1GMUA

Structure of uree
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
b'MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UREE
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation.
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Metallochaperone
total genus 36
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmuA02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmuA01
2Q2GA 3AGYA 4L3KA 1NLTA 3AGXA 1XAOA 3TJ8A 3TJAA 1GMWD 3TJ9A 3AGZA 3L9ZA 3NXZA 2B26A 1EARA 3I38A 1GMUA 2QLDA 3NY0A 4J80A 1GMWA 3LA0A 2HFVA 1GMVA 1C3GA 3LZ8A 1EB0A
chains in the Genus database with same CATH superfamily
2B0GA 1TFWA 4CLZA 2KZMA 4YB7A 1UEKA 2WVFA 2PIIA 1YBUA 1RT4A 3AKOB 1FX4A 1LNQA 2OPQB 5A0YA 1SQEA 4DSFA 1RYSA 2ZH4A 2WSCC 3Q8PB 1X0FA 1S1VA 2WBRA 2VJVA 4IRCA 1LWEB 1VQ8S 2XWYA 3GP9A 2B7CB 2JL9A 2EK1A 4N5SA 4QWDA 1RU1A 4ZIVA 2MMYA 1W25A 3OUYB 1YWXA 4JI4J 3WQPA 4TXSA 3SSQA 1F9EB 2D74B 5HI7A 5LXYA 4TQSA 3CXCR 2JC1A 2R42A 4TU8A 4MK9A 5CYMB 4B9SA 2HWHA 3SV3A 1VBKA 4J90A 4C48A 1OS5A 3NG8A 3T3FA 3N5FA 3V6DB 4JI4F 1XIQA 3CJ4A 3ZTSA 5IT0A 2ZHOA 3T41A 4LFBF 1HQ2A 2FQQB 2IDEA 4HDGA 5A8RB 4LVOP 4NI2B 3BSAA 3NWGA 3IR5B 4WFYA 2FJDB 1S6UA 4OI6A 3F41A 5KFAA 1S72S 2HRYA 3CULA 1RAOA 5L1JA 2RB7A 4TN2A 2Y8YA 1N52B 3F0NA 1SUQA 3CD6S 5KAKA 3D0IE 2EFGA 3D4JA 1N0VC 2XY5A 4BCAA 3D0GE 2XLJA 2YWEA 4C7QA 3PYGA 3GJQB 4JI0J 3M2UA 5F9NA 2GMJA 4DG1B 1JLFA 2PMHA 2V8DA 4B17A 3BBCA 2YNFB 4RBVA 4NZ0A 2MZRA 4WP9A 3OTBA 2R7SA 2OIHA 4J91A 3K8VA 1N48A 1JXEA 4JI0F 1JLEB 4NLSA 1G3OA 2A2CA 2RNEA 2GJFA 2XNQA 3WHIA 2WVEA 2C2OB 1PYTA 3KLEA 4OX6A 3Q8QB 4YOEA 1S1WA 2QO3A 1XMOF 1RWUA 1S1UA 4J9OA 3M1VA 2KB2A 3HSGA 4A46A 5E3PA 4DWIA 3QGIA 5JVGQ 1V9OA 4DV6J 2EKNA 4WJBA 4IFYA 2ZNZA 3FKBA 4B9TA 3ZTOA 4Y2IA 1U7LA 3AJ1A 2AHOB 2U1AA 3TZWA 3H2UB 2AU0A 3CEDA 4DV6F 4AT1B 3L7PA 1UVIA 4R8UA 2V4JA 1ZPWX 2R7UA 5AXMA 1EZZB 1KSPA 3UPFA 1S12A 5HK4A 1XR5A 4OHYA 4DLGA 5J1PA 1QE1A 4MYTA 4PPDA 3CO0P 3HSDA 4CM0A 1CQNA 4A8KA 4L3NA 5KG1A 2XYHB 3EMTA 1K0TA 4RU2A 3M9NB 1XWLA 2R7OA 3MCOA 4ECSA 4JOUA 2CPEA 4ZS6A 3H0PA 5D4OA 3KK3B 3BYRA 3D6FB 2J6UA 1CJKA 1DURA 2NXUA 2A2DA 2DNMA 2XS7A 1P8GA 1VIXA 1M5KC 1VRTA 1SL0A 1LKZA 3G86A 2AEJA 1NSPA 4JBCA 2G9OA 5IQ6A 1RWWB 5E7OB 3CJ8A 3AXKA 1VLYA 2BJDA 5L39A 4NA3A 2DHSA 3C6EC 3HX9A 5LMNF 3MUMP 3M8PB 5KG3A 3UI3A 1F3FA 2B9WA 2HIQA 4NLUA 3AAWB 2CKWA 5HP1A 1T03B 2AV5A 2ABYA 4IOBA 3M30B 3M8WA 2ZVSA 3OR1B 4LRAA 4B3TJ 1GXUA 3NCRA 5E33A 1TL3A 1YKWA 2N4DA 3MAQA 1H72C 4GVBA 3TANA 2Q3PA 4E98A 2BABA 4PG5A 4HHHA 2BJ3A 3HVTB 3R5GA 1WC3A 4B3TF 3BQ2A 1S9FA 1R0BG 3PIPQ 3G6YA 3VQTA 4IFVB 4PWWA 2LP4A 1GX5A 1Q7YT 4C11B 4W98A 4RUAA 2EG1A 2POKA 2HBZB 2MLXA 3NGUA 5EX0A 1U2RA 2BM1A 5AT1B 2HHSA 5HQMA 3MFHA 3RAQA 3C19A 1JWWA 3CCWA 2W2NP 3Q22A 2KU7A 1B3TA 2CJ9A 1G6BA 1RLDA 3CTRA 4ZPAA 3FZBA 1NDCA 2HVEA 3BJYA 2NCKL 3SCJE 1S0MA 2ZOFA 1PG5B 5HO4A 4F4YA 2GMHA 3KLFB 4O0IA 4GO7X 2QTWA 3VAKA 5EWFA 4N56A 2QSFA 3GSDA 3I5AA 4D3GA 4DBQA 2J7WA 5EWGA 5KFBA 4FPRA 5HROB 3KLHA 1JJCB 1R43A 1FNXH 1TKTA 3CD7A 4QU7A 1EIYB 1T02A 2DXDA 3HVWA 5ETQA 3Q83A 2C2ZB 1A6LA 4XDDA 3DLGB 2CQ3A 5HVFA 1N32J 2GC8A 1IKYA 3CMAS 3M8ZA 1UVNA 2CZ9A 3TVZA 3KLGB 4A47A 1E6VB 1PC4A 3EZOA 5CD4H 1L5UA 3T5KA 2PO4A 2EVZA 3G8QA 1H98A 2VICA 1ZS6A 2RS2A 3L7UA 2AJ0A 2BE2A 4FVMA 3IM8A 3C14A 2VQFF 4LSLA 2JLEA 2OTJS 1D09B 2VU5A 3EGVA 4ICLA 1VRUA 5DGBA 3HHLC 4YQWA 1ZYQA 4PUOB 2DR6A 4NYOA 2U2FA 4XAKA 3NGSA 1OIAA 2XHCA 3HHKA 1R0CB 2VG5B 2ZKTA 4WU3A 5LM7E 1WI8A 1CULA 2ASDA 2CUYA 3NOCA 4KGXB 5KFQA 2N7CA 2CA9A 3K57A 2OD6A 4U67Q 2XTJP 2QA1A 4ZVQB 5ADZA 5KFXA 2RT3A 3M2VA 4P71A 3CO9A 1SH3A 5K8MA 2DXEA 1HQUB 4UF4A 4HTIA 3NGRA 1MU2B 1VOMA 1F2HA 4RNMA 1RT6A 4CLWA 4F02A 4ZPBA 3PHEA 2VV5A 1SC4B 3G82B 3TAQA 5IT9U 3RR8A 3Q8SB 2AF6A 2K3KA 3NGDA 1P9YA 1KEKA 2MQPA 1YJNS 1QAIA 4JI6J 1RWVB 1R7IA 2YKNB 1FVSA 3GSIA 4ZP9A 3HHDA 3QJPA 4DUTA 3R7BB 2LVWA 2JSXA 1X4AA 1GTEA 2DNYA 4RKUC 3W63A 2QV6A 3ZZOA 2RDJA 2HVZA 1LOUA 4NOHA 3TQEA 3OSPA 2WBMA 1T9WA 4QWCA 3T6JA 4QBUA 1TELA 3GJRB 2HGNA 1WC1A 5ETRA 4ECUA 4NLVA 3US5A 1NH8A 2GGPB 3IWNC 3FRYA 1RQ0A 2MDAA 2ZJPQ 4WKYA 1IKWA 3KUEA 1Q82T 2OJ3A 2OEJA 4FBTA 4NCGA 2E9TA 4I7FB 1MROA 3RRKA 3CF5Q 2ZITA 3OJUA 3LGHA 1U1QA 3BSCA 1Z1ZA 2VPYB 2E1AA 3B6BA 3UFCX 4M5HA 3CDBA 2GNKA 2COLA 5JMNA 2QLBB 2B56A 2CQGA 3RBDA 4ED0A 2KVQE 1O5JA 1JNRB 3J7YI 3DLJA 3NWRA 2DNHA 3SYZA 5DZ6A 2VUGA 4BLGA 4EBEA 4P2MA 5I42A 4FS1A 3MM8B 2H9ZA 1RTIB 2QA4S 2XMJA 4M5LA 3B78A 1X31C 2IMOA 5BXIA 3RB0A 3DLHA 4OI3A 4AXIA 3KHRA 4AQYJ 4J9SA 2DPIA 3O44A 2NLWA 2J6SA 5F8GA 2JH3A 1FWKA 2N4CA 2ZBIA 1K1QA 3VALA 2BW2A 4AD6A 3I82A 3T1YJ 1Q8KA 4AQYF 3ET6A 2AJ4A 3DRPB 3HK2A 1KR4A 2VC0A 3ILJA 4MK8A 3M2RA 2B4PA 4USTA 1S9GB 1WF2A 3T1YF 3FGVA 5ETLA 1RA6A 4ZPVR 1CQMA 1W2IA 1TMJA 1SL1A 4UOHA 3B4DA 4DL7A 2KDOA 4ZOSA 3KFWX 3NAIA 3IXQA 1N5YB 3DGPA 4I6YA 4YDXA 2E7VA 1JX4A 2XS2A 4DUYF 4A8OA 2VG6B 2FY1A 3UN2A 5HQLA 2FZGB 1ZTWA 5A8WA 1TL1B 1UPPA 4ZN3A 1MWZA 3A3OB 5KOWA 3GIRA 1P6TA 4ZVOB 2PT0A 1ZZFA 2I1RA 2QA4G 1XMBA 4FXDA 9RUBA 5BYRA 4JUZA 1RTJB 3H20A 3I9V9 4J9KA 2ZWOA 1HNVB 1VQYA 1NBEB 5GAEI 2VPZB 4FXWA 3DLEA 1R8PA 4IUFA 2BKPA 3TRGA 2B51A 1X9SA 5DDPC 4DU7A 3CJSA 5KFPA 3OPKA 4WFZA 1FJCA 4X4VA 1IWGA 1BWVA 1NHKL 1JLQB 2YKMB 1UJ6A 2V68A 2J0QD 2W01A 4K4SA 4EK2A 3SZ2A 1S0NA 2Y1IA 3KMSA 4USWA 2JFKA 1WG4A 3T1AA 1VQNS 1C0TA 3ZTRA 2FHJD 4DFPA 2NXNA 1Y7PA 1T95A 3BB5A 2FGOA 5C42A 4GKKJ 2KI2A 3RAMA 5KG4A 3NMRA 3UR3C 1HWUA 3PZPA 5A6PA 3J7ZT 4TLQA 4X4TA 4QIGA 2V5HG 1JNZB 4IQMA 3FFIB 5JUMA 2P6TA 4ILRA 4DOZA 2V67A 1JB0C 4GKKF 4HLBA 3G6ES 2C3PA 2QEXS 3LQVA 2GA7A 3R5DA 1NRKA 4KT0C 3OFEA 5J1EB 1VK8A 3BO2A 2EPIA 3KK2B 1RACB 5KG6A 1WSVA 5L1IA 3UDCA 5BR8J 2XB2D 4URGA 2K7KA 3DRXA 4ZVTB 4C98A 3QSYB 3U1LA 3DGVA 3GIIA 4J9RA 1U09A 4QPTA 2B8PA 3IBFB 4B9VA 1VQ4S 2HGLA 1R89A 1M5VC 2KM8B 5BR8F 2O3DA 4CLYA 4HDHA 4EZ9A 4IR1A 2XMUA 3H98A 1HL6A 2DHHA 3H4DA 2IM1A 1F9FA 2R8KA 3QATA 3VF0B 3BR9A 4EFAC 4YMEA 3ZTPA 5HLFB 3M8RA 4UQGA 1WI6A 3SCIE 1VCTA 3EM1A 2N7YA 4O0NA 4CIOA 2BANA 3EVOA 3VAIA 3AJ2A 3GJTB 4Q2LA 1WDDA 5E41A 3DOKA 1KQFB 1TKZA 3NLCA 2W8KA 1GH8A 3KK1A 1YJ7A 1GMVA 1HMVA 2DEIA 4W90B 1TV6B 2BE9B 1RA7A 4X4QA 4MFBB 1FA0A 3HKZD 2GHWA 2FJXA 4ZHRA 1CS4A 3VQSA 3KJVB 4MIWA 2BX6A 5KFOA 1RT7A 1J5EJ 2R7WA 1D9DA 4RWWA 2X3DA 3J81U 1IKVB 3P4UB 1IN0A 1UAWA 4Y65A 3R5JB 3W5YA 1S6PB 3QSIA 2ASYA 2B26A 2GMLA 3PM9A 4CLLA 1VIOA 2MHEA 3CDUA 2QFJA 2QLDA 2MXYA 2W25A 3G9CA 4R25A 4OHZA 2E7XA 3WZ0A 1HNXJ 4IR9A 4OI0A 1C0UA 4WWSA 3L95X 3E01A 4JB8B 2CNLB 2OMLA 1REVB 1X4HA 2XULA 4OZ1A 4FN5A 3H25A 1TP7A 3JSRA 4ATNA 2FVRA 5J2NA 3AHPA 2ODXA 3QBCA 4U6PA 2VFVA 3ISND 2BEFA 3KMQA 1HNXF 1VYAA 4ZVSB 3N28A 3DYAA 3DDNA 2D3UA 4WBFA 2MZ1A 3ZO7A 5KTQA 1F5CA 4CTAA 4KO0A 5L8RC 1BGXT 3NGKA 3PRVA 3EGWB 4FYYB 5F8MA 1IBLJ 3TEHB 4CLSA 4W4MA 3QLHA 2RKIA 1RZMA 5JXSA 3CD0A 3X3UA 1DTQA 5KG7A 4CDIA 2E5IA 4TU7A 1VQ6S 1S1XA 2HNDA 3MAAB 3CW2C 1IBLF 3CJQA 4CO4A 5KFYA 3C5XC 2X1BA 2E1PA 2PFDA 5BYQA 3T5LA 3QFWA 1ZTTA 4USUA 2XI2A 2JFDA 4HT7A 4RR5A 5AXKA 5L9XA 4KC5A 5FDLB 2ACMA 2L9DA 3SSSA 1U1NA 4LF1A 1S7HA 1IQTA 2UXBF 4ZPTR 4IG0A 5KT5A 3AA9A 3ILOA 3Q89A 4J9UE 2DCUB 1FWLA 1N8RT 2XG8A 3EPGA 3HCXA 1WDTA 4F3MA 4DV4F 3M7VA 3PHTA 2CPDA 1YQHA 5HAOA 1NNDA 2OTLS 4OX8A 2BJ1A 3FCVA 3J7YU 1V5IB 5MLCV 2GW8A 1LWXA 4OJ1A 3DM2A 1LW0B 4ZLLA 4U8VA 2KT3A 3PYFA 1XTZA 2R2SA 1HQEB 4E2FB 1RGVA 4DX8H 3H2VE 3OW2R 1Q4RA 2AJQA 2FPHX 3MM9B 3A8EA 1AFIA 2R7XA 2I5JB 4LF4J 1FRIA 3IRWP 2FHJA 4HVZA 4CWBA 1SJ1A 3B4MA 4DI6A 2E29A 3EPIA 1E6YA 3LGNA 1KTVA 3LALA 4ECXA 1DLOB 5ETPA 5CABA 4B02A 3K2YA 2W2QP 4LIRA 1TL4A 2EFNA 4S0MA 1K1SA 1D3WA 2QIFA 4EMDA 4ZP7A 2G2OA 1UA0A 4X64J 1N36J 2CNKB 5EWEA 4FF4A 1RT4B 4NLGA 4KQZA 2CJAA 2H1YA 2KTQA 1FFSB 2MPUA 3LO3A 1FNMA 5B0GA 1RJJA 3PCOB 3LWLA 2H65B 5A0YB 3V6JA 1S1VB 4DCJB 4P10A 2H48B 1N36F 4X64F 5AXNA 3W60A 1ICEB 2DGOA 1S99A 2LECA 1MMNA 4AL5A 2B4VA 3EWGA 2KT5A 1JK9B 4WFNQ 2R3VA 1NSAA 4QIWD 3N6LA 3PX0A 2HVIA 2LEBA 2IM2A 3D68A 5GAEU 3HZGA 4C8NA 4RUHA 5KFWA 4OYMA 3MM5A 2BV3A 1G1XA 2J9CA 3L3CA 2MQQA 3TUZC 3QMQA 3MI7X 4LRFA 3JQKA 1F60B 3CCVS 2RQCA 3CJRA 3TZYA 4RW6A 1B70B 3G6VA 1PBUA 1FESA 1U1PA 3EUNA 3BEGB 1UJ4A 4L3KA 3O1LA 2EC0A 1NAQA 1RK8A 2FHMA 1JQGA 1SUQB 4PAAA 4USJC 5ETOA 2UUTA 4K2XA 2E5LJ 3DDKA 2MJNA 1IJFB 1XERA 2GCFA 2QYGA 2PA8D 3MMCA 5DQHA 2QRRA 4X4PA 5CZXA 2D1CA 4ETXA 2E5LF 3FRZA 1XC9A 4J80A 1UW9A 3LPYA 2A3JA 2F8HA 9ATCB 1X9MA 2ZBRA 1TFYA 3P8BB 3PV8A 3BBFA 3KJFB 3THTA 3KLEB 4ZCLA 4EI2A 3GR1A 1NK9A 4KHPJ 1S1UB 3M1VB 1WKJA 1X0PA 4I2PA 1QSLA 4MKBA 3RBXA 3QIDA 3I5BA 4GO5X 1O8BA 1RI7A 2VD3A 2W7OA 3AD7C 4M94A 4KSEB 4IFYB 2KFZA 1AUDA 4EYIB 4O44A 3ZXWA 2CG4A 4WE1A 3F44A 3BGUA 3C66A 4OJ3A 5KFTA 2DNOA 1CJVA 2VA3A 1GFWB 4WZQA 1HHSA 3GTYX 5RUBA 1TU0B 4QR0A 2D3OR 1GXTA 4M5NA 2QLJB 2P9GA 4R8UB 4RX6A 2QLXA 3V81A 3MM6A 5FD1A 3ILLA 4IKAA 3FEXB 3KHGA 2CQCA 4QWEA 1QE1B 2F65A 4ED1A 2F9JA 2ZHAA 4KGMA 2YWFA 4IH5A 4RU9A 4NLOA 2J8AA 1UVLA 5KFEA 4J9VA 3KOAA 3HHEA 1RT2B 2I9SA 2EK6A 5C2GA 3L9ZA 2CPYA 1HIYA 3ZNUA 2JHEA 3AODA 2B9EA 1CJKB 2F8EX 3ZTQA 3UDLA 1ZM9A 4YR3A 2DRDA 4JV0A 3TWZA 5B7WA 1YGYA 4URQU 1VRTB 2LQ5A 3U02A 1SV5A 3G2XA 1SIZA 4ID8A 4JV2A 5IT9Y 2DIVA 2B6AA 2VASA 4O3NA 4RNHA 1TTHB 1RB0A 3R5AA 2HHXA 4M5DA 3H42A 2X1AA 4PR6A 3CE8A 1FK9A 2YWGA 3MWBA 4P6QA 4ZDNA 5ETVA 2IAJA 3VR1A 4KGVB 4LREA 3IAM9 2GFFA 1ZH5A 2ZC3A 5HP1B 4C8OA 2IFXA 3R27A 4O23A 5T14A 4K4TA 1J5OA 1H2VZ 1TL5A 5HJXA 2E1RA 2BJ8A 4BDPA 2CVEA 2BE7D 1TL3B 2BOPA 5DG7A 3EZ5A 3S7RA 2WTFA 4GVBB 1O0PA 3MUVP 2LKZA 2W4CA 4LF2A 4HTJA 3SCLE 1U0HA 4DZ6A 1Q16B 3RR7A 4K4UA 2MZSA 2V34A 5KFMA 3V5RA 3MPYA 2OGUA 2DNQA 1QUPA 4HYKA 4H4OA 3ZZRA 2QMXA 4DPTA 2VBWA 3HXMA 2YWWA 4RW4A 4OYWA 2CQ4A 1VLOA 4J9LA 4CCHA 2YQ1A 2OHDA 2DHAA 1FE4A 2AEMA 4ZPDA 5HQ8A 1CVJA 3N5BA 2HW3A 1WHXA 2ZZTA 1CJTA 5K5MA 3MR3A 3BPDA 5HBMA 2XO7A 3HLUA 5G0RA 4Z7YA 2IHR1 3D66A 2EBGA 2UXCJ 4A8WA 2MSTA 1VQLS 3I6PA 2B5JA 4DX6A 2XMVA 4R5PB 1WORA 3CJ2A 2M8HA 2V2QA 2OEMA 2C42A 4KFBA 5LSLA 4HEA9 2Z56B 4AXJA 1RTDA 4Q7AA 3GIJA 1IKYB 2HVDA 2AZ3A 2UXCF 