2YBRA 4NO0D 4M3KB 1CYXA 5F2FA 3G6JE 5EZOL 1RUAL 1FDLL 3NIGB 2VXUL 4NYLB 5C6TL 1NGWB 1GIGL 2NZ9C 4JN2A 3BPOB 4FFZL 1R6VA 5A43C 1RZJC 4HT1H 1A7BA 1TMQA 4DJMA 2DY2A 5HGAB 1F3RB 2YPLA 5DT1H 3ML9A 1JG9A 1NLBH 2UXVA 2JKRM 3D0LA 4X7TA 2ESVD 1F0LA 1LM8V 1NWPA 3SDXB 5JNYB 1OM9A 4GQPH 3NZSA 3D9AL 2HG0A 2K6YA 4H26A 3WOVA 4ZPVB 3LNDA 2P42B 4JFED 1L7TL 2BCMA 2J6EL 3QH3A 2X3CA 3BRFA 4U1NB 1OIOA 1T2QL 1EA9C 4GQQA 1NFKA 1J8RA 1N6VA 5FK9A 2AQNA 4X6FB 4DKEL 3BFOA 4G6KH 4JDEA 5KS9B 3N42B 5FF6A 4AOFA 4XN9A 4WK2B 2ZUQC 5DJXA 2W92A 3QWRD 2CBPA 4UV4L 1JRHL 1UD5A 3BCDA 1OF2B 3FK3A 3V5HA 5B4MD 4WNSA 5A2CA 2QLYA 4CBZA 2O5YH 2N0KA 3W0WA 5KG9A 1ZT7B 3Q43A 1LO0H 4APQD 3OKNA 3JT2A 4RWYH 5FUCE 3WUWB 4HC1L 4L3EA 3MV7D 2C34A 4P2AA 5C6WH 5KBNC 1HKLH 4GY4A 3DX0A 1GS7A 4JRXA 2Y06H 4MQTB 5GHWH 1TTUA 3ETBF 3LKRA 5HHVH 4BZ1H 1NCJA 1SDDA 5D7LE 5D2NA 3DC0A 5IOPA 3ELAT 3U1SL 3N5AA 3AUWB 4ODXA 1UWEL 2VERN 4UBDC 4J28A 5IBTL 1UZ8B 2NR6A 5EEYA 4Y19E 3ZQXA 2J5WA 4ZO7A 1J1OH 2WVUA 3P3YA 4JVUA 4MRBA 1GZHA 3KPMA 3VFMB 2PYEB 2E8ZA 2B4CL 3P02A 1MOEA 4MJIE 4Z7AA 3L3OB 3HJ0A 4HUUA 1IFGA 4WFHD 4L18A 3KJ4C 1XZ0B 5J06A 4F2EA 4GSXA 2YZ1A 2B0SL 2E59A 4MASA 4ZMQA 4U1SA 4O58H 3QJFA 3KLKA 4ZO8A 5JZ7D 1FYTE 5GIRB 2FDBP 2IH1B 3GMNA 3K2MC 3MAWA 3UEZA 3N50A 1A3LL 1U8HA 5AKRA 2R9HD 2ICWJ 3OC8A 3Q2LA 2Q86A 4YHLH 4BUHA 5ITBL 1BVNT 4HKBA 3VAEA 2UWEB 2W9DH 4KV5F 4PJ8B 4Y2OA 5BO1H 5H35A 2EINB 3UPRA 1OK8A 5FV2A 5H94B 4YC2B 4HPYL 2NY3C 2ZXQA 2JCWA 3BH9B 4Q9RH 2NQ3A 5I23A 5GRVL 3VDCA 4WVRA 2A4ZA 4KI5F 1Q4NX 1KLFB 1TTFA 3A47A 4BWTA 4EI6B 2F0CA 2GAZA 1QFUL 4XP4H 4ZD3L 2YSTA 1MRCL 1YECH 2N59A 4YK4B 4ZOBA 3W56A 2GY7B 3CFNA 3DYOA 1PNCA 1TETL 1SBSL 3H3KA 1IEAB 4JFYA 1AXSA 4GBXA 2C9PA 3OAYK 3US1A 2DTSA 1LO4H 3KDMA 4I88A 1NQBA 5DEZA 1YEGH 3QRGH 3IPBA 4M6NH 3D30A 3QNZB 4NRYB 1JZ5A 2ZYIA 3QCVL 3Q2NA 1JMXA 1OSEA 1TIUA 5E2WL 2D3JA 4AQ1B 1NBVL 3MYJA 1C12B 1CLOH 4U4IA 4RA0C 2B77A 2NX5D 3U4AA 4Z3HA 3O3DA 4UQ9A 2F53D 1O5DT 3IMRA 3UZQA 5IJVB 2FYYA 4MA7L 2WSPA 2ESVB 4WCYL 5EN2A 2B5IC 5BRQA 4OJCA 5IKCB 4JVWA 1ORSA 1GGYA 4X5XB 3IN2A 3IEAA 4RDQF 5DD6B 4E0RB 1KFGA 1R3KA 1WBZA 4G7VL 1RERA 4XNMB 3R1GH 4WO0A 2O6CA 1Q9LB 1JGLH 2AXFA 3HG1E 3B43A 3OB8A 4XZ4A 4DP0X 4OFIA 3C9NA 5T5FH 4PV9A 3STZA 4YHYC 1BVNP 4BD4A 1BWMA 2FCBA 4FCHA 1CFNA 3L2MA 1S46A 3E2HB 2PTVA 3SPIA 5F88A 1EEYA 2ENSA 1JHKL 4B9CA 3RVTD 4LBEA 4APQB 1AP2B 1N0LB 2GUYA 2R0KL 4DP7X 1G84A 1FZMA 4U1GB 1XIWC 2ENJA 1GGCL 2IPKA 2MTAA 4KKCC 1BXUA 2NY4B 2OSYA 4JPIB 1ZIAA 3PXJA 3TV3L 3VTTA 2P3YA 5I6XC 1Z66A 2APBA 3OR6B 4GI8A 4HIIB 1MAKA 4JFQB 3AREC 3H7BA 4XNXL 4EN3B 3VGBA 3DSNB 1JUFB 2Y07H 3O2DL 4HIHB 5DI8A 2EDTA 2EAEA 2OR9H 1INEL 3QUZC 2ZSVB 4OZGE 3QE5A 1EZVX 1UA6L 5SWSD 1DVSA 4G1EB 4XPTL 2IWFA 3IBOA 2KZBA 4PJDA 3SKNB 3BQUC 1FFPB 4TRPL 3AB0C 3MJ7A 4EVNB 1TJGL 3LZOA 1KB5L 3FUJA 3ELQA 4A7GA 1NGQH 2W9LA 5TDPA 5BUPA 3LKOA 3K6SB 3VFGH 2F7RA 3BLKA 4HSQA 1F11A 4NDMA 5ALBL 4MMXA 2UXTA 1UUNA 4ONGH 7FABH 2WWKT 4HUMB 2H2SD 3LH2H 4G8GD 4XNZB 4YHNB 3O0RH 1E5BA 2XBTA 2H4EA 2KBGA 1H15A 1E5UI 4KKBD 1GA2A 3MRDA 3SDYH 3KNBA 1AO7E 1CYWA 2VSMB 3WSQH 3AFLA 1NBZB 3FT9A 1OCCB 4PGEB 3GLZA 4P57B 4D9LL 1PLGH 1XF3A 4QHUB 4ERSH 4N87A 4IGBB 5ADPL 3QT2A 4LSPL 3OKOB 2MMXA 1IAKA 