1GMUA

Structure of uree
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation.
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Metallochaperone
molecule keywords UREE
total genus 36
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmuA02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmuA01
3AGXA 1C3GA 1EB0A 3AGYA 3I38A 1NLTA 2B26A 2QLDA 3TJ9A 3LZ8A 3TJAA 3NY0A 2HFVA 1GMVA 3LA0A 3TJ8A 1XAOA 4J80A 3L9ZA 2Q2GA 4L3KA 1GMWD 3AGZA 1EARA 3NXZA 1GMWA 1GMUA
chains in the Genus database with same CATH superfamily
1Q0NA 4USJC 5C42B 2ZOGA 1K1QA 4F25A 5F8HA 1DTQA 2VQEJ 2G2OA 4ZP7A 1NK8A 5GAGI 2HLTA 4ECYA 2L9WA 1VQYA 2HHTA 1B64A 2QRRA 1P9QC 1SVDA 2G1HA 2J8AA 2VG5A 3UVJB 3TVKA 1P6TA 4CO2A 1KEKA 2JEJA 3W8GA 5HVHA 4Z2XA 5HLFA 1MN9A 2HKEA 1L3TA 1FHTA 4RZRA 1DJ0A 4H4KA 3PYFA 2BVZA 3ADAC 4IG0B 2DITA 2FHJA 3HSJA 5AJ3J 3MUTP 3B4MA 3OFHA 3BYRA 2Q2GA 5E3AA 4ELVA 4DJBA 3AXKA 2DR8A 3CJ4A 4J9MA 2FY1A 1JXVA 2GIFA 1NK0A 4LF7F 3MR3A 2OTLS 1YG0A 1RGVA 1XR5A 1D3WA 2AEMA 2ZBCA 3GFXA 5AE2A 1Y00A 2BJDA 2HWIA 3VF0B 2Z0GA 3NAIA 2F8HA 3IBFB 2ZH8A 2ZH4A 3VQTA 2CVIA 4XAKA 1BLUA 3P5BP 3UO0A 5DJBA 4F3QA 1S10A 2R8KA 1OO0B 3MFIA 3KK1A 2DGXA 1ZAVA 3OR2B 5SUHA 1XC9A 4Q2LA 3JB9k 4WE1A 5CABA 2NREA 2LQJA 1ZETA 1F2GA 4YHHF 3J81j 4HTIA 1JXLA 2ZZTA 1X4HA 3TAPA 3QLHA 2CJBA 4F4XA 3IGNA 2XI3A 4ZA1A 4CT9A 2LEBA 4ZCLA 3MPWA 2OEMA 4M5DB 1E6VB 4ZP8A 1N5TA 2K1RB 4IRDA 4GKKF 2XHCA 3M8YA 2DH9A 3ISZA 4FZVA 8AT1B 3BQ1A 1GXTA 2HHQA 2VKZG 2C2KB 3C6TB 4ER8A 4M5DA 1YBUA 1FO1A 1XK8A 3D6FB 4DN0A 3THVA 1RAAB 2HFNA 3I4HX 4OLPA 2XWXA 4QCLA 1B70B 1PJ5A 1ULRA 3BGFA 1QE1B 1SB6A 4JI8J 3WX8A 3BSAA 3SFUA 1IBMJ 2QE5A 2ZH5A 3BKTA 3DKDA 1S1UB 3BSOA 1TFYA 1HWKA 3GILA 4FF3A 4LBPA 4LSNB 3Q2TC 3QBCA 1OMSA 2KHCA 3Q89A 5DGBA 3H25A 2JLEA 2OFGX 4EEYA 2RD5C 2KXHA 2HQDA 4NYPA 1FRMA 5F9NA 3A3OB 1UEVA 5F9LA 2DCUB 2CZVC 4F36A 2XS2A 3IXQA 3IP0A 1S1WB 2NXEA 4IH7A 2V8PA 4MT1A 1HQ2A 4FF4A 3EZ5A 4LF9J 4NYOA 3CD0A 3R5GA 2RQMA 1HQUB 2BW2A 3D54A 2J9DE 3R6LB 1L3UA 2FHMA 2UUAF 1SIZA 2RHSB 1RUSA 3DMJA 1SXLA 5HMZA 2ZD1A 4FNHA 2D3UA 2J9EA 3N79A 2D74B 2G0IA 1G2EA 4OYXA 4DSJA 2AJFE 4JI8F 5KAKA 2XCPA 2QA4S 4IDKA 3IS9B 2ZEJA 2MEWA 2HS3A 2XYPB 4IG3B 4K59A 1JJCB 3KNGA 4ANEA 4HACA 3UN5A 1M5SA 3FFIB 3L4BC 4JI4J 2FGOA 3AD8C 4ZCMA 4LJMA 1KN6A 1PIEA 4L3NA 3BO4A 3SI8A 1MWYA 5GMKa 2VDHA 2YNGB 4GVBA 5ETOA 3DI6B 4BWJA 1IKYB 2FHJD 3MEDB 2R7WA 1EARA 3BYPA 2DVIA 4F4WA 1C1CA 2N3OA 5G4DA 2K3KA 5KG5A 5E33A 3PW5A 2HZCA 2EFNA 4WU3A 1TMJA 4CI0B 2RAQA 1HBUB 5D3GB 2UUCJ 2ZHOA 4DMZA 3H8YA 1R8HA 1YQHA 1RHQB 4UOHA 3OVSA 1WUUA 5HROA 5ETSA 2DO4A 3C8YA 2CNKB 4PCQA 2M70A 5E3CA 3KLFB 1UVMA 3AHPA 2W9BA 1X4CA 1KDNA 3IRWP 3K5NA 4Q0BB 4Q0BA 1R8AA 3IRXA 4WP8A 4URSA 5A76A 5C25A 1FT8A 2HNDB 5L1IA 3NWGA 3BGOP 2DRAA 3HFKA 3Q0AA 5H9FK 2KXFA 2GAHC 4DV0J 2UXCF 3JYTA 1CQNA 1N88A 1RA6A 2HNZA 3OLAA 3CCVS 2LQBA 2ATLA 5KFYA 2Q66A 5KTQA 2BOPA 3OSNA 4CNYA 2PGCA 4UTGA 3PNIA 2XY5A 4DR3F 4YDDB 2OFHX 2CWXA 2GA7A 3CCMS 4URQU 3X3UA 4FXVA 2LECA 2ZM6F 3LP1B 4TU7A 3RW6A 1W25A 2M8DB 5J2PB 2MQMA 1HW9A 4ZPWR 2AT1B 2UVRA 4ZLNA 2HFVA 2B4VA 3CJTA 3M8PB 3PYEA 3TA1A 3OJSA 1S0NA 3PY8A 3R2DJ 1PYTA 2EK1A 4WKYA 4LF5J 4NLPA 3IBWA 2BJ3A 1B0VA 3TX0A 1HD1A 3K2YA 5HQMA 2W8KA 1LK7A 3CCJS 1VQMS 1N52B 1UA1A 1VMBA 3O8WA 2WBRA 3L9ZA 3LTOA 3GG0A 4FXWA 4CNZA 3D6TB 3GWCA 2GO8A 2IRYA 2DRBA 3RR7A 3MUMP 2FJVA 3O1LA 3I5AA 3CIMA 4HTJA 3IG1B 3RYLA 4EK2A 4DV2F 2C2EA 2PMWA 4C6AA 3KK3A 2GX8A 4ID5A 5C5JA 1G3OA 1R43A 1SH3A 2MHEA 4C11B 2BE7D 1JLCA 2NLWA 1UVIA 4G1PA 2GHVC 1NHVA 3MD3A 4C8MA 2QZ8A 1JLBA 3RBZA 4YB1P 2HQIA 1S72S 4OX9J 1FVSA 1AYEA 2MQ8A 4K0KF 3DLHA 2W4DA 1UW4A 3DLGB 3NCRA 3CWJA 1WORA 3MMJA 4IFVB 4J9VA 3KLHA 1RT5B 2Y1JA 1QAJA 2BE2A 3DM2B 2HBYB 5DLFA 1HNIA 3ITHA 2YKAA 1QAIA 3I5BA 2XTJP 3QAEA 1ZAWA 2RQKA 3N0VA 2BBEA 3PTWA 4IDKB 4IYQA 4J5OA 4ZVQB 4N41A 4NLOA 1YKWA 4LF1A 5HQ8A 3HCXA 1E6YA 2RT3A 3NOGA 1M5KC 4YOEA 3K8VA 3PJWA 3CJ8A 1GMWA 3K57A 3D9BA 1D9AA 4ECUA 1M5OC 3MM6B 2C2RA 1FRJA 4DR2F 3K8WA 1XMOJ 2FQQB 3CD5A 3V6DB 2WTFA 3R9LA 3DXSX 2RQCA 2XYGB 3NGTA 2PT0A 3NRBA 1CBKA 2B5JB 2DISA 4NI2A 3DOLA 1K1SA 5AE3A 3OLBA 3GFYA 4OZJA 2AX1A 4XO0A 3CCQS 4USIA 4NA2A 2MZSA 1HYSB 3AB2B 4F3OA 4X64F 2ZZMA 3JTOA 2QA4G 1U2FA 2G0CA 4GO7X 2B9YA 2X1FA 3KFWX 4KB7A 1FWKA 4K0KJ 2B9WA 4WFYA 3J81Y 4CTAA 3I9ZA 2DBBA 4D3GA 3UR3C 3D3BJ 2DGTA 3AJ1A 5IXUA 2RIJA 3E51A 4DX7A 3POTB 3W2VA 3CO0P 5J2MB 3QZ7A 2PE8A 1GAOA 2KT2A 3GR1A 3KK3B 4DFKA 4V19X 1AUSL 3M9MB 2E5LF 2KL8A 3M9NB 2OH2A 2CQ1A 2Q3PA 4LRBA 3KHRA 4F0HA 2AZ1A 2HLUA 2EFVA 4KPCA 2GQ2A 1S4FA 1F3FA 4I69A 2GVZA 4B3SJ 2QL7B 4LR7A 3D67A 1XMBA 1FE4A 2XMWA 3GPAA 1NDLA 3N28A 4KBIA 3VGUA 4DDFA 5I3QA 4DV0F 3Q86A 4MYTA 3MXHP 4C9DA 2OIHA 1RT7B 2HHPA 2POKA 2KI2A 3CB4A 5DM6Q 1JLQA 2PO4A 2F4VF 3GR0A 4X64J 3CUNA 4QBUA 1GX5A 2R7XA 1RTIB 2L08A 1U6FA 5BR8J 1S6PA 2QT7A 5DZ7A 1VIOA 1URNA 2IYGA 4QWBA 2GJFA 4WTOB 1RT2A 2BANB 3DHWC 4DV5F 4J90A 4A46A 2IRUA 2BUNA 3RR8A 3U1MA 1WACA 3KJNB 2VFVA 5CD4H 2BABA 3I87A 2BANA 1LWXA 2OGUA 1U48A 3CCTA 4KGMA 4OQJA 1NMEB 1IR2A 2Z2MA 3MURP 2FVPA 2JZ5A 1VJQA 4Q43A 1Y3JA 2VICA 3AOAA 1TL7A 1OYDA 3G82B 4TU8A 3HHNB 1RHUB 2FJWA 4F04B 2VBWA 2MKHA 3LGNA 4S0MA 1K73T 4LFAF 4IR9A 2J6TA 3CCRS 4AD6A 1S9EA 1LWEA 2WB1D 3QT5A 1TL7B 3UNYA 1YX2A 2J76E 3CDWA 1ZA1B 3MEKA 3P4UB 4XDDA 2B51A 2K1RA 3W9IA 2WW8A 4DQRA 4CIOA 4JI7J 1OPZA 1A0OB 4DV6F 2ZBPA 2CDQA 3NGRA 2E5IA 1RBAA 2FB0A 5K9FA 5HL7Q 4B3OA 3QLHB 3AAWB 2YX4A 1X5PA 4KTQA 4MFBB 1RKJA 5KFAA 4LF6J 1CJUB 3G9CA 1S4EA 3KUHA 1X9WA 4B3OB 1EB0A 4QWDA 2J9DA 2MLYA 4LF8J 1HA1A 1U47A 2XLKA 1EKRA 3GFHA 4O44A 2CQ3A 5D4NA 2AQ4A 2KYXA 3W66A 2CNLB 4RW4A 4KY3A 2KO1A 3LZ8A 2WONA 2K8GA 3Q24A 1QAXA 2Y1IA 1TP7A 2MY7A 2DKOB 2OPRB 4TY8A 1NK5A 2RKIB 5KFBA 4F4KA 1JWWA 3NGUA 2CPFA 1NH7A 1TKZB 2WVEA 4DPYA 5IS2A 1ZOTA 4M5NA 4K4TA 3KTQA 3QRRA 2HQCA 1EKSA 3IC1A 1N4LA 3VTIA 1RTDB 4DU7A 2WB4A 1P27B 3D68A 1MLAA 4OYAA 2PIIA 3DRPA 3WC2A 1X4DA 1Y10A 4TLRA 1HLWA 2KZMA 1CVJA 2AWZA 3QT6A 4ED0A 1SPBP 2HIYA 1SC6A 4ZPDA 1WG1A 2IPOB 2ZKTA 1S1VB 1VRTA 1KQFB 3HMJG 2ADCA 2AJ1A 4Q44A 4WK3A 2CPJA 3GV7B 2GVDB 3CC7S 4NMXA 1WJ9A 4WFAQ 4B3TJ 5IOLA 1IJFB 4X4TA 3FQLA 1S12A 2XMUA 4IRCA 1SC4B 1X4FA 2YX1A 3GMGA 4C48A 2OSRA 5A8RB 2G1DA 1PBUA 2DXFA 3GCXP 4HACB 1N48A 3NY0A 2FLNA 1QD1A 4NASA 1T02A 2V4QA 1I3OB 2MZJA 3TUIC 3L7UA 4U8VA 5L38A 4ED8A 1HBMB 2QYCA 2VDIA 1CJTA 3ZTSA 5KFOA 1REVA 5LJ5Y 1M1KT 4AQYF 1S99A 1V6HA 3AKOB 3IWNC 1WC3A 3UD5A 2FLPA 2R7VA 3CPWR 3IFEA 5HMXA 5GADU 3MM6A 2RSQA 4AFFA 4IG0A 2CG8A 1KLMA 3DOMB 1SV5A 3Q8PB 2D3ZA 2K3IA 3VWSA 2CZ4A 7AT1B 1NJWA 2XMVA 1YBTA 2ZWOA 3FEZA 1EQMA 2WRMA 1LW2B 4OI6A 3GE9A 4AL7A 2YNIA 1HNWJ 3KG4A 4XIUA 5SZTA 3MM7A 4DLEA 4BLGA 1GTHA 1RP5A 1HPZA 3FBEA 3MEEB 1NK6A 2O1PA 4B3RJ 2MSTA 4ZVGA 3RB0A 2FJEB 1Z2ZA 2HGNA 2CWKA 2MZTA 3ULHA 5HMYA 1W2BR 5E3PA 1IBCB 2FJDB 4FYYB 1VRUB 3ZTQA 1VS3A 1UAWA 3QQCD 5A8KB 2I8EA 3GSIA 2AX0A 1FRLA 1Y3KA 1S9FA 4DL0C 1KONA 3FRZA 3C6UA 1WTBA 5LSOA 2I2YA 2JEIA 3HSZA 4K4XA 1S97A 4ELTA 1UP1A 4HT5A 3CD6S 2RMLA 2AF6A 1LOUA 3M8QB 1KVKA 4MKAA 1OIAA 1SBRA 3TZXA 2EPIA 4ZVSB 3Q23A 1HI0P 3QWUA 3Q8VA 4DOZA 4JI4F 4ZLPA 1RT4A 1RAIB 3G6YA 1H2TZ 1LWFA 4I68A 5E2QA 2QC3A 3DNCA 2AJ4A 1AA1B 4I7FB 2B0GA 4DPXA 2JL9A 3ITHB 9RUBA 4PR6A 4F4ZA 4DR6J 2LLZA 2MJUA 3EZUA 1I94F 4MAKA 2DNZA 3B78A 4OHWA 4DX8H 3Q2SC 2PMZD 4KGKA 4FYDA 2W9CB 4AL6A 4DPTA 2LCWA 3M1VA 3FSYA 1B7YB 4DG1B 2F40A 4WFNQ 2PD1A 4DSEA 4QU7A 1HR0J 2ZZNA 4V19J 2R7UA 5DDQC 5C2CA 1F5AA 3OVBA 2AV5A 2BKPA 4HLBA 4A8YA 5HMWA 1UFWA 4DZ6A 1Q8BA 3SCKE 1WC5A 1RLCL 1JLCB 3MAQA 1CJVB 1TELA 4F50A 2MYFA 4RU2A 2E9TA 1NK4A 2F8EX 2DGSA 3MR2A 3RBDA 1HNXF 3IG1A 3N6NA 1U0HA 2IM3A 2NSBA 3HKWA 4NL5A 3GU0A 3VGTA 3C6EC 2HQFA 2KYZA 3BDPA 4JI1J 2CIMA 1NDKA 2HHXA 4J9KA 5JUMA 1NDPA 2RHQB 2V4JA 4BBYA 4F26A 3EPGA 2OTJS 4GC7A 3EYZA 2A18A 4LR8A 2E44A 2GGPA 2MPUA 1S0VA 4WPAA 3SQGB 5MAOA 1GQEA 2DGOA 2KDOA 2WOMB 1RHRB 3J7YI 3R8YA 4AE5A 1S9GB 2IYIA 5KG0A 3TNVA 3KHLA 1J5OA 3PO4A 3SZ2A 1KS2A 5IT9U 1ELOA 3OHAA 2JC0A 2HZVA 3UCGA 5KFEA 1VQ4S 2C1EB 1REVB 1V3SA 4FBUA 3UDVA 1WF1A 4V1Ak 5D0RA 1Q16B 2R4FA 3PACA 1AXQA 3D0IE 3LP1A 3R5JB 1DBDA 3FCHA 2CA9A 4C8NA 3TUJC 5BJRA 1JJ4A 3W2WB 4F4AA 2IA6A 2AJ2A 1KNZA 1VQNS 2A10A 3Q8RB 1H3DA 2CAJA 1HBNA 2XSFA 4A8FA 2BEFA 4G65A 4YB7A 4C0OC 1V9OA 3PVXA 3DDNA 1APSA 2VHGA 4LQ3A 2JEGA 4ITSA 4Z7CA 1SCJB 1HWIA 2MXYA 1T0TV 4CP5A 3TP2A 2XSJB 3D3CJ 3T1HF 4OIXA 1EJ7L 4JYAF 4I2QA 1EQ0A 1WHXA 4DR1F 5KFQA 4FF1A 4RUCA 2XI2A 3FCWA 1YITS 4I4BA 1HMVA 4RUHA 2HSEB 1IUJA 5DG7A 4HI2A 3TUZC 1RT5A 1R6VA 1HHQA 4C8KA 5CHCB 4RWXA 1ZBTA 5LOQA 4KHPJ 5FJ4A 4WP9A 4ZLLA 3I32A 3LH2S 3OTBA 4ZP6A 1SL2A 2HQGA 1ZH5A 4WZQA 2V94A 2PI4A 3V4IA 1SUQA 2HRTA 2V8VA 1T9VA 1OSCA 4IFYA 5B09A 4F4YA 3TAMB 1FEHA 3AH6A 1FDDA 2NZCA 1Q78A 1VISA 1W2IA 3TJAA 2X1GA 4I6YA 1U25A 5HI7A 2CPHA 5I3UA 5B0GA 2AYEA 1TVRB 2ZITA 2NPIA 1A6LA 3GYGA 2YNFA 2I6WA 5F8GA 4PXDA 4QWAA 1JLAA 1TL4A 4KGXB 1IBLF 4X4RA 1XAOA 3MCNA 2FHKA 5CYQB 4CLZA 6FDRA 3GJTB 5MLCV 4DCJB 3RTVA 3RAXA 2C3MA 4LBIA 1QAYA 2V68A 3RGIA 6FD1A 2DRDA 2VPXB 3BDEA 1P1LA 1XTZA 3A4TA 2GIQA 3IM9A 1YJRA 3C16A 4HL9A 4WYLA 5JVGQ 4DUTA 4UT4A 4DV7J 1HBOA 1I94J 4PQUB 2BACA 4CLFA 5ETMA 4OYOA 4RBVA 4WJBA 4NXNF 3PEHA 5D4OA 4KPYA 2HRYA 3GYNA 4TYAA 4FPIA 4CO5A 3CJQA 4HT7A 2YKMB 2VFTA 3MMBA 4K5RA 4IH6A 5B0FA 3SV4A 2XY7A 3IAS9 4HVZA 2D3O1 4DSLA 1F9HA 1UW9A 2VPWB 2G9OA 3UW1A 7FD1A 2PEHA 3IR6B 1H74A 1RT3A 2C3YA 2EXUA 5ETKA 1S1VA 1VRTB 1Q79A 2RU3A 3MR5A 2GVDA 1G1XA 2M0GB 4Q5VA 4K50A 4AQYJ 3RB4A 2E5LJ 1VI7A 4P75A 3PRBA 3G71S 3OXGA 4DQQA 1JJHA 4NLQA 1XWLA 4O3PA 5J1EA 5HROB 2FIUA 2APOA 2GMJA 1RT7A 3AOBA 4MK9A 3VGSA 1KLNA 3DLLQ 4NLRA 2D9PA 4NEZA 1IQTA 3CDEA 1RWUA 3EGWB 3MDFA 5LMUJ 4DV1F 3T1AA 5CXTA 4EZ6A 4EBCA 3A13A 5L1KA 1JLGB 1S0OA 1L5UA 1WSVA 2WVBA 3ILIA 2EWHA 4O4GB 3FMBA 2BQUA 4I0WA 1VCTA 4BDPA 4NCBA 3EXCX 3QFHA 3S8SA 1U45A 2J0SD 3CULA 1B7FA 3DI6A 3ONQA 5B0EA 1IVZA 1YZ6A 3EJMA 2AP6A 3CCWA 1RAFB 2B3TB 1F6TA 2ZBRA 3OR2A 4KHMA 2JVRA 4XTTA 4QIWD 3MWBA 1F3VA 2XULA 1ZM3A 2ZDPA 4WE1B 4ZVTB 2DIVA 4QZVB 4X4VA 5ETQA 2HFUA 1F5BA 2GHWA 2B8QA 