1U24A 1UMJA 3CB4A 1TKXA 1N5QA 4HH0A 5LOQA 1UWBA 4P2SA 2DGSA 2HSEB 1U47A 3MTJA 3GCXP 4PWDA 4M5KA 1RXOB 2D41A 1VJWA 2LQJA 3TA1A 1N88A 3C6UA 7AT1B 2E9ZA 2KL8A 3I4HX 2EI5A 4RWXA 4LSLB 3T9NA 3BM7A 4USMA 4F04B 3D5MA 4TYBA 4ICLB 1VRUB 2I6WA 2CJQA 2BQUA 2XHWA 3WIVA 4L74A 2HRUA 4JV5J 2IYIA 4L76A 1WOPA 3U7JA 4YFUA 4F4AA 4DR7J 2CXEA 1CSJA 4DX5A 3MM7A 4U7UK 4DQSA 3DMJA 1FVQA 2HHTA 2PSZA 5B08A 2FYXA 3ISNC 3TAPA 1MMDA 2H3EB 3MCMA 3MR7A 5F0WA 1NJZA 2CZ4A 3DOMA 1PCAA 1SKSA 1HBOA 4JV5F 4OYPA 2HHPA 2FVCA 4DR7F 3A4TA 2P6SA 1FDNA 1U8WA 1S6QB 4IOCQ 4DL2A 2ZH7A 3R5BA 1RT6B 2A0FB 3PKYA 1FXRA 4PQUA 4B9UA 2MY7A 2XSFA 3H7HB 4K8RA 2QJ3A 2DR7A 4HACB 2XLKA 1SJRA 1YZ7A 3OLBA 4LF9J 4RW8A 3OTCA 2NPFA 3W64A 5DGAA 4PXEA 4IDKA 5IM0A 2DGQA 3MOJB 1NK4A 4U9RA 3GCWP 3UR0A 2UV8G 4ZLJA 4I2QA 2HHVA 2L48A 2AGPA 1X4FA 1Q1KA 5J2PA 4TY8A 2HLTA 4WPAA 3TUPA 3FQKA 2A6OA 3AGYA 5T41A 2HPUA 4B3OA 1CG2A 2MHNA 4USHA 1PILA 4F4XA 4K4ZA 1RWNB 1NHUA 2Y1JA 1WJ9A 4EWTA 1UETA 3FC9A 2AT1B 4ZJLA 5DRKA 1XR7A 1IKWB 2CPJA 2ZM6J 1RYRA 4N8NA 2BRLA 5ETTA 3OVSA 4CH0S 4NCGB 1R27B 2DXFA 1WOOA 3C16A 3IAS9 1R6YA 2I0XA 2LQ8A 4G3IA 2WB4A 4NL5A 2ZM6F 3P5BP 3QJJA 2NUUG 3CJ3A 3T5JA 4OMFG 3I38A 4TLRA 2E5HA 5HMYA 2PD1A 4O3OA 2ASLA 1ZAXA 3Q23A 5A2QU 3AJDA 1FRHA 1TVRA 5M2RA 2IC3A 2HRTA 3SMZA 1RDRA 1SJ3P 3C15A 4C8LA 1Q53A 5I42B 4DR4J 5L9NA 4QIEA 2MKHA 2QLWA 4X2BA 4Y0FA 2LEPA 5CA5A 2F3JA 1SH2A 2C3YA 4M1KA 1K44A 3CCJS 1NZ8A 5GADU 4NXMJ 2APOA 3GG0A 1V5VA 3MGJA 4WU2A 4IH7A 1N5VA 3MECA 3CJ0A 1IBMF 1WD6A 2JZ8A 5IS2A 2ADCA 1LWCA 4KYZA 3UW1A 4HH1A 5JJBA 3LP2A 5D15A 1NEEA 4MKYA 2VJUA 3QYYA 1DAXA 2L9WA 3ET6B 1IUJA 3Q2TC 4TQRA 4NXMF 3PW2A 5DLFA 1OO0B 3SV4A 3ELHA 3CGIA 1RT5B 5BYSA 4MKVA 5DG9A 1KLMA 1WTFA 2RQ4A 2WW8A 3R2DJ 2QL5B 2HWTA 3U1MA 1U26A 2UUCF 2Z2YB 1X4EA 3J81Y 3IR7B 3UNGC 5D0EA 4CNYA 2R7TA 1HI1A 2J76E 4H4KA 1RBLA 4LQ3A 3R6GB 3QT5A 2JDJA 1EP4A 2GO8A 3FCWA 2WAQD 1OPIA 1W26A 3DGPB 3M32A 3KLVA 2K06A 1VQ9S 3N79A 2CRLA 5A8WB 2YNGA 1NLKL 1OSDA 1RAGB 4OZ3A 3A8JA 1HWLA 1Q79A 4V19X 2VHGA 1JJHA 2EKYA 2ZKUA 2YNHA 4NZ6A 1KONA 2JC0A 3NS6A 3AOCA 2V4QA 2ROEA 3D6HB 1I51B 5D78A 1FKPA 3DFEA 1VQSA 3DLEB 3GV8B 3N6NA 2UP1A 2MEWA 2YQ3A 2GQCA 2LLZA 4QJVA 7FD1A 1C1BA 2HNZA 3BR8A 3V6HA 3PW5A 3EICA 1D9FA 2PI4A 1Y00A 4LF8J 1Q95G 2EG2A 3CCRS 2F4VF 3P45B 2XLIA 2FVSA 1RBOB 2L08A 2J7UA 1C0TB 3A3NB 3GIMA 4UZBA 3UD3P 1NKEA 1URRA 2G2ZA 2ZE2A 1Y9OA 5D6GA 3EXCX 4PZVA 1F5BA 2ZH6A 5C42B 4LF8F 2GVZA 4W92B 4KAIA 2W9BB 2N3LA 1UFWA 4DPWA 2HFOA 3BN7A 2GIRA 3OL7A 2PE8A 3ULHA 3MDFA 1DY3A 4DV7J 4Y2MA 3OHBA 3DU5A 3P49B 3QRRA 4JI5J 2HQGA 1XEZA 3PO5A 2BMBA 3W7BA 4RLEA 4N8OA 2RD5C 5CH7B 5LJ5Y 4DV7F 3A8KA 4I68A 3MEDA 1Y5LB 2NREA 4X66F 2L3MA 1EAYC 4JI5F 4MJKA 1H74A 3VWSA 2H5JB 3CIMA 1HBMA 2DY9A 3W2WB 1QDUB 2Y0SD 3QAEA 1NKCA 4N47A 4F0KA 3VGVA 3JTNA 3AXMA 2R8JA 2CG8A 1M90T 1B0TA 2F40A 4KH1B 1I1GA 3RAXA 3V6KA 4EYHB 4LBHA 3FMWA 4NLQA 1WKKA 2G13A 4U95A 1FTRA 1GNKA 4ES1A 2BANB 3GU0A 3TW0A 2B8QA 3TJAA 3DOKB 2WONA 2A10A 3CC2S 1TKZB 2A18A 4UY8T 3VCDA 4NZ7A 3KK1B 4ZKAA 4HHUA 1HMVB 3W2VB 1YJRA 1JLGA 4LSZB 3NCPA 1NK5A 1YITS 1S4FA 2HKEA 4DN9A 1LV5A 3NRBA 1WC5A 5H9EK 4ZHRB 1CS4B 5IWAJ 3UDEA 2N82B 2RU3A 1T8EA 1ZOTA 4ERDA 3SFUA 2MLZA 4NLYA 1KOOA 1RT7B 2Z2ZA 4B3MJ 3AQOA 3KHHA 4ETZA 2BDPA 3PX6A 3F56A 4ZK7M 1S0VA 1SBRA 4QWAA 4DV1J 1X9WA 1L3SA 1S49A 1CC8A 1IR0A 4NMXA 2AGOA 1Q8LA 4OV1A 2V2VA 1WACA 4B3MF 3NP5A 3D2WA 2EW9A 2DO0A 4J9PA 1LXNA 2VQEF 4X4RA 4P72A 1C0UB 3E01B 1FRXA 1S10A 3POTA 4LT6A 1H2TZ 1IM4A 4Q5VA 1BLUA 3AY0A 3VGSA 2YKPA 1S97A 3J7A1 5J2NB 1KVJA 1GTHA 1TUGB 1LK5A 1U1RA 4OJGA 4KY3A 3DYAB 4LIWA 4K4YA 3VVTA 4H4KC 1K73T 2MKIA 4WFAQ 3OV7A 3S8SA 4CTAB 4KO0B 3L09A 3D1OA 1ZAWA 1T05B 3QAUA 4YR0A 2R4FA 2HBRB 2KT2A 1SH0A 2VKRA 2YX7A 1R8HA 1Y3KA 2RKIB 1FNOA 2A1BA 4B3RF 1DTQB 4USVA 2JEIA 1N5SA 3TNVA 2HNDB 3DHWC 4Z37A 1NM2A 1WHYA 3MD1A 3KLIA 3I0RA 4DPOA 3T6BA 2XGPA 2ACYA 2NSBA 2D3O1 4QCLA 3TX0A 1U1KA 2HWIA 4OHWA 1Q5YA 1D0EA 1OQ6A 3MD3A 2P8IA 2ATCB 3JB9k 4IG0B 4KGZB 4C0HA 4QPXA 2RSQA 4DV3J 1V3ZA 4OI1A 1KC8T 2XNRA 4F50A 2BKNA 4DV3F 3DM2B 1VS3A 3TVKA 2KM8C 2W9CA 1RT1A 2KYZA 1U48A 5CD4A 2VG7A 5C7PA 4M5GA 1SKUB 3CD5A 3OL9A 3AOBA 3GFZA 5IV4A 4EO8A 1NK6A 2XZTB 5GVQA 1RAJA 3G87A 3KUHA 3VAHA 3E8OA 2IPOB 3SQGA 5D4NA 3RZAA 2OSQA 4DV0J 2DJWA 3OR1A 1M1KT 3MOZA 4G65A 3PDNA 1RAHB 1HHQA 4BHQA 4Z7CA 5LJ3Y 3SXLA 4FDFA 3SSRA 4IG3A 1U25A 1PIEA 1NK8A 4DV0F 3FCHA 1R8AA 2IA6A 5H9FK 2YH1A 5KFSA 2KG1A 1TK5A 4ED7A 2IVFB 4DJBA 4LFBJ 1NDLA 3VHQA 3QT6A 3QT7A 3PRDA 4V1Ak 4FKXA 1T3OA 5B09A 4EUVA 1ZBTA 8ATCB 2DIUA 3QO9A 3VGTA 2DHXA 1L3KA 5B0DA 1S9EA 1U45A 2DISA 1JXVA 1CPZA 3MXHP 1U2FA 1YTYA 3A13A 1TZ0A 1NPKA 3MPVA 3CJ5A 2GO9A 2HURA 2DGXA 1YG0A 2NQPA 3NNHA 4Y3CA 4P73A 1KBRA 3TO8A 1M5SA 4YHHJ 1H3DA 4NLTA 5HVGA 4XPCA 1HA1A 3RTVA 2W4DA 1XMOJ 1S5ZA 4WP8A 2AD9A 2ERRA 3EE3A 2XSJA 3MM5B 4U8YA 4FYWB 2WVCA 1VBZA 3FSYA 2IMWP 3AT1B 1YJTA 2IA0A 3B54A 2J0XA 4YHHF 1HNIB 1EETA 2BQ3A 3UDVA 1E6VA 2BW7A 4RW6B 4DL6A 2OPRB 1FTCA 2YNIA 4NWBA 2HHUA 2G1HA 4DUZJ 1S1TA 3KTQA 5H1SV 5CYQB 4LRCA 4DQQA 3PJ9A 1YBTA 4YY3J 2MY8A 3H2LA 2OEKA 4DUZF 1NZAA 2FHKA 3BGRA 4PUOA 4WIIA 1X4BA 4NRUA 3MMCB 1YK9A 1JLBA 4YY3F 1C4CA 4A48A 3KHLA 1YIJS 5J1NA 4F8RA 4F67A 1IR1A 4I64A 2CWKA 3R7NB 3H4BA 3GPAA 1I94J 4OYBA 1CJUA 1XNRJ 1HQUA 3OL6A 4I2PB 1YX2A 2DK2A 1FERA 1NMEB 1R6VA 1NB7A 3G82A 4O44B 1I94F 3B82A 2RRAA 4WE1B 4O3SA 1XNRF 3KG1A 1SKWA 2NXCA 1CJVB 2DTJA 2IJNA 1QLNA 2V4RA 2AX1A 4RNOA 4ZVGA 1VBXA 1JKHA 1PYOB 1WWHA 4MMOA 4G1QA 5LMNJ 2BJ9A 1U0SA 3V81B 8AT1B 3MM6B 3OTOF 2JNJA 4FF1A 3SQOP 2Z30B 1S76D 2OI2A 1FFWB 3JAMU 2Z8QA 1IBKF 3LAMA 4CQ1A 1KD1T 2DPJA 3IO1A 1Y0HA 4X4SA 2JEGA 2XWXA 2VBYA 1TL7B 3ZZTA 3MCNA 2AYMA 4NLXA 3UNYA 1U1LA 2C2EA 3QQCD 3WIUA 3LWMA 2IM0A 4MT1A 3OD2A 5ETKA 3GONA 5DO2A 3BKTA 2R2UA 3H8YA 3PR4A 3MEEB 2ZEJA 1NK0A 2Z57B 4CO1A 2JLGA 3PEHA 3S1TA 2LDIA 3Q8VA 2CQ0A 4ITSA 2KH9A 2JVMA 1YSJA 1SV5B 4RPFA 1VDHA 2GHPA 3JS9A 4J9MA 3DC2A 1VQMS 2BXJA 2HFSA 2B6AB 1FJGJ 4Y34A 4J5OA 1XNQJ 4OQJA 1NJIT 4M5DB 1UEUA 4RW9A 3K5MA 1FK9B 2IRUA 4WK1A 4ANEA 2M0GB 4ES2A 1YLXA 1UL3A 4OIXA 2IAJB 3IMQJ 1YZ6A 5CXTA 1SJQA 2CPFA 4FNHA 3M6WA 2FLLA 1FJGF 1XNQF 4QYZJ 2FLPA 3ZFVA 2GV1A 4HI1A 1J5OB 4IRKA 1KP6A 2ZBPA 2XM3A 2M4MA 4ZCKA 3DLLQ 1EQ0A 1RTHA 2Y1RI 4DHVA 3UCUP 3AGZA 2KVIA 5EHHA 2HK3A 3MTKA 2ADBA 2JRRA 2DVIA 3D1QA 5F9LA 4WKRA 4ECRA 1I3OB 1KOHA 2RU9A 1U0HB 3DRPA 3DU6A 2R9LA 1BQNA 3BV8A 5HMXA 1RHJB 2HQDA 3R8YA 1DJ0A 2RAQA 3UO0A 3VGUA 1M5HA 3OFGA 3RB3A 3J7AN 4O4RA 3LTOA 3KJNB 1GEHA 2D7SA 3A1YG 5A2QY 3AGXA 2VQFJ 3TJ8A 1B99A 5K20B 4KE5A 3HZEA 2J0SD 4RW4B 1WUUA 5L38A 1QAYA 4AYBD 4KB7A 4YDDB 3LP1B 4HKQA 2H5EA 3HJVA 2VB6A 1CJTB 1WNEA 2V2KA 5HBMB 4LFCJ 1TK8A 5G0RB 5GAHI 2FY8A 1RLCL 1O6XA 1RTJA 2B5JB 3UD5A 4JI1J 4NLPA 1RWOB 2C2DA 4KFBB 2HMIA 4P74A 2YBVA 1Q78A 3QFHA 4LFCF 1RTDB 1TUVA 3C6TA 4NRTA 5LSRA 5KFIA 4U7UD 3OSNA 1FXDA 4CO3A 3HVAA 4I56A 3JYTB 4CRJA 1UWBB 4UW2A 5F0UA 4JI1F 2LXIA 4PWDB 4FNIA 3W1YC 2OAUA 3C6UB 1LW2A 3GIKA 1Y5NB 1OY9A 3PKMA 2V9WA 3EVWA 4RUBA 5C24A 4KH0B 4DL3A 1U49A 2PA3A 4DQIA 1DQ8A 4Y2CA 3TUIC 4KJIA 2KN4A 5D0HA 1HPZA 4OX9F 1VQOS 3MM7B 3AH6A 4TY9A 2EFPA 3DCAA 3DMJB 3W8PA 1KFSA 4ECWA 2HK2A 4UQTA 3CVKA 2HS4A 3R9LA 3DOMB 2AP6A 2B7BB 3CCLS 2PN6A 2JVRA 4DFJA 5K8OA 3UN5A 2LU2A 4PQUB 5AE2A 2IDLA 4DF4A 1KHWA 4KPCA 2R7QA 2ASJA 4RW8B 3H5SA 4IDKB 3KYLA 4ZVEA 5IM0B 4EZ6A 3OTEA 3W65A 2RF2A 2V2ZA 2MKCA 4I2QB 5KFFA 2CDQA 2RRNA 3W3SA 2LYVA 4I6WA 1QAXA 3DOLA 5J2PB 3HSJA 5HLFA 2DITA 4N77A 4K4WA 2V63A 2LA6A 4F4KA 1XK8A 2Q66A 3RG6A 5DDRC 3TARA 1D8YA 2LEAA 1Y10A 5E0OA 3FK4A 4ED4A 2YPZA 4URSA 2WOMB 1YJ9S 1M1GA 4I6AA 2E5GA 3HT0A 2K8GA 4DPYA 2E1CA 3D28A 2XMWA 4KKOB 3BN4A 3I4PA 3C16B 3T5HA 2HAFA 3KJVA 4DF8A 4K50A 3PRBA 1X5OA 4PWUA 1NSKL 3NNAA 1HBUA 2XQCA 1X5PA 1RSCA 1QY7A 5MAOA 1FRJA 3PACA 3QPIA 2MKKA 3JTOA 4RBUA 1TVRB 2IC3B 2R8IA 4KPYA 3EX7B 1VMBA 5HN0A 2HVHA 1VR6A 4CP5A 3C15B 4DUYJ 4BWJA 5BJRA 3LUYA 3ENQA 1U1OA 2YWHA 5D3GA 1T9UA 3NCQA 2BUNA 2GIFA 2IJFA 1ZPVA 3MCSA 2ZDPA 2XGQA 5B0EA 1HFEL 3K5OA 4G1IA 1YRUA 5KFUA 3PXGa 4OHVA 4QU6A 2IRYA 2DRAA 2AZ1A 4KTQA 3UCZP 4OJHA 3MECB 1SI9A 3OT9A 3HI9A 1LWCB 3JTPA 2UV8A 3LP2B 5T7LA 3CIZA 4CT9A 3ENAA 2CZVC 4QYZK 1RAEB 4MK7A 2V8HA 2O66A 1M1HA 1NJYA 4OI4A 3G8TA 2X7IA 1FEHA 3I32A 2OELA 4X65J 5KT6A 4DPUA 1GAOA 1KLMB 4OZ2A 4GMKA 2HQCA 4U7CA 5IC6B 1UWAA 2B43A 2GQQA 2XC9A 1NHVA 4DSIA 5JVHQ 3ZZPA 4PKDB 5E3RA 1BC6A 5KFRA 1DBDA 3MAAA 4X65F 5DQGA 1EP4B 1VBYA 1T0TV 5GMKa 2LA4A 2EFOA 3M32B 4UUWA 1SVDA 3LAKA 4YP3A 2KXHA 4OZNA 3BSNA 1S7IA 4YR2A 4J9QA 2YNGB 4NMLA 2YVSA 1X4DA 3IGNA 2H51B 1SXLA 5K14B 1WF0A 3L4BC 1X60A 1APSA 2YKOA 1HD1A 1YJWS 3VV2B 2YNHB 2E9RX 4CLPA 3MHYA 2UUBJ 1C2PA 1FKPB 1JLCA 2ZH9A 4B9MA 4NLWA 3OBIA 2VH7A 4ELTA 1C1BB 3IS9A 4B3SJ 2UUBF 3ENWA 2RUGA 2HNZB 3UN3A 1FI4A 1K0VA 4K4VA 3T1HJ 4WP3A 2FLNA 1XBWA 1T9YA 3O8WA 5D4PA 2AQ4A 3TZXA 2QSWA 4YB6A 1BHNA 4B3SF 1PJ6A 2HZAA 3GFHA 2VOOA 3HT3A 1MWYA 4H4MB 2VFRA 2ZE2B 4C4WA 3R6LB 4WYWA 3D3CJ 3G71S 3T1HF 2GVZB 2Q79A 2FJAB 2M88A 3BS9A 4Y00A 3TOQA 1DLOA 2UVUA 1OWXA 1JLAB 5EGYA 3UE2A 2NSCA 3DLKA 3M8YA 3GB0A 1FXLA 2YWKA 2CNNB 3BGOP 1U2CA 5B0AA 4DR3J 3RBEA 1HWIA 1RT3A 4G6VB 2Y9HA 3IFEA 2HAIA 2H4YB 2BYCA 2N3OA 2R2TA 4QZVB 4YS2A 4JP8A 3MEDB 1KKHA 1EHWA 4N7TA 1FE0A 4UOFA 2AW0A 3CPWR 3V4IB 2IJRA 1LQ9A 4DR3F 1OYEA 1HBMB 1WG1A 4IO1A 4KIAA 3O2IA 4F2SA 1SL2A 3JXOA 1TUWA 3PJXA 5DDOC 2DH9A 3GJSB 4FS2A 5AXLA 4CM2A 4DN0A 4ER8A 1QSSA 2I2YA 1K8AT 3ZC4A 1TMMA 1Z2ZA 3PW0A 1HNZJ 2DR9A 3GLJA 2BZ2A 2C2RA 4P7TA 5GAHU 3HHNB 5IZHA 1SB6A 3I5CA 4LSNA 1UFKA 2J9DE 2PDAA 3PFEA 2WONB 2ZWPA 1AZSA 3HSZA 4L73A 2BVZA 5D4LA 4DSEA 1HNZF 1S59A 3M9MB 2J9DA 1IKXA 1UJ5A 1FRKA 3CCQS 2MKJA 2AMCB 4XK8C 4FKYA 1JLGB 5A6WA 3R97A 3EJMA 4ZVHA 3E2EA 5ETMA 4LR8A 1EQMA 3NMAA 3AQPA 3OXFA 4BWMA 3L7OA 3Q8RB 3QJLA 1FKOA 2HYIB 1EARA 4QIVA 2VONA 1PBAA 2ZVIA 3GWCA 3W9HA 5IV3A 2YX4A 2OPPA 3IG1B 3CDEA 5B0FA 1HYSA 2CQ1A 4XO0A 4QR2A 2ALZA 2HHQA 1OY8A 2WVBA 4K5SA 3HHLA 2EBEA 3JSYA 1M5PC 2B3TB 3FMBA 1BQMA 4UOCA 3POTB 1YJVA 