4LQFL 1WZAA 1CD0A 3GWJA 3V4VH 1IM9B 1VF5C 1UFUA 3FSOA 2CJTA 5E8EA 1NCNA 1IVLA 1IC4L 4NO5B 4DETA 3BESR 1JOIA 2VM3A 3MX0B 2R0WH 3KCPA 1TMCB 2ERJB 4G9FD 2BOLA 4E42A 3KLDA 3CSPA 1ETZB 3QEHA 5HD8C 1DZBA 3B3IA 4HJTA 3OMIB 1KJVB 4MDIA 4QTIL 3ZE0B 2OJ1A 5FYJL 4FFVC 3DX7B 3BJLA 4NRXA 3GUFA 4XCYA 1YO4A 3ZE1F 1CGSL 2BJML 1PLBA 2EDLA 3NPSB 4XVUD 3ARDD 4U3CA 2AC0A 4HIEA 1NGZA 5TD4A 2AGJH 3NGBC 1E5YA 3RUGF 3LEVL 5JOFA 3QARA 4MJHA 4WDIB 5F9AC 1MUJB 1LO2L 3QJHA 4H8WC 2E7DA 4JRFA 1WFMA 2Y24A 5IEKB 3IS0X 1LO0L 4JFZL 3MV8A 2I07A 5GS0L 5I24A 3KVQA 3QAZB 3TIEA 5HJGA 1IE5A 1CU4H 1NIBA 3OM3B 4Y9BA 5E9DB 5JO5B 3B83A 4P2QD 4P46D 3SBWA 3LQZB 3LHPL 3DHUA 3AU1B 4I77L 4RDBA 3DIFB 1CF1A 5DTFA 1ZGLB 2NX5B 1OZTG 1E4WL 4UQAA 1C5CL 1NGYA 5E5MA 5JHLA 3OAUH 4PCSA 3C09C 1L3WA 4I9WE 4PRBA 4M4PA 5HDQL 3NQIA 2DYPA 2Q7AA 4U7MA 4N5UA 3KHQA 5IB4A 1JGDA 1MJ8L 2EC9U 5BVPH 4PJHB 1DVFA 2EKSA 1HHIA 1A7OH 3GXTA 4R5TA 5IBLD 4IBZA 5E2UH 4JFDB 2Q9OA 5C2BH 3GRBA 5DS2A 5EOCH 4JS7A 2UZXB 1DVYA 5ECGA 1MJUH 4CSPA 1UEYA 1WO2A 4GXUN 2WGNB 1N2RA 2BM3A 3Q5OA 4FNSA 4KX8A 4NO3A 2W81C 1BIHA 4YBHA 3CMOH 3OXSA 2WV3A 3SGDI 1EHKB 1AHWB 2J8UE 4HU8A 1AGFB 2WBJD 4IOSA 5LBVA 1TCRB 4QOKE 3VNZA 3FTVA 1OE2A 2F54B 4HWZB 4NQDD 3HI6L 5JHDA 4ODUB 3LN9A 1IVTA 4HP5A 3MUUA 1DN0A 3THML 3TVMD 4PJEA 4XCFL 4JFPB 3KLHD 3QJVB 4M6MH 2X4NA 1FVCB 1ND0A 5FWRA 3ZZQA 3IJ7A 2H1PL 4M43L 5D2LF 4MQ7A 1JGUH 1J12A 4QI3A 3D6GA 3ALWA 3VXMB 3WJMA 3I6LD 3QIUA 2QGBA 2IPTL 1HOCA 1UURA 2B3IA 1J8HE 1RPUA 3NAAH 2FUTA 4A38A 4Q2ZA 2B16A 5K9OA 4RMVA 4D0CA 1XXDC 1A6ZA 1G7JB 5IJCC 2MOGA 4HKXB 4HEPG 5IW6A 3L3HB 3CZLA 2YPVL 3C6SA 3B5HA 4H8PA 2XIIA 2DWXA 3QG6B 1WA0X 4FFYL 5H37G 2H6OA 2ZWLT 4OFDA 1PQZA 1QSEB 3APDA 3CFBA 4DK6A 1A8ZA 3V79C 3BVDB 4EQ2A 2CK0L 2CGZA 4P2RA 4WKXA 3BP5A 3FT3A 4Q97A 4IKKA 3QJRB 5DVKA 5F89A 2V7NB 1YC7A 2N01B 2OTPA 3NJNA 4EBQL 1T5WB 4WTWA 1L3NA 5DJAB 5EIIA 2IBZX 1LWJA 4YC2C 1TLMA 4PVBA 1M7DB 1JWSA 3S34L 1NCAL 3NFPB 3G5ZA 5G55A 2WN2A 1DP0A 3U30C 4LLQA 4HS6B 1ORQB 2WINA 5C9KA 5IQOA 4BFFA 5BZWA 3ZKMD 4CILA 1MIEH 2VLRA 1U2YA 3EF4A 4RNRB 3S4SA 2A4CA 3PJSA 4KUCF 3QFJD 5DHEA 3C60B 4OKVB 2FTAA 5F9OL 1S9XB 1L6ZA 1IGML 1MREH 2NUTA 4JE4B 4BWWA 3DJ9A 1A6WH 2CNZA 4K8RH 5T5FL 2CHNA 2R1YB 4GSQA 1VGKB 3KPSE 4ZW6A 1KELH 3K1KC 2CDEB 5IB1A 1T21B 2GK0B 5I6MA 3FXIC 2BNUB 1CUOA 3HPJA 1QFPA 4MFHA 3AROA 2FIKB 4A67A 4XZUB 4P2QB 1I3UA 4OKDA 3DUHA 1BYOA 1GZQB 4JRYE 4MCMA 4OFQA 3EJZD 3RX5A 5B7FA 5IWLC 1J1PL 4YL4A 2FJGB 4E9WA 3UYPA 1E30A 2KMWA 3AITA 4XXDB 1IIIA 1FC1A 1FNGB 1CS6A 1U93A 4PRHA 4AKPA 1DVTA 1DQML 3ARQA 5F1IA 3ZO9A 1DUZB 1QR4A 1UWYA 3KPPA 5C0GB 1B0RA 5DQDH 1CDGA 3I3EA 4MAYA 3IGLA 1X9UA 1XSOA 4FQJH 3HE6B 5DS8B 4ETYA 1BGXH 1C5DA 4CN6A 2R8SL 3Q9PA 5LO7A 2FGZA 3T0DA 2WLHA 32C2A 1MDTA 3UTSD 1H8OA 2R2EB 4I3SH 2JJVA 4K9EC 4ONGL 3L1GA 3SQBB 4LCIH 4D0DB 5I1HH 4LVEA 4ZXBB 5GS1B 4BH7A 4AH2B 2YPLE 3IYLW 4NNXA 5EU5A 1DTUA 4QWWD 3UCQA 4APQC 5B38A 2EVJA 3GKWH 5C07A 4HKJB 4LOUD 4FC3E 2AQ2A 2A1WL 4JFXB 4L1BA 4G7RB 3U7YL 3L5HA 5SWZD 2H41A 4OIFA 1NCWL 2ITDB 4XBGA 2X42A 4TLSA 4ERSL 2GABA 4GRLB 3B7UX 1MCWM 3VFWA 5F3BA 1PX3A 1N67A 5T8IA 4EN3C 4IOFC 1W0WA 1ZLSH 2M2DA 5BV7L 1SJMA 3IMBA 4RH4A 2HRGA 1BREA 3QEGL 1Y18B 3QNXA 4BE6A 3FF8A 3G5XA 