2LXIA 2VL1A 2YNIB 1NJZA 4FPRA 1EAYC 1CULB 1QM9A 1U6ZA 4OI3A 4W98A 1VBXA 3CJRA 3M2RB 4AT1B 2IC3B 2ZFHA 4YN3B 1MN7A 3THPA 3M05A 2ZJPQ 3O3LA 3BO3A 1H38A 2FHOB 2ZH1A 5KFWA 5AXKA 2V63A 2ASJA 2DPJA 2VIHA 1TV6A 3M2UA 3T3FA 4G1QB 3I4PA 2QLWA 1VRUA 1Y0HA 2JHEA 3N9UC 5A8KA 5CZXA 4RW4B 1FXRA 2KVIA 1WC0A 4G6VB 3EWGA 4Y2MA 5L46A 3OV7A 1N56A 1S6UA 3ETOA 5K8OA 1K44A 1JLAB 4K7QA 2BR0A 1NZ8A 4P2FA 2MQNA 1DAXA 4X2BA 2ZOFA 4HHJA 2N7CA 3BBCA 2K2PA 3H5UA 4X66J 3CMQA 1RT2B 1XIQA 1FDNA 1JLGA 2UUCF 4L6V3 3L3CA 2NUUG 1R6YA 4USVA 2BX6A 2CRLA 3CE8A 3UNGC 2N82B 2E7XA 2RDIA 3TWZA 1JLFB 1HBOB 2UV8A 5DZ6A 1KRPA 1T9WA 5FDLB 3AODA 4CLPA 2E9RX 1S5ZA 2DNNA 2A1BA 2L41A 3K58A 4M1KA 2FZGB 2K7JA 3HF5A 1FDAA 1KP6A 1UJ5A 2BZ2A 4A8WA 5HVGA 5EDWA 1CULA 2FC9A 4C3LA 4J9LA 4K4SA 1DZ5A 1Q1KA 4CYUB 1S48A 5EWFA 2V5HG 2E1AA 3OTOF 1WG4A 2BQ3A 2EEYA 3GV5B 3E01A 3ILOA 1UJ4A 3CDBA 5CZVA 2X1BA 3IBCB 5D8HB 3JSYA 2AHOB 2QN6B 3SFGA 1FKPB 2QEXS 1PYOB 1RT6A 3PR5B 4AYBD 1RTZA 1DQAA 3W5YA 4H4MB 1MG7A 2LEAA 1RWWB 3JSBA 1UVJA 1NM2A 2I5JB 1ZPWX 2DNGA 4RBTA 2ALZA 1G4CA 1CEZA 2DB1A 3DRRB 5EX3A 4GKKJ 2JFDA 1RTIA 1S0MA 3N5BA 2E29A 4I6WA 3JQKA 5H9FJ 3V6DA 1X5OA 2IHR1 1T9YA 3ZZRA 2ZOMA 2IJRA 2YNGA 4NI2B 3H40A 2VONA 5KFGA 2QTWA 4J9RA 2RRBA 1F0XA 1I5OB 2HS4A 4CLWA 3C14B 2HFZA 2DGVA 2UUTA 3Q8YA 4O0NA 2LP4A 4ZK7M 2KRRA 3DHXA 4A8KA 1N6QB 3NCPA 1SKRA 3GIMA 3DYAB 2VB6A 4USTA 5LL6d 5BYQA 3IM8A 1D8ZA 1CLFA 1U1KA 2HK2A 4BCAA 2ZH2A 4A8XA 2H65B 4DV2J 4FXDA 1PBAA 2EFPA 4TLQA 1RISA 3T9ZA 5E41A 1QSYA 3M8RA 3C6UB 1BY9A 3HHDA 4FF2A 2YPZA 1TL5A 2VG6A 4CLUA 4CDIA 4IFVA 3UCUP 4GKJF 2AJ0A 1LW0A 2OEKA 1Q8LA 3ZFVA 1SUQB 4IFYB 1BQMB 4P7TA 1GK8A 4RW7A 3P45B 5J1NA 3TAMA 4K4ZA 4ATNA 3WQPA 1TK8A 2ZBIA 4MK8A 2H5JB 2DR9A 1PAUB 4J9QA 1TK0A 3QGGA 4LF4J 3CTRA 3FNNA 4G1QA 3MM5B 3T1YF 2ROEA 4P2SA 4B3MJ 4JV5F 2FJBB 4OI4A 3HHLA 2KVQE 4RW8A 3OHBA 3I56S 4LBHA 1LQ9A 3I55S 1OJ4A 2GGPB 4FYWB 2M52A 4P7VA 4EUVA 4FS1A 5GAGU 3U1NA 5KFKA 2DHSA 3B54A 3SCJE 5D6GA 2Q43A 4IRKA 4DR7J 2GNKA 3D0HE 3NBPB 1DRZA 4FBTA 2RH3A 1BMQB 1U24A 2E1MC 1IXKA 1JLEA 3I96A 5I4MA 1VQ9S 2NUHA 5J2QB 4JUZA 1PJ6A 2FTRA 3GQCA 1K8AT 2UU9J 3W3SA 3TRGA 1MU2A 2OPSA 2R7RA 1SV5B 5HVFA 2CQHA 2CQIA 2LQ9A 4DUYJ 1N34F 2B26A 2QG9B 4ZPAA 4LT6A 4BC7A 1AROP 1TKXA 3LF0A 4C7QA 3V81A 2HBRB 3BBBA 3MGJA 2DJWA 2B43A 4TYBA 1LK5A 1FWLA 3I0RB 2C28A 5HP1A 1XJWB 1Q7YT 1PJ7A 2H1YA 1N33J 1D09B 2AEJA 1UL3A 2RUSA 4PWWA 2MGZB 4FS2A 2HYIB 2CNOB 1VOMA 4P72A 1FA0A 3MCOA 3OBIA 1KSPA 4CO0A 5EHHA 2VJVA 5ETPA 5D0EA 5DDRC 3NEKA 4E2FB 2YH0A 4OHYA 3CCUS 5I42B 4M5JA 2W2NP 2AGPA 1IKWB 1Q7LB 4UF4A 5E5NA 3HD2A 3R5AA 4BHQA 1HI8A 3MI7X 4P2XA 2PN6A 1VQSA 2OD6A 3ISNC 4PABA 3R6GB 1X4AA 5HANA 4LFAJ 1ZZFA 2K7KA 1ZAXA 2QMUB 2XHWA 2YWWA 1J5EJ 1WDDA 2MLZA 4ES3A 4GRSA 2UXDF 2EBGA 4JI1F 5F8LA 1CC7A 3MM9A 3M8QA 1RT3B 1HNIB 4OI2A 2YWHA 2VZ9A 1T9XA 3EVOA 2JNJA 4C3KA 4DR3J 2E7VA 5EUHA 1OY6A 1VGYA 4Q7AA 4N5SA 1ITPA 2CPEA 4OFZA 1RTJB 2YY3A 2GMLA 2RKIA 1VJWA 3P5TL 2J5AA 1LEOA 3K5PA 1YJUA 2CJ9A 3I0RA 2F9DA 4F7VA 1Q81T 1SL0A 3BV8A 3PIPQ 5BR8F 5HO4A 1FNMA 2HBZB 1T3OA 5CAAA 1Q82T 2QL5B 2PFFB 3ET6A 3C3LA 4ALZA 4C98A 3LPEA 1TKXB 3HP6A 3GTYX 5AJ3F 2AGOA 2KKHA 2P9EA 3QZ8A 4A8QA 2IMWP 2KU7A 1NLTA 3T9NA 2LA6A 4QW9A 4CLTA 4C8YA 3W7BA 3HDSA 1VDHA 5AT1B 1HW8A 5HBMB 3LGHA 2DTJA 2OPPB 5K14A 2B7CB 4W90B 2XO7A 1I51B 2DY9A 1TV6B 2IBKA 1WC4A 5I3UB 4R8UA 2DEIA 2UU9F 4X65F 2DGQA 1S1WA 3RJMB 4CO1A 3QSYB 3MHYA 4OJ1A 4X84A 3G2XA 1RE1B 1UZHA 3RUBL 1RU1A 2PDAA 4K2XA 2MHNA 4PWUA 3H42A 1GNKA 1X4GA 2VASA 3VAJA 4DR4J 5E3QA 5KFPA 4JI3F 2I5JA 4GVBB 5CYMA 2GJIA 2Z2LA 4DR4F 1QLNA 1QUVA 3LAKA 4N7TA 3Q8UA 4JV2A 4LF4F 3E3XA 4PYAA 2V4RA 2NPFA 4LFBF 1WWHA 4B9MA 3PIOQ 1V3RA 2QLDA 1WHVA 3EGZA 1KVIA 1NB2A 2R2SA 4NA1A 2B6AA 4JI2J 2GC8A 3C66A 1OWXA 4I67A 2ZDOA 1HNVA 3J7Z5 2R42A 3BJYA 2LU1A 2NS1B 3N01A 4E98A 1H0HB 3RZAA 1PSDA 4KO0A 2KM8C 1YBAA 2RNEA 3HK2A 1LWEB 2GFFA 1VRQC 5DS7A 4ED7A 3AGZA 5FIIA 2A6OA 1HQUA 4HHHA 1R8PA 1A7GE 4KO0B 4ZCIA 1SI9A 1FKAF 1LV5A 1LXJA 5IM0B 2CUYA 2EW9A 4DQSA 1KWMA 2Q6CA 2ATCB 4JI7F 1XNRJ 4O3NA 1RAJA 3BS9A 2FYXA 4OX9F 2VFUA 1F1BB 1QDUB 3TAQA 4OJ3A 1WEXA 1YJ7A 3CMES 1RT6B 5JMNA 2EFGA 4R0JA 1T03A 4C8ZA 2KT5A 2O5DA 3FEYB 1OPIA 3JQJA 5IQQA 1DTQB 3J80U 3JYTB 4ECSA 1KOHA 4WU2A 3CCES 4CYUA 3MM8A 1DFDA 3LA0A 1RT1A 4KRWA 1HKAA 2W4PA 1I6JA 1RWKB 1FWPA 2ZH3A 4EYHB 2LA4A 3BREA 2ASDA 4I1TA 2IAJA 4P10A 3LW5C 2AMCB 2BJ1A 3LUYA 5L8RC 1N5VA 5HATA 3OQ2A 4EI2A 1UEUA 3R7BB 4U7CA 4DV7F 2ZH6A 1O8BA 4F0KA 5GAHU 3EVMA 2ACMA 3D28A 4DL2A 4LRFA 1JLFA 3UDEA 2KJVA 4O3QA 4DR6F 1UTAA 1T94A 3AGYA 4X62J 1WC1A 4ECRA 1HNVB 4ECWA 3M2RA 4RO0A 4MIWA 1DQ8A 1Q8KA 3GJSB 3RAMA 5DETA 1F5CA 1FKOB 1WOPA 1Q5YA 4YMEA 2D3OR 1U7LA 3UDCA 2HHWA 2E5HA 3EMTA 4X4PA 2ZH7A 2HHVA 2H3EB 1W26A 3DRSA 3KDOA 1VQ5S 1BC6A 2CKWA 4Z37A 1H7WA 3NWRA 3WDOA 2HWHA 1U1LA 5GMEA 1QVFR 4Y2CA 4CRJA 3MTKA 3VVTA 5FLXU 1R8BA 5LSLA 3HFZB 3V4IB 2RUGA 1MWQA 3KLIA 1NHKL 2R2UA 2RU9A 4C11A 2NSCA 2YKNB 2WSCC 2JVMA 3ETMA 2DO0A 2OMLA 4ZVUB 3PW7A 1PCAA 3M2UB 3HVTA 2GMHA 3DRXA 2WSEC 2B4OA 2QFIA 4M8LA 5T14A 1UWBA 3PR4A 1MWZA 1UVLA 1RT1B 2YX7A 3GJQB 1VQOS 4MTPA 2MY8A 3CXCR 2D41A 2HRUA 2PA8D 2IM1A 3TZWA 4ILLA 3LP2B 4JI5F 2HG4A 4WFZA 2MKIA 1RHKB 3M2VB 1RDRA 2VBZA 2ZKUA 4GO5X 2WCXA 3VAFA 1YDLA 1S1UA 2BM0A 3AY0A 1RWOB 3ET6B 3FSXA 3Q8QB 3CMAS 3OVAA 5CYJA 1K9MT 4HEA9 4JI2F 3E8OA 3I5CA 3VALA 4CTAB 1HQEA 4BS2A 2HIQA 2KM8B 4QYZK 3WX4A 2ASYA 2CQ0A 3V6HA 2FD2A 2QMXA 3DRPB 2ZC3A 1N8RT 3MD1A 1S6QB 2VBYA 1O6XA 3MMAA 3PFEA 1J27A 4EGLA 2MQOA 4OJHA 4UOCA 4DI6A 4IQXA 2NCKL 4ID5B 3ZNJ1 2VOOA 1TFWA 1RAGB 4IOBA 2Q79A 4RNNA 1U8SA 3GIKA 3HXMA 1S1TA 1UPMB 3AJ2A 2UUAJ 3TA0A 4ZIVA 2JVOA 2R8IA 3D5MA 2IVYA 4QWEA 2O66A 4F2RA 2VG5B 4DR2J 3F0NA 2XMTA 1TVRA 3W1YC 1ICEB 3HT3A 3K5LA 5LMUF 4KHRA 4DV1J 2XGPA 3EM1A 3IA0A 3M2VA 1K47A 3DM2A 3KXDA 1BUXA 3R5BA 5C42A 3U27A 4K2JA 3LOUA 5A2QY 2P6TA 4I56A 1REGX 1X4BA 3A3PB 5HJYA 1VBZA 4I64A 2FVSA 2HHHF 3FVYA 5IFMA 5LMNJ 1Z1ZA 4O3RA 4OYZA 4UY8T 2BKNA 1BE4A 4DSFA 4DPWA 3H7HB 1WOOA 4ED3A 2FUG9 4FVCA 3TVYA 2CG4A 3A8KA 1O51A 3KYLA 3L09A 1NKCA 4M5IA 3GG1A 1VC0A 5KOWA 2DH8A 3PHEA 1X0PA 4L76A 4DR1J 1FF2A 3OL8A 1SKSA 2V9KA 5HBMA 3T6BA 2LKZA 3TYTA 3SSQA 3MFHA 4QU6A 4YEAA 1JK9B 3CC4S 2CQDA 2R8GA 4N8NA 4ICLB 5H9EK 4WFBQ 4FDFA 1OQ3A 1KQKA 1XNRF 4X65J 1Y11A 1ZTWA 3HD1A 1NUEA 3CEDA 3FBFA 2BQRA 1SH0A 1B0PA 2QO3A 2RQ4A 2YKPA 4YHHJ 2VC1A 3H4BA 1N0UA 4N47A 5KFCA 1S9GA 1GT8A 1F9FA 3LP0B 3OUYB 3AA8A 1AW0A 1V5IB 2F3JA 3MAAB 3CJ0A 4YR2A 4QWCA 4K4WA 1GTEA 3TZZA 1R3NA 2WK4A 2ZHBA 5K8NA 3LP2A 2DD8S 2E7WA 1NSPA 2XSJA 2XEXA 5GMDA 4ZHRB 4CLSA 2IFXA 3PZPA 3M32B 4FNIA 4IUFA 1VQ8S 1JXEA 3ISND 5JXSA 1QVGR 3TQEA 2DH7A 1RBLA 3CCZA 2YVSA 3Q22A 2F4VJ 2IDEA 3PX4A 5DDPC 1JQGA 4USKA 4OZ0A 2DR6A 5I42A 1U1RA 1RADB 1K0VA 5DGAA 3W60A 1AZSB 2IM0A 4WIQA 2G2YA 4FP9A 4MKBA 1UVKA 4JOUA 5ETTA 5AE1A 3US5A 3OTDA 4ZS6A 5RUBA 1SJFA 3MZIA 4CO3A 2GQCA 3DLJA 1AZSA 2M88A 1KHWA 2CXEA 3GYXB 3ZZOA 4HKQA 4OV6A 4NLTA 2W8LA 1UETA 3OPKA 5KG2A 4HDGA 2Q1LA 4ETZA 3QGHA 1PKUA 5KT5A 3EZOA 3BQ0A 2XZDB 3VVUA 2EG1A 1NO8A 2C2MB 4LIWA 1M1HA 1NH8A 1FTCA 2WBMA 3OXLA 4LQ9A 4RNFA 2OELA 4F3MA 3SXLA 3FSIA 4DL6A 5C2GA 1JJ2R 4P71A 3SQOP 3P6YC 1LWFB 1NCLA 4IOAQ 1RKIA 3T5LA 2R2TA 1PG5B 2E5GA 3KWMA 3NBPA 1RWMB 2DNYA 5IC6B 2FY8A 1TUWA 4JI5J 3QO9A 5J2NB 2J6UA 2FZCB 2I38A 1DLOB 2OI2A 4RNHA 5F0UA 3V6KA 2J0WA 2RJZA 4DL4A 2HURA 2M5YA 2VV5A 5DLGA 3EGVA 5LSRA 5KFNA 5A2QU 1SC3B 1MMLA 1VHFA 3D4JA 4WTYA 1QSLA 3QJPA 4NRTA 3HT0A 3GIJA 1ZS6A 3DRSB 3P49B 4M94A 5KFRA 3CVKA 1VIXA 2CPZA 1T11A 2DIUA 3CJKA 2EG2A 3LQVA 1HPZB 3MEEA 1FXDA 4TNOA 2XQCA 1XEZA 3L7PA 4ENOA 1V5VA 2Y0BB 3HHEA 3M4XA 2HAIA 3H20A 2D1CA 2OD4A 3MOZA 4KR0B 4KT0C 1GFWB 3SDEA 4RJVA 2XC9A 4H4OB 4U96A 2W9AA 3G8TA 1U6BA 4PWDA 1C4CA 1NHUA 2CADA 4DFMA 3FUYA 2Q6BA 2Z56B 2MJNA 3BM7A 1BGXT 2DNQA 1S57A 4YB5A 3KJVB 4F0MA 4UZBA 2YWEA 2LVWA 4QPTA 4DL7A 3LGMA 1B4SA 1SH2A 2I9SA 2NYIA 4PQUA 3JS9A 1S79A 1C1CB 3PM9A 2RRAA 2F7VA 2XWYA 5HLFB 5U47A 2HFSA 3BBFA 1RYSA 4LSNA 4E8UA 2BM1A 1JX4A 2VA3A 4P2MA 3NNCA 5KFHA 2GJ2A 1LKZA 1YSJA 3DCAA 2J7UA 4LF5F 4LREA 1S76D 3G86A 1ZM4A 4XPEA 3UN2A 3CF5Q 2XY6A 2C2OB 3PEJA 4CH0S 4Y34A 3I38A 4Z7YA 1KC8T 5C25B 1XR7A 2CQPA 3B4DA 4LFBJ 5THWA 1LW2A 2KRBA 4OMFG 3SBMA 3K7RA 4Y2AA 3TVZA 2M8HA 3W64A 1WI8A 1RQ0A 1RTDA 1X9SA 1WHYA 4QIFA 2ZE2A 3FEXB 4Y00A 4DEZA 3B82A 4F2SA 5D3GA 3ZXWA 4I2PA 1C1BA 3PDNA 1K0TA 2EVZA 5HP1B 4J80A 1FTRA 5ETVA 1SJ1A 2CVEA 5J1PA 1TK5A 1NB7A 2W2OP 2B4UA 4NMLA 4K5SA 4DF8A 3ENVA 3LWMA 1G6BA 2GVZB 2IC3A 4B02A 4X4UA 4ES2A 3KK2A 2A6MA 2VUGA 4U8YA 4H4MA 4P9SA 3UDLA 3D2WA 5C24A 3NXZA 3ICLA 5KFVA 3QGIA 1SJQA 5GAHI 5EWGA 3UVJA 1TL1A 3NL0A 5T7LB 1C3GA 5CH7B 1QTMA 3HZGA 4LVOP 2UVVA 1MMDA 4MFBA 3T41A 4X4QA 2GW8A 3KLHB 4EO6A 2OJ3A 4M63A 4B3MF 3NS7B 5KFJA 3QIPA 2BDPA 4NZ7A 2QA1A 1Y5NB 4A8SA 3SV3A 4ZKAA 3UPFA 4LF2A 2ACYA 4MKYA 5KT2A 4B9UA 3NG8A 1RJJA 4YQWA 4NXMJ 1SIWB 3R2CJ 2VA2A 4QQBA 3NMRA 5D77A 1LFPA 2NXUA 1C1BB 1VC5A 2R7SA 3N6MA 2F4FA 3H59A 5DDOC 2IRXA 3KG1A 3M6WA 3CJ5A 3I6PA 4LUBA 1MNEA 5B0AA 5KT4A 2KJWA 3KNAA 1Y7PA 4MIBA 2KB2A 3AFGA 4YUDA 3CJ2A 4OZ1A 5L39A 2MQQA 2R2RA 5DQGA 1HR0F 3FBBA 4PAAA 2FDNA 4DV3J 2FJXA 1R0AA 3MECA 3QJJA 1JNZB 3K5OA 4DBQA 1WKKA 3EXYA 3P8BB 3RAQA 2J6SA 1R27B 3AD9C 2DNOA 2P9GA 4RL1A 4R5PB 5IZHA 3F73A 2QGFB 1EP4A 2JRRA 3ENWA 1Y5LB 3TARA 4GKJJ 5EGYA 5B0DA 4PPDA 4PXCA 3WHIA 2H4WB 4UUWA 2A0FB 1DY3A 2ZBQA 3DLEB 3ZZZA 2COLA 3HI9A 3L7OA 3RRKA 3OL7A 2VG7A 3KMSA 2IVFB 3UCZP 1BD6A 3HULA 1HNWF 3PFOA 3C6TA 3HM9A 2GZOA 4A8MP 1NEEA 1TKTB 2Z58B 4J7CA 4QR1A 2P2CB 3HPOA 4JV5J 1HYSA 1FI4A 5GAEU 2H4YB 3QNWB 2NYHA 3PV8A 3JTPA 4G1IA 3O44A 3LPYA 4QW8A 3TEGA 2L9NA 4LF7J 3MM9B 4ZOSA 1U49A 1ZM2A 2VPZB 3R27A 2YPYA 2Z4PA 5F8JA 2U2FA 1IBKF 3V2UC 3LAMA 4BWMA 2UVUA 3EE3A 1N34J 1MROB 2X3DA 3BQ2A 2VH7A 5HSPA 1R31A 4KHPF 2ZH9A 3PHTA 3BO2A 1H7XA 2DNKA 5DO2A 3ZZ0A 2DR7A 2CPDA 5IT9Y 3HHLD 4HDHA 2F63A 2YQ1A 5KG1A 1SQFA 5G0RA 4UUXA 2VBXA 1VR6A 2KG0A 3BH7B 5A6PA 1HNZF 4ZITA 2J7WA 3ZO7A 2AZ3A 3SEOA 1JB0C 2BYCA 2VFRA 3MPDA 1M5PC 1CS4B 2B9XA 2C3PA 2F65A 1BQNB 