2RJZA 3DI6B 2UXBJ 3M8QA 2WHOA 4V19J 3ZZYA 5G4DA 3ZNJ1 2BRKA 4R0JA 1IR2A 3MEGA 4TVAB 2LDYA 1W7WA 3D0HE 2R7VA 3HDSA 4DV4J 2FGCA 5FLXU 2GHVC 3OVBA 1FDAA 4OZ5A 3EGZA 1HWKA 5HJYA 1T9XA 4R0EA 3GG1A 2MKSA 4RW7A 5DQIA 2BJEA 1XN9A 2ILYA 2FZCB 2NUHA 3QGHA 2K3IA 5SUHA 5GMDA 4DL5A 2E7WA 2CJXB 1F6TA 3TP2A 1PGZA 2FTRA 1J2VA 4QR1A 3KLIB 5F3TA 2GZOA 3I0RB 3I0SB 4M8LA 4I1TA 5LMUJ 1RT2A 3PY8A 3DNCA 3EVMA 3H5UA 4NASA 1NDKA 1QAJA 3T19A 3ILIA 3DDIA 5KFLA 1CLFA 1C3GA 3H5YA 5LMUF 1BUXA 2VKZG 3TAMA 2QZ8A 5I3PA 4CNZA 2P9EA 4P9SA 1NJXA 2G0JA 3MMBB 4KV8A 4FYXB 3P96A 5SZTA 2MJUA 1VFJA 2BA9A 2HZCA 4OHXA 3IRXA 1ACMB 3TEGA 4F3QA 1SJ4P 1UA1A 3FBEA 4QIFA 4QQBA 4LF6J 2Y0BB 4XTTA 1S57A 2W9CB 1ZM4A 1RT1B 4PYDA 2Z58B 1L3VA 4A8MP 5I3QA 2VG7B 3TR5A 4NA1A 3PG9A 3J7Z5 4C0BA 1G4CA 3JSMA 4CLFA 3QZ8A 3JAMY 2LQBA 4LF6F 1HI8A 4JI3J 1N5TA 3SQGB 2GIQA 5HMWA 5DS7A 1KDNA 3OQ2A 4A4JA 5LSOA 1QJHA 2GVDA 1AT1B 1KS2A 1HD0A 1JIHA 4KBIA 3QIPA 3KKFA 4F25A 1DFDA 2IBOA 4JI3F 1WC0A 3Q8YA 4IG3B 2V8GA 3BYPA 5I3UA 2CJYB 6FD1A 3JQMA 3THPA 2XCAA 3Q24A 1UW4A 2W8LA 1VC0A 1H6KX 3PFOA 1F2GA 4M5MA 3QO9B 4OYXA 1KVIA 3GYNA 3DRSA 2M52A 3W61A 2LU1A 1KNZA 1NB2A 1S9EB 3GFXA 4ECVA 3CCMS 5DM7Q 4F0HA 2KJWA 3Q2SC 2VL1A 3G96A 1LWFA 2F9DA 4C3KA 4C6AA 4WFBQ 2WVDA 3ISZA 3SBMA 4NLRA 2UUWA 2VDIA 1WEYA 2LXUA 2MQLA 3M2UB 4FVCA 1BY9A 4NEYA 1JLFB 1RISA 1WHWA 3N9UC 3BSOA 3K0JA 5F8IA 4R5PA 3NKYA 2XSJB 4PCQA 2BQRA 3NNCA 4ZVPB 2KKHA 3D6TB 4K2JA 2DKOB 3RJMB 2V0NA 1S79A 3Q0AA 2GQ2A 1EETB 2W2OP 2DNRA 2FVQA 1N4LA 3N01A 2MKYA 4CI0B 1S1WB 4O4GA 2YNIB 4ZVFA 3I56S 1F0XA 1S1TB 3CT9A 3TX8A 4IRDA 2XMTA 2HNYA 2DR5A 1N32F 4N76A 1QM9A 1QVGR 5KFKA 3RRGA 3V4MA 3UCGA 3W9JA 1B4SA 2PC6A 4EO6A 4TYAA 4ZA1A 1U4BA 4BBYA 2DO4A 4Q2MA 1TAUA 3BGRB 1PKUA 2OMOA 3MAHA 2Q1LA 2CPXA 3PNIA 3BO4A 3FEYB 5HSPA 4LF5J 1JJ4A 1JLBB 1FD2A 5B0BA 1HHTP 2V4JB 1VQ7S 1FO1A 1NU4A 4OLOA 4OYAA 2ZH8A 3HVRA 2JEFA 3AB2B 3R3TA 4QYRA 5AJ3J 1WKLA 4LF5F 2XEXA 1FRLA 5IOLA 4FP9A 1CJUB 4A8FA 1S6QA 3H59A 4P2FA 2DY1A 4TKTA 3C46A 3N0VA 5DLGA 4P52A 1TAQA 1UPMB 2G0IA 4HACA 5EN1A 2DNKA 5AJ3F 4K4XA 4CT8A 2F8MA 4ZLPA 1WSRA 1FJEB 2J8SA 4EBCA 4DFKA 3O6QA 2W7PA 2K1RA 1JKHB 4WIQA 1DTTA 2KRBA 2FHOB 1MNEA 4G1QB 2ZC4A 3FJ2A 4USKA 4HT5A 1MMLA 3MPWA 4F0MA 2RIJA 4JI6F 3GQCA 2M7SA 1OMSA 2EFVA 4E8UA 2QC3A 1AYEA 2AKWB 1HR0J 2ZH3A 2FLOA 2LMIA 2Z4PA 2PFFB 4LBPA 2MQOA 5J2MA 3A3PB 2DNGA 3NOGA 1UEVA 2J9EA 5FJ4A 2R2RA 2WSFC 2E44A 1HR0F 5LL6d 2BJ7A 1V3RA 2M3DA 2AX0A 1VQKS 4NLDA 3LA0A 1KVKA 2PEBA 2ZD1A 1JJ2R 3QGGA 3VAJA 4JYAJ 3OFFA 4LVNP 2FJEB 4HL9A 1PC5A 1IJEB 1CBKA 2OP5A 2JX2A 1WG5A 5HL7Q 1LK7A 2LQ9A 4ED2A 1ROFA 2CQIA 1KFDA 2XYGB 4RW9B 1RBAA 2HS0A 3TUJC 2L41A 4JYAF 1W2BR 3I96A 5B0CA 1OSCA 2IY5B 3HMJG 5U47A 1YHQS 1BMQB 4K5RA 2RHSB 2JZ5A 4OYIA 1Y4ZB 4Y2KA 2GJ2A 4LRDA 2M70A 4LMZA 1UKUA 1XR6A 1JMTA 1U6BA 3KG0A 4I69A 4NPOA 1FJ7A 1C1CA 2CDRB 1RTHB 4ECQA 1AROP 4QOTA 4DS4A 2HG4A 3GILA 4LRBA 4PG7A 4C3LA 3SEOA 3KLHB 4XPEA 2DH7A 4DQRA 3IP0A 1TKTB 3MF5A 1BQNB 4ID5A 1RT5A 2PGCA 2FC9A 2PMWA 2XMKA 4KR0B 4CLKA 1C4AA 2MQ8A 2WCXA 3OJSA 4Q44A 5KFDA 4DX7A 4WK3A 1I6JA 2MGZA 3IBCB 1N54B 4CZCA 3FSXA 3NBPA 2D9OA 1HLWA 2Z2LA 3BO3A 3FNNA 4N41A 3OR2A 4Q8FA 1RU2A 4DL0C 4QW9A 5GAGI 1HW8A 2BE2B 2BOAA 5I4MA 4USIA 3C14B 1IM6A 3EDRB 5KOXA 2EWHA 3CCZA 3NS7B 3NEKA 4MH8A 1NDPA 2OPSA 3AOAA 4PXCA 2CWXA 1R0AA 3MMAA 2DEJA 3O5TB 5C25A 3R1HA 1N33J 1TQLA 1CULB 5DETA 2DRBA 2PEHA 2RVJA 2HMIB 3C6TB 1AUSL 4KHMA 3M2VB 1P1LA 4NX9A 1KN6A 2ZJQQ 1N33F 4UTGA 3VAMA 1MN9A 3OXLA 3EYZA 3M6UA 1PJ7A 1H7WA 2YKQA 1MWQA 4MKAA 1LW2B 2DT9A 4FYDA 4RBTA 4PG8A 1KWMA 2V69A 3HFKA 1K47A 2OFGX 2VOPA 4CH1A 3HP6A 2F5GA 2M8DB 3RU0A 5C24B 4F3OA 4GVLA 4Z2XA 2ZH1A 1RWKB 4DDFA 1Z4UA 2W9BA 2BR0A 4RZRA 1RKJA 3CCSS 1NK7A 1HPZB 1TK0A 3ITHA 4DEZA 1DQ9A 2D3ZA 2VFTA 1PJ5A 3BKFA 5E5NA 5H9EJ 2C1EB 4OX7A 2J0WA 4B9LA 1GK8A 5IC4B 2NXEA 4PPZA 2Y8WA 4E0DA 1H7XA 3VZHA 2MZTA 1QTMA 1Y5IB 2RE1A 3D67A 1A7GE 1O51A 4FBUA 1WELA 4JI2J 3UQSA 4XDCA 3W2WA 1MROB 4AL7A 1IQZA 4O3QA 2XMAA 2RF2B 4ZN1A 3MR5A 3FBCA 4K59A 2GX8A 2VPXB 4JI2F 3DOLB 4AE5A 4F36A 1F5AA 3R7SB 2JVOA 3TYTA 5J2QA 2AYEA 1H0HB 2XMMA 2XY7A 4EBDA 1RADB 5IT4A 5KFZA 1RAIB 4AFFA 4B08A 3M9OB 2ZBCA 3TVYA 1FDDA 4CYUA 2X3GA 4QW8A 4DSJA 2ILZA 2G2YA 5EX3A 2ZH2A 2CQ2A 4IH6A 1VQPS 1RHRB 2JEJA 5F41A 1IBMJ 4YB5A 5KG0A 4OLPA 1UVMA 3W2VA 3LOUA 1N6QA 1UZDA 5L1LA 1Z2LA 2CNOB 2HQFA 1PSDA 5CZVA 1WC4A 1IBCB 4DZDA 4PYAA 5AE3A 4ED8A 2HZVA 3K5LA 5CCLA 2FC8A 3H40A 1HBUB 1FD8A 2XY6A 3CNQP 2RRBA 1NPPA 3BQ1A 2UUCJ 3Q8UA 3QWPA 4HHJA 1F9HA 4ALZA 3DLBA 2CADA 2CQDA 3IC1A 4JI8J 3CJKA 1ZA2B 3M2RB 2DNPA 3M8SA 1J5EF 1QD1A 3M6XA 2QL9B 2KO1A 2C2MB 3QNWB 3DRRA 4ED3A 4A8XA 5F8HA 2D69A 4C8ZA 4DSKA 1R8BA 4ZCIA 5THWA 4JI8F 5KFCA 5D3GB 1Q86T 3GYGA 3ENVA 2DR8A 2VZ9A 2YKAA 3AFGA 5LXRA 2MTLA 2ZNYA 3MPDA 2VBXA 1RKIA 1VC6A 5T7LB 3DXSX 2FJVA 2ROPA 4FYVB 2UZAA 3BF4A 4NA2A 3K58A 1HBNA 1VISA 2HFZA 3LZ8A 3FUYA 1T05A 2DB1A 3OTDA 3MFIA 2YY3A 1OY6A 1OQ3A 1HNWJ 3MR2A 1UVJA 1S77D 4ZJQA 3E51A 3UVJA 2NZCA 1P9QC 2F4VJ 3PVXA 4YB1P 4X4NA 3FSIA 2UU9J 2R8GA 3KWMA 4CH7A 2ZJRQ 3RUBL 1KLNA 4Q0BA 1HNWF 2Z0GA 5AE1A 2VF3A 2QE5A 2V8VA 4UOGA 2M2BA 3SDEA 2LFVA 2UU9F 1FF2A 2HGMA 4OZ0A 1AB8A 2KFYA 2MYFA 5H9FJ 3VVUA 3LP0A 2FVPA 3GYXB 2FB0A 3QT8A 4DR2J 4BC9A 2ZUAA 3M05A 2CYYA 3K17A 5A8KA 4XIUA 1QUVA 3NAHA 5KFGA 1JLCB 5HVHA 3G8SA 3RB6A 1RHMB 2ZZNA 3BGLA 4DR2F 5FLXY 5GMEA 4X66J 3IS9B 3G4SS 3CDAA 1PAEX 3LPEA 2FUG9 4DCPB 1WEXA 2UVWA 2OPQA 4C8KA 2DNZA 4DV2J 1T9TA 3SFGA 2JOQA 4NCBA 3FVYA 2O01C 1ZAVA 5E2QA 4ZJOA 3KJQB 4C0OC 1ZM3A 5K9FA 1LWEA 3D9BA 1SPBP 2W2MP 2HBQB 3K59A 3GE9A 3HF5A 2AJ2A 4DMZA 4DV2F 5KT7A 5HMZA 3JQJA 1DARA 2GAGC 4LF4F 3OUYA 4Q45A 2E1MC 1HI0P 4ZVRB 2C3OA 3DLKB 2HHHJ 2E66A 3EZUA 2WSEC 4FXVA 3IN5A 2VDHA 3GMGA 5D77A 3S01A 1RTZA 2WB1D 4WZMA 3PR5B 2IRXA 3K5NA 5CYMA 5D0GA 3U27A 2QYCA 2RDIA 1RT3B 2V94A 4Q8EA 3K5PA 1K9MT 3V6DA 2DYAA 2V9KA 3LH2S 2HHHF 1QTNB 3VAFA 2ZDOA 1MLAA 4C9DA 1D1UA 4B9NA 2NZ4A 5A8RA 4NI2A 2CVIA 2YQ0A 4EEYA 1EJ7L 1Q81T 4PABA 5GAGU 3CCES 1MN7A 2QLFB 5DZ7A 2OD4A 4X4OA 1VC5A 3OXGA 4LQ9A 4RJVA 5D8HB 3RGIA 1M5OC 4LUBA 3MUTP 4GC7A 2VQEJ 3J80U 4NYZA 4DG1A 3N4WA 4LSNB 3SIPB 1VHIA 2I38A 1AZSB 2AYGA 1YBAA 2YNFA 4TNOA 4ECYA 1FX2A 2HIYA 1IKXB 2VPWB 2VFSA 2Y1LB 3KDOA 1GT8A 1JLEA 2OSRA 4I0WA 1TR0A 2KXFA 5EUHA 1HNIA 3PIOQ 3D1HA 1U02A 2KHDA 5CYJA 3RYLA 1P27B 2OPRA 1RWXB 6AT1B 2M9KA 3D3BJ 1Q8IA 5KG2A 2LCWA 3PW7A 2JWNA 2VODA 3WX4A 2PMZD 1PYSB 5KFHA 1H73A 1H38A 5CYQA 3C3LA 2RQKA 4L6V3 3W8GA 1RE1B 2NXJA 2NR0A 3P6YC 1NJWA 1V3SA 4NXNJ 1FKOB 1RP5A 1FCAA 4ZCMA 4B3RJ 1SJFA 1F3VA 3MEKA 2ZOMA 1FEEA 2QMWA 3HPOA 1ZZNA 3D7SB 3CC4S 3WC0A 2OPPB 2C3UA 4KGKA 1HYSB 1MW7A 2H4WB 4NXNF 3QLHB 3PEJA 5KT2A 2KJVA 3Q86A 3RB4A 1YI2S 1B64A 2PI5A 2RH3A 3CMQA 2G4BA 1VJQA 2AEFA 1S1XB 3HHLB 2DHGA 1FFGB 2EXUA 1BQMB 3NGTA 2HQIA 1HWJA 4FZVA 2AJFE 4CLTA 2NYIA 2YXLA 1U1MA 3M8QB 2XS5A 5GADI 3CDWA 3IR6B 4CLUA 3MR6A 3MEGB 4PQAA 2VBZA 3V2UC 2UUAJ 2W24A 3W5XA 5IQQA 3KK3A 2RMLA 1XMQJ 4ZP6A 4KHPF 3QGPA 4ILMA 1X8DA 3CWJA 3HD1A 4RNFA 2Y3YA 4CO2A 1EKSA 4WTYA 2O1PA 2UUAF 4RW7B 1U6ZA 4Q43A 2A6MA 1Q5VA 1XMQF 2HLUA 1ZETA 4PXDA 4DR5J 4LFAJ 1GXLA 4ED5A 2W2PP 1QVFR 1CC7A 5ITHA 1S4EA 3VAGA 3BBBA 5A76A 1Q8BA 4QWBA 2JJ4D 4NEZA 2DD8S 3AA8A 1BD6A 3ICLA 3M8PA 4DR5F 4LFAF 4C2MA 4WCEQ 1TL7A 4DPXA 2QN6B 2QFIA 1RAAB 3FQLA 1T03A 2ZZMA 5F8NA 1URNA 2AYBA 3M30A 3MEEA 1KQSR 2QGFB 4P2XA 1RHQB 1WTBA 2IBKA 4DCOB 4C8MA 3TAMB 3I9ZA 2ALYB 1E6YB 5K8NA 4KV8B 2DNLA 2IVYA 2QL7B 5F3ZA 3CJTA 3HVTA 2QA2A 4OL8A 1J27A 2LXFA 3IRXB 2XCPA 4P75A 3TA0A 3GR0A 4IFVA 1LEOA 4C11A 5C5JA 2H5IB 2Q6CA 5EDWA 5E3CA 1HW9A 2W9AA 4F4WA 3JSMB 3N6MA 2Z2MA 3FDSA 1X7VA 3DN9A 3SI8A 3C8YA 4F4ZA 2YTCA 4ES3A 2V8PA 3P3DA 2B9XA 3PYEA 2H54B 1T94A 2DCLA 2GVDB 4WXWA 3KLFA 1EKRA 1R3NA 1R8CA 4OFZA 2YPYA 1V6HA 2WRMA 2CIMA 2IM3A 3QIPB 1KHVA 2UXDJ 1NCLA 2YX1A 2OKQA 3WBZA 1F1BB 5HROA 5I3UB 2B4OA 4ZVUB 1FDBA 2OH2A 1NLTA 4A8YA 3OFHA 2OUGA 1G7CB 2FDNA 3KNAA 3ADAC 6FDRA 4MTPA 3DLGA 1SC1B 2UXDF 1GQEA 5LT5A 4OZJA 2QG9B 4EGLA 4WFXA 1S48A 3THVA 3KLGA 3DRSB 4ZIWA 1X5TA 1NXIA 3NXZA 2ZBQA 4ELVA 3FZ2A 2CFXA 2MSSA 3VZIA 2C28A 2G0CA 4YUDA 1LWFB 3PO4A 2EFQA 4L72B 3QRQA 3H5XA 3A12A 4DXLA 3D54A 4UY85 3LP1A 3HJFA 2HEKA 1UTAA 1VRQC 4PG4A 2CPIA 4DQPA 4DLEA 2XZWA 5HANA 2J7KA 2C2KB 2VG5A 3KNGA 1X4GA 2OO4A 2X51A 4L75A 1DHMA 4ZLNA 3BREA 1B0VA 3LF0A 1YRXA 1MG7A 1FHTA 2KRRA 5ETNA 1S0OA 2MLYA 2HFUA 3JYTA 4O4GB 1KRPA 1MU2A 3BKUA 3ZZUA 4DR1J 2Q43A 2GJIA 2HNYB 2GAHC 1FRMA 1IXKA 4AUKA 4J9NA 1VGYA 3M4XA 3OTOJ 3BGFA 3GV7B 2JRSA 2YKNA 3U1NA 1IBKJ 4DR1F 3LGMA 4ANCA 1ULRA 2DGTA 1T7PA 2ROGA 3X1LB 4ANDA 1G2EA 1R31A 3K7RA 2DH8A 2XBPA 4K7QA 3RW7A 1RWPB 4RNNA 2RILA 1AXQA 3WDOA 1ZM2A 3PX4A 5KG5A 3IWXA 3WX8A 4X4UA 4IYQA 1YDLA 2GGPA 2AJ1A 5DM6Q 1H2UX 4Y6IA 1B7YB 2ATLA 2F1FA 5ETSA 4NYPA 4I7FA 3VTIA 3KG4A 1M0SA 3ETOA 1HKAA 3TA2A 2K1RB 1DTTB 2R8HA 4LF9F 1T3NA 3NL0A 4PEOA 4Y28C 3FBFA 2D9PA 4X84A 1BWEA 3MMJA 4HI2A 1U6FA 3S6EA 1VK3A 3TJ9A 4J7CA 2QMUB 1XQIA 1N56A 4M63A 3MM8A 4D3HA 4DV5J 2E5JA 1RTIA 2WOMA 5J2MB 3ZZ0A 3A8IA 1SCJB 2MZQA 3MZIA 4C97A 4RL1A 4KKOA 3J81j 1DRZA 4M5JA 2CPHA 2ZD1B 2UVVA 3M6VA 4DV5F 1RCOB 4ECTA 1QSYA 3R1LA 3HM9A 1FWPA 3UWTA 3FBBA 1MSWD 1GMWD 2Q6BA 2ZOGA 2B4UA 2VA2A 1IVZA 3NY0A 2EC2A 3TZZA 4ZPWR 2DGVA 1P1TA 3QZ7A 1NH7A 4P7VA 4X62J 3RBZA 2C3MA 2C22A 1I5OB 2KZZA 3MPUB 2YH0A 3K89A 4YEAA 4OV6A 3EGNA 1S9GA 1L3UA 1HARA 2P9CA 1FKAF 2MQMA 1YRTA 3T9ZA 4O3PA 1T9VA 1OPZA 3PTWA 1U8SA 1BXNA 1TKDA 4PG6A 1DQAA 4H4OB 2O67A 3TI0A 5M2PA 4X62F 4M95A 1N5YA 3G6XA 1NO8A 1VI7A 4CO5A 1GX6A 4DU8A 2VG6A 4DR4F 4OI2A 5DG8A 2AIRB 5KT3A 2HBYB 3BZQA 3O3LA 1C1CB 1TL1A 4LR7A 3D6MB 4M5IA 2EEYA 4ED6A 4U96A 1SIWB 5KT4A 3ONQA 4JI7J 1A9NB 2DGWA 3EXYA 3OVAA 3HKWA 4ID5B 3AD8C 3UD4P 2FZKB 3WC2A 4UT4A 1HNVA 3PYDA 3RW6A 2DGUA 2V50A 2FJBB 4JI7F 3W9IA 4HR2A 2GS8A 3BH6B 5L46A 3KXDA 3DHXA 2MGZB 4CO0A 2C2NA 2BKOA 3ETMA 1TKXB 3K8WA 2J6TA 3R2CJ 3NBPB 4LJMA 4RO0A 1EX8A 4H54A 1A0OB 1YJUA 5CCMA 3OR2B 1JLQA 2YKMA 4I4BA 4GRSA 4A8QA 2QX0A 2FIUA 2MZJA 4C8YA 