4OJEH 4AEFA 4AWJC 5CM1A 5EOQL 4UUJB 2F1AA 1XB8A 4LPUA 2ZXBA 3OC5A 1M05A 3PAVA 3KYNA 1ZA6A 4OGZA 3GK8L 4PPTA 1YYML 1NIFA 3M6DA 2EYTA 2NPLX 1RZFL 4LCYB 1MLCA 1F1AA 2DEYX 2BPBA 2Y5EA 4L3EE 3U9UA 4F8PA 4AEIH 3KS0H 3U4EA 4P4KA 1XGRA 2G9HB 1YZZA 3MGOB 4PBWD 5JZ7C 1ZJAA 2HWZL 2NY0B 4XNZC 1JZGA 1N6QH 5JPNA 5D2NE 3EXJA 3TYFA 3BPCB 2R9HC 2VDQH 4J3SA 1AGCA 3VXSB 4ZX3A 5IHBA 4LK4A 1EFQA 3US0A 1KN4H 4UMSA 1FV1A 1T20A 5D7JD 4B3EA 4IGBC 1XTLA 4E41A 4QAMB 5J6SA 1KNOA 4HHGA 2NYYD 3GBNH 3TBYB 3E80A 2F7IA 3R0MA 3SCMD 4A66A 3NQKA 1CJYA 2AJUH 3PJLA 4ZMTA 3OLIA 2CR0A 5AALA 4KKZA 3TO2B 1F4YH 4MDRA 4UB0H 2ERJC 1L9RA 4P5TA 5JR1H 1BFSA 4Q52A 3NCYS 1U6AL 3OPZH 1RJZA 4LSSH 4Q9QL 5JXAH 4ZFGL 1XGPA 1K3ZA 5C2BL 2G0LA 2X10A 3ZTNH 3TA4D 4N86A 3PF2A 1XH3B 1MJUL 2VXVH 3DX6B 1WZ1H 1G7QB 1TTRA 5DRXB 2EH7L 4J23A 4Z7OB 3NOIA 3VRJA 3TBSA 3TZVD 4OJDH 1PKQE 2E56A 4JFFD 3MRKB 3QIWA 3TXAA 3EJJX 1OE1A 2IOIA 5L9DH 2Y5TB 3V4UL 2JJUA 2C4FT 3QAZC 4GRMA 3KZ8A 3ARYA 3CK0L 1EEZB 4JFVA 4HUXB 2NNFA 2VMDA 4BZ2H 4NQCB 2D2OA 1KPVA 2G5RA 12E8L 5SWQB 1T4KB 4U1IA 5KOMC 4QRQB 2I85A 3B5TA 3ZIYA 1MQKH 1FFTB 1UT2A 4XWOC 1F1GA 3BDYH 5C0DB 1LVEA 1WEJH 3D8MA 3HZMB 3K2UL 4YLQT 3VXRD 2N0MA 2XA8H 4BFEA 2WOBA 1HZKA 3P0VH 1XR8B 1BJMA 1PIFA 2H26B 4XP1H 5JPMC 3S3BB 3BWAB 2IMMA 3GSVB 4BSWB 4OU3A 4HHAA 3V52L 3IDJA 4KXBA 1OAUH 3L95A 4BKTC 4CKQA 4ELMA 1PJ9A 4B9FA 5I1AB 4G1MB 4JFOB 1QR1A 1V3MA 5D1XA 1A6AB 5LXGH 4X9GA 4ZRGA 4LRIA 4PJFB 5BVJB 3BMVA 3HG4A 3MCYA 5AW3B 4FADA 1M1XA 3QI9A 2DQFB 2QV2A 2K9UA 5IQNA 4U1LB 2EVHA 5D5MA 4MZIA 4WW2C 4FL4C 1I85A 4Z7NF 4HULB 3U6XS 4W81A 3GJFH 1I7RB 3EKCA 1GGUA 2ZOLA 4YSEA 3O3AB 4F9LC 2H6PB 3P9WB 3FKUS 1UXLA 4TNVF 5DC9B 1HAWA 5F7MC 3ZJAA 3MRPA 5I6LA 2OFQA 5IGXL 5FA4B 5J89A 1G1YA 4IRSD 5H4YA 1A6UL 6TAAA 4FKKA 4GSUA 1ONQA 4KHXH 4QHNA 4PJIE 4EI5A 2CXKA 3QJTB 2HVKB 4L4TB 2E76C 3NIGF 3PGCB 4A04A 4WI2A 3ISWA 3VYOA 3OSVA 4XMKL 4YHPA 3RX7A 4MS8C 1WBYA 2Y9RT 1TOXA 1JGEA 1FNHA 5FFLA 4JDZB 3WKQA 4KJQD 4G8EA 2VDKB 1ZS2A 2WYIA 5KVMC 1EXUA 1QRNE 2YGOA 4N8CL 3BUYA 3JWNG 1K8DA 2H2SC 3NP3A 1FBIH 4PJXE 1KELL 3WO3B 2XXGA 1MI5A 3C08L 4WGWB 3REVA 3OKMA 2AKRB 2HJLB 2RACA 4TSCL 3DO7A 3SDXF 4A2HA 4NN7B 4P59H 3QVAA 1WS8A 3QR1A 4Z7UB 1HHJB 2Q6WB 3VFUB 1J88A 1ZHBA 2CALA 2VLKD 1HEHC 3EJYC 3BGMA 4PJDE 5SV3A 3SPHA 2JF1A 1MHHB 2D4FA 4YSUA 3NCEB 4WI3A 1QVOB 4JAMB 4PWHA 5T1MB 1CFVH 3BVXA 3P0GB 1NANI 5D4IA 1K6QL 5KS9F 3IKCA 4FG0A 1BDYA 3GTNA 5HXMA 3IFPB 2B3RA 2LU5A 3GTVA 5C0ND 5DFWH 5DQDL 4YNYB 4YDJA 1MFEL 3IMUA 1I1AD 1URZA 4PU2A 2K1MA 1S8DA 5DO8A 1A9BB 2HJFB 3DXAB 3QG7L 3MRLB 2G60H 2OM5A 3RX8A 1CL7L 3GO1L 3C75A 3LRLA 4GIOA 4P9HC 5EBGA 1MCQA 3ARDC 2B59A 1KCRL 2A0LC 5AAWC 4BFGA 2C9UA 4G8IA 4RX4D 5CO1A 1JTOA 2NT1A 3MV9B 2DWEA 2OX5A 3D4ZA 3Q8CA 4LDEB 4AYEC 5AVUB 4U33A 3GF8A 3ZKSD 4J6IA 5ILTL 2BK8A 1IC0A 3C6EA 3OL2A 1BMWA 3GKWL 5FO9A 3FULA 4Y1AA 5IG7A 3GS7A 2ZUTA 2V3DA 3L3KA 2WBXA 4P46C 1MFMA 4FNPA 4ZMNA 4FLSA 4ZFFB 2FL5B 2DM2A 1F45A 4IW4C 4R90L 3FC8A 4J4PD 1BA9A 2HLEB 2OL3B 3NFSH 2ICWB 3QWQB 3BN9D 1IMHC 4G6AD 4J12A 4ANVA 2WB1A 5DC4B 5AUMA 2O1AA 4RMWA 2QFRA 3HE6C 1IAII 4PRIB 5I1LA 4MSWB 3P73B 4U1HA 1U8LB 5GGUB 4XP5L 2AEOA 1O7DE 4C83B 3MRFA 2UWEF 4UV7L 1JDAA 4NX0A 4WWKD 2F15A 4BZ1A 