1H73A 1TKTA 2N7YA 4OZ3A 5DRKA 1NXIA 4RW6A 4EZ9A 3J7ZT 1VBKA 2FPHX 5KFUA 2XMAA 3NMAA 1A9NB 2KG1A 2OPPA 3M6XA 4K4YA 3O6QA 4RUAA 4JV1A 3RRGA 3FQKA 1H2UX 4K8RA 4DPUA 3QYYA 2X1AA 3PW2A 4RX6A 1KKHA 4PKDB 1SQEA 3PKYA 1Y4ZB 5ETLA 1LXNA 2CQBA 2JLFA 2M4MA 2W24A 4USHA 3MEGB 2R8HA 2F1FA 4NA3A 1Q95G 2E1RA 3QGPA 3KHHA 2E1CA 3FMWA 3DOKA 1UMJA 4PYDA 2B7BB 1VQPS 3LP0A 1FX2A 5HJXA 3JAMU 1TAUA 2LEPA 1VFJA 1XR6A 2RF2B 2BE9B 4MH8A 4N8OA 3VZIA 3W2WA 1L3VA 3HKZD 3G87A 3I0SB 2MKJA 3M7VA 2LQ8A 5G0RB 1DHMA 4MJKA 2XS5A 1IKVA 1MW7A 1PAEX 3MCSA 3OTCA 5E0OA 1GMUA 5J2NA 2W2MP 1EZZB 4U7UD 1FERA 1S77D 4K4VA 4ICLA 1F9EB 4YY3J 2KXNB 3VAGA 1Q8IA 4LRAA 3ZTPA 2N3LA 2YNHB 3EVWA 2QJ3A 4OHZA 1IQZA 1YGYA 3SDEB 4ZMMA 2JSXA 4DLGA 4P52A 2CJYB 2CJKA 1BXNA 3OJUA 3BSNA 4DF4A 3MPUB 2M3DA 2V8DA 4LSLB 2HGMA 5D0HA 3CGIA 4UOFA 5M2RA 3OW2R 3RB3A 4F02A 4ZN3A 5KFLA 3PYDA 2PFDA 2V67A 5DG9A 4DV3F 3OTOJ 4WYWA 1IKWA 3OUYA 4B9NA 1Q4RA 1IBKJ 1BQNA 1KR4A 2V2KA 2BE2B 2CPIA 2W2PP 3QFWA 2CPXA 3KUGA 1IWGA 1NPRA 4JBCA 2X3GA 1SQGA 2V2ZA 3PRDA 3BR8A 2MTLA 4TY9A 3RG6A 2RF2A 2Y0SD 1KTQA 2YWFA 2JFKA 3I0SA 2RVJA 1C0UA 1RAEB 2UUWA 3W63A 2FZKB 3J81U 1M5VC 3KJVA 1JNRB 3R97A 2KT3A 4NE9C 4DN9A 3RBEA 2H48B 4FKXA 2WVFA 3GP9A 4G3IA 2NXCA 3JSMB 4NXMF 3P3DA 1XNQJ 1SC1B 1SL1A 4UQGA 1MROA 2Y3YA 3LO3A 4CLYA 1WEYA 4ZHRA 1QE1A 2CYYA 2ILZA 5KG6A 3CIZA 5KFDA 2G13A 1FFSB 4QIGA 2IVMA 3PW0A 2IDLA 4WZMA 1N5YA 3E2EA 3B6BA 4A48A 2I1RA 1U0HB 1ZPVA 1MSWD 3K59A 2DGUA 2V69A 4A47A 2R7OA 4O0IA 1YJ9S 1TAQA 4OZLA 1E6VA 2GHPA 3MMBB 4NYZA 4RW7B 3B8HA 4UY85 4FN5A 1FNOA 4RUBA 4ED2A 4ANDA 2W01A 4QIEA 2J7KA 2W2QP 3MM8B 4H4KC 2A2DA 4NLDA 4ZVOB 1U1OA 1T9TA 2CQCA 1FFWB 1WKJA 1X60A 2JOQA 2YTCA 3CJ3A 2GQQA 1VK8A 3ZTRA 1C4AA 2HNZB 4Y0FA 2J0QD 1U0SA 3H4DA 1WKLA 1R0BG 4I7FA 2CJQA 3KDNA 3AQPA 4X4NA 1U8WA 4I6AA 3M30A 3V4MA 3GIIA 4IG3A 4A8OA 1TUGB 2VFSA 3CNQP 2LMIA 5K5MA 2LQ5A 4NCGB 2WW4A 1N6QA 4NZ0A 1SKWA 3R5CA 3M8ZA 4ZPCA 5ITHA 4JI0J 3EGNA 5FDLA 1X5SA 2KHDA 4OYWA 3PW4A 2QV6A 1SJ4P 2R8JA 5KFXA 3OR1B 4HYKA 3GCWP 3UD3P 2WHOA 1IWAA 2XNQA 2J8SA 4J9UE 4Y6IA 2ZWPA 1FX4A 2VG6B 3CSKA 5A8RA 3V5RA 1RTHB 4ZCKA 1QJHA 1YLXA 3AT1B 3EDRB 4EFAC 4U95A 4KAIA 5K8MA 1T03B 2WVDA 2HAFA 4XDCA 4PXBA 2W4CA 1NRKA 4ZPVR 1RTHA 1HHSA 2VQEF 2HGLA 2G4BA 1N54B 3F41A 2EC2A 3FFIA 4DZDA 3DLKB 1NLKL 2Y1LB 3R1HA 1NSQA 1NSKL 2HNYB 2BA9A 2O3DA 3EUNA 3BN4A 4ILRA 2UVWA 4NLYA 4GMKA 1KLMB 3DOMA 1VQKS 1RK8A 1WHWA 2Z2YB 4DPOA 4X62F 3KJFB 1CJTB 3V81B 1HBUA 5KT3A 2RS2A 1NKEA 1C0UB 1P9YA 2AKWB 2V34A 4DU8A 4JB8B 1TMMA 3FCVA 2ALYB 3NNHA 3A12A 4ZN1A 4M95A 3MEDA 3PKMA 3T5HA 1RI7A 4OJGA 5B08A 2NR0A 5HN0A 2ZJQQ 3GSDA 4DX5A 3H5SA 4DHVA 3QJLA 4X4OA 1FNXH 4F8RA 5LXYA 2CJAA 2H51B 1EETA 3MM7B 2CQ2A 2HVHA 1SJ3P 4AXJA 3GONA 3BN7A 1QUPA 2EC0A 1Q5VA 4FVMA 3NGSA 3T1YJ 1UCNA 2AD9A 2W9BB 5IM0A 1NPKA 5KG7A 3VZHA 2MKKA 3GV8B 4CQ1A 4I2PB 1EHWA 4U7UK 5F41A 2AGQA 1YI2S 2VODA 3TANA 3VHQA 5F0WA 1J5EF 5K8PA 2HMIA 2JC1A 3VV2B 2JH3A 4DWIA 4CZCA 2WSFC 2VG7B 3FZBA 4PUOA 1GMVA 1P8GA 1VHIA 4RNOA 1ZM9A 1N36F 1N5SA 2QSWA 3DRRA 5A0YA 4O23A 2QYGA 1E6YB 1Y9OA 3QATA 3SSSA 1EP4B 3G6VA 3OSPA 2MQPA 1NSAA 2YKOA 3NGDA 1NJXA 1D8YA 1D9FA 1S49A 2W9CA 2DK2A 3BSCA 3D66A 3R3TA 5ETNA 3CCLS 1CQMA 1HBNB 6AT1B 3ZTOA 2IMOA 4L75A 4LRCA 3J80Y 1L3SA 1URRA 1C0TB 4DV5J 2BJ7A 3D7SB 3HZEA 3QIDA 2MKCA 2G2ZA 3C15A 4RKUC 4CLKA 4EBDA 2E9ZA 2HVDA 3A8EA 1Q86T 1OS5A 1JKHA 2XM3A 5LM7E 3KLVA 1RTJA 4PPZA 2UUBJ 1ZZNA 3QRQA 2AJQA 2DY1A 2IJNA 1IM4A 1OY9A 1RAOA 1KFSA 2I0XA 1LWCA 2GS8A 1WDTA 3TR5A 2V6AA 2EFOA 2ZNYA 4OZ5A 4JP8A 2R9LA 2ZE2B 2UXDJ 3BEGB 4KV8A 4XK8C 4LSLA 1IR1A 3W5XA 3LALA 4I2QB 4IH5A 4ZPBA 1GMWD 3D1QA 2OP5A 4C3MA 1U09A 3QMQA 5AXMA 1RWNB 4OL8A 4NLGA 2ZUGA 3OD2A 5J2MA 2UXBF 5FD1A 3QAUA 3MECB 4B08A 2KFZA 4NOHA 1TZ0A 3PX6A 4DQIA 2HHHJ 1L3KA 2A3JA 1B99A 5A8WA 4ECVA 1FD8A 3P96A 3JAMY 1NU4A 1FRHA 2UXBJ 2VD3A 2ZVIA 5D0GA 2ZM6J 1RWPB 2PA3A 3MAHA 4IQMA 4NLXA 3RBXA 3F56A 1WI6A 2ILYA 5KFTA 2JLGA 1S6PB 4H54A 1Z2LA 4MMOA 3VCDA 3T5JA 2R3VA 4O3OA 3ELHA 3AJDA 3J7AN 1FE0A 1KQGB 2BKOA 1WG5A 3BKFA 3FGVA 3QO9B 4PXEA 3DOLB 1VLOA 2W25A 1UFKA 3I82A 3MPVA 1DLOA 3R5DA 3MOJB 2D7SA 5GVQA 3EICA 4NEYA 3DGPA 1RABB 3MEGA 3BF4A 3QT8A 4J91A 3DLBA 1S1XA 2HS0A 2OPQB 3HJVA 3G4SS 3PCOB 4J9OA 3T5KA 4RW9B 4Q8EA 1N32J 2QLBB 1I1GA 1B3TA 4C4WA 1FD2A 3DYAA 4LSZB 4D3HA 4DXLA 3AGXA 2YNHA 1EETB 1FRKA 3KLFA 2GIRA 2O67A 3KG0A 3ZC4A 1AB8A 4JI6J 1GXUA 4W4MA 4L74A 4P73A 1U02A 1CS4A 3MCMA 3WZ0A 4QR2A 5JJBA 4TQRA 2XO6A 1U1PA 4YR0A 1UVNA 1U1MA 4ERDA 4J9PA 2PMHA 1U26A 2PC6A 4O4RA 1RB0A 3VGVA 5GAEI 1YHQS 1YIJS 2FC8A 1JLBB 2F9JA 4ILMA 1RBOB 4DS4A 5L1JA 5EWEA 4PUOB 1S9EB 1R0CB 1Q53A 2SXLA 2C2ZB 3IR7B 2JEFA 4CM0A 2Y8YA 5M2UA 2RRNA 4M5LA 1RCOB 2QA2A 1ZTTA 4CCHA 5ETRA 4UZCA 3G6XA 5BXIA 1PGZA 4LFCJ 3DRYA 3PG9A 2JRSA 3KUEA 3T19A 3M32A 3W9JA 2C2NA 2B6AB 3QPIA 3JXOA 1FRIA 4RW9A 5LXRA 1JLEB 3CCSS 1D1UA 1SJRA 4RLEA 3BGUA 1CJUA 1HL6A 3N5FA 1XBWA 3I31A 2N4DA 3OFEA 4WK1A 4EU0A 2ASLA 2ADBA 1X31C 2IJFA 3HSGA 4FYXB 1FJGJ 2XLIA 2RDJA 2A2CA 3BGRA 3HVWA 2L9DA 1W7WA 3A3NB 5DQIA 2JJ4D 1FJGF 2LDIA 2YKMA 4OX7A 3H5YA 3CJSA 2AW0A 3MR7A 1YJNS 4URGA 2LFVA 1NJYA 1FXLA 4IO1A 1RA7A 2QIFA 2P5VA 3IMQJ 3K17A 2VQFJ 3Q8SB 1WELA 3BPSP 3U02A 5BYRA 2DHGA 4R8UB 4Q8FA 3MF5A 2ODXA 1IKXB 5B0BA 4ZIWA 4IR1A 2L3MA 4EMDA 2DR5A 1QY7A 1S7HA 3SIPB 4C0HA 4KIAA 4IKAA 2C42A 1MMNA 2O01C 2V4JB 2VU5A 4KKOA 1FJEB 4J9SA 1RXOB 2MKYA 2Z8QA 3IS9A 3IRXB 4PEOA 1HWJA 4YB6A 4UOGA 3LWLA 1Z4UA 5JVHQ 2HWTA 1YZ7A 2EBEA 3FJ2A 4KKOB 1YJVA 1EIYB 5T41A 1U2CA 2LXFA 1LNQA 2M7SA 2WVCA 4F67A 5LT5A 5LJ3Y 1X9MA 3OL9A 1OQ6A 3MTJA 4EO8A 1UFLA 1KHVA 2HEKA 5CA5A 1C2PA 3GZ7A 1AT1B 3GJRB 2YKNA 4WXOA 4ZPTR 2AYBA 2BOAA 4KE5A 5F3TA 2DXDA 3K89A 4LR9A 5KFMA 2MB0B 1HBMA 1NDCA 2VOPA 1JIHA 1YJTA 3MUVP 4L72B 2K06A 4TKTA 2FLOA 1X0FA 3C15B 2CNNB 3FRYA 1XNQF 4B17A 4O44B 4X66F 2ABYA 2EKNA 2FVCA 3D6HB 3AB4B 5IV3A 3CO9A 1CJKA 4OYBA 4ZVEA 1ACMB 3FKBA 2HZAA 3H0PA 1HNZJ 4OLOA 2KN4A 5FLXY 3WBZA 1RWXB 3IO1A 3VAHA 3WIVA 4YY3F 2E66A 2HNDA 3VQSA 3AQOA 1WF0A 3DFEA 3H2UB 2XMMA 1TUVA 4OYIA 4QR0A 4OX8A 1QTNB 5I3PA 3T6JA 3NGKA 3G8SA 4DV4F 4LF6F 4W92B 2YQ3A 2ZD1B 4YR3A 2JX2A 4HHUA 5HQLA 4NLSA 4WKRA 4LRDA 4JI6F 3R7SB 2D69A 1S1TB 1PC5A 2BRKA 4NZ6A 4USMA 5ADZA 2CDRB 1N5QA 5L9NA 2V9WA 1KOOA 4DL3A 4NLVA 2YH1A 4P6QA 2FVRA 5KT6A 4DV6J 5F3ZA 3OT9A 1S6QA 1IM6A 3MM5A 4R25A 3J7A1 4MYUA 3EX7B 1KVJA 2C2DA 2V2QA 2XLJA 1LW0B 4RWWA 3DXBA 3TOQA 4AXIA 1T05B 4DQPA 2XG8A 1IBLJ 4KFBB 1X5TA 4JI3J 1M1GA 5GADI 2DNMA 2IY5B 1ROFA 2KTQA 1OYEA 2WOMA 2ZNZA 4M5HA 5L9XA 1TL1B 1G7CB 5IC4B 1MU2B 2OPSB 4PG4A 1NZAA 1TL3B 5E3RA 5IQ6A 4Y2IA 2V2VA 2E5JA 5L1LA 3T1HJ 2AYMA 2LYVA 3WIUA 9ATCB 1VC6A 4JYAJ 1UWBB 2IBOA 3O5TB 1VYAA 4NLUA 1YRTA 1KFDA 4KGZB 2W7PA 2BXJA 2UP1A 1VQ7S 2QL9B 2V8HA 3W9HA 1FCAA 1BWVA 3G8QA 4DUYF 4YP3A 5IT4A 3R1LA 3HO1A 2B9EA 3C16B 3JSRA 1NK7A 1FEEA 1NNDA 3CD7A 3VR1A 1VQLS 2HVEA 2LDYA 3RU0A 3C14A 3UD4P 3N6LA 5D15A 2Z2ZA 1J2VA 3VAIA 2F5GA 1XN9A 2DCLA 4ID8A 3AA9A 3C5XC 5D78A 4ANCA 2KFNA 1RHMB 3CDAA 2JWNA 3G82A 1JKHB 4QOTA 3KLIB 3HJFA 2WZ1A 2ERRA 5KFIA 1ZA2B 4HR2A 3DU6A 5KFZA 2ZVSA 3N4WA 2XMKA 4C0BA 4DCPB 5AXLA 4A4JA 3PJXA 3GIRA 4YS2A 4RR5A 2IIHA 4P74A 3EPIA 3POTA 3W2VB 4KFBA 1RU2A 2XS7A 2ROPA 4OYPA 4B9SA 2F8MA 1YWXA 3U1LA 4TU9A 1R89A 5DG8A 2MZRA 4ZVRB 2QLJB 5F8NA 4ED6A 1CSJA 4M5MA 3AXMA 3K5MA 4YFUA 3W65A 4NWBA 5A0YB 4RPFA 4RW6B 4DS5A 5F8MA 3VAMA 1TR0A 3ENAA 5D4LA 2DPIA 2RS8A 4M5KA 3HSDA 4JV0A 1YRXA 3MPYA 2ZUAA 4ZJOA 2LXUA 4QYRA 1T3NA 4C8OA 4JI0F 5CCLA 2HQ3A 1PYSB 2M2BA 2XCAA 1XMQF 2H5IB 1V3ZA 2MKSA 3UN3A 1GEHA 2UXCJ 3SMZA 1RSCA 3TA2A 3UR0A 4TQSA 3G6ES 1C0TA 1M0SA 3U7JA 5CYQA 1HIYA 1F60B 2HVIA 4EWTA 4R0EA 3OXFA 3NP5A 4ELUA 1CC8A 4NPOA 1R0AB 3WC0A 4B9LA 1RAHB 3KK1B 2ZHAA 1N33F 1FKOA 4KH0B 2DNHA 3ZZPA 2XMJA 1TU0B 7FDRA 2Y9HA 4RNMA 3KOAA 2HK3A 2RB7A 4LVNP 1WOSA 3GFZA 3UQSA 1D9DA 2MDAA 2V8GA 4WCEQ 1XERA 2CPYA 3H2VE 2MQLA 4TVAB 1KD1T 1KBRA 1YK9A 2R7TA 1TQLA 2RILA 2VC0A 3SSRA 3KLGB 1RWVB 2EI5A 4J37A 4KC5A 2HMIB 4LF9F 1NPPA 1XQIA 1M5HA 1HI1A 1AFJA 2P9CA 3M6UA 2HNYA 3NCQA 4ZVFA 4ZJQA 5J1EB 2FVQA 5EN1A 3KLGA 2YKQA 4DR7F 2JDJA 3DLEA 4CLLA 4OI1A 5B0CA 3NS6A 1S6OA 3DC2A 5HK4A 3OFFA 3TEHB 3AD7C 2VKRA 1DTTA 3W5ZA 2AEFA 4C2MA 1D0EA 2NXNA 2WONB 4U9RA 2HBQB 4TXSA 3FK4A 3QIPB 4WXWA 4USWA 1CPZA 1TL3A 3V6JA 4U67Q 2YNFB 4WWSA 2Z30B 2DT9A 2XNRA 1RLDA 5CYMB 3W61A 4ED4A 2OMOA 3D6MB 4XPCA 1TTHB 2M9KA 2P8IA 3FDSA 1WSRA 3VAKA 1UZDA 3IR5B 3H98A 4KSEB 4CO4A 5KFSA 4Q45A 1BHNA 1J5OB 2D9OA 2IM2A 4NCAA 2OSQA 2WAQD 1S1XB 2OPQA 2V50A 3OR1A 3C19A 4O4GA 4IOCQ 2DHHA 3CDUA 1H6KX 1U4BA 3BGRB 2MSSA 1NBEB 1UEKA 1LWCB 1UPPA 3PXGa 2YBVA 3SYZA 4MIAA 1F2HA 1TKZA 2B56A 2YQ0A 4MKVA 4LIRA 5D4PA 2XGQA 3MMAB 2DNPA 2N4CA 5KFFA 4ECTA 2UUBF 2Y8WA 1UJ6A 4H4OA 4Q2MA 2UV8G 5KOXA 3PO5A 1VK3A 3OFGA 5AXNA 3JQMA 4QIVA 1N0VC 5A6WA 1PC4A 2EK6A 3A1YG 2AIRB 3D1HA 3CJKB 2C3UA 3J7YU 1BQXA 1XMQJ 4OZNA 4B9VA 3K0JA 3EDQB 2Y1RI 3OTEA 5T7LA 3GB0A 2PEBA 1RCXB 3HHLB 4PRFA 5KG3A 3DGVA 2B8PA 1WD6A 3NLCA 3L95X 5IWAF 2OLWA 1DARA 1U1QA 2IA0A 2V0NA 4AUKA 8ATCB 1KQSR 2X51A 2W7AA 1FFGB 1HFEL 1ZYQA 1JLQB 5HAOA 1WNEA 2BW7A 3PJ9A 4NX9A 3DDKA 3G96A 2XB2D 3CC2S 2B4PA 1RYRA 5IT0A 3DOKB 4GC6A 4OX6A 5CCMA 2FLLA 2ROGA 2CJXB 2IAJB 1N5YB 2DHAA 3FZ2A 4OI0A 1T95A 4TY8B 1O0PA 4ZP9A 4ZVHA 3S7RA 1RZMA 1OSDA 1RHJB 1VLYA 1WF2A 3OL6A 1NJIT 3H2LA 1IR0A 2OUGA 2CQ4A 1YRUA 3UE2A 4K4UA 3ZNUA 4CH1A 2QSFA 1YTYA 1Y5IB 1N36J 8RUCA 1U2RA 1FESA 3DMJB 3RRHA 3QRPA 1FVQA 4ES1A 5E7OB 2J0XA 3HHKA 2QFJA 2BV3A 4NXNJ 1NAQA 4DR5F 3TO8A 1PILA 5C24B 3DLGA 3M6VA 1IJEB 3D0GE 2HW3A 3KHGA 2YWGA 2FJAB 2OKQA 3IWLA 2KH9A 4J9NA 3ZZTA 2BJ9A 2GV1A 2PSZA 1FJ7A 4DL5A 4KJIA 4BC9A 2CFXA 3KKFA 4CWBA 4DUZJ 1AUDA 2J9CA 3A8JA 4FYVB 4B9TA 3ILJA 3HX9A 4WBFA 2GAGC 4RU9A 2OO4A 3M8SA 2AU0A 2BJEA 1GXLA 1M90T 3S01A 2RDDA 4OHVA 4NCGA 5CD4A 4LFCF 2XYHB 2GO9A 3KLEB 4EYIB 2C22A 4PZVA 2HHUA 1KTVA 3NKYA 5BYSA 2DHXA 4PG5A 2ZJRQ 2C3OA 4WIIA 1T9UA 1UKUA 2E1PA 1FK9B 3ILLA 3NNAA 3M30B 4QPXA 1RT4B 1NKBA 3KLEA 3ZZUA 1O5JA 1N32F 1BWEA 1YVFA 3O2IA 4EBEA 1XMOF 4AL5A 1CG2A 3BR9A 4QJVA 4UW2A 3M8PA 