5FIIA 1Y3JA 4OZLA 3OLAA 2ZHBA 4OX9J 2O5DA 5E3QA 5K14A 2G1DA 2XI3A 1ITPA 2OPSB 2CAJA 1R0AB 2KXNB 3MMAB 5C25B 1WEZA 2NYHA 4LF7J 4F7VA 2UVRA 3FFIA 2HS3A 3CUNA 3I55S 4NCAA 3HD2A 5IXUA 1HBOB 5J1EA 1WOSA 4IQXA 3KK2A 4YN3B 3PJWA 4LF7F 4EU0A 4DSLA 3NS5A 1IWAA 2ZH5A 1ELOA 2F4FA 2CPZA 4IOAQ 4GC6A 5KFJA 1B7FA 3QWUA 5E3AA 4H4MA 4I67A 3F73A 2F63A 4J37A 4ENOA 4ZPCA 2KFNA 2W1BA 2HFNA 1Q0NA 3KDNA 2JLFA 1X5SA 2NPIA 3B8HA 4TY8B 4UZCA 3ITHB 1JLAA 1RWMB 3IWLA 3GFYA 2M5YA 2KG0A 3SCKE 1Y11A 3I31A 4B3OB 1Q7LB 2W7AA 1UVKA 3AB4B 3LW5C 3H90A 3HFVA 2WZ1A 3BPSP 3JSBA 1TV6A 4WYLA 2VIHA 2AWZA 3IGVA 1RCXB 3V4IA 3HFZB 1L3TA 2P2CB 1N0UA 4MFBA 1XJWB 1WHVA 5KFVA 1RAFB 3MURP 1GMUA 4PXBA 2OLWA 1OYDA 2KHCA 2RUSA 1BE4A 4ZP8A 3QRPA 1D8ZA 1RHUB 2K2PA 4ELUA 1NPRA 2XZDB 3DKDA 1YVFA 2X1GA 1IKVA 4AL6A 2QT7A 3GV5B 3E3XA 4KRWA 1AFJA 2CJBA 3P5TL 1KQKA 4RUCA 1S6PA 5J2QB 2I8EA 3C2PA 4JV1A 4BC7A 4CYUB 3IM9A 3HHLD 2HFVA 7FDRA 2K7JA 3DXBA 4WXOA 1N6QB 1AW0A 5K8PA 1SQFA 1B0PA 1REVA 4MAKA 5CHCB 1T11A 2FD2A 2HHWA 1FT8A 4ECZA 2WK4A 1UFLA 4DFMA 3ZZZA 1LFPA 4C3MA 5KFNA 3CC7S 2SXLA 1VQ5S 1XAOA 5D0RA 3CSKA 3R5CA 2CQBA 3KUGA 3CCUS 2P5VA 4DR6J 1WF1A 3EDQB 4UUXA 2R7RA 1GMWA 1UCNA 5HATA 4PRFA 4OYOA 3I87A 1JXLA 5IWAF 2CJKA 2XO6A 2W4PA 1NSQA 4G1PA 1UP1A 3CJKB 3IG1A 5CQGA 3AD9C 4DR6F 2IVMA 4GKJJ 3IBWA 2VFUA 1KTQA 3DRRB 1LXJA 4DV1F 1EB0A 1KQGB 2BACA 5C2CA 3RRHA 4DL4A 3CMES 2FJWA 2MB0B 5F8LA 1RABB 2WW4A 5F8JA 3J80Y 1SC3B 1OJ4A 4F2RA 4A8SA 2X1FA 4GKJF 2F7VA 3DI6A 3LANA 2CQHA 1NKBA 1REGX 5L1KA 2L9NA 2IYGA 2CQPA 1PAUB 5FDLA 4FPIA 3CCTA 2IIHA 2J5AA 2HQ3A 4OYZA 3TQ1A 1SQGA 2ZUGA 1VHFA 1HBNB 4MYUA 4NE9C 4LBIA 5DDQC 4ZMMA 5CAAA 4MIAA 4FF2A 4K0KJ 1X4CA 3BH7B 1AA1B 4MIBA 3DRYA 3IA0A 3PW4A 1PO6A 4ZITA 3W66A 2DBBA 3W5ZA 1RUSA 2NS1B 3HO1A 3UVJB 1ZA1B 4Y2AA 2XYPB 3HULA 4DS5A 2VC1A 1N34J 1S6OA 2RHQB 2KYXA 2AGQA 4K0KF 1LW0A 2RQMA 2OFHX 1CEZA 5IFMA 3OHAA 2V6AA 3BQ0A 1SKRA 4BS2A 4Q0BB 4ILLA 4TU9A 5DJBA 1HQEA 1LFWA 3GZ7A 3I0SA 2BM0A 4IO9Q 2B9YA 3SDEB 1N34F 2Q2GA 3W62A 1NUEA 3MM9A 4F26A 4WF9Q 1DZ5A 2I5JA 5M2UA 1SC6A 2RS8A 3FEZA 3LP0B 4O3RA 2RDDA 4LR9A 1RHKB 2DNNA 3MMBA 5A8KB 8RUCA 2BBEA 3OL8A 4FF3A 1WC6A 1BQXA 3BDPA 3BDEA 4WTOB 1UZHA 2ZFHA 1D9AA 4KHRA 2MQNA
chains in the Genus database with same CATH topology
2Q2GA 3AGYA 4L3KA 1NLTA 3AGXA 1XAOA 3TJ8A 3TJAA 1GMWD 3TJ9A 3AGZA 3L9ZA 3NXZA 2B26A 1EARA 3I38A 1GMUA 2QLDA 3NY0A 4J80A 1GMWA 3LA0A 2HFVA 1GMVA 1C3GA 3LZ8A 1EB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2G A;  3AGY A;  4L3K A;  1NLT A;  3AGX A;  1XAO A;  3TJ8 A;  3TJA A;  1GMW D;  3TJ9 A;  3AGZ A;  3L9Z A;  3NXZ A;  2B26 A;  1EAR A;  3I38 A;  1GMU A;  2QLD A;  3NY0 A;  4J80 A;  1GMW A;  3LA0 A;  2HFV A;  1GMV A;  1C3G A;  3LZ8 A;  1EB0 A; 
#chains in the Genus database with same CATH topology
 2B0G A;  1TFW A;  4CLZ A;  2KZM A;  4YB7 A;  1UEK A;  2WVF A;  2PII A;  1YBU A;  1RT4 A;  3AKO B;  1FX4 A;  1LNQ A;  2OPQ B;  5A0Y A;  1SQE A;  4DSF A;  1RYS A;  2ZH4 A;  2WSC C;  3Q8P B;  1X0F A;  1S1V A;  2WBR A;  2VJV A;  4IRC A;  1LWE B;  1VQ8 S;  2XWY A;  3GP9 A;  2B7C B;  2JL9 A;  2EK1 A;  4N5S A;  4QWD A;  1RU1 A;  4ZIV A;  2MMY A;  1W25 A;  3OUY B;  1YWX A;  4JI4 J;  3WQP A;  4TXS A;  3SSQ A;  1F9E B;  2D74 B;  5HI7 A;  5LXY A;  4TQS A;  3CXC R;  2JC1 A;  2R42 A;  4TU8 A;  4MK9 A;  5CYM B;  4B9S A;  2HWH A;  3SV3 A;  1VBK A;  4J90 A;  4C48 A;  1OS5 A;  3NG8 A;  3T3F A;  3N5F A;  3V6D B;  4JI4 F;  1XIQ A;  3CJ4 A;  3ZTS A;  5IT0 A;  2ZHO A;  3T41 A;  4LFB F;  1HQ2 A;  2FQQ B;  2IDE A;  4HDG A;  5A8R B;  4LVO P;  4NI2 B;  3BSA A;  3NWG A;  3IR5 B;  4WFY A;  2FJD B;  1S6U A;  4OI6 A;  3F41 A;  5KFA A;  1S72 S;  2HRY A;  3CUL A;  1RAO A;  5L1J A;  2RB7 A;  4TN2 A;  2Y8Y A;  1N52 B;  3F0N A;  1SUQ A;  3CD6 S;  5KAK A;  3D0I E;  2EFG A;  3D4J A;  1N0V C;  2XY5 A;  4BCA A;  3D0G E;  2XLJ A;  2YWE A;  4C7Q A;  3PYG A;  3GJQ B;  4JI0 J;  3M2U A;  5F9N A;  2GMJ A;  4DG1 B;  1JLF A;  2PMH A;  2V8D A;  4B17 A;  3BBC A;  2YNF B;  4RBV A;  4NZ0 A;  2MZR A;  4WP9 A;  3OTB A;  2R7S A;  2OIH A;  4J91 A;  3K8V A;  1N48 A;  1JXE A;  4JI0 F;  1JLE B;  4NLS A;  1G3O A;  2A2C A;  2RNE A;  2GJF A;  2XNQ A;  3WHI A;  2WVE A;  2C2O B;  1PYT A;  3KLE A;  4OX6 A;  3Q8Q B;  4YOE A;  1S1W A;  2QO3 A;  1XMO F;  1RWU A;  1S1U A;  4J9O A;  3M1V A;  2KB2 A;  3HSG A;  4A46 A;  5E3P A;  4DWI A;  3QGI A;  5JVG Q;  1V9O A;  4DV6 J;  2EKN A;  4WJB A;  4IFY A;  2ZNZ A;  3FKB A;  4B9T A;  3ZTO A;  4Y2I A;  1U7L A;  3AJ1 A;  2AHO B;  2U1A A;  3TZW A;  3H2U B;  2AU0 A;  3CED A;  4DV6 F;  4AT1 B;  3L7P A;  1UVI A;  4R8U A;  2V4J A;  1ZPW X;  2R7U A;  5AXM A;  1EZZ B;  1KSP A;  3UPF A;  1S12 A;  5HK4 A;  1XR5 A;  4OHY A;  4DLG A;  5J1P A;  1QE1 A;  4MYT A;  4PPD A;  3CO0 P;  3HSD A;  4CM0 A;  1CQN A;  4A8K A;  4L3N A;  5KG1 A;  2XYH B;  3EMT A;  1K0T A;  4RU2 A;  3M9N B;  1XWL A;  2R7O A;  3MCO A;  4ECS A;  4JOU A;  2CPE A;  4ZS6 A;  3H0P A;  5D4O A;  3KK3 B;  3BYR A;  3D6F B;  2J6U A;  1CJK A;  1DUR A;  2NXU A;  2A2D A;  2DNM A;  2XS7 A;  1P8G A;  1VIX A;  1M5K C;  1VRT A;  1SL0 A;  1LKZ A;  3G86 A;  2AEJ A;  1NSP A;  4JBC A;  2G9O A;  5IQ6 A;  1RWW B;  5E7O B;  3CJ8 A;  3AXK A;  1VLY A;  2BJD A;  5L39 A;  4NA3 A;  2DHS A;  3C6E C;  3HX9 A;  5LMN F;  3MUM P;  3M8P B;  5KG3 A;  3UI3 A;  1F3F A;  2B9W A;  2HIQ A;  4NLU A;  3AAW B;  2CKW A;  5HP1 A;  1T03 B;  2AV5 A;  2ABY A;  4IOB A;  3M30 B;  3M8W A;  2ZVS A;  3OR1 B;  4LRA A;  4B3T J;  1GXU A;  3NCR A;  5E33 A;  1TL3 A;  1YKW A;  2N4D A;  3MAQ A;  1H72 C;  4GVB A;  3TAN A;  2Q3P A;  4E98 A;  2BAB A;  4PG5 A;  4HHH A;  2BJ3 A;  3HVT B;  3R5G A;  1WC3 A;  4B3T F;  3BQ2 A;  1S9F A;  1R0B G;  3PIP Q;  3G6Y A;  3VQT A;  4IFV B;  4PWW A;  2LP4 A;  1GX5 A;  1Q7Y T;  4C11 B;  4W98 A;  4RUA A;  2EG1 A;  2POK A;  2HBZ B;  2MLX A;  3NGU A;  5EX0 A;  1U2R A;  2BM1 A;  5AT1 B;  2HHS A;  5HQM A;  3MFH A;  3RAQ A;  3C19 A;  1JWW A;  3CCW A;  2W2N P;  3Q22 A;  2KU7 A;  1B3T A;  2CJ9 A;  1G6B A;  1RLD A;  3CTR A;  4ZPA A;  3FZB A;  1NDC A;  2HVE A;  3BJY A;  2NCK L;  3SCJ E;  1S0M A;  2ZOF A;  1PG5 B;  5HO4 A;  4F4Y A;  2GMH A;  3KLF B;  4O0I A;  4GO7 X;  2QTW A;  3VAK A;  5EWF A;  4N56 A;  2QSF A;  3GSD A;  3I5A A;  4D3G A;  4DBQ A;  2J7W A;  5EWG A;  5KFB A;  4FPR A;  5HRO B;  3KLH A;  1JJC B;  1R43 A;  1FNX H;  1TKT A;  3CD7 A;  4QU7 A;  1EIY B;  1T02 A;  2DXD A;  3HVW A;  5ETQ A;  3Q83 A;  2C2Z B;  1A6L A;  4XDD A;  3DLG B;  2CQ3 A;  5HVF A;  1N32 J;  2GC8 A;  1IKY A;  3CMA S;  3M8Z A;  1UVN A;  2CZ9 A;  3TVZ A;  3KLG B;  4A47 A;  1E6V B;  1PC4 A;  3EZO A;  5CD4 H;  1L5U A;  3T5K A;  2PO4 A;  2EVZ A;  3G8Q A;  1H98 A;  2VIC A;  1ZS6 A;  2RS2 A;  3L7U A;  2AJ0 A;  2BE2 A;  4FVM A;  3IM8 A;  3C14 A;  2VQF F;  4LSL A;  2JLE A;  2OTJ S;  1D09 B;  2VU5 A;  3EGV A;  4ICL A;  1VRU A;  5DGB A;  3HHL C;  4YQW A;  1ZYQ A;  4PUO B;  2DR6 A;  4NYO A;  2U2F A;  4XAK A;  3NGS A;  1OIA A;  2XHC A;  3HHK A;  1R0C B;  2VG5 B;  2ZKT A;  4WU3 A;  5LM7 E;  1WI8 A;  1CUL A;  2ASD A;  2CUY A;  3NOC A;  4KGX B;  5KFQ A;  2N7C A;  2CA9 A;  3K57 A;  2OD6 A;  4U67 Q;  2XTJ P;  2QA1 A;  4ZVQ B;  5ADZ A;  5KFX A;  2RT3 A;  3M2V A;  4P71 A;  3CO9 A;  1SH3 A;  5K8M A;  2DXE A;  1HQU B;  4UF4 A;  4HTI A;  3NGR A;  1MU2 B;  1VOM A;  1F2H A;  4RNM A;  1RT6 A;  4CLW A;  4F02 A;  4ZPB A;  3PHE A;  2VV5 A;  1SC4 B;  3G82 B;  3TAQ A;  5IT9 U;  3RR8 A;  3Q8S B;  2AF6 A;  2K3K A;  3NGD A;  1P9Y A;  1KEK A;  2MQP A;  1YJN S;  1QAI A;  4JI6 J;  1RWV B;  1R7I A;  2YKN B;  1FVS A;  3GSI A;  4ZP9 A;  3HHD A;  3QJP A;  4DUT A;  3R7B B;  2LVW A;  2JSX A;  1X4A A;  1GTE A;  2DNY A;  4RKU C;  3W63 A;  2QV6 A;  3ZZO A;  2RDJ A;  2HVZ A;  1LOU A;  4NOH A;  3TQE A;  3OSP A;  2WBM A;  1T9W A;  4QWC A;  3T6J A;  4QBU A;  1TEL A;  3GJR B;  2HGN A;  1WC1 A;  5ETR A;  4ECU A;  4NLV A;  3US5 A;  1NH8 A;  2GGP B;  3IWN C;  3FRY A;  1RQ0 A;  2MDA A;  2ZJP Q;  4WKY A;  1IKW A;  3KUE A;  1Q82 T;  2OJ3 A;  2OEJ A;  4FBT A;  4NCG A;  2E9T A;  4I7F B;  1MRO A;  3RRK A;  3CF5 Q;  2ZIT A;  3OJU A;  3LGH A;  1U1Q A;  3BSC A;  1Z1Z A;  2VPY B;  2E1A A;  3B6B A;  3UFC X;  4M5H A;  3CDB A;  2GNK A;  2COL A;  5JMN A;  2QLB B;  2B56 A;  2CQG A;  3RBD A;  4ED0 A;  2KVQ E;  1O5J A;  1JNR B;  3J7Y I;  3DLJ A;  3NWR A;  2DNH A;  3SYZ A;  5DZ6 A;  2VUG A;  4BLG A;  4EBE A;  4P2M A;  5I42 A;  4FS1 A;  3MM8 B;  2H9Z A;  1RTI B;  2QA4 S;  2XMJ A;  4M5L A;  3B78 A;  1X31 C;  2IMO A;  5BXI A;  3RB0 A;  3DLH A;  4OI3 A;  4AXI A;  3KHR A;  4AQY J;  4J9S A;  2DPI A;  3O44 A;  2NLW A;  2J6S A;  5F8G A;  2JH3 A;  1FWK A;  2N4C A;  2ZBI A;  1K1Q A;  3VAL A;  2BW2 A;  4AD6 A;  3I82 A;  3T1Y J;  1Q8K A;  4AQY F;  3ET6 A;  2AJ4 A;  3DRP B;  3HK2 A;  1KR4 A;  2VC0 A;  3ILJ A;  4MK8 A;  3M2R A;  2B4P A;  4UST A;  1S9G B;  1WF2 A;  3T1Y F;  3FGV A;  5ETL A;  1RA6 A;  4ZPV R;  1CQM A;  1W2I A;  1TMJ A;  1SL1 A;  4UOH A;  3B4D A;  4DL7 A;  2KDO A;  4ZOS A;  3KFW X;  3NAI A;  3IXQ A;  1N5Y B;  3DGP A;  4I6Y A;  4YDX A;  2E7V A;  1JX4 A;  2XS2 A;  4DUY F;  4A8O A;  2VG6 B;  2FY1 A;  3UN2 A;  5HQL A;  2FZG B;  1ZTW A;  5A8W A;  1TL1 B;  1UPP A;  4ZN3 A;  1MWZ A;  3A3O B;  5KOW A;  3GIR A;  1P6T A;  4ZVO B;  2PT0 A;  1ZZF A;  2I1R A;  2QA4 G;  1XMB A;  4FXD A;  9RUB A;  5BYR A;  4JUZ A;  1RTJ B;  3H20 A;  3I9V 9;  4J9K A;  2ZWO A;  1HNV B;  1VQY A;  1NBE B;  5GAE I;  2VPZ B;  4FXW A;  3DLE A;  1R8P A;  4IUF A;  2BKP A;  3TRG A;  2B51 A;  1X9S A;  5DDP C;  4DU7 A;  3CJS A;  5KFP A;  3OPK A;  4WFZ A;  1FJC A;  4X4V A;  1IWG A;  1BWV A;  1NHK L;  1JLQ B;  2YKM B;  1UJ6 A;  2V68 A;  2J0Q D;  2W01 A;  4K4S A;  4EK2 A;  3SZ2 A;  1S0N A;  2Y1I A;  3KMS A;  4USW A;  2JFK A;  1WG4 A;  3T1A A;  1VQN S;  1C0T A;  3ZTR A;  2FHJ D;  4DFP A;  2NXN A;  1Y7P A;  1T95 A;  3BB5 A;  2FGO A;  5C42 A;  4GKK J;  2KI2 A;  3RAM A;  5KG4 A;  3NMR A;  3UR3 C;  1HWU A;  