3PHOB 4X9IA 2FIRT 3L08A 4HLEA 1KCLA 2HN7B 3HNSH 4JPSA 3GXNA 2Y7OA 1RZJL 1TVHA 1WFTA 2WBJC 5FLUA 3U2GA 1QFWH 4J1UB 2RCSL 5GRUL 3TTSA 4HJGA 4N1EA 3KEHA 2OLDA 4PJCA 5E6UB 4G43A 3LNGA 2XRAH 1AXIB 1AY1H 2YD6A 5AW0B 4JZOA 2ZCZA 3TVMC 1IJ9A 3MRGB 3KLHC 1JVLA 3WFEL 1H3GA 1QQDA 4KQ0A 1HX0A 3KGTA 4F2FA 1G7HA 3LNFA 1U0QA 4BGDA 1ZWIA 1EHNA 3B6SA 4U6TA 5E08H 1F4YL 3EYVB 3QHZL 1FL5A 4W6YB 4DP6X 3CSYB 4PLKD 1D7DA 2NXYD 4CMMA 1DN2A 3WIFA 4E9TA 1T7XA 4OD3L 1H3XA 1NOFA 4MD4B 5E6ZA 4JJHA 3VXQA 4AC2A 4ZPTB 5KJRL 1FYHB 4ZAKD 4DFIA 1HQRB 3SKJH 3WNPA 4YVUA 2PKDA 1X44A 3JTBA 1IGCL 4PP1D 4CGUB 4AV5A 4L29B 4GMSH 1S6NA 1WZ1L 4HPOL 5L7XL 1TVBB 2NTFB 2CPCA 4N2IA 2FJFA 4AM0Q 1JWMB 5PCYA 3GMLB 1E4XI 3DBXB 5FYLD 4RMQA 1DQKA 3ARUA 2B2XH 3UDWC 3MRBB 4FQHA 5F7EL 4ZMVA 5L9DL 5HDRA 3HFMH 4QRTB 3ROLB 4F7PA 3IE4A 1UJ3C 4WZ9A 3L3JA 4QRBA 2DQTL 3WG7B 1G7LB 2GBAA 1YNKL 1NFIA 3KWWB 4D8PA 5CEZE 3EW3B 1X5LA 2WXRA 2D31A 3DPBB 2Z8SA 2IAND 4N90D 2JKWA 2WK2A 4HJEA 1OP4A 3CZJA 5I0ZA 1MQKL 5E99H 5GRZA 4N1HB 4M7LL 1KB9J 1K4DB 1HJBC 1NIEA 2QSCH 3QPQD 3UTQB 2YQ3A 3RWFB 3KPNB 2VRKA 4LLMB 1U58A 5FW7A 4GPVA 2CLZB 5B1BB 4UDTB 3ZKMC 4YSOA 1T03H 3LNEA 4NQQA 2IBZY 1UFGA 3ZUCA 3LSOB 3PAYA 5CSGA 1H6EA 2K4WA 5EO9A 3U36B 1HKFA 1N59A 4P2RE 1TR7A 3RWJA 2C9VA 4X99B 3HUJE 5TDOA 4EXPX 3MRRA 4U2ZA 4IRJD 4R2GD 4NPYB 2B14A 2BCKB 3JV4B 3MODH 3TESA 4WJKB 2OJZH 3CBRA 4BDVA 2IPUG 2FJSA 3H54A 1U2CA 5K33A 1UH3A 2CM6A 3RZWA 3TNNA 3ZPDA 5I16B 1HCYA 3LXBA 1BZDA 4ODSH 4DP1X 4MLSA 1ZHKA 4FI8A 1ODAA 2VLRE 2NLJB 4XH2B 3A21A 3ABMB 2AAAA 1NDGB 5ISZB 4YHZL 1E6OL 1I9IL 4X4YA 3TA3A 3AQDA 2XN9A 4U1JB 1H0DB 1KCVH 4LL4A 4X7CC 4M8QA 2OXHB 3CN2A 5BQ7A 1F86A 3FPXA 4KHXL 4W9CC 4M4RB 1YN7A 1NFDB 3ARGD 3C2SA 5HI5C 3MBXH 2VNCA 1QWHA 1LNUA 4PY7A 2XWJB 4JO5A 1N19A 1UB5A 2APVA 4ESKA 3P9MB 5IB5B 1YN6A 2BW4A 4GT7A 3H9HB 4H1LH 1EIBA 4HMDA 1ZTXE 2TAAA 1VFBA 1ZLUH 4CVZB 4JY4A 4NZUH 2VZ1A 4F7TA 5DS1A 4QWWC 2HA1A 5BXFA 1TT6A 4LOUC 1WHPA 4FXGA 3FU5A 4UQIM 3ECBA 3W9DA 3BUQA 3NEOA 2ARJA 3ZE0F 4Y19D 4R5VA 5ESQA 4JZNA 3VRLF 4O51B 3WDIA 4GQ9H 3UYOD 4MYWB 2F8VA 2Q20A 4YEFA 1HI6B 1FA4A 1I3RA 3ZL4H 2KLSA 4F7EB 4AY0A 1SYSB 4F8NA 5FHAL 1XT5A 3U46A 1JV2B 3QUMB 4XNQB 3LQAC 3DVNB 3QQXA 3VFTA 1J7VR 5DHDA 3BPLB 2P47B 1EANA 4K3DH 1A65A 3LAFA 1S3KL 4H0HB 4LSTL 1K8IA 4H0LC 4TL4A 1KJMB 4UIMA 4OV5A 2VXQH 2DLFH 2GCYA 1FYTD 2FJHA 5F6HJ 3ZHKA 5DDHB 3RWGB 3WJLC 4ZMAT 5DHVB 3K81A 5F7HA 4PB9L 4F58L 1GXEA 3DOHA 3F83A 3KG5A 5C07E 1FL6B 3UTPD 2HJKA 2XKSA 1OARH 4JREC 3V4VA 1IM3D 5AVYB 2ZKYA 4WO4B 1OT2A 1CLYH 3NSYA 5T33H 3MLXH 4ONHB 3FO1B 4EDXA 2DMHA 3QJUB 2GI7A 2R56H 1F4XL 3P77B 2ADJA 1DQQB 4NN7C 4AJWA 2X4OA 4WI9A 4OLEA 3BCFA 2P7TB 1FNAA 3N1PC 2FX8H 4LSUL 4FABL 5D7JC 4PJHF 4X6CA 3MNVB 3MROA 3P69A 4TXVB 2LW5A 1AGBA 2GJPA 3VJ6B 5C0RL 3A4AA 3DO4A 4WUKL 3SCMC 3SDDA 1P9MA 1Z9NA 2ADFL 3GEWB 1YHPA 2YRLA 4FXLA 4NUJA 2QR0A 2NNAB 4OB5H 5TJWK 1U92B 3NFSL 2O26U 4C56D 3HMXL 1VLXA 3UJIL 2Z92A 1BAFH 4I5BB 4GI9A 3D39B 3VD1A 3MOBH 3S98A 1P2CB 1RZGA 1LMKA 2BS9A 3CLEL 3HCVB 1JZIA 1M57B 4OLUL 2WZPD 2WUCH 1W80A 4OLXH 3G6JB 1T89A 1TTAA 3KYOA 1I9RL 1KGUA 2JQAA 5EN3A 5IJBC 4YAQA 1WA2X 5FV1L 4XMWA 2YOAA 1F56A 2AVGA 4FEMA 4PWIA 3TZVC 5LGJB 3ARZA 3BIAX 2MIZA 4DWHA 