4PG7A 2OEJA 3H90A 3JSMA 1IBMF 1CJVA 2HPUA 1IKVB 1HWUA 2DYAA 4YDXA 4ZDNA 4B3RF 2VQFF 2EFQA 4CM2A 4ECZA 3SCIE 3PRVA 3LANA 4DSIA 3RB6A 1U1NA 1HQEB 4QYZJ 1BQMA 1SKUB 2UZAA 3TZYA 4R5PA 3KMQA 1WTFA 4WF9Q 1DQ9A 1FKPA 2MZQA 3FC9A 3SQGA 4C8LA 4KGVB 1FJCA 2CQGA 2G0JA 1WC6A 3FBCA 4OV1A 2QLFB 2X7IA 1VBYA 3UI3A 4IO9Q 2H5EA 1QSSA 3NS5A 4KYZA 2BRLA 2XZWA 1WEZA 2MMYA 3DU5A 3ENQA 3MMCA 2MLXA 3W62A 4ZLJA 4DFPA 1TKDA 1NK9A 1S7IA 3QWPA 2BJ8A 3DLKA 3HVAA 3JTNA 2RE1A 4HI1A 4HH0A 1FK9A 4OZ2A 1AFIA 5EX0A 1H2VZ 4LMZA 1GH8A 1HD0A 3MAAA 3RW7A 3TJ9A 4C97A 4U6PA 2W1BA 4X4SA 1CJKB 3HVTB 2CZ9A 1T8EA 1HWLA 4CT8A 3M9OB 2Z57B 3NOCA 1T05A 4E0DA 3TUPA 4RW8B 2KFYA 3H5XA 4FKYA 2W7OA 3HVRA 4PQAA 1DURA 1JMTA 4Y65A 3QT7A 3S6EA 4DCOB 1UWAA 5J2PA 3QSIA 3TQ1A 2OPRA 4WFXA 2EKYA 2XZTB 5LMNF 4B3TF 3SCLE 3GLJA 4MK7A 3IWXA 3MR6A 3BPDA 4LF8F 1VQ6S 4ECQA 2QX0A 4L73A 2H54B 2VPYB 2FGCA 3ZZYA 5C7PA 5DQHA 3D1OA 3C46A 5CQGA 1HMVB 4ED1A 2QLXA 4DV4J 1IN0A 1HNXJ 3E01B 3UWTA 3IN5A 5KT7A 4N77A 3M8WA 4DSKA 1X7VA 2DNLA 2VF3A 3THTA 3BKUA 2KZZA 3DDIA 3MMCB 1R8CA 4TN2A 4USUA 2YXLA 2VJUA 1FRXA 1PO6A 1HHTP 4ETXA 3UFCX 3Q83A 5F8IA 3KK2B 2OAUA 2GCFA 3S1TA 4B3SF 3HFVA 4UQTA 3KJQB 3C2PA 3TJ8A 4OHXA 1H98A 2R7QA 3IAM9 2NQPA 4DFJA 2U1AA 5KG4A 2LU2A 3HLUA 4L3KA 2MZ1A 2QMWA 4M5GA 1LFWA 1X4EA 3CW2C 3M1VB 4Y2KA 4Y3CA 1S59A 4DG1A 5A8WB 4NLWA 5K20B 5IWAJ 3IGVA 1X8DA 3HHLC 4N76A 2OHDA 3TX8A 1IKYA 4DUZF 3I9V9 3BB5A 3CT9A 4OYMA 1GX6A 4ECXA 1EX8A 1HARA 2L48A 3TI0A 4GVLA 5H9EJ 1DTTB 5DM7Q 4N56A 1R7IA 4RBUA 5J2QA 3A8IA 4ZJLA 1H72C 1FDBA 3TW0A 5B7WA 2HVZA 2PI5A 3X1LB 1YJWS 5H1SV 2YWKA 3BZQA 4NRUA 3AOCA 4PG6A 4O3SA 3PYGA 3DN9A 4KH1B 2DNRA 4KV8B 3DGPB 3F44A 4PG8A 5IV4A 2B5JA 2DGWA 3PX0A 1UA0A 2NXJA 1B0TA 4WP3A 4ZVPB 2H9ZA 3W8PA 1IKXA 5M2PA 2BMBA 1P1TA 3R7NB 2ZC4A 5K14B 1RACB 2DXEA 4ED5A 2NZ4A 4KQZA 3BH6B 3BGLA 1OY8A 2MGZA 4DX6A 2JZ8A 2HFOA 2P6SA 4PWDB 2AYGA 2DEJA 4Y28C 4CH7A 4HH1A 3NAHA 2HHSA 2XBPA 4DR5J 1T7PA
chains in the Genus database with same CATH topology
3AGXA 1C3GA 1EB0A 3AGYA 3I38A 1NLTA 2B26A 2QLDA 3TJ9A 3LZ8A 3TJAA 3NY0A 2HFVA 1GMVA 3LA0A 3TJ8A 1XAOA 4J80A 3L9ZA 2Q2GA 4L3KA 1GMWD 3AGZA 1EARA 3NXZA 1GMWA 1GMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGX A;  1C3G A;  1EB0 A;  3AGY A;  3I38 A;  1NLT A;  2B26 A;  2QLD A;  3TJ9 A;  3LZ8 A;  3TJA A;  3NY0 A;  2HFV A;  1GMV A;  3LA0 A;  3TJ8 A;  1XAO A;  4J80 A;  3L9Z A;  2Q2G A;  4L3K A;  1GMW D;  3AGZ A;  1EAR A;  3NXZ A;  1GMW A;  1GMU A; 
#chains in the Genus database with same CATH topology
 1Q0N A;  4USJ C;  5C42 B;  2ZOG A;  1K1Q A;  4F25 A;  5F8H A;  1DTQ A;  2VQE J;  2G2O A;  4ZP7 A;  1NK8 A;  5GAG I;  2HLT A;  4ECY A;  2L9W A;  1VQY A;  2HHT A;  1B64 A;  2QRR A;  1P9Q C;  1SVD A;  2G1H A;  2J8A A;  2VG5 A;  3UVJ B;  3TVK A;  1P6T A;  4CO2 A;  1KEK A;  2JEJ A;  3W8G A;  5HVH A;  4Z2X A;  5HLF A;  1MN9 A;  2HKE A;  1L3T A;  1FHT A;  4RZR A;  1DJ0 A;  4H4K A;  3PYF A;  2BVZ A;  3ADA C;  4IG0 B;  2DIT A;  2FHJ A;  3HSJ A;  5AJ3 J;  3MUT P;  3B4M A;  3OFH A;  3BYR A;  2Q2G A;  5E3A A;  4ELV A;  4DJB A;  3AXK A;  2DR8 A;  3CJ4 A;  4J9M A;  2FY1 A;  1JXV A;  2GIF A;  1NK0 A;  4LF7 F;  3MR3 A;  2OTL S;  1YG0 A;  1RGV A;  1XR5 A;  1D3W A;  2AEM A;  2ZBC A;  3GFX A;  5AE2 A;  1Y00 A;  2BJD A;  2HWI A;  3VF0 B;  2Z0G A;  3NAI A;  2F8H A;  3IBF B;  2ZH8 A;  2ZH4 A;  3VQT A;  2CVI A;  4XAK A;  1BLU A;  3P5B P;  3UO0 A;  5DJB A;  4F3Q A;  1S10 A;  2R8K A;  1OO0 B;  3MFI A;  3KK1 A;  2DGX A;  1ZAV A;  3OR2 B;  5SUH A;  1XC9 A;  4Q2L A;  3JB9 k;  4WE1 A;  5CAB A;  2NRE A;  2LQJ A;  1ZET A;  1F2G A;  4YHH F;  3J81 j;  4HTI A;  1JXL A;  2ZZT A;  1X4H A;  3TAP A;  3QLH A;  2CJB A;  4F4X A;  3IGN A;  2XI3 A;  4ZA1 A;  4CT9 A;  2LEB A;  4ZCL A;  3MPW A;  2OEM A;  4M5D B;  1E6V B;  4ZP8 A;  1N5T A;  2K1R B;  4IRD A;  4GKK F;  2XHC A;  3M8Y A;  2DH9 A;  3ISZ A;  4FZV A;  8AT1 B;  3BQ1 A;  1GXT A;  2HHQ A;  2VKZ G;  2C2K B;  3C6T B;  4ER8 A;  4M5D A;  1YBU A;  1FO1 A;  1XK8 A;  3D6F B;  4DN0 A;  3THV A;  1RAA B;  2HFN A;  3I4H X;  4OLP A;  2XWX A;  4QCL A;  1B70 B;  1PJ5 A;  1ULR A;  3BGF A;  1QE1 B;  1SB6 A;  4JI8 J;  3WX8 A;  3BSA A;  3SFU A;  1IBM J;  2QE5 A;  2ZH5 A;  3BKT A;  3DKD A;  1S1U B;  3BSO A;  1TFY A;  1HWK A;  3GIL A;  4FF3 A;  4LBP A;  4LSN B;  3Q2T C;  3QBC A;  1OMS A;  2KHC A;  3Q89 A;  5DGB A;  3H25 A;  2JLE A;  2OFG X;  4EEY A;  2RD5 C;  2KXH A;  2HQD A;  4NYP A;  1FRM A;  5F9N A;  3A3O B;  1UEV A;  5F9L A;  2DCU B;  2CZV C;  4F36 A;  2XS2 A;  3IXQ A;  3IP0 A;  1S1W B;  2NXE A;  4IH7 A;  2V8P A;  4MT1 A;  1HQ2 A;  4FF4 A;  3EZ5 A;  4LF9 J;  4NYO A;  3CD0 A;  3R5G A;  2RQM A;  1HQU B;  2BW2 A;  3D54 A;  2J9D E;  3R6L B;  1L3U A;  2FHM A;  2UUA F;  1SIZ A;  2RHS B;  1RUS A;  3DMJ A;  1SXL A;  5HMZ A;  2ZD1 A;  4FNH A;  2D3U A;  2J9E A;  3N79 A;  2D74 B;  2G0I A;  1G2E A;  4OYX A;  4DSJ A;  2AJF E;  4JI8 F;  5KAK A;  2XCP A;  2QA4 S;  4IDK A;  3IS9 B;  2ZEJ A;  2MEW A;  2HS3 A;  2XYP B;  4IG3 B;  4K59 A;  1JJC B;  3KNG A;  4ANE A;  4HAC A;  3UN5 A;  1M5S A;  3FFI B;  3L4B C;  4JI4 J;  2FGO A;  3AD8 C;  4ZCM A;  4LJM A;  1KN6 A;  1PIE A;  4L3N A;  3BO4 A;  3SI8 A;  1MWY A;  5GMK a;  2VDH A;  2YNG B;  4GVB A;  5ETO A;  3DI6 B;  4BWJ A;  1IKY B;  2FHJ D;  3MED B;  2R7W A;  1EAR A;  3BYP A;  2DVI A;  4F4W A;  1C1C A;  2N3O A;  5G4D A;  2K3K A;  5KG5 A;  5E33 A;  3PW5 A;  2HZC A;  2EFN A;  4WU3 A;  1TMJ A;  4CI0 B;  2RAQ A;  1HBU B;  5D3G B;  2UUC J;  2ZHO A;  4DMZ A;  3H8Y A;  1R8H A;  1YQH A;  1RHQ B;  4UOH A;  3OVS A;  1WUU A;  5HRO A;  5ETS A;  2DO4 A;  3C8Y A;  2CNK B;  4PCQ A;  2M70 A;  5E3C A;  3KLF B;  1UVM A;  3AHP A;  2W9B A;  1X4C A;  1KDN A;  3IRW P;  3K5N A;  4Q0B B;  4Q0B A;  1R8A A;  3IRX A;  4WP8 A;  4URS A;  5A76 A;  5C25 A;  1FT8 A;  2HND B;  5L1I A;  3NWG A;  3BGO P;  2DRA A;  3HFK A;  3Q0A A;  5H9F K;  2KXF A;  2GAH C;  4DV0 J;  2UXC F;  3JYT A;  1CQN A;  1N88 A;  1RA6 A;  2HNZ A;  3OLA A;  3CCV S;  2LQB A;  2ATL A;  5KFY A;  2Q66 A;  5KTQ A;  2BOP A;  3OSN A;  4CNY A;  2PGC A;  4UTG A;  3PNI A;  2XY5 A;  4DR3 F;  4YDD B;  2OFH X;  2CWX A;  2GA7 A;  3CCM S;  4URQ U;  3X3U A;  4FXV A;  2LEC A;  2ZM6 F;  3LP1 B;  4TU7 A;  3RW6 A;  1W25 A;  2M8D B;  5J2P B;  2MQM A;  1HW9 A;  4ZPW R;  2AT1 B;  2UVR A;  4ZLN A;  2HFV A;  2B4V A;  3CJT A;  3M8P B;  3PYE A;  3TA1 A;  3OJS A;  1S0N A;  3PY8 A;  3R2D J;  1PYT A;  2EK1 A;  4WKY A;  4LF5 J;  4NLP A;  3IBW A;  2BJ3 A;  1B0V A;  3TX0 A;  1HD1 A;  3K2Y A;  5HQM A;  2W8K A;  1LK7 A;  3CCJ S;  1VQM S;  1N52 B;  1UA1 A;  1VMB A;  3O8W A;  2WBR A;  3L9Z A;  3LTO A;  3GG0 A;  4FXW A;  4CNZ A;  3D6T B;  3GWC A;  2GO8 A;  2IRY A;  2DRB A;  3RR7 A;  3MUM P;  2FJV A;  3O1L A;  3I5A A;  3CIM A;  4HTJ A;  3IG1 B;  3RYL A;  4EK2 A;  4DV2 F;  2C2E A;  2PMW A;  4C6A A;  3KK3 A;  2GX8 A;  4ID5 A;  5C5J A;  1G3O A;  1R43 A;  1SH3 A;  2MHE A;  4C11 B;  2BE7 D;  1JLC A;  2NLW A;  1UVI A;  4G1P A;  2GHV C;  1NHV A;  3MD3 A;  4C8M A;  2QZ8 A;  1JLB A;  3RBZ A;  4YB1 P;  2HQI A;  1S72 S;  4OX9 J;  1FVS A;  1AYE A;  2MQ8 A;  4K0K F;  3DLH A;  2W4D A;  1UW4 A;  3DLG B;  3NCR A;  3CWJ A;  1WOR A;  3MMJ A;  4IFV B;  4J9V A;  3KLH A;  1RT5 B;  2Y1J A;  1QAJ A;  2BE2 A;  3DM2 B;  2HBY B;  5DLF A;  1HNI A;  3ITH A;  2YKA A;  1QAI A;  3I5B A;  2XTJ P;  3QAE A;  1ZAW A;  2RQK A;  3N0V A;  2BBE A;  3PTW A;  4IDK B;  4IYQ A;  4J5O A;  4ZVQ B;  4N41 A;  4NLO A;  1YKW A;  4LF1 A;  5HQ8 A;  3HCX A;  1E6Y A;  2RT3 A;  3NOG A;  1M5K C;  4YOE A;  3K8V A;  3PJW A;  3CJ8 A;  1GMW A;  3K57 A;  3D9B A;  1D9A A;  4ECU A;  1M5O C;  3MM6 B;  2C2R A;  1FRJ A;  4DR2 F;  3K8W A;  1XMO J;  2FQQ B;  3CD5 A;  3V6D B;  2WTF A;  3R9L A;  3DXS X;  2RQC A;  2XYG B;  3NGT A;  2PT0 A;  3NRB A;  1CBK A;  2B5J B;  2DIS A;  4NI2 A;  3DOL A;  1K1S A;  5AE3 A;  3OLB A;  3GFY A;  4OZJ A;  2AX1 A;  4XO0 A;  3CCQ S;  4USI A;  4NA2 A;  2MZS A;  1HYS B;  3AB2 B;  4F3O A;  4X64 F;  2ZZM A;  3JTO A;  2QA4 G;  1U2F A;  2G0C A;  4GO7 X;  2B9Y A;  2X1F A;  3KFW X;  4KB7 A;  1FWK A;  4K0K J;  2B9W A;  4WFY A;  3J81 Y;  4CTA A;  3I9Z A;  2DBB A;  4D3G A;  3UR3 C;  3D3B J;  2DGT A;  3AJ1 A;  5IXU A;  2RIJ A;  3E51 A;  4DX7 A;  3POT B;  3W2V A;  3CO0 P;  5J2M B;  3QZ7 A;  2PE8 A;  1GAO A;  2KT2 A;  3GR1 A;  3KK3 B;  4DFK A;  4V19 X;  1AUS L;  3M9M B;  2E5L F;  2KL8 A;  3M9N B;  2OH2 A;  2CQ1 A;  2Q3P A;  4LRB A;  3KHR A;  4F0H A;  2AZ1 A;  2HLU A;  2EFV A;  4KPC A;  2GQ2 A;  1S4F A;  1F3F A;  4I69 A;  2GVZ A;  4B3S J;  2QL7 B;  4LR7 A;  3D67 A;  1XMB A;  1FE4 A;  2XMW A;  3GPA A;  1NDL A;  3N28 A;  4KBI A;  3VGU A;  4DDF A;  5I3Q A;  4DV0 F;  3Q86 A;  4MYT A;  3MXH P;  4C9D A;  2OIH A;  1RT7 B;  2HHP A;  2POK A;  2KI2 A;  3CB4 A;  5DM6 Q;  1JLQ A;  2PO4 A;  2F4V F;  3GR0 A;  4X64 J;  3CUN A;  4QBU A;  1GX5 A;  2R7X A;  1RTI B;  2L08 A;  1U6F A;  5BR8 J;  1S6P A;  2QT7 A;  5DZ7 A;  1VIO A;  1URN A;  2IYG A;  4QWB A;  2GJF A;  4WTO B;  1RT2 A;  2BAN B;  3DHW C;  4DV5 F;  4J90 A;  4A46 A;  2IRU A;  2BUN A;  3RR8 A;  3U1M A;  1WAC A;  3KJN B;  2VFV A;  5CD4 H;  2BAB A;  3I87 A;  2BAN A;  1LWX A;  2OGU A;  1U48 A;  3CCT A;  4KGM A;  4OQJ A;  1NME B;  1IR2 A;  2Z2M A;  3MUR P;  2FVP A;  2JZ5 A;  1VJQ A;  4Q43 A;  1Y3J A;  2VIC A;  3AOA A;  1TL7 A;  1OYD A;  3G82 B;  4TU8 A;  3HHN B;  1RHU B;  2FJW A;  4F04 B;  2VBW A;  2MKH A;  3LGN A;  4S0M A;  1K73 T;  4LFA F;  4IR9 A;  2J6T A;  3CCR S;  4AD6 A;  1S9E A;  1LWE A;  2WB1 D;  3QT5 A;  1TL7 B;  3UNY A;  1YX2 A;  2J76 E;  3CDW A;  1ZA1 B;  3MEK A;  3P4U B;  4XDD A;  2B51 A;  2K1R A;  3W9I A;  2WW8 A;  4DQR A;  4CIO A;  4JI7 J;  1OPZ A;  1A0O B;  4DV6 F;  2ZBP A;  2CDQ A;  3NGR A;  2E5I A;  1RBA A;  2FB0 A;  5K9F A;  5HL7 Q;  4B3O A;  3QLH B;  3AAW B;  2YX4 A;  1X5P A;  4KTQ A;  4MFB B;  1RKJ A;  5KFA A;  4LF6 J;  1CJU B;  3G9C A;  1S4E A;  3KUH A;  1X9W A;  4B3O B;  1EB0 A;  4QWD A;  2J9D A;  2MLY A;  4LF8 J;  1HA1 A;  