3PZP A;  5A6P A;  3J7Z T;  4TLQ A;  4X4T A;  4QIG A;  2V5H G;  1JNZ B;  4IQM A;  3FFI B;  5JUM A;  2P6T A;  4ILR A;  4DOZ A;  2V67 A;  1JB0 C;  4GKK F;  4HLB A;  3G6E S;  2C3P A;  2QEX S;  3LQV A;  2GA7 A;  3R5D A;  1NRK A;  4KT0 C;  3OFE A;  5J1E B;  1VK8 A;  3BO2 A;  2EPI A;  3KK2 B;  1RAC B;  5KG6 A;  1WSV A;  5L1I A;  3UDC A;  5BR8 J;  2XB2 D;  4URG A;  2K7K A;  3DRX A;  4ZVT B;  4C98 A;  3QSY B;  3U1L A;  3DGV A;  3GII A;  4J9R A;  1U09 A;  4QPT A;  2B8P A;  3IBF B;  4B9V A;  1VQ4 S;  2HGL A;  1R89 A;  1M5V C;  2KM8 B;  5BR8 F;  2O3D A;  4CLY A;  4HDH A;  4EZ9 A;  4IR1 A;  2XMU A;  3H98 A;  1HL6 A;  2DHH A;  3H4D A;  2IM1 A;  1F9F A;  2R8K A;  3QAT A;  3VF0 B;  3BR9 A;  4EFA C;  4YME A;  3ZTP A;  5HLF B;  3M8R A;  4UQG A;  1WI6 A;  3SCI E;  1VCT A;  3EM1 A;  2N7Y A;  4O0N A;  4CIO A;  2BAN A;  3EVO A;  3VAI A;  3AJ2 A;  3GJT B;  4Q2L A;  1WDD A;  5E41 A;  3DOK A;  1KQF B;  1TKZ A;  3NLC A;  2W8K A;  1GH8 A;  3KK1 A;  1YJ7 A;  1GMV A;  1HMV A;  2DEI A;  4W90 B;  1TV6 B;  2BE9 B;  1RA7 A;  4X4Q A;  4MFB B;  1FA0 A;  3HKZ D;  2GHW A;  2FJX A;  4ZHR A;  1CS4 A;  3VQS A;  3KJV B;  4MIW A;  2BX6 A;  5KFO A;  1RT7 A;  1J5E J;  2R7W A;  1D9D A;  4RWW A;  2X3D A;  3J81 U;  1IKV B;  3P4U B;  1IN0 A;  1UAW A;  4Y65 A;  3R5J B;  3W5Y A;  1S6P B;  3QSI A;  2ASY A;  2B26 A;  2GML A;  3PM9 A;  4CLL A;  1VIO A;  2MHE A;  3CDU A;  2QFJ A;  2QLD A;  2MXY A;  2W25 A;  3G9C A;  4R25 A;  4OHZ A;  2E7X A;  3WZ0 A;  1HNX J;  4IR9 A;  4OI0 A;  1C0U A;  4WWS A;  3L95 X;  3E01 A;  4JB8 B;  2CNL B;  2OML A;  1REV B;  1X4H A;  2XUL A;  4OZ1 A;  4FN5 A;  3H25 A;  1TP7 A;  3JSR A;  4ATN A;  2FVR A;  5J2N A;  3AHP A;  2ODX A;  3QBC A;  4U6P A;  2VFV A;  3ISN D;  2BEF A;  3KMQ A;  1HNX F;  1VYA A;  4ZVS B;  3N28 A;  3DYA A;  3DDN A;  2D3U A;  4WBF A;  2MZ1 A;  3ZO7 A;  5KTQ A;  1F5C A;  4CTA A;  4KO0 A;  5L8R C;  1BGX T;  3NGK A;  3PRV A;  3EGW B;  4FYY B;  5F8M A;  1IBL J;  3TEH B;  4CLS A;  4W4M A;  3QLH A;  2RKI A;  1RZM A;  5JXS A;  3CD0 A;  3X3U A;  1DTQ A;  5KG7 A;  4CDI A;  2E5I A;  4TU7 A;  1VQ6 S;  1S1X A;  2HND A;  3MAA B;  3CW2 C;  1IBL F;  3CJQ A;  4CO4 A;  5KFY A;  3C5X C;  2X1B A;  2E1P A;  2PFD A;  5BYQ A;  3T5L A;  3QFW A;  1ZTT A;  4USU A;  2XI2 A;  2JFD A;  4HT7 A;  4RR5 A;  5AXK A;  5L9X A;  4KC5 A;  5FDL B;  2ACM A;  2L9D A;  3SSS A;  1U1N A;  4LF1 A;  1S7H A;  1IQT A;  2UXB F;  4ZPT R;  4IG0 A;  5KT5 A;  3AA9 A;  3ILO A;  3Q89 A;  4J9U E;  2DCU B;  1FWL A;  1N8R T;  2XG8 A;  3EPG A;  3HCX A;  1WDT A;  4F3M A;  4DV4 F;  3M7V A;  3PHT A;  2CPD A;  1YQH A;  5HAO A;  1NND A;  2OTL S;  4OX8 A;  2BJ1 A;  3FCV A;  3J7Y U;  1V5I B;  5MLC V;  2GW8 A;  1LWX A;  4OJ1 A;  3DM2 A;  1LW0 B;  4ZLL A;  4U8V A;  2KT3 A;  3PYF A;  1XTZ A;  2R2S A;  1HQE B;  4E2F B;  1RGV A;  4DX8 H;  3H2V E;  3OW2 R;  1Q4R A;  2AJQ A;  2FPH X;  3MM9 B;  3A8E A;  1AFI A;  2R7X A;  2I5J B;  4LF4 J;  1FRI A;  3IRW P;  2FHJ A;  4HVZ A;  4CWB A;  1SJ1 A;  3B4M A;  4DI6 A;  2E29 A;  3EPI A;  1E6Y A;  3LGN A;  1KTV A;  3LAL A;  4ECX A;  1DLO B;  5ETP A;  5CAB A;  4B02 A;  3K2Y A;  2W2Q P;  4LIR A;  1TL4 A;  2EFN A;  4S0M A;  1K1S A;  1D3W A;  2QIF A;  4EMD A;  4ZP7 A;  2G2O A;  1UA0 A;  4X64 J;  1N36 J;  2CNK B;  5EWE A;  4FF4 A;  1RT4 B;  4NLG A;  4KQZ A;  2CJA A;  2H1Y A;  2KTQ A;  1FFS B;  2MPU A;  3LO3 A;  1FNM A;  5B0G A;  1RJJ A;  3PCO B;  3LWL A;  2H65 B;  5A0Y B;  3V6J A;  1S1V B;  4DCJ B;  4P10 A;  2H48 B;  1N36 F;  4X64 F;  5AXN A;  3W60 A;  1ICE B;  2DGO A;  1S99 A;  2LEC A;  1MMN A;  4AL5 A;  2B4V A;  3EWG A;  2KT5 A;  1JK9 B;  4WFN Q;  2R3V A;  1NSA A;  4QIW D;  3N6L A;  3PX0 A;  2HVI A;  2LEB A;  2IM2 A;  3D68 A;  5GAE U;  3HZG A;  4C8N A;  4RUH A;  5KFW A;  4OYM A;  3MM5 A;  2BV3 A;  1G1X A;  2J9C A;  3L3C A;  2MQQ A;  3TUZ C;  3QMQ A;  3MI7 X;  4LRF A;  3JQK A;  1F60 B;  3CCV S;  2RQC A;  3CJR A;  3TZY A;  4RW6 A;  1B70 B;  3G6V A;  1PBU A;  1FES A;  1U1P A;  3EUN A;  3BEG B;  1UJ4 A;  4L3K A;  3O1L A;  2EC0 A;  1NAQ A;  1RK8 A;  2FHM A;  1JQG A;  1SUQ B;  4PAA A;  4USJ C;  5ETO A;  2UUT A;  4K2X A;  2E5L J;  3DDK A;  2MJN A;  1IJF B;  1XER A;  2GCF A;  2QYG A;  2PA8 D;  3MMC A;  5DQH A;  2QRR A;  4X4P A;  5CZX A;  2D1C A;  4ETX A;  2E5L F;  3FRZ A;  1XC9 A;  4J80 A;  1UW9 A;  3LPY A;  2A3J A;  2F8H A;  9ATC B;  1X9M A;  2ZBR A;  1TFY A;  3P8B B;  3PV8 A;  3BBF A;  3KJF B;  3THT A;  3KLE B;  4ZCL A;  4EI2 A;  3GR1 A;  1NK9 A;  4KHP J;  1S1U B;  3M1V B;  1WKJ A;  1X0P A;  4I2P A;  1QSL A;  4MKB A;  3RBX A;  3QID A;  3I5B A;  4GO5 X;  1O8B A;  1RI7 A;  2VD3 A;  2W7O A;  3AD7 C;  4M94 A;  4KSE B;  4IFY B;  2KFZ A;  1AUD A;  4EYI B;  4O44 A;  3ZXW A;  2CG4 A;  4WE1 A;  3F44 A;  3BGU A;  3C66 A;  4OJ3 A;  5KFT A;  2DNO A;  1CJV A;  2VA3 A;  1GFW B;  4WZQ A;  1HHS A;  3GTY X;  5RUB A;  1TU0 B;  4QR0 A;  2D3O R;  1GXT A;  4M5N A;  2QLJ B;  2P9G A;  4R8U B;  4RX6 A;  2QLX A;  3V81 A;  3MM6 A;  5FD1 A;  3ILL A;  4IKA A;  3FEX B;  3KHG A;  2CQC A;  4QWE A;  1QE1 B;  2F65 A;  4ED1 A;  2F9J A;  2ZHA A;  4KGM A;  2YWF A;  4IH5 A;  4RU9 A;  4NLO A;  2J8A A;  1UVL A;  5KFE A;  4J9V A;  3KOA A;  3HHE A;  1RT2 B;  2I9S A;  2EK6 A;  5C2G A;  3L9Z A;  2CPY A;  1HIY A;  3ZNU A;  2JHE A;  3AOD A;  2B9E A;  1CJK B;  2F8E X;  3ZTQ A;  3UDL A;  1ZM9 A;  4YR3 A;  2DRD A;  4JV0 A;  3TWZ A;  5B7W A;  1YGY A;  4URQ U;  1VRT B;  2LQ5 A;  3U02 A;  1SV5 A;  3G2X A;  1SIZ A;  4ID8 A;  4JV2 A;  5IT9 Y;  2DIV A;  2B6A A;  2VAS A;  4O3N A;  4RNH A;  1TTH B;  1RB0 A;  3R5A A;  2HHX A;  4M5D A;  3H42 A;  2X1A A;  4PR6 A;  3CE8 A;  1FK9 A;  2YWG A;  3MWB A;  4P6Q A;  4ZDN A;  5ETV A;  2IAJ A;  3VR1 A;  4KGV B;  4LRE A;  3IAM 9;  2GFF A;  1ZH5 A;  2ZC3 A;  5HP1 B;  4C8O A;  2IFX A;  3R27 A;  4O23 A;  5T14 A;  4K4T A;  1J5O A;  1H2V Z;  1TL5 A;  5HJX A;  2E1R A;  2BJ8 A;  4BDP A;  2CVE A;  2BE7 D;  1TL3 B;  2BOP A;  5DG7 A;  3EZ5 A;  3S7R A;  2WTF A;  4GVB B;  1O0P A;  3MUV P;  2LKZ A;  2W4C A;  4LF2 A;  4HTJ A;  3SCL E;  1U0H A;  4DZ6 A;  1Q16 B;  3RR7 A;  4K4U A;  2MZS A;  2V34 A;  5KFM A;  3V5R A;  3MPY A;  2OGU A;  2DNQ A;  1QUP A;  4HYK A;  4H4O A;  3ZZR A;  2QMX A;  4DPT A;  2VBW A;  3HXM A;  2YWW A;  4RW4 A;  4OYW A;  2CQ4 A;  1VLO A;  4J9L A;  4CCH A;  2YQ1 A;  2OHD A;  2DHA A;  1FE4 A;  2AEM A;  4ZPD A;  5HQ8 A;  1CVJ A;  3N5B A;  2HW3 A;  1WHX A;  2ZZT A;  1CJT A;  5K5M A;  3MR3 A;  3BPD A;  5HBM A;  2XO7 A;  3HLU A;  5G0R A;  4Z7Y A;  2IHR 1;  3D66 A;  2EBG A;  2UXC J;  4A8W A;  2MST A;  1VQL S;  3I6P A;  2B5J A;  4DX6 A;  2XMV A;  4R5P B;  1WOR A;  3CJ2 A;  2M8H A;  2V2Q A;  2OEM A;  2C42 A;  4KFB A;  5LSL A;  4HEA 9;  2Z56 B;  4AXJ A;  1RTD A;  4Q7A A;  3GIJ A;  1IKY B;  2HVD A;  2AZ3 A;  2UXC F;  1U24 A;  1UMJ A;  3CB4 A;  1TKX A;  1N5Q A;  4HH0 A;  5LOQ A;  1UWB A;  4P2S A;  2DGS A;  2HSE B;  1U47 A;  3MTJ A;  3GCX P;  4PWD A;  4M5K A;  1RXO B;  2D41 A;  1VJW A;  2LQJ A;  3TA1 A;  1N88 A;  3C6U A;  7AT1 B;  2E9Z A;  2KL8 A;  3I4H X;  2EI5 A;  4RWX A;  4LSL B;  3T9N A;  3BM7 A;  4USM A;  4F04 B;  3D5M A;  4TYB A;  4ICL B;  1VRU B;  2I6W A;  2CJQ A;  2BQU A;  2XHW A;  3WIV A;  4L74 A;  2HRU A;  4JV5 J;  2IYI A;  4L76 A;  1WOP A;  3U7J A;  4YFU A;  4F4A A;  4DR7 J;  2CXE A;  1CSJ A;  4DX5 A;  3MM7 A;  4U7U K;  4DQS A;  3DMJ A;  1FVQ A;  2HHT A;  2PSZ A;  5B08 A;  2FYX A;  3ISN C;  3TAP A;  1MMD A;  2H3E B;  3MCM A;  3MR7 A;  5F0W A;  1NJZ A;  2CZ4 A;  3DOM A;  1PCA A;  1SKS A;  1HBO A;  4JV5 F;  4OYP A;  2HHP A;  2FVC A;  4DR7 F;  3A4T A;  2P6S A;  1FDN A;  1U8W A;  1S6Q B;  4IOC Q;  4DL2 A;  2ZH7 A;  3R5B A;  1RT6 B;  2A0F B;  3PKY A;  1FXR A;  4PQU A;  4B9U A;  2MY7 A;  2XSF A;  3H7H B;  4K8R A;  2QJ3 A;  2DR7 A;  4HAC B;  2XLK A;  1SJR A;  1YZ7 A;  3OLB A;  4LF9 J;  4RW8 A;  3OTC A;  2NPF A;  3W64 A;  5DGA A;  4PXE A;  4IDK A;  5IM0 A;  2DGQ A;  3MOJ B;  1NK4 A;  4U9R A;  3GCW P;  3UR0 A;  2UV8 G;  4ZLJ A;  4I2Q A;  2HHV A;  2L48 A;  2AGP A;  1X4F A;  1Q1K A;  5J2P A;  4TY8 A;  2HLT A;  4WPA A;  3TUP A;  3FQK A;  2A6O A;  3AGY A;  5T41 A;  2HPU A;  4B3O A;  1CG2 A;  2MHN A;  4USH A;  1PIL A;  4F4X A;  4K4Z A;  1RWN B;  1NHU A;  2Y1J A;  1WJ9 A;  4EWT A;  1UET A;  3FC9 A;  2AT1 B;  4ZJL A;  5DRK A;  1XR7 A;  1IKW B;  2CPJ A;  2ZM6 J;  1RYR A;  4N8N A;  2BRL A;  5ETT A;  3OVS A;  4CH0 S;  4NCG B;  1R27 B;  2DXF A;  1WOO A;  3C16 A;  3IAS 9;  1R6Y A;  2I0X A;  2LQ8 A;  4G3I A;  2WB4 A;  4NL5 A;  2ZM6 F;  3P5B P;  3QJJ A;  2NUU G;  3CJ3 A;  3T5J A;  4OMF G;  3I38 A;  4TLR A;  2E5H A;  5HMY A;  2PD1 A;  4O3O A;  2ASL A;  1ZAX A;  3Q23 A;  5A2Q U;  3AJD A;  1FRH A;  1TVR A;  5M2R A;  2IC3 A;  2HRT A;  3SMZ A;  1RDR A;  1SJ3 P;  3C15 A;  4C8L A;  1Q53 A;  5I42 B;  4DR4 J;  5L9N A;  4QIE A;  2MKH A;  2QLW A;  4X2B A;  4Y0F A;  2LEP A;  5CA5 A;  2F3J A;  1SH2 A;  2C3Y A;  4M1K A;  1K44 A;  3CCJ S;  1NZ8 A;  5GAD U;  4NXM J;  2APO A;  3GG0 A;  1V5V A;  3MGJ A;  4WU2 A;  4IH7 A;  1N5V A;  3MEC A;  3CJ0 A;  1IBM F;  1WD6 A;  2JZ8 A;  5IS2 A;  2ADC A;  1LWC A;  4KYZ A;  3UW1 A;  4HH1 A;  5JJB A;  3LP2 A;  5D15 A;  1NEE A;  4MKY A;  2VJU A;  3QYY A;  1DAX A;  2L9W A;  3ET6 B;  1IUJ A;  3Q2T C;  4TQR A;  4NXM F;  3PW2 A;  5DLF A;  1OO0 B;  3SV4 A;  3ELH A;  3CGI A;  1RT5 B;  5BYS A;  4MKV A;  5DG9 A;  1KLM A;  1WTF A;  2RQ4 A;  2WW8 A;  3R2D J;  2QL5 B;  2HWT A;  3U1M A;  1U26 A;  2UUC F;  2Z2Y B;  1X4E A;  3J81 Y;  3IR7 B;  3UNG C;  5D0E A;  4CNY A;  2R7T A;  1HI1 A;  2J76 E;  4H4K A;  1RBL A;  4LQ3 A;  3R6G B;  3QT5 A;  2JDJ A;  1EP4 A;  2GO8 A;  3FCW A;  2WAQ D;  1OPI A;  1W26 A;  3DGP B;  3M32 A;  3KLV A;  2K06 A;  1VQ9 S;  3N79 A;  2CRL A;  5A8W B;  2YNG A;  1NLK L;  1OSD A;  1RAG B;  4OZ3 A;  3A8J A;  1HWL A;  1Q79 A;  4V19 X;  2VHG A;  1JJH A;  2EKY A;  2ZKU A;  2YNH A;  4NZ6 A;  1KON A;  2JC0 A;  3NS6 A;  3AOC A;  2V4Q A;  2ROE