3CFEA 1LTXA 3IPEA 3MSPA 4M7KL 4RISH 3DECA 1JNNL 4MNQD 5EBLB 5CLZA 4DVRH 3V4PH 4NJ9H 4GRWE 4P23A 1AY1L 3WY3A 2UX7A 2Q76B 2XV2A 2F9BT 1MFDL 1NCDL 5DJ2A 1VFMA 3O41A 3CX2A 2HCZX 4Y5YC 2OS7A 5AW8B 1TJHL 3CZSA 3HG1D 4MMYA 1D2PA 5D1ZB 2J1ZA 3MO1B 4G80A 3BZFA 3HG3A 4NUQA 5D6DC 1JZ8A 2YRBA 4H5SA 1PY4A 4GW5B 5FW8A 1DO5A 2JLLA 3D07A 1CC3A 1WFNA 1KEML 3VTMA 3GMRB 3ZKND 4PBDA 5ADOL 4H8WL 4OAWB 3B7TA 1FZJB 3F84A 3CVIL 1YEKH 1MCOH 1RIVL 4TMPA 4WQOA 3L4YA 3UBXG 2GHWB 3D48R 4NRZB 2BRRL 3FUEA 4LEXH 3R19A 3STLA 3ZO0A 5T3ZD 1HL5A 1JP5A 4NBXB 4XWGH 1KPRA 3DGGB 4S1SL 2WO3B 1ZV2A 2VLJE 5D7LB 3EHBD 3ESPA 2EZ0D 1SHMA 1U3NA 3ULUL 2VMCA 2C9XA 4KO5A 3U6RA 3FBKA 4ZUTB 1B90A 3SGEI 1FCCA 4Y19B 1ZVNA 3F7YA 3LH9A 2YARA 3U82B 3ARFA 1RV6X 2MCAA 3WIIL 1OAKH 2BSTB 1YEEH 3L5XL 4MJIB 3MN8A 1NAMB 1NJ9A 1GSMA 1IGFH 3BW9A 3TNMA 2MNUA 2XXCB 3W5MA 2HRLA 2WCSA 3ABGA 3D05A 4IRSC 1U8JA 3G6DH 2D7NA 3CUPB 5C3IA 1KFAH 3B9KD 1TKWB 5D1XE 2E6PA 1FP5A 1FYTB 4L9DA 4WK4B 4LFHD 3FL7A 5FHBL 3L3IB 1C16A 3FN3A 5IV2B 3ATAA 5CJOL 5DJ0A 1I3VA 4PGBB 4W9KC 4KJQC 2XWDA 3B34A 4PGZA 4PEEA 2WAQA 2FECL 3CFKA 5ETUA 4X7FC 4QXTA 5D71L 1OO2A 3EO9H 4XBEH 2CO7B 2VC2L 1A64A 4HQQL 1QLEL 1FLRL 1KCSH 1TYJA 3CXFA 2R4RL 4S10A 5DQ9B 3WN5C 2IALA 4P2CG 4P3DB 1YEFL 2E86A 1X5HA 2BX5A 4GH7B 4R97C 4PS7A 3V5DB 4DO6A 5KYUB 5CJ8A 1AZVA 2W9EH 3E6FB 3L1OL 3AM8A 2QADD 3KD4A 3DUSA 5D7HA 2CU9A 3IDGB 4NJAH 5F7DA 4HUWB 2JMRA 2NQCA 4OR1A 1RIHH 4NQSA 2AK4D 1XSIA 5EU4A 3RDTA 3C5SB 1JI2A 4UQDA 1BECA 3KVPA 8FABA 1F00I 4JPWH 2UY7B 5IQ7H 1SFDA 1J5CA 1G1KA 3FYIB 4YDVB 3GS4A 5CLYA 1RZQA 1I7ZB 2G5BB 3M7OA 3O3UN 1MI5E 2DKSA 1RU9L 5CBEB 1OHQA 1S7UA 4GUPB 1AD0A 1IZKA 2ADYA 5D9SA 3VH8G 3SO3B 3BP6B 1SXZA 1IL1B 3GI8H 3DMMD 4BHUI 2BS71 1OAZH 1PIGA 1ZSHA 2NSMA 4NQVB 5TQ2L 3FMGH 4TUOB 2E3VA 1X5GA 3N0PB 4NO2B 5A2KH 4B0MM 2A73A 2J4WL 2N1KA 4RZKA 4L4VD 2EDHA 4WU5B 4XTRD 5HJ3B 4AG4H 3LHAA 4I9WD 4XMXA 3PNRB 3FFOA 5LCVL 1E4KC 1BFVH 4C4UA 3F5WB 4UT6L 2K78A 4AE1A 4OFVA 1OGAE 4J4PC 3E1F1 4BSVB 2VITA 5K59E 1WAAE 1GJIA 3AY4A 4ORZC 3UIZA 3BN9C 3HR5B 4HF5L 5B7EA 3HG1B 3ZGIA 2VAAA 1FCGA 4ZG1A 2PCPB 1LEGA 2BP5M 5KSBF 4YOKA 4AKOA 3T77A 2EDRA 1NCCH 3MCLL 5J12B 4JQIH 3S88H 3OVUB 3QDGD 4M7JH 4HKZB 4TUKH 3CTTA 5FO8A 1QEWB 3E8UH 2X6BA 4DKDC 4QOKD 1USQA 3GJFK 4KX9A 2ZE0A 4WWKC 4Y1AE 3SZ6A 2PPDA 3OX8A 4F5CE 1OK0A 1G6RH 4PJAA 4TQEL 4PJ9A 3QUYD 4P3CH 4PJGE 2Z8WC 4Y5VC 5CR1A 4BZYA 4PS4L 2ZXDA 2X70B 2A5UA 1N5YL 1RJYA 1H9VA 1F90H 1KJ2H 2BLFA 3QC6X 2XX1A 4OZGB 2X5PA 1ZEAL 4RFEA 3ARVA 1CFBA 1WPCA 4WI8A 1KGJA 2Q8BH 4X9FA 1D6VH 1JERA 2R23A 3QHFH 2BOBB 4UNUA 3NIFE 4LSQH 2OJEA 2GEEA 3T6ZA 4YHKL 3NK4A 1Q1JH 2P80D 1M7XA 3L9RB 4OF3A 3SKMA 2JNZA 2YGNA 3V7MA 3GBEA 5HHNA 1FG2A 4Z7OF 1J0ZA 1FIGH 4PLKC 2NXYC 1SLUA 3BPLC 2Z7WA 4KOBA 4MZRA 3AWFA 4DAGL 2BS8A 4HOXA 4ZAKC 2JI1A 3HTLX 3WTYA 2EIZB 2JKJA 2WUCL 3EO0A 5GZOA 4LSVL 4OLXL 2E7CA 1QRKA 4CDGC 2AABH 4IIQA 1FZKB 1AO7B 1EDQA 1S9VB 2XFXA 5B3NA 2JKLA 4PJCE 2OMWA 3Q1EA 3X1EA 4Z5RB 2PP8A 4FTDA 4TNGA 1KXVC 4WO4C 1CXEA 2EYRA 1TQTA 3F64A 2HPOA 1IGJA 1MRFL 3QUXA 3FCBA 4HAFA 5ID0B 3JTTA 3N40P 3WU1A 1I1FB 1S5HA 1X4ZA 4JLRA 2K0RA 3MRHB 4LLUB 2DM3A 4EN2A 3BKJH 1P4BL 3UMTA 1SXCA 4I2XE 1JD9A 3HC0A 4MYPA 4J2QA 4XPHH 5CJXC 3V0WL 