1U47 A;  2XLK A;  1EKR A;  3GFH A;  4O44 A;  2CQ3 A;  5D4N A;  2AQ4 A;  2KYX A;  3W66 A;  2CNL B;  4RW4 A;  4KY3 A;  2KO1 A;  3LZ8 A;  2WON A;  2K8G A;  3Q24 A;  1QAX A;  2Y1I A;  1TP7 A;  2MY7 A;  2DKO B;  2OPR B;  4TY8 A;  1NK5 A;  2RKI B;  5KFB A;  4F4K A;  1JWW A;  3NGU A;  2CPF A;  1NH7 A;  1TKZ B;  2WVE A;  4DPY A;  5IS2 A;  1ZOT A;  4M5N A;  4K4T A;  3KTQ A;  3QRR A;  2HQC A;  1EKS A;  3IC1 A;  1N4L A;  3VTI A;  1RTD B;  4DU7 A;  2WB4 A;  1P27 B;  3D68 A;  1MLA A;  4OYA A;  2PII A;  3DRP A;  3WC2 A;  1X4D A;  1Y10 A;  4TLR A;  1HLW A;  2KZM A;  1CVJ A;  2AWZ A;  3QT6 A;  4ED0 A;  1SPB P;  2HIY A;  1SC6 A;  4ZPD A;  1WG1 A;  2IPO B;  2ZKT A;  1S1V B;  1VRT A;  1KQF B;  3HMJ G;  2ADC A;  2AJ1 A;  4Q44 A;  4WK3 A;  2CPJ A;  3GV7 B;  2GVD B;  3CC7 S;  4NMX A;  1WJ9 A;  4WFA Q;  4B3T J;  5IOL A;  1IJF B;  4X4T A;  3FQL A;  1S12 A;  2XMU A;  4IRC A;  1SC4 B;  1X4F A;  2YX1 A;  3GMG A;  4C48 A;  2OSR A;  5A8R B;  2G1D A;  1PBU A;  2DXF A;  3GCX P;  4HAC B;  1N48 A;  3NY0 A;  2FLN A;  1QD1 A;  4NAS A;  1T02 A;  2V4Q A;  1I3O B;  2MZJ A;  3TUI C;  3L7U A;  4U8V A;  5L38 A;  4ED8 A;  1HBM B;  2QYC A;  2VDI A;  1CJT A;  3ZTS A;  5KFO A;  1REV A;  5LJ5 Y;  1M1K T;  4AQY F;  1S99 A;  1V6H A;  3AKO B;  3IWN C;  1WC3 A;  3UD5 A;  2FLP A;  2R7V A;  3CPW R;  3IFE A;  5HMX A;  5GAD U;  3MM6 A;  2RSQ A;  4AFF A;  4IG0 A;  2CG8 A;  1KLM A;  3DOM B;  1SV5 A;  3Q8P B;  2D3Z A;  2K3I A;  3VWS A;  2CZ4 A;  7AT1 B;  1NJW A;  2XMV A;  1YBT A;  2ZWO A;  3FEZ A;  1EQM A;  2WRM A;  1LW2 B;  4OI6 A;  3GE9 A;  4AL7 A;  2YNI A;  1HNW J;  3KG4 A;  4XIU A;  5SZT A;  3MM7 A;  4DLE A;  4BLG A;  1GTH A;  1RP5 A;  1HPZ A;  3FBE A;  3MEE B;  1NK6 A;  2O1P A;  4B3R J;  2MST A;  4ZVG A;  3RB0 A;  2FJE B;  1Z2Z A;  2HGN A;  2CWK A;  2MZT A;  3ULH A;  5HMY A;  1W2B R;  5E3P A;  1IBC B;  2FJD B;  4FYY B;  1VRU B;  3ZTQ A;  1VS3 A;  1UAW A;  3QQC D;  5A8K B;  2I8E A;  3GSI A;  2AX0 A;  1FRL A;  1Y3K A;  1S9F A;  4DL0 C;  1KON A;  3FRZ A;  3C6U A;  1WTB A;  5LSO A;  2I2Y A;  2JEI A;  3HSZ A;  4K4X A;  1S97 A;  4ELT A;  1UP1 A;  4HT5 A;  3CD6 S;  2RML A;  2AF6 A;  1LOU A;  3M8Q B;  1KVK A;  4MKA A;  1OIA A;  1SBR A;  3TZX A;  2EPI A;  4ZVS B;  3Q23 A;  1HI0 P;  3QWU A;  3Q8V A;  4DOZ A;  4JI4 F;  4ZLP A;  1RT4 A;  1RAI B;  3G6Y A;  1H2T Z;  1LWF A;  4I68 A;  5E2Q A;  2QC3 A;  3DNC A;  2AJ4 A;  1AA1 B;  4I7F B;  2B0G A;  4DPX A;  2JL9 A;  3ITH B;  9RUB A;  4PR6 A;  4F4Z A;  4DR6 J;  2LLZ A;  2MJU A;  3EZU A;  1I94 F;  4MAK A;  2DNZ A;  3B78 A;  4OHW A;  4DX8 H;  3Q2S C;  2PMZ D;  4KGK A;  4FYD A;  2W9C B;  4AL6 A;  4DPT A;  2LCW A;  3M1V A;  3FSY A;  1B7Y B;  4DG1 B;  2F40 A;  4WFN Q;  2PD1 A;  4DSE A;  4QU7 A;  1HR0 J;  2ZZN A;  4V19 J;  2R7U A;  5DDQ C;  5C2C A;  1F5A A;  3OVB A;  2AV5 A;  2BKP A;  4HLB A;  4A8Y A;  5HMW A;  1UFW A;  4DZ6 A;  1Q8B A;  3SCK E;  1WC5 A;  1RLC L;  1JLC B;  3MAQ A;  1CJV B;  1TEL A;  4F50 A;  2MYF A;  4RU2 A;  2E9T A;  1NK4 A;  2F8E X;  2DGS A;  3MR2 A;  3RBD A;  1HNX F;  3IG1 A;  3N6N A;  1U0H A;  2IM3 A;  2NSB A;  3HKW A;  4NL5 A;  3GU0 A;  3VGT A;  3C6E C;  2HQF A;  2KYZ A;  3BDP A;  4JI1 J;  2CIM A;  1NDK A;  2HHX A;  4J9K A;  5JUM A;  1NDP A;  2RHQ B;  2V4J A;  4BBY A;  4F26 A;  3EPG A;  2OTJ S;  4GC7 A;  3EYZ A;  2A18 A;  4LR8 A;  2E44 A;  2GGP A;  2MPU A;  1S0V A;  4WPA A;  3SQG B;  5MAO A;  1GQE A;  2DGO A;  2KDO A;  2WOM B;  1RHR B;  3J7Y I;  3R8Y A;  4AE5 A;  1S9G B;  2IYI A;  5KG0 A;  3TNV A;  3KHL A;  1J5O A;  3PO4 A;  3SZ2 A;  1KS2 A;  5IT9 U;  1ELO A;  3OHA A;  2JC0 A;  2HZV A;  3UCG A;  5KFE A;  1VQ4 S;  2C1E B;  1REV B;  1V3S A;  4FBU A;  3UDV A;  1WF1 A;  4V1A k;  5D0R A;  1Q16 B;  2R4F A;  3PAC A;  1AXQ A;  3D0I E;  3LP1 A;  3R5J B;  1DBD A;  3FCH A;  2CA9 A;  4C8N A;  3TUJ C;  5BJR A;  1JJ4 A;  3W2W B;  4F4A A;  2IA6 A;  2AJ2 A;  1KNZ A;  1VQN S;  2A10 A;  3Q8R B;  1H3D A;  2CAJ A;  1HBN A;  2XSF A;  4A8F A;  2BEF A;  4G65 A;  4YB7 A;  4C0O C;  1V9O A;  3PVX A;  3DDN A;  1APS A;  2VHG A;  4LQ3 A;  2JEG A;  4ITS A;  4Z7C A;  1SCJ B;  1HWI A;  2MXY A;  1T0T V;  4CP5 A;  3TP2 A;  2XSJ B;  3D3C J;  3T1H F;  4OIX A;  1EJ7 L;  4JYA F;  4I2Q A;  1EQ0 A;  1WHX A;  4DR1 F;  5KFQ A;  4FF1 A;  4RUC A;  2XI2 A;  3FCW A;  1YIT S;  4I4B A;  1HMV A;  4RUH A;  2HSE B;  1IUJ A;  5DG7 A;  4HI2 A;  3TUZ C;  1RT5 A;  1R6V A;  1HHQ A;  4C8K A;  5CHC B;  4RWX A;  1ZBT A;  5LOQ A;  4KHP J;  5FJ4 A;  4WP9 A;  4ZLL A;  3I32 A;  3LH2 S;  3OTB A;  4ZP6 A;  1SL2 A;  2HQG A;  1ZH5 A;  4WZQ A;  2V94 A;  2PI4 A;  3V4I A;  1SUQ A;  2HRT A;  2V8V A;  1T9V A;  1OSC A;  4IFY A;  5B09 A;  4F4Y A;  3TAM B;  1FEH A;  3AH6 A;  1FDD A;  2NZC A;  1Q78 A;  1VIS A;  1W2I A;  3TJA A;  2X1G A;  4I6Y A;  1U25 A;  5HI7 A;  2CPH A;  5I3U A;  5B0G A;  2AYE A;  1TVR B;  2ZIT A;  2NPI A;  1A6L A;  3GYG A;  2YNF A;  2I6W A;  5F8G A;  4PXD A;  4QWA A;  1JLA A;  1TL4 A;  4KGX B;  1IBL F;  4X4R A;  1XAO A;  3MCN A;  2FHK A;  5CYQ B;  4CLZ A;  6FDR A;  3GJT B;  5MLC V;  4DCJ B;  3RTV A;  3RAX A;  2C3M A;  4LBI A;  1QAY A;  2V68 A;  3RGI A;  6FD1 A;  2DRD A;  2VPX B;  3BDE A;  1P1L A;  1XTZ A;  3A4T A;  2GIQ A;  3IM9 A;  1YJR A;  3C16 A;  4HL9 A;  4WYL A;  5JVG Q;  4DUT A;  4UT4 A;  4DV7 J;  1HBO A;  1I94 J;  4PQU B;  2BAC A;  4CLF A;  5ETM A;  4OYO A;  4RBV A;  4WJB A;  4NXN F;  3PEH A;  5D4O A;  4KPY A;  2HRY A;  3GYN A;  4TYA A;  4FPI A;  4CO5 A;  3CJQ A;  4HT7 A;  2YKM B;  2VFT A;  3MMB A;  4K5R A;  4IH6 A;  5B0F A;  3SV4 A;  2XY7 A;  3IAS 9;  4HVZ A;  2D3O 1;  4DSL A;  1F9H A;  1UW9 A;  2VPW B;  2G9O A;  3UW1 A;  7FD1 A;  2PEH A;  3IR6 B;  1H74 A;  1RT3 A;  2C3Y A;  2EXU A;  5ETK A;  1S1V A;  1VRT B;  1Q79 A;  2RU3 A;  3MR5 A;  2GVD A;  1G1X A;  2M0G B;  4Q5V A;  4K50 A;  4AQY J;  3RB4 A;  2E5L J;  1VI7 A;  4P75 A;  3PRB A;  3G71 S;  3OXG A;  4DQQ A;  1JJH A;  4NLQ A;  1XWL A;  4O3P A;  5J1E A;  5HRO B;  2FIU A;  2APO A;  2GMJ A;  1RT7 A;  3AOB A;  4MK9 A;  3VGS A;  1KLN A;  3DLL Q;  4NLR A;  2D9P A;  4NEZ A;  1IQT A;  3CDE A;  1RWU A;  3EGW B;  3MDF A;  5LMU J;  4DV1 F;  3T1A A;  5CXT A;  4EZ6 A;  4EBC A;  3A13 A;  5L1K A;  1JLG B;  1S0O A;  1L5U A;  1WSV A;  2WVB A;  3ILI A;  2EWH A;  4O4G B;  3FMB A;  2BQU A;  4I0W A;  1VCT A;  4BDP A;  4NCB A;  3EXC X;  3QFH A;  3S8S A;  1U45 A;  2J0S D;  3CUL A;  1B7F A;  3DI6 A;  3ONQ A;  5B0E A;  1IVZ A;  1YZ6 A;  3EJM A;  2AP6 A;  3CCW A;  1RAF B;  2B3T B;  1F6T A;  2ZBR A;  3OR2 A;  4KHM A;  2JVR A;  4XTT A;  4QIW D;  3MWB A;  1F3V A;  2XUL A;  1ZM3 A;  2ZDP A;  4WE1 B;  4ZVT B;  2DIV A;  4QZV B;  4X4V A;  5ETQ A;  2HFU A;  1F5B A;  2GHW A;  2B8Q A;  2LXI A;  2VL1 A;  2YNI B;  1NJZ A;  4FPR A;  1EAY C;  1CUL B;  1QM9 A;  1U6Z A;  4OI3 A;  4W98 A;  1VBX A;  3CJR A;  3M2R B;  4AT1 B;  2IC3 B;  2ZFH A;  4YN3 B;  1MN7 A;  3THP A;  3M05 A;  2ZJP Q;  3O3L A;  3BO3 A;  1H38 A;  2FHO B;  2ZH1 A;  5KFW A;  5AXK A;  2V63 A;  2ASJ A;  2DPJ A;  2VIH A;  1TV6 A;  3M2U A;  3T3F A;  4G1Q B;  3I4P A;  2QLW A;  1VRU A;  1Y0H A;  2JHE A;  3N9U C;  5A8K A;  5CZX A;  4RW4 B;  1FXR A;  2KVI A;  1WC0 A;  4G6V B;  3EWG A;  4Y2M A;  5L46 A;  3OV7 A;  1N56 A;  1S6U A;  3ETO A;  5K8O A;  1K44 A;  1JLA B;  4K7Q A;  2BR0 A;  1NZ8 A;  4P2F A;  2MQN A;  1DAX A;  4X2B A;  2ZOF A;  4HHJ A;  2N7C A;  3BBC A;  2K2P A;  3H5U A;  4X66 J;  3CMQ A;  1RT2 B;  1XIQ A;  1FDN A;  1JLG A;  2UUC F;  4L6V 3;  3L3C A;  2NUU G;  1R6Y A;  4USV A;  2BX6 A;  2CRL A;  3CE8 A;  3UNG C;  2N82 B;  2E7X A;  2RDI A;  3TWZ A;  1JLF B;  1HBO B;  2UV8 A;  5DZ6 A;  1KRP A;  1T9W A;  5FDL B;  3AOD A;  4CLP A;  2E9R X;  1S5Z A;  2DNN A;  2A1B A;  2L41 A;  3K58 A;  4M1K A;  2FZG B;  2K7J A;  3HF5 A;  1FDA A;  1KP6 A;  1UJ5 A;  2BZ2 A;  4A8W A;  5HVG A;  5EDW A;  1CUL A;  2FC9 A;  4C3L A;  4J9L A;  4K4S A;  1DZ5 A;  1Q1K A;  4CYU B;  1S48 A;  5EWF A;  2V5H G;  2E1A A;  3OTO F;  1WG4 A;  2BQ3 A;  2EEY A;  3GV5 B;  3E01 A;  3ILO A;  1UJ4 A;  3CDB A;  5CZV A;  2X1B A;  3IBC B;  5D8H B;  3JSY A;  2AHO B;  2QN6 B;  3SFG A;  1FKP B;  2QEX S;  1PYO B;  1RT6 A;  3PR5 B;  4AYB D;  1RTZ A;  1DQA A;  3W5Y A;  4H4M B;  1MG7 A;  2LEA A;  1RWW B;  3JSB A;  1UVJ A;  1NM2 A;  2I5J B;  1ZPW X;  2DNG A;  4RBT A;  2ALZ A;  1G4C A;  1CEZ A;  2DB1 A;  3DRR B;  5EX3 A;  4GKK J;  2JFD A;  1RTI A;  1S0M A;  3N5B A;  2E29 A;  4I6W A;  3JQK A;  5H9F J;  3V6D A;  1X5O A;  2IHR 1;  1T9Y A;  3ZZR A;  2ZOM A;  2IJR A;  2YNG A;  4NI2 B;  3H40 A;  2VON A;  5KFG A;  2QTW A;  4J9R A;  2RRB A;  1F0X A;  1I5O B;  2HS4 A;  4CLW A;  3C14 B;  2HFZ A;  2DGV A;  2UUT A;  3Q8Y A;  4O0N A;  2LP4 A;  4ZK7 M;  2KRR A;  3DHX A;  4A8K A;  1N6Q B;  3NCP A;  1SKR A;  3GIM A;  3DYA B;  2VB6 A;  4UST A;  5LL6 d;  5BYQ A;  3IM8 A;  1D8Z A;  1CLF A;  1U1K A;  2HK2 A;  4BCA A;  2ZH2 A;  4A8X A;  2H65 B;  4DV2 J;  4FXD A;  1PBA A;  2EFP A;  4TLQ A;  1RIS A;  3T9Z A;  5E41 A;  1QSY A;  3M8R A;  3C6U B;  1BY9 A;  3HHD A;  4FF2 A;  2YPZ A;  1TL5 A;  2VG6 A;  4CLU A;  4CDI A;  4IFV A;  3UCU P;  4GKJ F;  2AJ0 A;  1LW0 A;  2OEK A;  1Q8L A;  3ZFV A;  1SUQ B;  4IFY B;  1BQM B;  4P7T A;  1GK8 A;  4RW7 A;  3P45 B;  5J1N A;  3TAM A;  4K4Z A;  4ATN A;  3WQP A;  1TK8 A;  2ZBI A;  4MK8 A;  2H5J B;  2DR9 A;  1PAU B;  4J9Q A;  1TK0 A;  3QGG A;  4LF4 J;  3CTR A;  3FNN A;  4G1Q A;  3MM5 B;  3T1Y F;  2ROE A;  4P2S A;  4B3M J;  4JV5 F;  2FJB B;  4OI4 A;  3HHL A;  2KVQ E;  4RW8 A;  3OHB A;  3I56 S;  4LBH A;  1LQ9 A;  3I55 S;  1OJ4 A;  2GGP B;  4FYW B;  2M52 A;  4P7V A;  4EUV A;  4FS1 A;  5GAG U;  3U1N A;  5KFK A;  2DHS A;  3B54 A;  3SCJ E;  5D6G A;  2Q43 A;  4IRK A;  4DR7 J;  2GNK A;  3D0H E;  3NBP B;  1DRZ A;  4FBT A;  2RH3 A;  1BMQ B;  1U24 A;  2E1M C;  1IXK A;  1JLE A;  3I96 A;  5I4M A;  1VQ9 S;  2NUH A;  5J2Q B;  4JUZ A;  1PJ6 A;  2FTR A;  3GQC A;  1K8A T;  2UU9 J;  3W3S A;  3TRG A;  1MU2 A;  2OPS A;  2R7R A;  1SV5 B;  5HVF A;  2CQH A;  2CQI A;  