A;  3D6H B;  1I51 B;  5D78 A;  1FKP A;  3DFE A;  1VQS A;  3DLE B;  3GV8 B;  3N6N A;  2UP1 A;  2MEW A;  2YQ3 A;  2GQC A;  2LLZ A;  4QJV A;  7FD1 A;  1C1B A;  2HNZ A;  3BR8 A;  3V6H A;  3PW5 A;  3EIC A;  1D9F A;  2PI4 A;  1Y00 A;  4LF8 J;  1Q95 G;  2EG2 A;  3CCR S;  2F4V F;  3P45 B;  2XLI A;  2FVS A;  1RBO B;  2L08 A;  2J7U A;  1C0T B;  3A3N B;  3GIM A;  4UZB A;  3UD3 P;  1NKE A;  1URR A;  2G2Z A;  2ZE2 A;  1Y9O A;  5D6G A;  3EXC X;  4PZV A;  1F5B A;  2ZH6 A;  5C42 B;  4LF8 F;  2GVZ A;  4W92 B;  4KAI A;  2W9B B;  2N3L A;  1UFW A;  4DPW A;  2HFO A;  3BN7 A;  2GIR A;  3OL7 A;  2PE8 A;  3ULH A;  3MDF A;  1DY3 A;  4DV7 J;  4Y2M A;  3OHB A;  3DU5 A;  3P49 B;  3QRR A;  4JI5 J;  2HQG A;  1XEZ A;  3PO5 A;  2BMB A;  3W7B A;  4RLE A;  4N8O A;  2RD5 C;  5CH7 B;  5LJ5 Y;  4DV7 F;  3A8K A;  4I68 A;  3MED A;  1Y5L B;  2NRE A;  4X66 F;  2L3M A;  1EAY C;  4JI5 F;  4MJK A;  1H74 A;  3VWS A;  2H5J B;  3CIM A;  1HBM A;  2DY9 A;  3W2W B;  1QDU B;  2Y0S D;  3QAE A;  1NKC A;  4N47 A;  4F0K A;  3VGV A;  3JTN A;  3AXM A;  2R8J A;  2CG8 A;  1M90 T;  1B0T A;  2F40 A;  4KH1 B;  1I1G A;  3RAX A;  3V6K A;  4EYH B;  4LBH A;  3FMW A;  4NLQ A;  1WKK A;  2G13 A;  4U95 A;  1FTR A;  1GNK A;  4ES1 A;  2BAN B;  3GU0 A;  3TW0 A;  2B8Q A;  3TJA A;  3DOK B;  2WON A;  2A10 A;  3CC2 S;  1TKZ B;  2A18 A;  4UY8 T;  3VCD A;  4NZ7 A;  3KK1 B;  4ZKA A;  4HHU A;  1HMV B;  3W2V B;  1YJR A;  1JLG A;  4LSZ B;  3NCP A;  1NK5 A;  1YIT S;  1S4F A;  2HKE A;  4DN9 A;  1LV5 A;  3NRB A;  1WC5 A;  5H9E K;  4ZHR B;  1CS4 B;  5IWA J;  3UDE A;  2N82 B;  2RU3 A;  1T8E A;  1ZOT A;  4ERD A;  3SFU A;  2MLZ A;  4NLY A;  1KOO A;  1RT7 B;  2Z2Z A;  4B3M J;  3AQO A;  3KHH A;  4ETZ A;  2BDP A;  3PX6 A;  3F56 A;  4ZK7 M;  1S0V A;  1SBR A;  4QWA A;  4DV1 J;  1X9W A;  1L3S A;  1S49 A;  1CC8 A;  1IR0 A;  4NMX A;  2AGO A;  1Q8L A;  4OV1 A;  2V2V A;  1WAC A;  4B3M F;  3NP5 A;  3D2W A;  2EW9 A;  2DO0 A;  4J9P A;  1LXN A;  2VQE F;  4X4R A;  4P72 A;  1C0U B;  3E01 B;  1FRX A;  1S10 A;  3POT A;  4LT6 A;  1H2T Z;  1IM4 A;  4Q5V A;  1BLU A;  3AY0 A;  3VGS A;  2YKP A;  1S97 A;  3J7A 1;  5J2N B;  1KVJ A;  1GTH A;  1TUG B;  1LK5 A;  1U1R A;  4OJG A;  4KY3 A;  3DYA B;  4LIW A;  4K4Y A;  3VVT A;  4H4K C;  1K73 T;  2MKI A;  4WFA Q;  3OV7 A;  3S8S A;  4CTA B;  4KO0 B;  3L09 A;  3D1O A;  1ZAW A;  1T05 B;  3QAU A;  4YR0 A;  2R4F A;  2HBR B;  2KT2 A;  1SH0 A;  2VKR A;  2YX7 A;  1R8H A;  1Y3K A;  2RKI B;  1FNO A;  2A1B A;  4B3R F;  1DTQ B;  4USV A;  2JEI A;  1N5S A;  3TNV A;  2HND B;  3DHW C;  4Z37 A;  1NM2 A;  1WHY A;  3MD1 A;  3KLI A;  3I0R A;  4DPO A;  3T6B A;  2XGP A;  2ACY A;  2NSB A;  2D3O 1;  4QCL A;  3TX0 A;  1U1K A;  2HWI A;  4OHW A;  1Q5Y A;  1D0E A;  1OQ6 A;  3MD3 A;  2P8I A;  2ATC B;  3JB9 k;  4IG0 B;  4KGZ B;  4C0H A;  4QPX A;  2RSQ A;  4DV3 J;  1V3Z A;  4OI1 A;  1KC8 T;  2XNR A;  4F50 A;  2BKN A;  4DV3 F;  3DM2 B;  1VS3 A;  3TVK A;  2KM8 C;  2W9C A;  1RT1 A;  2KYZ A;  1U48 A;  5CD4 A;  2VG7 A;  5C7P A;  4M5G A;  1SKU B;  3CD5 A;  3OL9 A;  3AOB A;  3GFZ A;  5IV4 A;  4EO8 A;  1NK6 A;  2XZT B;  5GVQ A;  1RAJ A;  3G87 A;  3KUH A;  3VAH A;  3E8O A;  2IPO B;  3SQG A;  5D4N A;  3RZA A;  2OSQ A;  4DV0 J;  2DJW A;  3OR1 A;  1M1K T;  3MOZ A;  4G65 A;  3PDN A;  1RAH B;  1HHQ A;  4BHQ A;  4Z7C A;  5LJ3 Y;  3SXL A;  4FDF A;  3SSR A;  4IG3 A;  1U25 A;  1PIE A;  1NK8 A;  4DV0 F;  3FCH A;  1R8A A;  2IA6 A;  5H9F K;  2YH1 A;  5KFS A;  2KG1 A;  1TK5 A;  4ED7 A;  2IVF B;  4DJB A;  4LFB J;  1NDL A;  3VHQ A;  3QT6 A;  3QT7 A;  3PRD A;  4V1A k;  4FKX A;  1T3O A;  5B09 A;  4EUV A;  1ZBT A;  8ATC B;  2DIU A;  3QO9 A;  3VGT A;  2DHX A;  1L3K A;  5B0D A;  1S9E A;  1U45 A;  2DIS A;  1JXV A;  1CPZ A;  3MXH P;  1U2F A;  1YTY A;  3A13 A;  1TZ0 A;  1NPK A;  3MPV A;  3CJ5 A;  2GO9 A;  2HUR A;  2DGX A;  1YG0 A;  2NQP A;  3NNH A;  4Y3C A;  4P73 A;  1KBR A;  3TO8 A;  1M5S A;  4YHH J;  1H3D A;  4NLT A;  5HVG A;  4XPC A;  1HA1 A;  3RTV A;  2W4D A;  1XMO J;  1S5Z A;  4WP8 A;  2AD9 A;  2ERR A;  3EE3 A;  2XSJ A;  3MM5 B;  4U8Y A;  4FYW B;  2WVC A;  1VBZ A;  3FSY A;  2IMW P;  3AT1 B;  1YJT A;  2IA0 A;  3B54 A;  2J0X A;  4YHH F;  1HNI B;  1EET A;  2BQ3 A;  3UDV A;  1E6V A;  2BW7 A;  4RW6 B;  4DL6 A;  2OPR B;  1FTC A;  2YNI A;  4NWB A;  2HHU A;  2G1H A;  4DUZ J;  1S1T A;  3KTQ A;  5H1S V;  5CYQ B;  4LRC A;  4DQQ A;  3PJ9 A;  1YBT A;  4YY3 J;  2MY8 A;  3H2L A;  2OEK A;  4DUZ F;  1NZA A;  2FHK A;  3BGR A;  4PUO A;  4WII A;  1X4B A;  4NRU A;  3MMC B;  1YK9 A;  1JLB A;  4YY3 F;  1C4C A;  4A48 A;  3KHL A;  1YIJ S;  5J1N A;  4F8R A;  4F67 A;  1IR1 A;  4I64 A;  2CWK A;  3R7N B;  3H4B A;  3GPA A;  1I94 J;  4OYB A;  1CJU A;  1XNR J;  1HQU A;  3OL6 A;  4I2P B;  1YX2 A;  2DK2 A;  1FER A;  1NME B;  1R6V A;  1NB7 A;  3G82 A;  4O44 B;  1I94 F;  3B82 A;  2RRA A;  4WE1 B;  4O3S A;  1XNR F;  3KG1 A;  1SKW A;  2NXC A;  1CJV B;  2DTJ A;  2IJN A;  1QLN A;  2V4R A;  2AX1 A;  4RNO A;  4ZVG A;  1VBX A;  1JKH A;  1PYO B;  1WWH A;  4MMO A;  4G1Q A;  5LMN J;  2BJ9 A;  1U0S A;  3V81 B;  8AT1 B;  3MM6 B;  3OTO F;  2JNJ A;  4FF1 A;  3SQO P;  2Z30 B;  1S76 D;  2OI2 A;  1FFW B;  3JAM U;  2Z8Q A;  1IBK F;  3LAM A;  4CQ1 A;  1KD1 T;  2DPJ A;  3IO1 A;  1Y0H A;  4X4S A;  2JEG A;  2XWX A;  2VBY A;  1TL7 B;  3ZZT A;  3MCN A;  2AYM A;  4NLX A;  3UNY A;  1U1L A;  2C2E A;  3QQC D;  3WIU A;  3LWM A;  2IM0 A;  4MT1 A;  3OD2 A;  5ETK A;  3GON A;  5DO2 A;  3BKT A;  2R2U A;  3H8Y A;  3PR4 A;  3MEE B;  2ZEJ A;  1NK0 A;  2Z57 B;  4CO1 A;  2JLG A;  3PEH A;  3S1T A;  2LDI A;  3Q8V A;  2CQ0 A;  4ITS A;  2KH9 A;  2JVM A;  1YSJ A;  1SV5 B;  4RPF A;  1VDH A;  2GHP A;  3JS9 A;  4J9M A;  3DC2 A;  1VQM S;  2BXJ A;  2HFS A;  2B6A B;  1FJG J;  4Y34 A;  4J5O A;  1XNQ J;  4OQJ A;  1NJI T;  4M5D B;  1UEU A;  4RW9 A;  3K5M A;  1FK9 B;  2IRU A;  4WK1 A;  4ANE A;  2M0G B;  4ES2 A;  1YLX A;  1UL3 A;  4OIX A;  2IAJ B;  3IMQ J;  1YZ6 A;  5CXT A;  1SJQ A;  2CPF A;  4FNH A;  3M6W A;  2FLL A;  1FJG F;  1XNQ F;  4QYZ J;  2FLP A;  3ZFV A;  2GV1 A;  4HI1 A;  1J5O B;  4IRK A;  1KP6 A;  2ZBP A;  2XM3 A;  2M4M A;  4ZCK A;  3DLL Q;  1EQ0 A;  1RTH A;  2Y1R I;  4DHV A;  3UCU P;  3AGZ A;  2KVI A;  5EHH A;  2HK3 A;  3MTK A;  2ADB A;  2JRR A;  2DVI A;  3D1Q A;  5F9L A;  4WKR A;  4ECR A;  1I3O B;  1KOH A;  2RU9 A;  1U0H B;  3DRP A;  3DU6 A;  2R9L A;  1BQN A;  3BV8 A;  5HMX A;  1RHJ B;  2HQD A;  3R8Y A;  1DJ0 A;  2RAQ A;  3UO0 A;  3VGU A;  1M5H A;  3OFG A;  3RB3 A;  3J7A N;  4O4R A;  3LTO A;  3KJN B;  1GEH A;  2D7S A;  3A1Y G;  5A2Q Y;  3AGX A;  2VQF J;  3TJ8 A;  1B99 A;  5K20 B;  4KE5 A;  3HZE A;  2J0S D;  4RW4 B;  1WUU A;  5L38 A;  1QAY A;  4AYB D;  4KB7 A;  4YDD B;  3LP1 B;  4HKQ A;  2H5E A;  3HJV A;  2VB6 A;  1CJT B;  1WNE A;  2V2K A;  5HBM B;  4LFC J;  1TK8 A;  5G0R B;  5GAH I;  2FY8 A;  1RLC L;  1O6X A;  1RTJ A;  2B5J B;  3UD5 A;  4JI1 J;  4NLP A;  1RWO B;  2C2D A;  4KFB B;  2HMI A;  4P74 A;  2YBV A;  1Q78 A;  3QFH A;  4LFC F;  1RTD B;  1TUV A;  3C6T A;  4NRT A;  5LSR A;  5KFI A;  4U7U D;  3OSN A;  1FXD A;  4CO3 A;  3HVA A;  4I56 A;  3JYT B;  4CRJ A;  1UWB B;  4UW2 A;  5F0U A;  4JI1 F;  2LXI A;  4PWD B;  4FNI A;  3W1Y C;  2OAU A;  3C6U B;  1LW2 A;  3GIK A;  1Y5N B;  1OY9 A;  3PKM A;  2V9W A;  3EVW A;  4RUB A;  5C24 A;  4KH0 B;  4DL3 A;  1U49 A;  2PA3 A;  4DQI A;  1DQ8 A;  4Y2C A;  3TUI C;  4KJI A;  2KN4 A;  5D0H A;  1HPZ A;  4OX9 F;  1VQO S;  3MM7 B;  3AH6 A;  4TY9 A;  2EFP A;  3DCA A;  3DMJ B;  3W8P A;  1KFS A;  4ECW A;  2HK2 A;  4UQT A;  3CVK A;  2HS4 A;  3R9L A;  3DOM B;  2AP6 A;  2B7B B;  3CCL S;  2PN6 A;  2JVR A;  4DFJ A;  5K8O A;  3UN5 A;  2LU2 A;  4PQU B;  5AE2 A;  2IDL A;  4DF4 A;  1KHW A;  4KPC A;  2R7Q A;  2ASJ A;  4RW8 B;  3H5S A;  4IDK B;  3KYL A;  4ZVE A;  5IM0 B;  4EZ6 A;  3OTE A;  3W65 A;  2RF2 A;  2V2Z A;  2MKC A;  4I2Q B;  5KFF A;  2CDQ A;  2RRN A;  3W3S A;  2LYV A;  4I6W A;  1QAX A;  3DOL A;  5J2P B;  3HSJ A;  5HLF A;  2DIT A;  4N77 A;  4K4W A;  2V63 A;  2LA6 A;  4F4K A;  1XK8 A;  2Q66 A;  3RG6 A;  5DDR C;  3TAR A;  1D8Y A;  2LEA A;  1Y10 A;  5E0O A;  3FK4 A;  4ED4 A;  2YPZ A;  4URS A;  2WOM B;  1YJ9 S;  1M1G A;  4I6A A;  2E5G A;  3HT0 A;  2K8G A;  4DPY A;  2E1C A;  3D28 A;  2XMW A;  4KKO B;  3BN4 A;  3I4P A;  3C16 B;  3T5H A;  2HAF A;  3KJV A;  4DF8 A;  4K50 A;  3PRB A;  1X5O A;  4PWU A;  1NSK L;  3NNA A;  1HBU A;  2XQC A;  1X5P A;  1RSC A;  1QY7 A;  5MAO A;  1FRJ A;  3PAC A;  3QPI A;  2MKK A;  3JTO A;  4RBU A;  1TVR B;  2IC3 B;  2R8I A;  4KPY A;  3EX7 B;  1VMB A;  5HN0 A;  2HVH A;  1VR6 A;  4CP5 A;  3C15 B;  4DUY J;  4BWJ A;  5BJR A;  3LUY A;  3ENQ A;  1U1O A;  2YWH A;  5D3G A;  1T9U A;  3NCQ A;  2BUN A;  2GIF A;  2IJF A;  1ZPV A;  3MCS A;  2ZDP A;  2XGQ A;  5B0E A;  1HFE L;  3K5O A;  4G1I A;  1YRU A;  5KFU A;  3PXG a;  4OHV A;  4QU6 A;  2IRY A;  2DRA A;  2AZ1 A;  4KTQ A;  3UCZ P;  4OJH A;  3MEC B;  1SI9 A;  3OT9 A;  3HI9 A;  1LWC B;  3JTP A;  2UV8 A;  3LP2 B;  5T7L A;  3CIZ A;  4CT9 A;  3ENA A;  2CZV C;  4QYZ K;  1RAE B;  4MK7 A;  2V8H A;  2O66 A;  1M1H A;  1NJY A;  4OI4 A;  3G8T A;  2X7I A;  1FEH A;  3I32 A;  2OEL A;  4X65 J;  5KT6 A;  4DPU A;  1GAO A;  1KLM B;  4OZ2 A;  4GMK A;  2HQC A;  4U7C A;  5IC6 B;  1UWA A;  2B43 A;  2GQQ A;  2XC9 A;  1NHV A;  4DSI A;  5JVH Q;  3ZZP A;  4PKD B;  5E3R A;  1BC6 A;  5KFR A;  1DBD A;  3MAA A;  4X65 F;  5DQG A;  1EP4 B;  1VBY A;  1T0T V;  5GMK a;  2LA4 A;  2EFO A;  3M32 B;  4UUW A;  1SVD A;  3LAK A;  4YP3 A;  2KXH A;  4OZN A;  3BSN A;  1S7I A;  4YR2 A;  4J9Q A;  2YNG B;  4NML A;  2YVS A;  1X4D A;  3IGN A;  2H51 B;  1SXL A;  5K14 B;  1WF0 A;  3L4B C;  1X60 A;  1APS A;  2YKO A;  1HD1 A;  1YJW S;  3VV2 B;  2YNH B;  2E9R X;  4CLP A;  3MHY A;  2UUB J;  1C2P A;  1FKP B;  1JLC A;  2ZH9 A;  4B9M A;  4NLW A;  3OBI A;  2VH7 A;  4ELT A;  1C1B B;  3IS9 A;  4B3S J;  2UUB F;  3ENW A;  2RUG A;  2HNZ B;  3UN3 A;  1FI4 