5IMOB 1F3DJ 1N68A 3QPQC 5ALCH 1J0IA 2VDNB 3BN3B 4CBPA 4GUQA 5E95B 5ICYA 1SMAA 1JFHA 2EILB 3LN5B 4HZLB 2CMRL 1O9VA 1QBLL 3UG5A 3VXOB 3BAIA 1IKNA 3Q48A 2N4IA 4IYKA 4PJFF 3Q8AA 4UOW0 4HDIA 5CIPB 2KDGA 1B0WA 1T7YA 3H9ZA 3HAEG 3DSFH 3QZPA 1ZRUA 4QRAA 5INDA 3V9FA 1UD3A 1QLRB 3OKKA 3WIHL 2XOTA 1MZZA 4BZ2A 5DJ6B 1CFQB 4HJJH 4ZT1A 4IRJC 3KW7A 4R2GC 2LT9A 4OF8A 1J8KA 2JQZA 1ZHNB 2OMUA 4RMUA 1A0QL 3B2VL 4EOWL 4TF4A 2YD9A 1I4FA 1A47A 2YN3A 4LLDA 3S36X 3B9DA 5ANMA 5CUSH 2OR8A 5EO0B 4GG8A 2X7LA 2ZXGA 5FFGA 4Y5XA 4JM2A 5J6HA 4UINH 3FFCD 2P8MB 1T5XB 3D4GA 2HFGH 4PTUB 4RGNE 2IH3A 4XPFH 4XPGL 4GAGH 5B1JA 2ZYHA 1TYEB 3TS8A 2IDQA 1AOZA 3I02A 4PRPA 4RMRA 4L1TA 4YBQC 5MEOA 1IGFL 4R8WH 4KX7A 3JSSA 2ICWI 1VACB 1DANT 2TSAA 3VRIB 4LAJH 5FW6A 2A83B 4ODVL 4RZCA 1WBXB 4GO9A 5C08A 3T09A 3UZVB 3O6ML 4X7DC 2OZNA 2E4TA 2YPLD 4AYDC 4JCLA 2J8UB 1JI1A 3O2VH 3PWPD 4HUKB 3GJFA 4Z7UF 5FUCC 3RNQA 3NIDE 3T1FB 4PJ7E 1A14L 5KW9H 1INQA 2H2PD 1JNHA 1KLGA 1T0NB 1X9QA 2EDFA 3Q2CA 2X44D 1I1YA 4R7NA 1R24A 5JORB 4XO8A 1NDTA 2EO7A 1FFQA 3FH7A 1CURA 3QQ9D 4MJ5B 2JCCA 2P46B 4WHTA 2YUZA 2XN9E 3CSTA 2XG5A 5EV7A 4IKJA 3R4RA 2PWFA 3VQ2C 3TBTB 2Z35A 3UTOA 1MW2A 1Z5HA 3JV6B 1J8HB 5CP3H 3UBFA 5ACZB 2XWEA 3SE8L 3W0WD 3L9EA 1OB1A 1K2DB 1KV3A 5IQ9B 1SM3H 2XX0A 4NCDA 4JPWL 2QV4A 4L3ED 1CF8L 5M95B 1CQKA 3IDXL 1URIA 4KKLC 3FZUD 4JRXD 5CCGE 3G3LA 5FB8A 1WFOA 1DEEB 3FT4B 1SQ2N 4MD5A 5JIIA 3T04D 3CVHH 3JQOB 1NINA 4BKLA 3VFOB 4MDJA 2MTPA 3A4FA 4IBSA 4R5XA 5E2VH 1VESA 3PDGA 2L04A 2NR6D 1N7ML 2EUWA 1KTLB 1H3VA 5EBWB 1TO5A 4UIKL 2Q3ZA 3RIAK 1LEKB 5T1KA 4IOIA 3W1ZA 2ZPKL 4YE4H 4AG4L 1D5IL 1D7CA 4NERA 4UNTA 1J5HA 3Q5YA 2HSIA 3ES6B 1XGTA 1SOKA 4JL1A 4PP2B 4QY8A 3QW9A 4KFMA 2CUMA 5EA0H 4M7ZB 1QSFE 5KUMA 2Y25A 4CRPA 4WJ5B 3OGCB 4FQXA 4M9OA 1WD8A 4DP8X 5LQBL 4MXVF 5F70A 1WV7T 4CVXB 3I50L 2F18A 4X4XB 4N5ED 2XQBH 3SE4A 4N25A 2VZUA 3NCJL 3Q5TA 4JQIL 2HLAA 3KPSB 1T1YA 5BS0A 5KJ4A 1D2OA 1P5VA 2G3XA 1JDCA 3FTWA 3BHBB 3E8UL 2AJ3B 1UKSA 1W72B 3I2CH 4X4ZA 3SO3C 3GBML 1QI4A 2E7MA 4OCWL 5A2BA 4JRYB 5CN1A 2IXQB 5DJDB 4HALA 1GVIA 1G6RL 1Z3GL 5CCKH 4KTYA 4H8UA 4Y9CA 2GBTA 3VSVA 1KTDA 2FB4L 4CSZA 2Y7LA 2WXNA 3ZDYE 1SOQA 3AXLB 4Y8AA 2IAMB 4O9HL 4WV1B 4QRSB 2FX7L 5EPMB 3H9SA 4ABUA 4OZIA 1CD1B 5C9JA 3CHRA 2Q8BL 5ABZA 5CU5A 1D6VL 3QHFL 4IBUA 4GBXD 4FA8A 1T3FB 4J8RA 2I7OA 2YBRB 2W07A 3HVNA 4BFRA 5EIVA 1ZCRA 2O72A 4QT5B 4GUOA 4PV8A 1AQMA 5TE7L 3NUKA 3T4YB 3BUPA 4XN2A 1ZLUK 4XE5B 3I9GH 5J12C 2ATAA 3CDGA 4HJUA 5I73C 2Q10A 5DUPH 1RLWA 1F8TH 1LO3H 2A74B 5C7XH 2RMNA 5E8DH 3ZKNC 2YPKB 1S7TA 4XPAH 1JF1A 4JG9A 1NCTA 5CILL 1SXAA 3T9WA 4JR9H 4F7KA 4FOMA 5BRPA 1I8AA 4NZJA 3QJZA 1OGTA 1WWBX 2QSTA 3IDNB 4L5FL 1IGYB 4QHLA 4S0TD 3PNWA 5ESAA 4ZMOA 1HC1A 3RA7L 4XOAA 1G0DA 4KJWD 2EZ0C 2VL5A 3EJSA 1BG9A 2OMXB 4NOFA 1D5MA 3U0TA 1X5YA 3C6LA 5IOKA 5FK9B 2QKIB 1N0XL 1G9EA 3VI3E 4DZ8A 3B2XA 4R0LA 5B8CB 3PWLB 3RAJL 3V5HB 1Z9PA 4M5YH 4KTGA 4F15B 3HA0A 1H19A 4PIBA 5FM8A 2YEZB 5ALCL 5I28A 5DVNA 3HE7B 4L3EB 3S0PA 3U79A 1DQJA 1DVXA 1U8MA 1LL1A 3N41B 4B95C 2PXYA 3B9KC 3EUUA 5I19H 4N8VG 4FDWA 3LKRB 4M93C 4TLUA 1SDDB 2XV0A 3MXVL 4XO3A 5D2NB 3I84A 4EKJA 3QRLA 2CIKB 4Q6YA 3BSZL 5EF3A 1X5KA 3HZYB 1RIUH 3LEYH 3MRCB 1R5WA 1KV7A 2X89A 