2LQ9 A;  4DUY J;  1N34 F;  2B26 A;  2QG9 B;  4ZPA A;  4LT6 A;  4BC7 A;  1ARO P;  1TKX A;  3LF0 A;  4C7Q A;  3V81 A;  2HBR B;  3BBB A;  3MGJ A;  2DJW A;  2B43 A;  4TYB A;  1LK5 A;  1FWL A;  3I0R B;  2C28 A;  5HP1 A;  1XJW B;  1Q7Y T;  1PJ7 A;  2H1Y A;  1N33 J;  1D09 B;  2AEJ A;  1UL3 A;  2RUS A;  4PWW A;  2MGZ B;  4FS2 A;  2HYI B;  2CNO B;  1VOM A;  4P72 A;  1FA0 A;  3MCO A;  3OBI A;  1KSP A;  4CO0 A;  5EHH A;  2VJV A;  5ETP A;  5D0E A;  5DDR C;  3NEK A;  4E2F B;  2YH0 A;  4OHY A;  3CCU S;  5I42 B;  4M5J A;  2W2N P;  2AGP A;  1IKW B;  1Q7L B;  4UF4 A;  5E5N A;  3HD2 A;  3R5A A;  4BHQ A;  1HI8 A;  3MI7 X;  4P2X A;  2PN6 A;  1VQS A;  2OD6 A;  3ISN C;  4PAB A;  3R6G B;  1X4A A;  5HAN A;  4LFA J;  1ZZF A;  2K7K A;  1ZAX A;  2QMU B;  2XHW A;  2YWW A;  1J5E J;  1WDD A;  2MLZ A;  4ES3 A;  4GRS A;  2UXD F;  2EBG A;  4JI1 F;  5F8L A;  1CC7 A;  3MM9 A;  3M8Q A;  1RT3 B;  1HNI B;  4OI2 A;  2YWH A;  2VZ9 A;  1T9X A;  3EVO A;  2JNJ A;  4C3K A;  4DR3 J;  2E7V A;  5EUH A;  1OY6 A;  1VGY A;  4Q7A A;  4N5S A;  1ITP A;  2CPE A;  4OFZ A;  1RTJ B;  2YY3 A;  2GML A;  2RKI A;  1VJW A;  3P5T L;  2J5A A;  1LEO A;  3K5P A;  1YJU A;  2CJ9 A;  3I0R A;  2F9D A;  4F7V A;  1Q81 T;  1SL0 A;  3BV8 A;  3PIP Q;  5BR8 F;  5HO4 A;  1FNM A;  2HBZ B;  1T3O A;  5CAA A;  1Q82 T;  2QL5 B;  2PFF B;  3ET6 A;  3C3L A;  4ALZ A;  4C98 A;  3LPE A;  1TKX B;  3HP6 A;  3GTY X;  5AJ3 F;  2AGO A;  2KKH A;  2P9E A;  3QZ8 A;  4A8Q A;  2IMW P;  2KU7 A;  1NLT A;  3T9N A;  2LA6 A;  4QW9 A;  4CLT A;  4C8Y A;  3W7B A;  3HDS A;  1VDH A;  5AT1 B;  1HW8 A;  5HBM B;  3LGH A;  2DTJ A;  2OPP B;  5K14 A;  2B7C B;  4W90 B;  2XO7 A;  1I51 B;  2DY9 A;  1TV6 B;  2IBK A;  1WC4 A;  5I3U B;  4R8U A;  2DEI A;  2UU9 F;  4X65 F;  2DGQ A;  1S1W A;  3RJM B;  4CO1 A;  3QSY B;  3MHY A;  4OJ1 A;  4X84 A;  3G2X A;  1RE1 B;  1UZH A;  3RUB L;  1RU1 A;  2PDA A;  4K2X A;  2MHN A;  4PWU A;  3H42 A;  1GNK A;  1X4G A;  2VAS A;  3VAJ A;  4DR4 J;  5E3Q A;  5KFP A;  4JI3 F;  2I5J A;  4GVB B;  5CYM A;  2GJI A;  2Z2L A;  4DR4 F;  1QLN A;  1QUV A;  3LAK A;  4N7T A;  3Q8U A;  4JV2 A;  4LF4 F;  3E3X A;  4PYA A;  2V4R A;  2NPF A;  4LFB F;  1WWH A;  4B9M A;  3PIO Q;  1V3R A;  2QLD A;  1WHV A;  3EGZ A;  1KVI A;  1NB2 A;  2R2S A;  4NA1 A;  2B6A A;  4JI2 J;  2GC8 A;  3C66 A;  1OWX A;  4I67 A;  2ZDO A;  1HNV A;  3J7Z 5;  2R42 A;  3BJY A;  2LU1 A;  2NS1 B;  3N01 A;  4E98 A;  1H0H B;  3RZA A;  1PSD A;  4KO0 A;  2KM8 C;  1YBA A;  2RNE A;  3HK2 A;  1LWE B;  2GFF A;  1VRQ C;  5DS7 A;  4ED7 A;  3AGZ A;  5FII A;  2A6O A;  1HQU A;  4HHH A;  1R8P A;  1A7G E;  4KO0 B;  4ZCI A;  1SI9 A;  1FKA F;  1LV5 A;  1LXJ A;  5IM0 B;  2CUY A;  2EW9 A;  4DQS A;  1KWM A;  2Q6C A;  2ATC B;  4JI7 F;  1XNR J;  4O3N A;  1RAJ A;  3BS9 A;  2FYX A;  4OX9 F;  2VFU A;  1F1B B;  1QDU B;  3TAQ A;  4OJ3 A;  1WEX A;  1YJ7 A;  3CME S;  1RT6 B;  5JMN A;  2EFG A;  4R0J A;  1T03 A;  4C8Z A;  2KT5 A;  2O5D A;  3FEY B;  1OPI A;  3JQJ A;  5IQQ A;  1DTQ B;  3J80 U;  3JYT B;  4ECS A;  1KOH A;  4WU2 A;  3CCE S;  4CYU A;  3MM8 A;  1DFD A;  3LA0 A;  1RT1 A;  4KRW A;  1HKA A;  2W4P A;  1I6J A;  1RWK B;  1FWP A;  2ZH3 A;  4EYH B;  2LA4 A;  3BRE A;  2ASD A;  4I1T A;  2IAJ A;  4P10 A;  3LW5 C;  2AMC B;  2BJ1 A;  3LUY A;  5L8R C;  1N5V A;  5HAT A;  3OQ2 A;  4EI2 A;  1UEU A;  3R7B B;  4U7C A;  4DV7 F;  2ZH6 A;  1O8B A;  4F0K A;  5GAH U;  3EVM A;  2ACM A;  3D28 A;  4DL2 A;  4LRF A;  1JLF A;  3UDE A;  2KJV A;  4O3Q A;  4DR6 F;  1UTA A;  1T94 A;  3AGY A;  4X62 J;  1WC1 A;  4ECR A;  1HNV B;  4ECW A;  3M2R A;  4RO0 A;  4MIW A;  1DQ8 A;  1Q8K A;  3GJS B;  3RAM A;  5DET A;  1F5C A;  1FKO B;  1WOP A;  1Q5Y A;  4YME A;  2D3O R;  1U7L A;  3UDC A;  2HHW A;  2E5H A;  3EMT A;  4X4P A;  2ZH7 A;  2HHV A;  2H3E B;  1W26 A;  3DRS A;  3KDO A;  1VQ5 S;  1BC6 A;  2CKW A;  4Z37 A;  1H7W A;  3NWR A;  3WDO A;  2HWH A;  1U1L A;  5GME A;  1QVF R;  4Y2C A;  4CRJ A;  3MTK A;  3VVT A;  5FLX U;  1R8B A;  5LSL A;  3HFZ B;  3V4I B;  2RUG A;  1MWQ A;  3KLI A;  1NHK L;  2R2U A;  2RU9 A;  4C11 A;  2NSC A;  2YKN B;  2WSC C;  2JVM A;  3ETM A;  2DO0 A;  2OML A;  4ZVU B;  3PW7 A;  1PCA A;  3M2U B;  3HVT A;  2GMH A;  3DRX A;  2WSE C;  2B4O A;  2QFI A;  4M8L A;  5T14 A;  1UWB A;  3PR4 A;  1MWZ A;  1UVL A;  1RT1 B;  2YX7 A;  3GJQ B;  1VQO S;  4MTP A;  2MY8 A;  3CXC R;  2D41 A;  2HRU A;  2PA8 D;  2IM1 A;  3TZW A;  4ILL A;  3LP2 B;  4JI5 F;  2HG4 A;  4WFZ A;  2MKI A;  1RHK B;  3M2V B;  1RDR A;  2VBZ A;  2ZKU A;  4GO5 X;  2WCX A;  3VAF A;  1YDL A;  1S1U A;  2BM0 A;  3AY0 A;  1RWO B;  3ET6 B;  3FSX A;  3Q8Q B;  3CMA S;  3OVA A;  5CYJ A;  1K9M T;  4HEA 9;  4JI2 F;  3E8O A;  3I5C A;  3VAL A;  4CTA B;  1HQE A;  4BS2 A;  2HIQ A;  2KM8 B;  4QYZ K;  3WX4 A;  2ASY A;  2CQ0 A;  3V6H A;  2FD2 A;  2QMX A;  3DRP B;  2ZC3 A;  1N8R T;  3MD1 A;  1S6Q B;  2VBY A;  1O6X A;  3MMA A;  3PFE A;  1J27 A;  4EGL A;  2MQO A;  4OJH A;  4UOC A;  4DI6 A;  4IQX A;  2NCK L;  4ID5 B;  3ZNJ 1;  2VOO A;  1TFW A;  1RAG B;  4IOB A;  2Q79 A;  4RNN A;  1U8S A;  3GIK A;  3HXM A;  1S1T A;  1UPM B;  3AJ2 A;  2UUA J;  3TA0 A;  4ZIV A;  2JVO A;  2R8I A;  3D5M A;  2IVY A;  4QWE A;  2O66 A;  4F2R A;  2VG5 B;  4DR2 J;  3F0N A;  2XMT A;  1TVR A;  3W1Y C;  1ICE B;  3HT3 A;  3K5L A;  5LMU F;  4KHR A;  4DV1 J;  2XGP A;  3EM1 A;  3IA0 A;  3M2V A;  1K47 A;  3DM2 A;  3KXD A;  1BUX A;  3R5B A;  5C42 A;  3U27 A;  4K2J A;  3LOU A;  5A2Q Y;  2P6T A;  4I56 A;  1REG X;  1X4B A;  3A3P B;  5HJY A;  1VBZ A;  4I64 A;  2FVS A;  2HHH F;  3FVY A;  5IFM A;  5LMN J;  1Z1Z A;  4O3R A;  4OYZ A;  4UY8 T;  2BKN A;  1BE4 A;  4DSF A;  4DPW A;  3H7H B;  1WOO A;  4ED3 A;  2FUG 9;  4FVC A;  3TVY A;  2CG4 A;  3A8K A;  1O51 A;  3KYL A;  3L09 A;  1NKC A;  4M5I A;  3GG1 A;  1VC0 A;  5KOW A;  2DH8 A;  3PHE A;  1X0P A;  4L76 A;  4DR1 J;  1FF2 A;  3OL8 A;  1SKS A;  2V9K A;  5HBM A;  3T6B A;  2LKZ A;  3TYT A;  3SSQ A;  3MFH A;  4QU6 A;  4YEA A;  1JK9 B;  3CC4 S;  2CQD A;  2R8G A;  4N8N A;  4ICL B;  5H9E K;  4WFB Q;  4FDF A;  1OQ3 A;  1KQK A;  1XNR F;  4X65 J;  1Y11 A;  1ZTW A;  3HD1 A;  1NUE A;  3CED A;  3FBF A;  2BQR A;  1SH0 A;  1B0P A;  2QO3 A;  2RQ4 A;  2YKP A;  4YHH J;  2VC1 A;  3H4B A;  1N0U A;  4N47 A;  5KFC A;  1S9G A;  1GT8 A;  1F9F A;  3LP0 B;  3OUY B;  3AA8 A;  1AW0 A;  1V5I B;  2F3J A;  3MAA B;  3CJ0 A;  4YR2 A;  4QWC A;  4K4W A;  1GTE A;  3TZZ A;  1R3N A;  2WK4 A;  2ZHB A;  5K8N A;  3LP2 A;  2DD8 S;  2E7W A;  1NSP A;  2XSJ A;  2XEX A;  5GMD A;  4ZHR B;  4CLS A;  2IFX A;  3PZP A;  3M32 B;  4FNI A;  4IUF A;  1VQ8 S;  1JXE A;  3ISN D;  5JXS A;  1QVG R;  3TQE A;  2DH7 A;  1RBL A;  3CCZ A;  2YVS A;  3Q22 A;  2F4V J;  2IDE A;  3PX4 A;  5DDP C;  1JQG A;  4USK A;  4OZ0 A;  2DR6 A;  5I42 A;  1U1R A;  1RAD B;  1K0V A;  5DGA A;  3W60 A;  1AZS B;  2IM0 A;  4WIQ A;  2G2Y A;  4FP9 A;  4MKB A;  1UVK A;  4JOU A;  5ETT A;  5AE1 A;  3US5 A;  3OTD A;  4ZS6 A;  5RUB A;  1SJF A;  3MZI A;  4CO3 A;  2GQC A;  3DLJ A;  1AZS A;  2M88 A;  1KHW A;  2CXE A;  3GYX B;  3ZZO A;  4HKQ A;  4OV6 A;  4NLT A;  2W8L A;  1UET A;  3OPK A;  5KG2 A;  4HDG A;  2Q1L A;  4ETZ A;  3QGH A;  1PKU A;  5KT5 A;  3EZO A;  3BQ0 A;  2XZD B;  3VVU A;  2EG1 A;  1NO8 A;  2C2M B;  4LIW A;  1M1H A;  1NH8 A;  1FTC A;  2WBM A;  3OXL A;  4LQ9 A;  4RNF A;  2OEL A;  4F3M A;  3SXL A;  3FSI A;  4DL6 A;  5C2G A;  1JJ2 R;  4P71 A;  3SQO P;  3P6Y C;  1LWF B;  1NCL A;  4IOA Q;  1RKI A;  3T5L A;  2R2T A;  1PG5 B;  2E5G A;  3KWM A;  3NBP A;  1RWM B;  2DNY A;  5IC6 B;  2FY8 A;  1TUW A;  4JI5 J;  3QO9 A;  5J2N B;  2J6U A;  2FZC B;  2I38 A;  1DLO B;  2OI2 A;  4RNH A;  5F0U A;  3V6K A;  2J0W A;  2RJZ A;  4DL4 A;  2HUR A;  2M5Y A;  2VV5 A;  5DLG A;  3EGV A;  5LSR A;  5KFN A;  5A2Q U;  1SC3 B;  1MML A;  1VHF A;  3D4J A;  4WTY A;  1QSL A;  3QJP A;  4NRT A;  3HT0 A;  3GIJ A;  1ZS6 A;  3DRS B;  3P49 B;  4M94 A;  5KFR A;  3CVK A;  1VIX A;  2CPZ A;  1T11 A;  2DIU A;  3CJK A;  2EG2 A;  3LQV A;  1HPZ B;  3MEE A;  1FXD A;  4TNO A;  2XQC A;  1XEZ A;  3L7P A;  4ENO A;  1V5V A;  2Y0B B;  3HHE A;  3M4X A;  2HAI A;  3H20 A;  2D1C A;  2OD4 A;  3MOZ A;  4KR0 B;  4KT0 C;  1GFW B;  3SDE A;  4RJV A;  2XC9 A;  4H4O B;  4U96 A;  2W9A A;  3G8T A;  1U6B A;  4PWD A;  1C4C A;  1NHU A;  2CAD A;  4DFM A;  3FUY A;  2Q6B A;  2Z56 B;  2MJN A;  3BM7 A;  1BGX T;  2DNQ A;  1S57 A;  4YB5 A;  3KJV B;  4F0M A;  4UZB A;  2YWE A;  2LVW A;  4QPT A;  4DL7 A;  3LGM A;  1B4S A;  1SH2 A;  2I9S A;  2NYI A;  4PQU A;  3JS9 A;  1S79 A;  1C1C B;  3PM9 A;  2RRA A;  2F7V A;  2XWY A;  5HLF B;  5U47 A;  2HFS A;  3BBF A;  1RYS A;  4LSN A;  4E8U A;  2BM1 A;  1JX4 A;  2VA3 A;  4P2M A;  3NNC A;  5KFH A;  2GJ2 A;  1LKZ A;  1YSJ A;  3DCA A;  2J7U A;  4LF5 F;  4LRE A;  1S76 D;  3G86 A;  1ZM4 A;  4XPE A;  3UN2 A;  3CF5 Q;  2XY6 A;  2C2O B;  3PEJ A;  4CH0 S;  4Y34 A;  3I38 A;  4Z7Y A;  1KC8 T;  5C25 B;  1XR7 A;  2CQP A;  3B4D A;  4LFB J;  5THW A;  1LW2 A;  2KRB A;  4OMF G;  3SBM A;  3K7R A;  4Y2A A;  3TVZ A;  2M8H A;  3W64 A;  1WI8 A;  1RQ0 A;  1RTD A;  1X9S A;  1WHY A;  4QIF A;  2ZE2 A;  3FEX B;  4Y00 A;  4DEZ A;  3B82 A;  4F2S A;  5D3G A;  3ZXW A;  4I2P A;  1C1B A;  3PDN A;  1K0T A;  2EVZ A;  5HP1 B;  4J80 A;  1FTR A;  5ETV A;  1SJ1 A;  2CVE A;  5J1P A;  1TK5 A;  1NB7 A;  2W2O P;  2B4U A;  4NML A;  4K5S A;  4DF8 A;  3ENV A;  3LWM A;  1G6B A;  2GVZ B;  2IC3 A;  4B02 A;  4X4U A;  4ES2 A;  3KK2 A;  2A6M A;  2VUG A;  4U8Y A;  4H4M A;  4P9S A;  3UDL A;  3D2W A;  5C24 A;  3NXZ A;  3ICL A;  5KFV A;  3QGI A;  1SJQ A;  5GAH I;  5EWG A;  3UVJ A;  1TL1 A;  3NL0 A;  5T7L B;  1C3G A;  5CH7 B;  1QTM A;  3HZG A;  4LVO P;  2UVV A;  1MMD A;  4MFB A;  3T41 A;  4X4Q A;  2GW8 A;  3KLH B;  4EO6 A;  2OJ3 A;  4M63 A;  4B3M F;  3NS7 B;  5KFJ A;  3QIP A;  2BDP A;  4NZ7 A;  2QA1 A;  1Y5N B;  4A8S A;  3SV3 A;  4ZKA A;  3UPF A;  4LF2 A;  2ACY A;  4MKY A;  5KT2 A;  4B9U A;  3NG8 A;  1RJJ A;  4YQW A;  4NXM J;  1SIW B;  3R2C J;  2VA2 A;  4QQB A;  3NMR