A;  1K0V A;  4K4V A;  3T1H J;  4WP3 A;  2FLN A;  1XBW A;  1T9Y A;  3O8W A;  5D4P A;  2AQ4 A;  3TZX A;  2QSW A;  4YB6 A;  1BHN A;  4B3S F;  1PJ6 A;  2HZA A;  3GFH A;  2VOO A;  3HT3 A;  1MWY A;  4H4M B;  2VFR A;  2ZE2 B;  4C4W A;  3R6L B;  4WYW A;  3D3C J;  3G71 S;  3T1H F;  2GVZ B;  2Q79 A;  2FJA B;  2M88 A;  3BS9 A;  4Y00 A;  3TOQ A;  1DLO A;  2UVU A;  1OWX A;  1JLA B;  5EGY A;  3UE2 A;  2NSC A;  3DLK A;  3M8Y A;  3GB0 A;  1FXL A;  2YWK A;  2CNN B;  3BGO P;  1U2C A;  5B0A A;  4DR3 J;  3RBE A;  1HWI A;  1RT3 A;  4G6V B;  2Y9H A;  3IFE A;  2HAI A;  2H4Y B;  2BYC A;  2N3O A;  2R2T A;  4QZV B;  4YS2 A;  4JP8 A;  3MED B;  1KKH A;  1EHW A;  4N7T A;  1FE0 A;  4UOF A;  2AW0 A;  3CPW R;  3V4I B;  2IJR A;  1LQ9 A;  4DR3 F;  1OYE A;  1HBM B;  1WG1 A;  4IO1 A;  4KIA A;  3O2I A;  4F2S A;  1SL2 A;  3JXO A;  1TUW A;  3PJX A;  5DDO C;  2DH9 A;  3GJS B;  4FS2 A;  5AXL A;  4CM2 A;  4DN0 A;  4ER8 A;  1QSS A;  2I2Y A;  1K8A T;  3ZC4 A;  1TMM A;  1Z2Z A;  3PW0 A;  1HNZ J;  2DR9 A;  3GLJ A;  2BZ2 A;  2C2R A;  4P7T A;  5GAH U;  3HHN B;  5IZH A;  1SB6 A;  3I5C A;  4LSN A;  1UFK A;  2J9D E;  2PDA A;  3PFE A;  2WON B;  2ZWP A;  1AZS A;  3HSZ A;  4L73 A;  2BVZ A;  5D4L A;  4DSE A;  1HNZ F;  1S59 A;  3M9M B;  2J9D A;  1IKX A;  1UJ5 A;  1FRK A;  3CCQ S;  2MKJ A;  2AMC B;  4XK8 C;  4FKY A;  1JLG B;  5A6W A;  3R97 A;  3EJM A;  4ZVH A;  3E2E A;  5ETM A;  4LR8 A;  1EQM A;  3NMA A;  3AQP A;  3OXF A;  4BWM A;  3L7O A;  3Q8R B;  3QJL A;  1FKO A;  2HYI B;  1EAR A;  4QIV A;  2VON A;  1PBA A;  2ZVI A;  3GWC A;  3W9H A;  5IV3 A;  2YX4 A;  2OPP A;  3IG1 B;  3CDE A;  5B0F A;  1HYS A;  2CQ1 A;  4XO0 A;  4QR2 A;  2ALZ A;  2HHQ A;  1OY8 A;  2WVB A;  4K5S A;  3HHL A;  2EBE A;  3JSY A;  1M5P C;  2B3T B;  3FMB A;  1BQM A;  4UOC A;  3POT B;  1YJV A;  2RJZ A;  3DI6 B;  2UXB J;  3M8Q A;  2WHO A;  4V19 J;  3ZZY A;  5G4D A;  3ZNJ 1;  2BRK A;  4R0J A;  1IR2 A;  3MEG A;  4TVA B;  2LDY A;  1W7W A;  3D0H E;  2R7V A;  3HDS A;  4DV4 J;  2FGC A;  5FLX U;  2GHV C;  3OVB A;  1FDA A;  4OZ5 A;  3EGZ A;  1HWK A;  5HJY A;  1T9X A;  4R0E A;  3GG1 A;  2MKS A;  4RW7 A;  5DQI A;  2BJE A;  1XN9 A;  2ILY A;  2FZC B;  2NUH A;  3QGH A;  2K3I A;  5SUH A;  5GMD A;  4DL5 A;  2E7W A;  2CJX B;  1F6T A;  3TP2 A;  1PGZ A;  2FTR A;  1J2V A;  4QR1 A;  3KLI B;  5F3T A;  2GZO A;  3I0R B;  3I0S B;  4M8L A;  4I1T A;  5LMU J;  1RT2 A;  3PY8 A;  3DNC A;  3EVM A;  3H5U A;  4NAS A;  1NDK A;  1QAJ A;  3T19 A;  3ILI A;  3DDI A;  5KFL A;  1CLF A;  1C3G A;  3H5Y A;  5LMU F;  1BUX A;  2VKZ G;  3TAM A;  2QZ8 A;  5I3P A;  4CNZ A;  2P9E A;  4P9S A;  1NJX A;  2G0J A;  3MMB B;  4KV8 A;  4FYX B;  3P96 A;  5SZT A;  2MJU A;  1VFJ A;  2BA9 A;  2HZC A;  4OHX A;  3IRX A;  1ACM B;  3TEG A;  4F3Q A;  1SJ4 P;  1UA1 A;  3FBE A;  4QIF A;  4QQB A;  4LF6 J;  2Y0B B;  4XTT A;  1S57 A;  2W9C B;  1ZM4 A;  1RT1 B;  4PYD A;  2Z58 B;  1L3V A;  4A8M P;  5I3Q A;  2VG7 B;  3TR5 A;  4NA1 A;  3PG9 A;  3J7Z 5;  4C0B A;  1G4C A;  3JSM A;  4CLF A;  3QZ8 A;  3JAM Y;  2LQB A;  4LF6 F;  1HI8 A;  4JI3 J;  1N5T A;  3SQG B;  2GIQ A;  5HMW A;  5DS7 A;  1KDN A;  3OQ2 A;  4A4J A;  5LSO A;  1QJH A;  2GVD A;  1AT1 B;  1KS2 A;  1HD0 A;  1JIH A;  4KBI A;  3QIP A;  3KKF A;  4F25 A;  1DFD A;  2IBO A;  4JI3 F;  1WC0 A;  3Q8Y A;  4IG3 B;  2V8G A;  3BYP A;  5I3U A;  2CJY B;  6FD1 A;  3JQM A;  3THP A;  2XCA A;  3Q24 A;  1UW4 A;  2W8L A;  1VC0 A;  1H6K X;  3PFO A;  1F2G A;  4M5M A;  3QO9 B;  4OYX A;  1KVI A;  3GYN A;  3DRS A;  2M52 A;  3W61 A;  2LU1 A;  1KNZ A;  1NB2 A;  1S9E B;  3GFX A;  4ECV A;  3CCM S;  5DM7 Q;  4F0H A;  2KJW A;  3Q2S C;  2VL1 A;  3G96 A;  1LWF A;  2F9D A;  4C3K A;  4C6A A;  4WFB Q;  2WVD A;  3ISZ A;  3SBM A;  4NLR A;  2UUW A;  2VDI A;  1WEY A;  2LXU A;  2MQL A;  3M2U B;  4FVC A;  1BY9 A;  4NEY A;  1JLF B;  1RIS A;  1WHW A;  3N9U C;  3BSO A;  3K0J A;  5F8I A;  4R5P A;  3NKY A;  2XSJ B;  4PCQ A;  2BQR A;  3NNC A;  4ZVP B;  2KKH A;  3D6T B;  4K2J A;  2DKO B;  3RJM B;  2V0N A;  1S79 A;  3Q0A A;  2GQ2 A;  1EET B;  2W2O P;  2DNR A;  2FVQ A;  1N4L A;  3N01 A;  2MKY A;  4CI0 B;  1S1W B;  4O4G A;  2YNI B;  4ZVF A;  3I56 S;  1F0X A;  1S1T B;  3CT9 A;  3TX8 A;  4IRD A;  2XMT A;  2HNY A;  2DR5 A;  1N32 F;  4N76 A;  1QM9 A;  1QVG R;  5KFK A;  3RRG A;  3V4M A;  3UCG A;  3W9J A;  1B4S A;  2PC6 A;  4EO6 A;  4TYA A;  4ZA1 A;  1U4B A;  4BBY A;  2DO4 A;  4Q2M A;  1TAU A;  3BGR B;  1PKU A;  2OMO A;  3MAH A;  2Q1L A;  2CPX A;  3PNI A;  3BO4 A;  3FEY B;  5HSP A;  4LF5 J;  1JJ4 A;  1JLB B;  1FD2 A;  5B0B A;  1HHT P;  2V4J B;  1VQ7 S;  1FO1 A;  1NU4 A;  4OLO A;  4OYA A;  2ZH8 A;  3HVR A;  2JEF A;  3AB2 B;  3R3T A;  4QYR A;  5AJ3 J;  1WKL A;  4LF5 F;  2XEX A;  1FRL A;  5IOL A;  4FP9 A;  1CJU B;  4A8F A;  1S6Q A;  3H59 A;  4P2F A;  2DY1 A;  4TKT A;  3C46 A;  3N0V A;  5DLG A;  4P52 A;  1TAQ A;  1UPM B;  2G0I A;  4HAC A;  5EN1 A;  2DNK A;  5AJ3 F;  4K4X A;  4CT8 A;  2F8M A;  4ZLP A;  1WSR A;  1FJE B;  2J8S A;  4EBC A;  4DFK A;  3O6Q A;  2W7P A;  2K1R A;  1JKH B;  4WIQ A;  1DTT A;  2KRB A;  2FHO B;  1MNE A;  4G1Q B;  2ZC4 A;  3FJ2 A;  4USK A;  4HT5 A;  1MML A;  3MPW A;  4F0M A;  2RIJ A;  4JI6 F;  3GQC A;  2M7S A;  1OMS A;  2EFV A;  4E8U A;  2QC3 A;  1AYE A;  2AKW B;  1HR0 J;  2ZH3 A;  2FLO A;  2LMI A;  2Z4P A;  2PFF B;  4LBP A;  2MQO A;  5J2M A;  3A3P B;  2DNG A;  3NOG A;  1UEV A;  2J9E A;  5FJ4 A;  2R2R A;  2WSF C;  2E44 A;  1HR0 F;  5LL6 d;  2BJ7 A;  1V3R A;  2M3D A;  2AX0 A;  1VQK S;  4NLD A;  3LA0 A;  1KVK A;  2PEB A;  2ZD1 A;  1JJ2 R;  3QGG A;  3VAJ A;  4JYA J;  3OFF A;  4LVN P;  2FJE B;  4HL9 A;  1PC5 A;  1IJE B;  1CBK A;  2OP5 A;  2JX2 A;  1WG5 A;  5HL7 Q;  1LK7 A;  2LQ9 A;  4ED2 A;  1ROF A;  2CQI A;  1KFD A;  2XYG B;  4RW9 B;  1RBA A;  2HS0 A;  3TUJ C;  2L41 A;  4JYA F;  1W2B R;  3I96 A;  5B0C A;  1OSC A;  2IY5 B;  3HMJ G;  5U47 A;  1YHQ S;  1BMQ B;  4K5R A;  2RHS B;  2JZ5 A;  4OYI A;  1Y4Z B;  4Y2K A;  2GJ2 A;  4LRD A;  2M70 A;  4LMZ A;  1UKU A;  1XR6 A;  1JMT A;  1U6B A;  3KG0 A;  4I69 A;  4NPO A;  1FJ7 A;  1C1C A;  2CDR B;  1RTH B;  4ECQ A;  1ARO P;  4QOT A;  4DS4 A;  2HG4 A;  3GIL A;  4LRB A;  4PG7 A;  4C3L A;  3SEO A;  3KLH B;  4XPE A;  2DH7 A;  4DQR A;  3IP0 A;  1TKT B;  3MF5 A;  1BQN B;  4ID5 A;  1RT5 A;  2PGC A;  2FC9 A;  2PMW A;  2XMK A;  4KR0 B;  4CLK A;  1C4A A;  2MQ8 A;  2WCX A;  3OJS A;  4Q44 A;  5KFD A;  4DX7 A;  4WK3 A;  1I6J A;  2MGZ A;  3IBC B;  1N54 B;  4CZC A;  3FSX A;  3NBP A;  2D9O A;  1HLW A;  2Z2L A;  3BO3 A;  3FNN A;  4N41 A;  3OR2 A;  4Q8F A;  1RU2 A;  4DL0 C;  4QW9 A;  5GAG I;  1HW8 A;  2BE2 B;  2BOA A;  5I4M A;  4USI A;  3C14 B;  1IM6 A;  3EDR B;  5KOX A;  2EWH A;  3CCZ A;  3NS7 B;  3NEK A;  4MH8 A;  1NDP A;  2OPS A;  3AOA A;  4PXC A;  2CWX A;  1R0A A;  3MMA A;  2DEJ A;  3O5T B;  5C25 A;  3R1H A;  1N33 J;  1TQL A;  1CUL B;  5DET A;  2DRB A;  2PEH A;  2RVJ A;  2HMI B;  3C6T B;  1AUS L;  4KHM A;  3M2V B;  1P1L A;  4NX9 A;  1KN6 A;  2ZJQ Q;  1N33 F;  4UTG A;  3VAM A;  1MN9 A;  3OXL A;  3EYZ A;  3M6U A;  1PJ7 A;  1H7W A;  2YKQ A;  1MWQ A;  4MKA A;  1LW2 B;  2DT9 A;  4FYD A;  4RBT A;  4PG8 A;  1KWM A;  2V69 A;  3HFK A;  1K47 A;  2OFG X;  2VOP A;  4CH1 A;  3HP6 A;  2F5G A;  2M8D B;  3RU0 A;  5C24 B;  4F3O A;  4GVL A;  4Z2X A;  2ZH1 A;  1RWK B;  4DDF A;  1Z4U A;  2W9B A;  2BR0 A;  4RZR A;  1RKJ A;  3CCS S;  1NK7 A;  1HPZ B;  1TK0 A;  3ITH A;  4DEZ A;  1DQ9 A;  2D3Z A;  2VFT A;  1PJ5 A;  3BKF A;  5E5N A;  5H9E J;  2C1E B;  4OX7 A;  2J0W A;  4B9L A;  1GK8 A;  5IC4 B;  2NXE A;  4PPZ A;  2Y8W A;  4E0D A;  1H7X A;  3VZH A;  2MZT A;  1QTM A;  1Y5I B;  2RE1 A;  3D67 A;  1A7G E;  1O51 A;  4FBU A;  1WEL A;  4JI2 J;  3UQS A;  4XDC A;  3W2W A;  1MRO B;  4AL7 A;  1IQZ A;  4O3Q A;  2XMA A;  2RF2 B;  4ZN1 A;  3MR5 A;  3FBC A;  4K59 A;  2GX8 A;  2VPX B;  4JI2 F;  3DOL B;  4AE5 A;  4F36 A;  1F5A A;  3R7S B;  2JVO A;  3TYT A;  5J2Q A;  2AYE A;  1H0H B;  2XMM A;  2XY7 A;  4EBD A;  1RAD B;  5IT4 A;  5KFZ A;  1RAI B;  4AFF A;  4B08 A;  3M9O B;  2ZBC A;  3TVY A;  1FDD A;  4CYU A;  2X3G A;  4QW8 A;  4DSJ A;  2ILZ A;  2G2Y A;  5EX3 A;  2ZH2 A;  2CQ2 A;  4IH6 A;  1VQP S;  1RHR B;  2JEJ A;  5F41 A;  1IBM J;  4YB5 A;  5KG0 A;  4OLP A;  1UVM A;  3W2V A;  3LOU A;  1N6Q A;  1UZD A;  5L1L A;  1Z2L A;  2CNO B;  2HQF A;  1PSD A;  5CZV A;  1WC4 A;  1IBC B;  4DZD A;  4PYA A;  5AE3 A;  4ED8 A;  2HZV A;  3K5L A;  5CCL A;  2FC8 A;  3H40 A;  1HBU B;  1FD8 A;  2XY6 A;  3CNQ P;  2RRB A;  1NPP A;  3BQ1 A;  2UUC J;  3Q8U A;  3QWP A;  4HHJ A;  1F9H A;  4ALZ A;  3DLB A;  2CAD A;  2CQD A;  3IC1 A;  4JI8 J;  3CJK A;  1ZA2 B;  3M2R B;  2DNP A;  3M8S A;  1J5E F;  1QD1 A;  3M6X A;  2QL9 B;  2KO1 A;  2C2M B;  3QNW B;  3DRR A;  4ED3 A;  4A8X A;  5F8H A;  2D69 A;  4C8Z A;  4DSK A;  1R8B A;  4ZCI A;  5THW A;  4JI8 F;  5KFC A;  5D3G B;  1Q86 T;  3GYG A;  3ENV A;  2DR8 A;  2VZ9 A;  2YKA A;  3AFG A;  5LXR A;  2MTL A;  2ZNY A;  3MPD A;  2VBX A;  1RKI A;  1VC6 A;  5T7L B;  3DXS X;  2FJV A;  2ROP A;  4FYV B;  2UZA A;  3BF4 A;  4NA2 A;  3K58 A;  1HBN A;  1VIS A;  2HFZ A;  3LZ8 A;  3FUY A;  1T05 A;  2DB1 A;  3OTD A;  3MFI A;  2YY3 A;  1OY6 A;  1OQ3 A;  1HNW J;  3MR2 A;  1UVJ A;  1S77 D;  4ZJQ A;  3E51 A;  3UVJ A;  2NZC A;  1P9Q C;  2F4V J;  3PVX A;  4YB1 P;  4X4N A;  3FSI A;  2UU9 J;  2R8G A;  3KWM A;  4CH7 A;  2ZJR Q;  3RUB L;  1KLN A;  4Q0B A;  1HNW F;  2Z0G A;  5AE1 A;  2VF3 A;  2QE5 A;  2V8V A;  4UOG A;  2M2B A;  3SDE A;  2LFV A;  2UU9 F;  1FF2 A;  2HGM A;  4OZ0 A;  1AB8 A;  2KFY A;  2MYF A;  5H9F J;  3VVU A;  3LP0 A;  2FVP A;  3GYX B;  2FB0 A;  3QT8 A;  4DR2 J;  4BC9 A;  2ZUA A;  3M05 A;  2CYY A;  3K17 A;  5A8K A;  4XIU A;  1QUV A;  3NAH A;  5KFG A;  1JLC B;  5HVH A;  3G8S A;  3RB6 A;  1RHM B;  2ZZN A;  3BGL A;  4DR2 F;  5FLX Y;  5GME A;  4X66 J;  3IS9 B;  3G4S S;  3CDA A;  1PAE X;  3LPE A;  2FUG 9;  4DCP B;  1WEX A;  2UVW A;  2OPQ A;  4C8K