3GGWA 4PY8J 3RL1B 1S78D 5KVEH 1PG7X 3RYMA 3P4OA 4KJYA 2JKSA 5D4JA 3QWOA 2X1XR 4FLHA 4NWTL 2I9TA 1E4HA 4RAVA 4AIXA 2BMKB 3BIKB 4Z23A 1D6EB 2E47A 1FPTL 4X6BA 1KY7A 4DP2X 2AAVA 4C59B 3HZVA 1BBJA 4Z3FA 2HUEA 5IVXE 4DP5X 4AZ8B 3QJFB 4CMHB 5DJYA 3FB6A 4N2HA 2FEEL 2O61A 5DD0L 4I3RH 1A7PH 1QSZA 4ACTA 4MCYA 1AXTL 1IC1A 4PJ5D 4R8WL 1ZXKA 1NGPH 2AXHA 1H8SA 4HKBB 1B88A 1BZ9B 1NSNL 1YPZE 4UQ2B 5GZNC 3L3GA 2AS5M 1J9CT 1MFAH 4BEIA 1PKQB 1SLXA 1VFAB 1V7MH 2CLRA 4Y2DB 3GSRB 4BXVA 1SJHA 2PCXA 4M1CC 1C8QA 3VI4A 4DT2A 5I1DB 3QQNA 4WEBH 1PX4A 3MVSA 2WP3T 3II1A 1BXAA 5D4HA 1ZLWH 3DMMC 4NZTH 4HWEH 2GJZA 5FR3A 4HLZH 4IBQA 1S4IA 4U6VH 5KN5A 1GGTA 43C9A 1XD0A 5AZ2H 1QPXA 3RI5F 2GAZB 3D69A 4TNWF 3VFPA 2XXFA 3SKOA 5DVLA 1FN4A 4XTRC 4AXWB 4G82A 5AOKA 1NDMB 4Z0BH 5TGBA 1ZANL 2ZQKA 5SX5H 3P2TA 2WO4A 4NP4L 1FGVH 3PABA 2GT9A 3S3DB 4JFYB 4AMKL 5EORH 4BFJA 3IFLH 4AUJA 2X4PA 4XN4A 2V3EA 3T2QA 1N5AB 1W15A 3QEQE 3SJVB 4QRPA 1NEZB 1PEZA 3MV8D 4Y8DC 1V27A 2YD8A 4H1LA 2G30A 4NM4H 5CLWA 4F7MB 4ANUA 3TWCH 3IFOA 4YXKH 1KIUA 5LKNA 4PYHA 1AKJB 3GSNL 5D1ZI 5HPMB 4XC3H 3BAYA 4AGQA 4UU9B 1D5ZB 1MNNA 3O3DB 2QGEA 4DKAA 3FUKA 1YNLH 5CJQL 4J3OC 2J2ZA 2WLMA 2WQXA 1PL3A 3ULSA 1R0AH 2ED7A 1GHFL 3ME0B 1FNEB 1UA3A 3D3VE 2DYPD 1DDHA 4TSBL 3SPJA 5D7KE 1V7NH 1R3KB 2L0DA 1WBZB 1XCQB 3QUYC 2CDGB 1C1EH 1DVFD 4OM0L 4WFFD 4XPBL 3TBCA 2FBOJ 3G04B 4G7SB 4OSUH 1FVDA 1MFUA 4DF9A 2VRQA 5I75B 1A9VA 3FB5B 2YGQA 1H5BB 4H44C 4DW2H 4IDJL 4FZ8H 1CFSA 3IDYC 1HL4A 2VXQA 3ZYIA 5CKAA 1TQBB 1NEUA 3JWOC 5B1AB 3EFFB 1M7IA 1OAJA 4K94C 4PJIB 4NCC1 5EC1A 3U48A 2DIEA 3G6JF 4I4WB 1YMMA 4NO0A 5EA0L 4ZMLA 3FB8B 3MRQA 5E9AA 4KKQA 3ZLQC 3HI5L 3K46A 3CWGA 4TNEA 1DLFH 1EO5A 3N2JA 5D7IE 5JHDD 3TFKC 3HPLA 2FT6A 1QRNB 4E5XA 4JHZA 1EAPA 1Y1DA 4RMTA 4PJXB 3QXDA 4D2NA 1CT8B 2FGWL 2Q2LA 1IARB 3CIAA 5JHAA 2HTKC 3MXWH 5DHYB 3W11D 5IVNA 2UYLA 1H3PH 3WS6C 4YZWA 2W38A 1RK1A 1I7TA 3BE1H 3NG5A 3F65A 2DIAA 2NRDA 4YQXL 2OBGA 2VH5H 3QIUD 1E65A 3RTQB 4K23H 2WNGA 2XFGB 3VACA 1EV2E 3D18A 2VCOA 2PO6A 4WKZA 3LKOB 1O7VA 2ZAHA 4EUPG 5C0CE 5GSVA 2DWYA 3LB6C 1UCBH 1XGQB 3F3HA 3P11H 4LESA 2RBLA 4HA1A 2Q5BA 2K7QA 4MMXB 3CLFL 5DWPA 3BXNA 3DX3A 4Y4HB 2GIMA 3ZT5A 3APFA 1U8PA 2VW7A 4HPHA 4R84A 4M7ZC 3CZNA 4HBCL 2NUPA 4IKNA 4LARL 4KU1A 5ID1A 3U0WH 3RKDC 4P2RD 1MF2H 3BOVA 3QZLA 1VEOA 4W93A 4MA1B 3L4XA 3O9WB 4A55A 2GIXA 4NM8H 1EMTH 2VDKL 4K15A 1LO3L 4CC1A 5C7XL 1CGYA 3CIQA 4LLVB 5E8EB 2ZX6A 5HY9A 3V4PA 3QYNA 3IDMA 4JL2A 4I0PB 5ANHA 3U9PL 5C92A 1K5NA 5EEUA 1KDJA 4HS3B 1IAOB 2F5AL 5I9QB 1HNGA 4OF5A 4XCEA 4HAKA 4Z77B 1TNMA 3F12B 2VLRD 2VE6A 4MDIB 4NS0A 2IG2H 3SGDH 3TN0A 5BPPA 5CP7A 4GKOA 4ZQKB 2CHDA 4F2MA 5GGSB 5AWNH 3FUDA 4U05A 4DGWC 2EIJB 2IAMC 5I74C 4WV1C 3T8MA 3X13A 2R83A 1NGZB 2AK1H 4Q6IA 2ADIA 4KDVA 4YDLB 1RZKH 4K5LA 1A1OB 3D0VA 3QJHB 4XVSH 3SDCA 1Y6MR 3L7FB 3EYSL 3LYRA 5LGHH 1T0PB 5DLML 4G6JL 5E1AA 5E8PA 2OW6A 5I8EA 3TIEB 3MNZA 5K39B 2WZAA 4M03A 2IWKA 1J8SA 3EDEA 5E4EB 3HB3D 1A3RH 2DMBA 2VDML 3QULA 2ZP8A 2DQUH 3ATBA 5C0IB 5I5IA 4NC0B 3TBVA 2A74C 3BISA 3BAEH 3FYEB 1C5BH 4JG0L 4PRHD 4KMLB 4JJOA 4XODA 1HXKA 2AV7B 5ANME 1NC2B 2H2PC 2C7UA 5IVOA 1I8KB 1RVFL 2J55A 2GY5A 2DJ4A 4MAYD 3P3TA 1G9NC 5IB4B 1T1XA 4I18A 4Z3IA 2ZUVA 4CC0A 