A;  5D77 A;  1LFP A;  2NXU A;  1C1B B;  1VC5 A;  2R7S A;  3N6M A;  2F4F A;  3H59 A;  5DDO C;  2IRX A;  3KG1 A;  3M6W A;  3CJ5 A;  3I6P A;  4LUB A;  1MNE A;  5B0A A;  5KT4 A;  2KJW A;  3KNA A;  1Y7P A;  4MIB A;  2KB2 A;  3AFG A;  4YUD A;  3CJ2 A;  4OZ1 A;  5L39 A;  2MQQ A;  2R2R A;  5DQG A;  1HR0 F;  3FBB A;  4PAA A;  2FDN A;  4DV3 J;  2FJX A;  1R0A A;  3MEC A;  3QJJ A;  1JNZ B;  3K5O A;  4DBQ A;  1WKK A;  3EXY A;  3P8B B;  3RAQ A;  2J6S A;  1R27 B;  3AD9 C;  2DNO A;  2P9G A;  4RL1 A;  4R5P B;  5IZH A;  3F73 A;  2QGF B;  1EP4 A;  2JRR A;  3ENW A;  1Y5L B;  3TAR A;  4GKJ J;  5EGY A;  5B0D A;  4PPD A;  4PXC A;  3WHI A;  2H4W B;  4UUW A;  2A0F B;  1DY3 A;  2ZBQ A;  3DLE B;  3ZZZ A;  2COL A;  3HI9 A;  3L7O A;  3RRK A;  3OL7 A;  2VG7 A;  3KMS A;  2IVF B;  3UCZ P;  1BD6 A;  3HUL A;  1HNW F;  3PFO A;  3C6T A;  3HM9 A;  2GZO A;  4A8M P;  1NEE A;  1TKT B;  2Z58 B;  4J7C A;  4QR1 A;  2P2C B;  3HPO A;  4JV5 J;  1HYS A;  1FI4 A;  5GAE U;  2H4Y B;  3QNW B;  2NYH A;  3PV8 A;  3JTP A;  4G1I A;  3O44 A;  3LPY A;  4QW8 A;  3TEG A;  2L9N A;  4LF7 J;  3MM9 B;  4ZOS A;  1U49 A;  1ZM2 A;  2VPZ B;  3R27 A;  2YPY A;  2Z4P A;  5F8J A;  2U2F A;  1IBK F;  3V2U C;  3LAM A;  4BWM A;  2UVU A;  3EE3 A;  1N34 J;  1MRO B;  2X3D A;  3BQ2 A;  2VH7 A;  5HSP A;  1R31 A;  4KHP F;  2ZH9 A;  3PHT A;  3BO2 A;  1H7X A;  2DNK A;  5DO2 A;  3ZZ0 A;  2DR7 A;  2CPD A;  5IT9 Y;  3HHL D;  4HDH A;  2F63 A;  2YQ1 A;  5KG1 A;  1SQF A;  5G0R A;  4UUX A;  2VBX A;  1VR6 A;  2KG0 A;  3BH7 B;  5A6P A;  1HNZ F;  4ZIT A;  2J7W A;  3ZO7 A;  2AZ3 A;  3SEO A;  1JB0 C;  2BYC A;  2VFR A;  3MPD A;  1M5P C;  1CS4 B;  2B9X A;  2C3P A;  2F65 A;  1BQN B;  1H73 A;  1TKT A;  2N7Y A;  4OZ3 A;  5DRK A;  1NXI A;  4RW6 A;  4EZ9 A;  3J7Z T;  1VBK A;  2FPH X;  5KFU A;  2XMA A;  3NMA A;  1A9N B;  2KG1 A;  2OPP A;  3M6X A;  4K4Y A;  3O6Q A;  4RUA A;  4JV1 A;  3RRG A;  3FQK A;  1H2U X;  4K8R A;  4DPU A;  3QYY A;  2X1A A;  3PW2 A;  4RX6 A;  1KKH A;  4PKD B;  1SQE A;  3PKY A;  1Y4Z B;  5ETL A;  1LXN A;  2CQB A;  2JLF A;  2M4M A;  2W24 A;  4USH A;  3MEG B;  2R8H A;  2F1F A;  4NA3 A;  1Q95 G;  2E1R A;  3QGP A;  3KHH A;  2E1C A;  3FMW A;  3DOK A;  1UMJ A;  4PYD A;  2B7B B;  1VQP S;  3LP0 A;  1FX2 A;  5HJX A;  3JAM U;  1TAU A;  2LEP A;  1VFJ A;  1XR6 A;  2RF2 B;  2BE9 B;  4MH8 A;  4N8O A;  3VZI A;  3W2W A;  1L3V A;  3HKZ D;  3G87 A;  3I0S B;  2MKJ A;  3M7V A;  2LQ8 A;  5G0R B;  1DHM A;  4MJK A;  2XS5 A;  1IKV A;  1MW7 A;  1PAE X;  3MCS A;  3OTC A;  5E0O A;  1GMU A;  5J2N A;  2W2M P;  1EZZ B;  4U7U D;  1FER A;  1S77 D;  4K4V A;  4ICL A;  1F9E B;  4YY3 J;  2KXN B;  3VAG A;  1Q8I A;  4LRA A;  3ZTP A;  2N3L A;  2YNH B;  3EVW A;  2QJ3 A;  4OHZ A;  1IQZ A;  1YGY A;  3SDE B;  4ZMM A;  2JSX A;  4DLG A;  4P52 A;  2CJY B;  2CJK A;  1BXN A;  3OJU A;  3BSN A;  4DF4 A;  3MPU B;  2M3D A;  2V8D A;  4LSL B;  2HGM A;  5D0H A;  3CGI A;  4UOF A;  5M2R A;  3OW2 R;  3RB3 A;  4F02 A;  4ZN3 A;  5KFL A;  3PYD A;  2PFD A;  2V67 A;  5DG9 A;  4DV3 F;  3OTO J;  4WYW A;  1IKW A;  3OUY A;  4B9N A;  1Q4R A;  1IBK J;  1BQN A;  1KR4 A;  2V2K A;  2BE2 B;  2CPI A;  2W2P P;  3QFW A;  2CPX A;  3KUG A;  1IWG A;  1NPR A;  4JBC A;  2X3G A;  1SQG A;  2V2Z A;  3PRD A;  3BR8 A;  2MTL A;  4TY9 A;  3RG6 A;  2RF2 A;  2Y0S D;  1KTQ A;  2YWF A;  2JFK A;  3I0S A;  2RVJ A;  1C0U A;  1RAE B;  2UUW A;  3W63 A;  2FZK B;  3J81 U;  1M5V C;  3KJV A;  1JNR B;  3R97 A;  2KT3 A;  4NE9 C;  4DN9 A;  3RBE A;  2H48 B;  4FKX A;  2WVF A;  3GP9 A;  4G3I A;  2NXC A;  3JSM B;  4NXM F;  3P3D A;  1XNQ J;  1SC1 B;  1SL1 A;  4UQG A;  1MRO A;  2Y3Y A;  3LO3 A;  4CLY A;  1WEY A;  4ZHR A;  1QE1 A;  2CYY A;  2ILZ A;  5KG6 A;  3CIZ A;  5KFD A;  2G13 A;  1FFS B;  4QIG A;  2IVM A;  3PW0 A;  2IDL A;  4WZM A;  1N5Y A;  3E2E A;  3B6B A;  4A48 A;  2I1R A;  1U0H B;  1ZPV A;  1MSW D;  3K59 A;  2DGU A;  2V69 A;  4A47 A;  2R7O A;  4O0I A;  1YJ9 S;  1TAQ A;  4OZL A;  1E6V A;  2GHP A;  3MMB B;  4NYZ A;  4RW7 B;  3B8H A;  4UY8 5;  4FN5 A;  1FNO A;  4RUB A;  4ED2 A;  4AND A;  2W01 A;  4QIE A;  2J7K A;  2W2Q P;  3MM8 B;  4H4K C;  2A2D A;  4NLD A;  4ZVO B;  1U1O A;  1T9T A;  2CQC A;  1FFW B;  1WKJ A;  1X60 A;  2JOQ A;  2YTC A;  3CJ3 A;  2GQQ A;  1VK8 A;  3ZTR A;  1C4A A;  2HNZ B;  4Y0F A;  2J0Q D;  1U0S A;  3H4D A;  1WKL A;  1R0B G;  4I7F A;  2CJQ A;  3KDN A;  3AQP A;  4X4N A;  1U8W A;  4I6A A;  3M30 A;  3V4M A;  3GII A;  4IG3 A;  4A8O A;  1TUG B;  2VFS A;  3CNQ P;  2LMI A;  5K5M A;  2LQ5 A;  4NCG B;  2WW4 A;  1N6Q A;  4NZ0 A;  1SKW A;  3R5C A;  3M8Z A;  4ZPC A;  5ITH A;  4JI0 J;  3EGN A;  5FDL A;  1X5S A;  2KHD A;  4OYW A;  3PW4 A;  2QV6 A;  1SJ4 P;  2R8J A;  5KFX A;  3OR1 B;  4HYK A;  3GCW P;  3UD3 P;  2WHO A;  1IWA A;  2XNQ A;  2J8S A;  4J9U E;  4Y6I A;  2ZWP A;  1FX4 A;  2VG6 B;  3CSK A;  5A8R A;  3V5R A;  1RTH B;  4ZCK A;  1QJH A;  1YLX A;  3AT1 B;  3EDR B;  4EFA C;  4U95 A;  4KAI A;  5K8M A;  1T03 B;  2WVD A;  2HAF A;  4XDC A;  4PXB A;  2W4C A;  1NRK A;  4ZPV R;  1RTH A;  1HHS A;  2VQE F;  2HGL A;  2G4B A;  1N54 B;  3F41 A;  2EC2 A;  3FFI A;  4DZD A;  3DLK B;  1NLK L;  2Y1L B;  3R1H A;  1NSQ A;  1NSK L;  2HNY B;  2BA9 A;  2O3D A;  3EUN A;  3BN4 A;  4ILR A;  2UVW A;  4NLY A;  4GMK A;  1KLM B;  3DOM A;  1VQK S;  1RK8 A;  1WHW A;  2Z2Y B;  4DPO A;  4X62 F;  3KJF B;  1CJT B;  3V81 B;  1HBU A;  5KT3 A;  2RS2 A;  1NKE A;  1C0U B;  1P9Y A;  2AKW B;  2V34 A;  4DU8 A;  4JB8 B;  1TMM A;  3FCV A;  2ALY B;  3NNH A;  3A12 A;  4ZN1 A;  4M95 A;  3MED A;  3PKM A;  3T5H A;  1RI7 A;  4OJG A;  5B08 A;  2NR0 A;  5HN0 A;  2ZJQ Q;  3GSD A;  4DX5 A;  3H5S A;  4DHV A;  3QJL A;  4X4O A;  1FNX H;  4F8R A;  5LXY A;  2CJA A;  2H51 B;  1EET A;  3MM7 B;  2CQ2 A;  2HVH A;  1SJ3 P;  4AXJ A;  3GON A;  3BN7 A;  1QUP A;  2EC0 A;  1Q5V A;  4FVM A;  3NGS A;  3T1Y J;  1UCN A;  2AD9 A;  2W9B B;  5IM0 A;  1NPK A;  5KG7 A;  3VZH A;  2MKK A;  3GV8 B;  4CQ1 A;  4I2P B;  1EHW A;  4U7U K;  5F41 A;  2AGQ A;  1YI2 S;  2VOD A;  3TAN A;  3VHQ A;  5F0W A;  1J5E F;  5K8P A;  2HMI A;  2JC1 A;  3VV2 B;  2JH3 A;  4DWI A;  4CZC A;  2WSF C;  2VG7 B;  3FZB A;  4PUO A;  1GMV A;  1P8G A;  1VHI A;  4RNO A;  1ZM9 A;  1N36 F;  1N5S A;  2QSW A;  3DRR A;  5A0Y A;  4O23 A;  2QYG A;  1E6Y B;  1Y9O A;  3QAT A;  3SSS A;  1EP4 B;  3G6V A;  3OSP A;  2MQP A;  1NSA A;  2YKO A;  3NGD A;  1NJX A;  1D8Y A;  1D9F A;  1S49 A;  2W9C A;  2DK2 A;  3BSC A;  3D66 A;  3R3T A;  5ETN A;  3CCL S;  1CQM A;  1HBN B;  6AT1 B;  3ZTO A;  2IMO A;  4L75 A;  4LRC A;  3J80 Y;  1L3S A;  1URR A;  1C0T B;  4DV5 J;  2BJ7 A;  3D7S B;  3HZE A;  3QID A;  2MKC A;  2G2Z A;  3C15 A;  4RKU C;  4CLK A;  4EBD A;  2E9Z A;  2HVD A;  3A8E A;  1Q86 T;  1OS5 A;  1JKH A;  2XM3 A;  5LM7 E;  3KLV A;  1RTJ A;  4PPZ A;  2UUB J;  1ZZN A;  3QRQ A;  2AJQ A;  2DY1 A;  2IJN A;  1IM4 A;  1OY9 A;  1RAO A;  1KFS A;  2I0X A;  1LWC A;  2GS8 A;  1WDT A;  3TR5 A;  2V6A A;  2EFO A;  2ZNY A;  4OZ5 A;  4JP8 A;  2R9L A;  2ZE2 B;  2UXD J;  3BEG B;  4KV8 A;  4XK8 C;  4LSL A;  1IR1 A;  3W5X A;  3LAL A;  4I2Q B;  4IH5 A;  4ZPB A;  1GMW D;  3D1Q A;  2OP5 A;  4C3M A;  1U09 A;  3QMQ A;  5AXM A;  1RWN B;  4OL8 A;  4NLG A;  2ZUG A;  3OD2 A;  5J2M A;  2UXB F;  5FD1 A;  3QAU A;  3MEC B;  4B08 A;  2KFZ A;  4NOH A;  1TZ0 A;  3PX6 A;  4DQI A;  2HHH J;  1L3K A;  2A3J A;  1B99 A;  5A8W A;  4ECV A;  1FD8 A;  3P96 A;  3JAM Y;  1NU4 A;  1FRH A;  2UXB J;  2VD3 A;  2ZVI A;  5D0G A;  2ZM6 J;  1RWP B;  2PA3 A;  3MAH A;  4IQM A;  4NLX A;  3RBX A;  3F56 A;  1WI6 A;  2ILY A;  5KFT A;  2JLG A;  1S6P B;  4H54 A;  1Z2L A;  4MMO A;  3VCD A;  3T5J A;  2R3V A;  4O3O A;  3ELH A;  3AJD A;  3J7A N;  1FE0 A;  1KQG B;  2BKO A;  1WG5 A;  3BKF A;  3FGV A;  3QO9 B;  4PXE A;  3DOL B;  1VLO A;  2W25 A;  1UFK A;  3I82 A;  3MPV A;  1DLO A;  3R5D A;  3MOJ B;  2D7S A;  5GVQ A;  3EIC A;  4NEY A;  3DGP A;  1RAB B;  3MEG A;  3BF4 A;  3QT8 A;  4J91 A;  3DLB A;  1S1X A;  2HS0 A;  2OPQ B;  3HJV A;  3G4S S;  3PCO B;  4J9O A;  3T5K A;  4RW9 B;  4Q8E A;  1N32 J;  2QLB B;  1I1G A;  1B3T A;  4C4W A;  1FD2 A;  3DYA A;  4LSZ B;  4D3H A;  4DXL A;  3AGX A;  2YNH A;  1EET B;  1FRK A;  3KLF A;  2GIR A;  2O67 A;  3KG0 A;  3ZC4 A;  1AB8 A;  4JI6 J;  1GXU A;  4W4M A;  4L74 A;  4P73 A;  1U02 A;  1CS4 A;  3MCM A;  3WZ0 A;  4QR2 A;  5JJB A;  4TQR A;  2XO6 A;  1U1P A;  4YR0 A;  1UVN A;  1U1M A;  4ERD A;  4J9P A;  2PMH A;  1U26 A;  2PC6 A;  4O4R A;  1RB0 A;  3VGV A;  5GAE I;  1YHQ S;  1YIJ S;  2FC8 A;  1JLB B;  2F9J A;  4ILM A;  1RBO B;  4DS4 A;  5L1J A;  5EWE A;  4PUO B;  1S9E B;  1R0C B;  1Q53 A;  2SXL A;  2C2Z B;  3IR7 B;  2JEF A;  4CM0 A;  2Y8Y A;  5M2U A;  2RRN A;  4M5L A;  1RCO B;  2QA2 A;  1ZTT A;  4CCH A;  5ETR A;  4UZC A;  3G6X A;  5BXI A;  1PGZ A;  4LFC J;  3DRY A;  3PG9 A;  2JRS A;  3KUE A;  3T19 A;  3M32 A;  3W9J A;  2C2N A;  2B6A B;  3QPI A;  3JXO A;  1FRI A;  4RW9 A;  5LXR A;  1JLE B;  3CCS S;  1D1U A;  1SJR A;  4RLE A;  3BGU A;  1CJU A;  1HL6 A;  3N5F A;  1XBW A;  3I31 A;  2N4D A;  3OFE A;  4WK1 A;  4EU0 A;  2ASL A;  2ADB A;  1X31 C;  2IJF A;  3HSG A;  4FYX B;  1FJG J;  2XLI A;  2RDJ A;  2A2C A;  3BGR A;  3HVW A;  2L9D A;  1W7W A;  3A3N B;  5DQI A;  2JJ4 D;  1FJG F;  2LDI A;  2YKM A;  4OX7 A;  3H5Y A;  3CJS A;  2AW0 A;  3MR7 A;  1YJN S;  4URG A;  2LFV A;  1NJY A;  1FXL A;  4IO1 A;  1RA7 A;  2QIF A;  2P5V A;  3IMQ J;  3K17 A;  2VQF J;  3Q8S B;  1WEL A;  3BPS P;  3U02 A;  5BYR A;  2DHG A;  4R8U B;  4Q8F A;  3MF5 A;  2ODX A;  1IKX B;  5B0B A;  4ZIW A;  4IR1 A;  2L3M A;  4EMD A;  2DR5 A;  1QY7 A;  1S7H A;  3SIP B;  4C0H A;  4KIA A;  4IKA A;  2C42 A;  1MMN A;  2O01 C;  2V4J B;  2VU5 A;  4KKO A;  1FJE B;  4J9S A;  1RXO B;  2MKY A;  2Z8Q A;  3IS9 A;  3IRX B;  4PEO A;  1HWJ A;  4YB6 A;  4UOG A;  3LWL A;  1Z4U A;  5JVH Q;  2HWT A;  1YZ7 A;  2EBE A;  3FJ2 A;  4KKO B;  1YJV A;  1EIY B;  5T41 A;  1U2C A;  2LXF A;  1LNQ A;  2M7S A;  2WVC A;  4F67 A;  5LT5 A;  5LJ3 Y;  1X9M A;  3OL9 