The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
170
|
structure length |
170
|
Chain Sequence |
ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAID
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Chaperone
|
| molecule keywords |
HEAT SHOCK PROTEIN 40
|
| publication title |
The crystal structure of the peptide-binding fragment from the yeast Hsp40 protein Sis1.
pubmed doi rcsb |
| source organism |
Saccharomyces cerevisiae
|
| total genus |
31
|
| structure length |
170
|
| sequence length |
170
|
| ec nomenclature | |
| pdb deposition date | 1999-07-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01556 | DnaJ_C | DnaJ C terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | Urease metallochaperone UreE, N-terminal domain | ||
| Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | Urease metallochaperone UreE, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1GMW A; 1GMU A; 3AGZ A; 3TJA A; 1EAR A; 3L9Z A; 3LZ8 A; 2QLD A; 3NY0 A; 1GMV A; 1EB0 A; 1XAO A; 3AGX A; 1NLT A; 2B26 A; 3NXZ A; 1C3G A; 4J80 A; 4L3K A; 3AGY A; 3TJ8 A; 3TJ9 A; 3LA0 A; 2Q2G A; 1GMW D; 3I38 A; #chains in the Genus database with same CATH topology 1GMW A; 1GMU A; 3AGZ A; 2JVM A; 3TJA A; 1EAR A; 3L9Z A; 3LZ8 A; 2QLD A; 3NY0 A; 2JZ8 A; 1GMV A; 1EB0 A; 3C5X C; 2ODX A; 3C6E C; 1XAO A; 3AGX A; 1NLT A; 2B26 A; 3NXZ A; 1C3G A; 4J80 A; 4L3K A; 3AGY A; 3AKO B; 3TJ8 A; 3TJ9 A; 3LA0 A; 2Q2G A; 1GMW D; 3I38 A; 2JRR A; #chains in the Genus database with same CATH homology 1GMW A; 1GMU A; 3AGZ A; 3TJA A; 1EAR A; 3L9Z A; 3LZ8 A; 2QLD A; 3NY0 A; 1GMV A; 1EB0 A; 1XAO A; 3AGX A; 1NLT A; 2B26 A; 3NXZ A; 1C3G A; 4J80 A; 4L3K A; 3AGY A; 3TJ8 A; 3TJ9 A; 3LA0 A; 2Q2G A; 1GMW D; 3I38 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