3HIZA 3ZN6A 3PDOB 3QQ9C 3LKPB 4GXUM 4CNIA 3QA3A 4HMEA 5EB9A 3QR2A 4L3CA 4S1RH 3RPIB 4NKDB 2QKIC 4KXDA 3I3DA 1FSKC 1A4BA 2KI6A 4L2LA 1N2RB 2FBJH 1HIMH 1TITA 1OXYA 5B8CC 5LG6A 2EDWA 4NNYB 3H0TA 5HVFB 3RY4A 5C09A 1KWKA 1KCUL 3EDKA 3P9LB 2EEXA 2EVGA 3SPVA 1J86A 2FSEB 3H2QA 4LHUB 3C5ZA 3U4BL 1LWRA 4PVNA 4WHYH 5E51A 3WEAA 1U8IA 3UJJH 3LPWA 4F80A 4HEME 4AYMC 3FZUC 5BJTA 5HYJE 5TE6L 2LE9A 2BSSB 3CPUA 5D2NC 5AOZA 5IMLA 4FRWA 2X4NB 2JCCE 3AZUA 4CDHA 1KGCD 4HWEL 4JFHE 4MQ7B 2XWCA 4N2NA 5EZJB 5IT2L 3U0PA 1DQLH 2NR6C 3P3UA 3EO1B 2YRPA 3M07A 3ALPA 4POUB 3SYPA 2JKNA 2JTDA 4X5LA 5AZ2L 2KT6A 3VD9A 1GZHC 4B41A 2IO5A 5AL8A 3UO1L 2XZCH 2XN2A 5EEXA 2DQCH 3MMEA 2RFXA 4AVKA 4JRWA 5IFHH 3WELA 3WE6B 4D0CB 5L2KE 4KQ3H 1DBBL 1A6ZB 1AS8A 2Y6SD 2E6JA 3DARA 3O2WL 1EDYA 3WUWG 1E6JH 5EOCJ 4P4KD 1BIIA 1HQ4B 5BCAA 4CMHC 1R3JA 2W65A 4FTVA 4HGWA 4YFLF 3LRSB 4R96A 4ES8A 1A7QH 3CFBB 3NZHH 3EOBB 1PLAA 3N1GC 4P2RB 3BP5B 4NWUL 3HUJB 4RFNB 2FO8A 3G6AA 5JHBA 1DLHA 3FQXA 3ESOA 4JKMA 4E41D 4JY5L 5KSAB 1QYGL 1Q0XL 2J71A 3FRPB 4Y2DC 3KYMA 2B9BA 4OZGF 4OF0A 3CFJA 3G5ZB 5CR8A 4OLWL 4Q0XL 3A0OA 5D1QA 3QPXH 5DR5L 4OGAD 5SWSA 4L8SA 4BE5A 2WINB 4P5TD 3ZR6A 5IB3A 5BZWB 3V6FA 5AQ0A 2QLVB 2DLGA 2VLRB 1DFXA 4EDWH 5DMIL 4BCYA 1ZOXA 2BWIA 3OWRA 2SEBA 2YIHA 3LN4A 3LKNB 4FZ8L 3PWVB 2NUTB 2DYSB 2DM7A 3LKQB 2B1AL 3WXVL 4UM8A 1KXHA 1WK0A 3DLQR 4Z8FH 1J5OL 4N6RA 4LLWB 4LBAA 5HYSA 1MCIA 3WHXB 5T3XD 1QI3A 4JN1H 2P49B 4F57L 3QIWD 5IFJB 4AL8L 5BS0E 4H0GA 1RUQH 1XCTB 3TPKA 4LKXA 4OGQC 2EVIA 1CE1L 2EEAA 3GJEB 4FCAA 3MJ8A 3GRWH 3VXNA 6CGTA 2ZXWB 5KVFL 4QF1B 4HWBH 3CXDL 5F7BA 1KJ2A 43CAB 3L7EA 5FECB 2B7DT 4B7LA 4R4FH 3AS2A 5F1IB 3PGFH 3P4NB 1N64L 1B0RB 2I5YL 4OGYL 4BFIA 4QKXB 1PZ2A 4M5ZH 4MAYB 3QZWG 5HI4D 2X05A 5A6MA 4IHBA 2ADGA 4MD0B 2E4FA 1ZGLM 3FTGA 5FGCE 5LWYH 1S7XB 4H13C 3DV6B 1H5BC 2AXWA 4W9JC 2OMZB 4ICXA 2X41A 1YEIH 1FJ1A 4KY1H 3O6LL 4C4KO 5D7SL 3GXMA 1EEQA 3NCMA 5D1XD 4BH7B 3ZDZE 1DBJL 4PTTA 5EU5B 4LL9A 3UBXA 4RBPH 5C07B 3QUHA 2QBWA 4F37F 1Z5LB 4FQ2H 1TG8A 2R2HB 1DBAH 1FZOA 3HNVH 3K72B 2FNWA 3VFWB 1EMTL 5IHWA 1RUMH 2R2BB 4X8JB 5ELIA 1LP9E 1W0WB 4QTHA 4XVOA 1E9PB 1SJXA 3G5XB 3LMJL 2HVBA 3V0FA 1S78C 3FDWA 2A9MH 3RNKA 4IMLA 3FONA 3NJLA 5AG8A 4EI5D 2RD0A 2IG2L 3K7UA 2A9AA 2AI0H 5D72L 1ZA6B 2XZAH 3APCA 4JVPA 3PQYE 5C0AE 4RGOH 5K9KA 2VM4A 5I26A 2A6JB 3U9UB 4MMXC 2XWZA 5BUAA 2NW2A 2ITFA 4OGXH 3U4EB 2NYKA 5DMKB 4PCTA 2VOTA 3SQOL 1KIRA 2MQCA 3ULUE 3ZX1A 1I8IA 1MI5D 3GXIA 4J3OF 4AX3A 1YNTA 3CX5K 3NJJA 5F1KC 1AGCB 2V9TA 3U4KA 1A3ZA 5HHME 3HJEA 4RIRA 2GJ6E 1S7SB 1FV1B 5J13C 2ZSWA 5JXEA 4MA1C 1EAQA 4YPGB 3UCRA 4B7IA 1E28B 1KNOB 4FMVA 1U8KB 2DQUL 3KBHE 4AGLA 2OSXA 1KIQB 5IY5B 2JXMA 1AIZA 5T3ZH 4DGIL 2XN0A 1A6VH 1IE4A 1O9WA 5FYLL 5LBSL 3KHOA 1MWAH 2OMNA 1G94A 4POYA 4OLYL 4OUUA 4LMQI 3UPCA 2APXA 4GRWB 2JV6A 2XPZA 5L4MA 4G83A 5JW4Q 2CIIA 3V0DA 2XWBB 3CD4A 3MLSL 3D4CA 1XGPB 1X5FA 3SOBH 3VSUA 1A1NA 4XN7A 3O4OC 4B5EA 4P2OB 2ZUSA 5HVWA 5HHPB 2YO3A 4M29A 4MNHB 1DUYB 2MHAB 3CXHK 3NABH 4KUZH 4FHBD 4NT6B 3UX9B 1GMEA 1S9WB 4B27A 2CXGA 2DLIA 2VO8A 3QIWB 3SDAA 2CE6A 4FNTA 3T2LA 3HOGA 4KMTL 4TSAH 1QACA 5J56B 1O7DC 4GRMB 3GI9H 4Q74A 3GRGA 3VVVA 4AQEB 4Y1AD 3JV5A 4NXSA 4NNPL 3SBWC 1YUKB 4YO0B 5EF1A