A;  1OQ6 A;  3MTJ A;  4EO8 A;  1UFL A;  1KHV A;  2HEK A;  5CA5 A;  1C2P A;  3GZ7 A;  1AT1 B;  3GJR B;  2YKN A;  4WXO A;  4ZPT R;  2AYB A;  2BOA A;  4KE5 A;  5F3T A;  2DXD A;  3K89 A;  4LR9 A;  5KFM A;  2MB0 B;  1HBM A;  1NDC A;  2VOP A;  1JIH A;  1YJT A;  3MUV P;  4L72 B;  2K06 A;  4TKT A;  2FLO A;  1X0F A;  3C15 B;  2CNN B;  3FRY A;  1XNQ F;  4B17 A;  4O44 B;  4X66 F;  2ABY A;  2EKN A;  2FVC A;  3D6H B;  3AB4 B;  5IV3 A;  3CO9 A;  1CJK A;  4OYB A;  4ZVE A;  1ACM B;  3FKB A;  2HZA A;  3H0P A;  1HNZ J;  4OLO A;  2KN4 A;  5FLX Y;  3WBZ A;  1RWX B;  3IO1 A;  3VAH A;  3WIV A;  4YY3 F;  2E66 A;  2HND A;  3VQS A;  3AQO A;  1WF0 A;  3DFE A;  3H2U B;  2XMM A;  1TUV A;  4OYI A;  4QR0 A;  4OX8 A;  1QTN B;  5I3P A;  3T6J A;  3NGK A;  3G8S A;  4DV4 F;  4LF6 F;  4W92 B;  2YQ3 A;  2ZD1 B;  4YR3 A;  2JX2 A;  4HHU A;  5HQL A;  4NLS A;  4WKR A;  4LRD A;  4JI6 F;  3R7S B;  2D69 A;  1S1T B;  1PC5 A;  2BRK A;  4NZ6 A;  4USM A;  5ADZ A;  2CDR B;  1N5Q A;  5L9N A;  2V9W A;  1KOO A;  4DL3 A;  4NLV A;  2YH1 A;  4P6Q A;  2FVR A;  5KT6 A;  4DV6 J;  5F3Z A;  3OT9 A;  1S6Q A;  1IM6 A;  3MM5 A;  4R25 A;  3J7A 1;  4MYU A;  3EX7 B;  1KVJ A;  2C2D A;  2V2Q A;  2XLJ A;  1LW0 B;  4RWW A;  3DXB A;  3TOQ A;  4AXI A;  1T05 B;  4DQP A;  2XG8 A;  1IBL J;  4KFB B;  1X5T A;  4JI3 J;  1M1G A;  5GAD I;  2DNM A;  2IY5 B;  1ROF A;  2KTQ A;  1OYE A;  2WOM A;  2ZNZ A;  4M5H A;  5L9X A;  1TL1 B;  1G7C B;  5IC4 B;  1MU2 B;  2OPS B;  4PG4 A;  1NZA A;  1TL3 B;  5E3R A;  5IQ6 A;  4Y2I A;  2V2V A;  2E5J A;  5L1L A;  3T1H J;  2AYM A;  2LYV A;  3WIU A;  9ATC B;  1VC6 A;  4JYA J;  1UWB B;  2IBO A;  3O5T B;  1VYA A;  4NLU A;  1YRT A;  1KFD A;  4KGZ B;  2W7P A;  2BXJ A;  2UP1 A;  1VQ7 S;  2QL9 B;  2V8H A;  3W9H A;  1FCA A;  1BWV A;  3G8Q A;  4DUY F;  4YP3 A;  5IT4 A;  3R1L A;  3HO1 A;  2B9E A;  3C16 B;  3JSR A;  1NK7 A;  1FEE A;  1NND A;  3CD7 A;  3VR1 A;  1VQL S;  2HVE A;  2LDY A;  3RU0 A;  3C14 A;  3UD4 P;  3N6L A;  5D15 A;  2Z2Z A;  1J2V A;  3VAI A;  2F5G A;  1XN9 A;  2DCL A;  4ID8 A;  3AA9 A;  3C5X C;  5D78 A;  4ANC A;  2KFN A;  1RHM B;  3CDA A;  2JWN A;  3G82 A;  1JKH B;  4QOT A;  3KLI B;  3HJF A;  2WZ1 A;  2ERR A;  5KFI A;  1ZA2 B;  4HR2 A;  3DU6 A;  5KFZ A;  2ZVS A;  3N4W A;  2XMK A;  4C0B A;  4DCP B;  5AXL A;  4A4J A;  3PJX A;  3GIR A;  4YS2 A;  4RR5 A;  2IIH A;  4P74 A;  3EPI A;  3POT A;  3W2V B;  4KFB A;  1RU2 A;  2XS7 A;  2ROP A;  4OYP A;  4B9S A;  2F8M A;  1YWX A;  3U1L A;  4TU9 A;  1R89 A;  5DG8 A;  2MZR A;  4ZVR B;  2QLJ B;  5F8N A;  4ED6 A;  1CSJ A;  4M5M A;  3AXM A;  3K5M A;  4YFU A;  3W65 A;  4NWB A;  5A0Y B;  4RPF A;  4RW6 B;  4DS5 A;  5F8M A;  3VAM A;  1TR0 A;  3ENA A;  5D4L A;  2DPI A;  2RS8 A;  4M5K A;  3HSD A;  4JV0 A;  1YRX A;  3MPY A;  2ZUA A;  4ZJO A;  2LXU A;  4QYR A;  1T3N A;  4C8O A;  4JI0 F;  5CCL A;  2HQ3 A;  1PYS B;  2M2B A;  2XCA A;  1XMQ F;  2H5I B;  1V3Z A;  2MKS A;  3UN3 A;  1GEH A;  2UXC J;  3SMZ A;  1RSC A;  3TA2 A;  3UR0 A;  4TQS A;  3G6E S;  1C0T A;  1M0S A;  3U7J A;  5CYQ A;  1HIY A;  1F60 B;  2HVI A;  4EWT A;  4R0E A;  3OXF A;  3NP5 A;  4ELU A;  1CC8 A;  4NPO A;  1R0A B;  3WC0 A;  4B9L A;  1RAH B;  3KK1 B;  2ZHA A;  1N33 F;  1FKO A;  4KH0 B;  2DNH A;  3ZZP A;  2XMJ A;  1TU0 B;  7FDR A;  2Y9H A;  4RNM A;  3KOA A;  2HK3 A;  2RB7 A;  4LVN P;  1WOS A;  3GFZ A;  3UQS A;  1D9D A;  2MDA A;  2V8G A;  4WCE Q;  1XER A;  2CPY A;  3H2V E;  2MQL A;  4TVA B;  1KD1 T;  1KBR A;  1YK9 A;  2R7T A;  1TQL A;  2RIL A;  2VC0 A;  3SSR A;  3KLG B;  1RWV B;  2EI5 A;  4J37 A;  4KC5 A;  2HMI B;  4LF9 F;  1NPP A;  1XQI A;  1M5H A;  1HI1 A;  1AFJ A;  2P9C A;  3M6U A;  2HNY A;  3NCQ A;  4ZVF A;  4ZJQ A;  5J1E B;  2FVQ A;  5EN1 A;  3KLG A;  2YKQ A;  4DR7 F;  2JDJ A;  3DLE A;  4CLL A;  4OI1 A;  5B0C A;  3NS6 A;  1S6O A;  3DC2 A;  5HK4 A;  3OFF A;  3TEH B;  3AD7 C;  2VKR A;  1DTT A;  3W5Z A;  2AEF A;  4C2M A;  1D0E A;  2NXN A;  2WON B;  4U9R A;  2HBQ B;  4TXS A;  3FK4 A;  3QIP B;  4WXW A;  4USW A;  1CPZ A;  1TL3 A;  3V6J A;  4U67 Q;  2YNF B;  4WWS A;  2Z30 B;  2DT9 A;  2XNR A;  1RLD A;  5CYM B;  3W61 A;  4ED4 A;  2OMO A;  3D6M B;  4XPC A;  1TTH B;  2M9K A;  2P8I A;  3FDS A;  1WSR A;  3VAK A;  1UZD A;  3IR5 B;  3H98 A;  4KSE B;  4CO4 A;  5KFS A;  4Q45 A;  1BHN A;  1J5O B;  2D9O A;  2IM2 A;  4NCA A;  2OSQ A;  2WAQ D;  1S1X B;  2OPQ A;  2V50 A;  3OR1 A;  3C19 A;  4O4G A;  4IOC Q;  2DHH A;  3CDU A;  1H6K X;  1U4B A;  3BGR B;  2MSS A;  1NBE B;  1UEK A;  1LWC B;  1UPP A;  3PXG a;  2YBV A;  3SYZ A;  4MIA A;  1F2H A;  1TKZ A;  2B56 A;  2YQ0 A;  4MKV A;  4LIR A;  5D4P A;  2XGQ A;  3MMA B;  2DNP A;  2N4C A;  5KFF A;  4ECT A;  2UUB F;  2Y8W A;  1UJ6 A;  4H4O A;  4Q2M A;  2UV8 G;  5KOX A;  3PO5 A;  1VK3 A;  3OFG A;  5AXN A;  3JQM A;  4QIV A;  1N0V C;  5A6W A;  1PC4 A;  2EK6 A;  3A1Y G;  2AIR B;  3D1H A;  3CJK B;  2C3U A;  3J7Y U;  1BQX A;  1XMQ J;  4OZN A;  4B9V A;  3K0J A;  3EDQ B;  2Y1R I;  3OTE A;  5T7L A;  3GB0 A;  2PEB A;  1RCX B;  3HHL B;  4PRF A;  5KG3 A;  3DGV A;  2B8P A;  1WD6 A;  3NLC A;  3L95 X;  5IWA F;  2OLW A;  1DAR A;  1U1Q A;  2IA0 A;  2V0N A;  4AUK A;  8ATC B;  1KQS R;  2X51 A;  2W7A A;  1FFG B;  1HFE L;  1ZYQ A;  1JLQ B;  5HAO A;  1WNE A;  2BW7 A;  3PJ9 A;  4NX9 A;  3DDK A;  3G96 A;  2XB2 D;  3CC2 S;  2B4P A;  1RYR A;  5IT0 A;  3DOK B;  4GC6 A;  4OX6 A;  5CCM A;  2FLL A;  2ROG A;  2CJX B;  2IAJ B;  1N5Y B;  2DHA A;  3FZ2 A;  4OI0 A;  1T95 A;  4TY8 B;  1O0P A;  4ZP9 A;  4ZVH A;  3S7R A;  1RZM A;  1OSD A;  1RHJ B;  1VLY A;  1WF2 A;  3OL6 A;  1NJI T;  3H2L A;  1IR0 A;  2OUG A;  2CQ4 A;  1YRU A;  3UE2 A;  4K4U A;  3ZNU A;  4CH1 A;  2QSF A;  1YTY A;  1Y5I B;  1N36 J;  8RUC A;  1U2R A;  1FES A;  3DMJ B;  3RRH A;  3QRP A;  1FVQ A;  4ES1 A;  5E7O B;  2J0X A;  3HHK A;  2QFJ A;  2BV3 A;  4NXN J;  1NAQ A;  4DR5 F;  3TO8 A;  1PIL A;  5C24 B;  3DLG A;  3M6V A;  1IJE B;  3D0G E;  2HW3 A;  3KHG A;  2YWG A;  2FJA B;  2OKQ A;  3IWL A;  2KH9 A;  4J9N A;  3ZZT A;  2BJ9 A;  2GV1 A;  2PSZ A;  1FJ7 A;  4DL5 A;  4KJI A;  4BC9 A;  2CFX A;  3KKF A;  4CWB A;  4DUZ J;  1AUD A;  2J9C A;  3A8J A;  4FYV B;  4B9T A;  3ILJ A;  3HX9 A;  4WBF A;  2GAG C;  4RU9 A;  2OO4 A;  3M8S A;  2AU0 A;  2BJE A;  1GXL A;  1M90 T;  3S01 A;  2RDD A;  4OHV A;  4NCG A;  5CD4 A;  4LFC F;  2XYH B;  2GO9 A;  3KLE B;  4EYI B;  2C22 A;  4PZV A;  2HHU A;  1KTV A;  3NKY A;  5BYS A;  2DHX A;  4PG5 A;  2ZJR Q;  2C3O A;  4WII A;  1T9U A;  1UKU A;  2E1P A;  1FK9 B;  3ILL A;  3NNA A;  3M30 B;  4QPX A;  1RT4 B;  1NKB A;  3KLE A;  3ZZU A;  1O5J A;  1N32 F;  1BWE A;  1YVF A;  3O2I A;  4EBE A;  1XMO F;  4AL5 A;  1CG2 A;  3BR9 A;  4QJV A;  4UW2 A;  3M8P A;  4PG7 A;  2OEJ A;  3H90 A;  3JSM A;  1IBM F;  1CJV A;  2HPU A;  1IKV B;  1HWU A;  2DYA A;  4YDX A;  4ZDN A;  4B3R F;  2VQF F;  2EFQ A;  4CM2 A;  4ECZ A;  3SCI E;  3PRV A;  3LAN A;  4DSI A;  3RB6 A;  1U1N A;  1HQE B;  4QYZ J;  1BQM A;  1SKU B;  2UZA A;  3TZY A;  4R5P A;  3KMQ A;  1WTF A;  4WF9 Q;  1DQ9 A;  1FKP A;  2MZQ A;  3FC9 A;  3SQG A;  4C8L A;  4KGV B;  1FJC A;  2CQG A;  2G0J A;  1WC6 A;  3FBC A;  4OV1 A;  2QLF B;  2X7I A;  1VBY A;  3UI3 A;  4IO9 Q;  2H5E A;  1QSS A;  3NS5 A;  4KYZ A;  2BRL A;  2XZW A;  1WEZ A;  2MMY A;  3DU5 A;  3ENQ A;  3MMC A;  2MLX A;  3W62 A;  4ZLJ A;  4DFP A;  1TKD A;  1NK9 A;  1S7I A;  3QWP A;  2BJ8 A;  3DLK A;  3HVA A;  3JTN A;  2RE1 A;  4HI1 A;  4HH0 A;  1FK9 A;  4OZ2 A;  1AFI A;  5EX0 A;  1H2V Z;  4LMZ A;  1GH8 A;  1HD0 A;  3MAA A;  3RW7 A;  3TJ9 A;  4C97 A;  4U6P A;  2W1B A;  4X4S A;  1CJK B;  3HVT B;  2CZ9 A;  1T8E A;  1HWL A;  4CT8 A;  3M9O B;  2Z57 B;  3NOC A;  1T05 A;  4E0D A;  3TUP A;  4RW8 B;  2KFY A;  3H5X A;  4FKY A;  2W7O A;  3HVR A;  4PQA A;  1DUR A;  1JMT A;  4Y65 A;  3QT7 A;  3S6E A;  4DCO B;  1UWA A;  5J2P A;  3QSI A;  3TQ1 A;  2OPR A;  4WFX A;  2EKY A;  2XZT B;  5LMN F;  4B3T F;  3SCL E;  3GLJ A;  4MK7 A;  3IWX A;  3MR6 A;  3BPD A;  4LF8 F;  1VQ6 S;  4ECQ A;  2QX0 A;  4L73 A;  2H54 B;  2VPY B;  2FGC A;  3ZZY A;  5C7P A;  5DQH A;  3D1O A;  3C46 A;  5CQG A;  1HMV B;  4ED1 A;  2QLX A;  4DV4 J;  1IN0 A;  1HNX J;  3E01 B;  3UWT A;  3IN5 A;  5KT7 A;  4N77 A;  3M8W A;  4DSK A;  1X7V A;  2DNL A;  2VF3 A;  3THT A;  3BKU A;  2KZZ A;  3DDI A;  3MMC B;  1R8C A;  4TN2 A;  4USU A;  2YXL A;  2VJU A;  1FRX A;  1PO6 A;  1HHT P;  4ETX A;  3UFC X;  3Q83 A;  5F8I A;  3KK2 B;  2OAU A;  2GCF A;  3S1T A;  4B3S F;  3HFV A;  4UQT A;  3KJQ B;  3C2P A;  3TJ8 A;  4OHX A;  1H98 A;  2R7Q A;  3IAM 9;  2NQP A;  4DFJ A;  2U1A A;  5KG4 A;  2LU2 A;  3HLU A;  4L3K A;  2MZ1 A;  2QMW A;  4M5G A;  1LFW A;  1X4E A;  3CW2 C;  3M1V B;  4Y2K A;  4Y3C A;  1S59 A;  4DG1 A;  5A8W B;  4NLW A;  5K20 B;  5IWA J;  3IGV A;  1X8D A;  3HHL C;  4N76 A;  2OHD A;  3TX8 A;  1IKY A;  4DUZ F;  3I9V 9;  3BB5 A;  3CT9 A;  4OYM A;  1GX6 A;  4ECX A;  1EX8 A;  1HAR A;  2L48 A;  3TI0 A;  4GVL A;  5H9E J;  1DTT B;  5DM7 Q;  4N56 A;  1R7I A;  4RBU A;  5J2Q A;  3A8I A;  4ZJL A;  1H72 C;  1FDB A;  3TW0 A;  5B7W A;  2HVZ A;  2PI5 A;  3X1L B;  1YJW S;  5H1S V;  2YWK A;  3BZQ A;  4NRU A;  3AOC A;  4PG6 A;  4O3S A;  3PYG A;  3DN9 A;  4KH1 B;  2DNR A;  4KV8 B;  3DGP B;  3F44 A;  4PG8 A;  5IV4 A;  2B5J A;  2DGW A;  3PX0 A;  1UA0 A;  2NXJ A;  1B0T A;  4WP3 A;  4ZVP B;  2H9Z A;  3W8P A;  1IKX A;  5M2P A;  2BMB A;  1P1T A;  3R7N B;  2ZC4 A;  5K14 B;  1RAC B;  2DXE A;  4ED5 A;  2NZ4 A;  4KQZ A;  3BH6 B;  3BGL A;  1OY8 A;  2MGZ A;  4DX6 A;  2JZ8 A;  2HFO A;  2P6S A;  4PWD B;  2AYG A;  2DEJ A;  4Y28 C;  4CH7 A;  4HH1 A;  3NAH A;  2HHS A;  2XBP A;  4DR5 J;  1T7P A; 
#chains in the Genus database with same CATH homology
 3AGX A;  1C3G A;  1EB0 A;  3AGY A;  3I38 A;  1NLT A;  2B26 A;  2QLD A;  3TJ9 A;  3LZ8 A;  3TJA A;  3NY0 A;  2HFV A;  1GMV A;  3LA0 A;  3TJ8 A;  1XAO A;  4J80 A;  3L9Z A;  2Q2G A;  4L3K A;  1GMW D;  3AGZ A;  1EAR A;  3NXZ A;  1GMW A;  1GMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...