A;  2DNZ A;  4DV2 J;  1T9T A;  3SFG A;  2JOQ A;  4NCB A;  3FVY A;  2O01 C;  1ZAV A;  5E2Q A;  4ZJO A;  3KJQ B;  4C0O C;  1ZM3 A;  5K9F A;  1LWE A;  3D9B A;  1SPB P;  2W2M P;  2HBQ B;  3K59 A;  3GE9 A;  3HF5 A;  2AJ2 A;  4DMZ A;  4DV2 F;  5KT7 A;  5HMZ A;  3JQJ A;  1DAR A;  2GAG C;  4LF4 F;  3OUY A;  4Q45 A;  2E1M C;  1HI0 P;  4ZVR B;  2C3O A;  3DLK B;  2HHH J;  2E66 A;  3EZU A;  2WSE C;  4FXV A;  3IN5 A;  2VDH A;  3GMG A;  5D77 A;  3S01 A;  1RTZ A;  2WB1 D;  4WZM A;  3PR5 B;  2IRX A;  3K5N A;  5CYM A;  5D0G A;  3U27 A;  2QYC A;  2RDI A;  1RT3 B;  2V94 A;  4Q8E A;  3K5P A;  1K9M T;  3V6D A;  2DYA A;  2V9K A;  3LH2 S;  2HHH F;  1QTN B;  3VAF A;  2ZDO A;  1MLA A;  4C9D A;  1D1U A;  4B9N A;  2NZ4 A;  5A8R A;  4NI2 A;  2CVI A;  2YQ0 A;  4EEY A;  1EJ7 L;  1Q81 T;  4PAB A;  5GAG U;  3CCE S;  1MN7 A;  2QLF B;  5DZ7 A;  2OD4 A;  4X4O A;  1VC5 A;  3OXG A;  4LQ9 A;  4RJV A;  5D8H B;  3RGI A;  1M5O C;  4LUB A;  3MUT P;  4GC7 A;  2VQE J;  3J80 U;  4NYZ A;  4DG1 A;  3N4W A;  4LSN B;  3SIP B;  1VHI A;  2I38 A;  1AZS B;  2AYG A;  1YBA A;  2YNF A;  4TNO A;  4ECY A;  1FX2 A;  2HIY A;  1IKX B;  2VPW B;  2VFS A;  2Y1L B;  3KDO A;  1GT8 A;  1JLE A;  2OSR A;  4I0W A;  1TR0 A;  2KXF A;  5EUH A;  1HNI A;  3PIO Q;  3D1H A;  1U02 A;  2KHD A;  5CYJ A;  3RYL A;  1P27 B;  2OPR A;  1RWX B;  6AT1 B;  2M9K A;  3D3B J;  1Q8I A;  5KG2 A;  2LCW A;  3PW7 A;  2JWN A;  2VOD A;  3WX4 A;  2PMZ D;  1PYS B;  5KFH A;  1H73 A;  1H38 A;  5CYQ A;  3C3L A;  2RQK A;  4L6V 3;  3W8G A;  1RE1 B;  2NXJ A;  2NR0 A;  3P6Y C;  1NJW A;  1V3S A;  4NXN J;  1FKO B;  1RP5 A;  1FCA A;  4ZCM A;  4B3R J;  1SJF A;  1F3V A;  3MEK A;  2ZOM A;  1FEE A;  2QMW A;  3HPO A;  1ZZN A;  3D7S B;  3CC4 S;  3WC0 A;  2OPP B;  2C3U A;  4KGK A;  1HYS B;  1MW7 A;  2H4W B;  4NXN F;  3QLH B;  3PEJ A;  5KT2 A;  2KJV A;  3Q86 A;  3RB4 A;  1YI2 S;  1B64 A;  2PI5 A;  2RH3 A;  3CMQ A;  2G4B A;  1VJQ A;  2AEF A;  1S1X B;  3HHL B;  2DHG A;  1FFG B;  2EXU A;  1BQM B;  3NGT A;  2HQI A;  1HWJ A;  4FZV A;  2AJF E;  4CLT A;  2NYI A;  2YXL A;  1U1M A;  3M8Q B;  2XS5 A;  5GAD I;  3CDW A;  3IR6 B;  4CLU A;  3MR6 A;  3MEG B;  4PQA A;  2VBZ A;  3V2U C;  2UUA J;  2W24 A;  3W5X A;  5IQQ A;  3KK3 A;  2RML A;  1XMQ J;  4ZP6 A;  4KHP F;  3QGP A;  4ILM A;  1X8D A;  3CWJ A;  3HD1 A;  4RNF A;  2Y3Y A;  4CO2 A;  1EKS A;  4WTY A;  2O1P A;  2UUA F;  4RW7 B;  1U6Z A;  4Q43 A;  2A6M A;  1Q5V A;  1XMQ F;  2HLU A;  1ZET A;  4PXD A;  4DR5 J;  4LFA J;  1GXL A;  4ED5 A;  2W2P P;  1QVF R;  1CC7 A;  5ITH A;  1S4E A;  3VAG A;  3BBB A;  5A76 A;  1Q8B A;  4QWB A;  2JJ4 D;  4NEZ A;  2DD8 S;  3AA8 A;  1BD6 A;  3ICL A;  3M8P A;  4DR5 F;  4LFA F;  4C2M A;  4WCE Q;  1TL7 A;  4DPX A;  2QN6 B;  2QFI A;  1RAA B;  3FQL A;  1T03 A;  2ZZM A;  5F8N A;  1URN A;  2AYB A;  3M30 A;  3MEE A;  1KQS R;  2QGF B;  4P2X A;  1RHQ B;  1WTB A;  2IBK A;  4DCO B;  4C8M A;  3TAM B;  3I9Z A;  2ALY B;  1E6Y B;  5K8N A;  4KV8 B;  2DNL A;  2IVY A;  2QL7 B;  5F3Z A;  3CJT A;  3HVT A;  2QA2 A;  4OL8 A;  1J27 A;  2LXF A;  3IRX B;  2XCP A;  4P75 A;  3TA0 A;  3GR0 A;  4IFV A;  1LEO A;  4C11 A;  5C5J A;  2H5I B;  2Q6C A;  5EDW A;  5E3C A;  1HW9 A;  2W9A A;  4F4W A;  3JSM B;  3N6M A;  2Z2M A;  3FDS A;  1X7V A;  3DN9 A;  3SI8 A;  3C8Y A;  4F4Z A;  2YTC A;  4ES3 A;  2V8P A;  3P3D A;  2B9X A;  3PYE A;  2H54 B;  1T94 A;  2DCL A;  2GVD B;  4WXW A;  3KLF A;  1EKR A;  1R3N A;  1R8C A;  4OFZ A;  2YPY A;  1V6H A;  2WRM A;  2CIM A;  2IM3 A;  3QIP B;  1KHV A;  2UXD J;  1NCL A;  2YX1 A;  2OKQ A;  3WBZ A;  1F1B B;  5HRO A;  5I3U B;  2B4O A;  4ZVU B;  1FDB A;  2OH2 A;  1NLT A;  4A8Y A;  3OFH A;  2OUG A;  1G7C B;  2FDN A;  3KNA A;  3ADA C;  6FDR A;  4MTP A;  3DLG A;  1SC1 B;  2UXD F;  1GQE A;  5LT5 A;  4OZJ A;  2QG9 B;  4EGL A;  4WFX A;  1S48 A;  3THV A;  3KLG A;  3DRS B;  4ZIW A;  1X5T A;  1NXI A;  3NXZ A;  2ZBQ A;  4ELV A;  3FZ2 A;  2CFX A;  2MSS A;  3VZI A;  2C28 A;  2G0C A;  4YUD A;  1LWF B;  3PO4 A;  2EFQ A;  4L72 B;  3QRQ A;  3H5X A;  3A12 A;  4DXL A;  3D54 A;  4UY8 5;  3LP1 A;  3HJF A;  2HEK A;  1UTA A;  1VRQ C;  4PG4 A;  2CPI A;  4DQP A;  4DLE A;  2XZW A;  5HAN A;  2J7K A;  2C2K B;  2VG5 A;  3KNG A;  1X4G A;  2OO4 A;  2X51 A;  4L75 A;  1DHM A;  4ZLN A;  3BRE A;  1B0V A;  3LF0 A;  1YRX A;  1MG7 A;  1FHT A;  2KRR A;  5ETN A;  1S0O A;  2MLY A;  2HFU A;  3JYT A;  4O4G B;  1KRP A;  1MU2 A;  3BKU A;  3ZZU A;  4DR1 J;  2Q43 A;  2GJI A;  2HNY B;  2GAH C;  1FRM A;  1IXK A;  4AUK A;  4J9N A;  1VGY A;  3M4X A;  3OTO J;  3BGF A;  3GV7 B;  2JRS A;  2YKN A;  3U1N A;  1IBK J;  4DR1 F;  3LGM A;  4ANC A;  1ULR A;  2DGT A;  1T7P A;  2ROG A;  3X1L B;  4AND A;  1G2E A;  1R31 A;  3K7R A;  2DH8 A;  2XBP A;  4K7Q A;  3RW7 A;  1RWP B;  4RNN A;  2RIL A;  1AXQ A;  3WDO A;  1ZM2 A;  3PX4 A;  5KG5 A;  3IWX A;  3WX8 A;  4X4U A;  4IYQ A;  1YDL A;  2GGP A;  2AJ1 A;  5DM6 Q;  1H2U X;  4Y6I A;  1B7Y B;  2ATL A;  2F1F A;  5ETS A;  4NYP A;  4I7F A;  3VTI A;  3KG4 A;  1M0S A;  3ETO A;  1HKA A;  3TA2 A;  2K1R B;  1DTT B;  2R8H A;  4LF9 F;  1T3N A;  3NL0 A;  4PEO A;  4Y28 C;  3FBF A;  2D9P A;  4X84 A;  1BWE A;  3MMJ A;  4HI2 A;  1U6F A;  3S6E A;  1VK3 A;  3TJ9 A;  4J7C A;  2QMU B;  1XQI A;  1N56 A;  4M63 A;  3MM8 A;  4D3H A;  4DV5 J;  2E5J A;  1RTI A;  2WOM A;  5J2M B;  3ZZ0 A;  3A8I A;  1SCJ B;  2MZQ A;  3MZI A;  4C97 A;  4RL1 A;  4KKO A;  3J81 j;  1DRZ A;  4M5J A;  2CPH A;  2ZD1 B;  2UVV A;  3M6V A;  4DV5 F;  1RCO B;  4ECT A;  1QSY A;  3R1L A;  3HM9 A;  1FWP A;  3UWT A;  3FBB A;  1MSW D;  1GMW D;  2Q6B A;  2ZOG A;  2B4U A;  2VA2 A;  1IVZ A;  3NY0 A;  2EC2 A;  3TZZ A;  4ZPW R;  2DGV A;  1P1T A;  3QZ7 A;  1NH7 A;  4P7V A;  4X62 J;  3RBZ A;  2C3M A;  2C22 A;  1I5O B;  2KZZ A;  3MPU B;  2YH0 A;  3K89 A;  4YEA A;  4OV6 A;  3EGN A;  1S9G A;  1L3U A;  1HAR A;  2P9C A;  1FKA F;  2MQM A;  1YRT A;  3T9Z A;  4O3P A;  1T9V A;  1OPZ A;  3PTW A;  1U8S A;  1BXN A;  1TKD A;  4PG6 A;  1DQA A;  4H4O B;  2O67 A;  3TI0 A;  5M2P A;  4X62 F;  4M95 A;  1N5Y A;  3G6X A;  1NO8 A;  1VI7 A;  4CO5 A;  1GX6 A;  4DU8 A;  2VG6 A;  4DR4 F;  4OI2 A;  5DG8 A;  2AIR B;  5KT3 A;  2HBY B;  3BZQ A;  3O3L A;  1C1C B;  1TL1 A;  4LR7 A;  3D6M B;  4M5I A;  2EEY A;  4ED6 A;  4U96 A;  1SIW B;  5KT4 A;  3ONQ A;  4JI7 J;  1A9N B;  2DGW A;  3EXY A;  3OVA A;  3HKW A;  4ID5 B;  3AD8 C;  3UD4 P;  2FZK B;  3WC2 A;  4UT4 A;  1HNV A;  3PYD A;  3RW6 A;  2DGU A;  2V50 A;  2FJB B;  4JI7 F;  3W9I A;  4HR2 A;  2GS8 A;  3BH6 B;  5L46 A;  3KXD A;  3DHX A;  2MGZ B;  4CO0 A;  2C2N A;  2BKO A;  3ETM A;  1TKX B;  3K8W A;  2J6T A;  3R2C J;  3NBP B;  4LJM A;  4RO0 A;  1EX8 A;  4H54 A;  1A0O B;  1YJU A;  5CCM A;  3OR2 B;  1JLQ A;  2YKM A;  4I4B A;  4GRS A;  4A8Q A;  2QX0 A;  2FIU A;  2MZJ A;  4C8Y A;  5FII A;  1Y3J A;  4OZL A;  3OLA A;  2ZHB A;  4OX9 J;  2O5D A;  5E3Q A;  5K14 A;  2G1D A;  2XI3 A;  1ITP A;  2OPS B;  2CAJ A;  1R0A B;  2KXN B;  3MMA B;  5C25 B;  1WEZ A;  2NYH A;  4LF7 J;  4F7V A;  2UVR A;  3FFI A;  2HS3 A;  3CUN A;  3I55 S;  4NCA A;  3HD2 A;  5IXU A;  1HBO B;  5J1E A;  1WOS A;  4IQX A;  3KK2 A;  4YN3 B;  3PJW A;  4LF7 F;  4EU0 A;  4DSL A;  3NS5 A;  1IWA A;  2ZH5 A;  1ELO A;  2F4F A;  2CPZ A;  4IOA Q;  4GC6 A;  5KFJ A;  1B7F A;  3QWU A;  5E3A A;  4H4M A;  4I67 A;  3F73 A;  2F63 A;  4J37 A;  4ENO A;  4ZPC A;  2KFN A;  2W1B A;  2HFN A;  1Q0N A;  3KDN A;  2JLF A;  1X5S A;  2NPI A;  3B8H A;  4TY8 B;  4UZC A;  3ITH B;  1JLA A;  1RWM B;  3IWL A;  3GFY A;  2M5Y A;  2KG0 A;  3SCK E;  1Y11 A;  3I31 A;  4B3O B;  1Q7L B;  2W7A A;  1UVK A;  3AB4 B;  3LW5 C;  3H90 A;  3HFV A;  2WZ1 A;  3BPS P;  3JSB A;  1TV6 A;  4WYL A;  2VIH A;  2AWZ A;  3IGV A;  1RCX B;  3V4I A;  3HFZ B;  1L3T A;  2P2C B;  1N0U A;  4MFB A;  1XJW B;  1WHV A;  5KFV A;  1RAF B;  3MUR P;  1GMU A;  4PXB A;  2OLW A;  1OYD A;  2KHC A;  2RUS A;  1BE4 A;  4ZP8 A;  3QRP A;  1D8Z A;  1RHU B;  2K2P A;  4ELU A;  1NPR A;  2XZD B;  3DKD A;  1YVF A;  2X1G A;  1IKV A;  4AL6 A;  2QT7 A;  3GV5 B;  3E3X A;  4KRW A;  1AFJ A;  2CJB A;  3P5T L;  1KQK A;  4RUC A;  1S6P A;  5J2Q B;  2I8E A;  3C2P A;  4JV1 A;  4BC7 A;  4CYU B;  3IM9 A;  3HHL D;  2HFV A;  7FDR A;  2K7J A;  3DXB A;  4WXO A;  1N6Q B;  1AW0 A;  5K8P A;  1SQF A;  1B0P A;  1REV A;  4MAK A;  5CHC B;  1T11 A;  2FD2 A;  2HHW A;  1FT8 A;  4ECZ A;  2WK4 A;  1UFL A;  4DFM A;  3ZZZ A;  1LFP A;  4C3M A;  5KFN A;  3CC7 S;  2SXL A;  1VQ5 S;  1XAO A;  5D0R A;  3CSK A;  3R5C A;  2CQB A;  3KUG A;  3CCU S;  2P5V A;  4DR6 J;  1WF1 A;  3EDQ B;  4UUX A;  2R7R A;  1GMW A;  1UCN A;  5HAT A;  4PRF A;  4OYO A;  3I87 A;  1JXL A;  5IWA F;  2CJK A;  2XO6 A;  2W4P A;  1NSQ A;  4G1P A;  1UP1 A;  3CJK B;  3IG1 A;  5CQG A;  3AD9 C;  4DR6 F;  2IVM A;  4GKJ J;  3IBW A;  2VFU A;  1KTQ A;  3DRR B;  1LXJ A;  4DV1 F;  1EB0 A;  1KQG B;  2BAC A;  5C2C A;  3RRH A;  4DL4 A;  3CME S;  2FJW A;  2MB0 B;  5F8L A;  1RAB B;  2WW4 A;  5F8J A;  3J80 Y;  1SC3 B;  1OJ4 A;  4F2R A;  4A8S A;  2X1F A;  4GKJ F;  2F7V A;  3DI6 A;  3LAN A;  2CQH A;  1NKB A;  1REG X;  5L1K A;  2L9N A;  2IYG A;  2CQP A;  1PAU B;  5FDL A;  4FPI A;  3CCT A;  2IIH A;  2J5A A;  2HQ3 A;  4OYZ A;  3TQ1 A;  1SQG A;  2ZUG A;  1VHF A;  1HBN B;  4MYU A;  4NE9 C;  4LBI A;  5DDQ C;  4ZMM A;  5CAA A;  4MIA A;  4FF2 A;  4K0K J;  1X4C A;  3BH7 B;  1AA1 B;  4MIB A;  3DRY A;  3IA0 A;  3PW4 A;  1PO6 A;  4ZIT A;  3W66 A;  2DBB A;  3W5Z A;  1RUS A;  2NS1 B;  3HO1 A;  3UVJ B;  1ZA1 B;  4Y2A A;  2XYP B;  3HUL A;  4DS5 A;  2VC1 A;  1N34 J;  1S6O A;  2RHQ B;  2KYX A;  2AGQ A;  4K0K F;  1LW0 A;  2RQM A;  2OFH X;  1CEZ A;  5IFM A;  3OHA A;  2V6A A;  3BQ0 A;  1SKR A;  4BS2 A;  4Q0B B;  4ILL A;  4TU9 A;  5DJB A;  1HQE A;  1LFW A;  3GZ7 A;  3I0S A;  2BM0 A;  4IO9 Q;  2B9Y A;  3SDE B;  1N34 F;  2Q2G A;  3W62 A;  1NUE A;  3MM9 A;  4F26 A;  4WF9 Q;  1DZ5 A;  2I5J A;  5M2U A;  1SC6 A;  2RS8 A;  3FEZ A;  3LP0 B;  4O3R A;  2RDD A;  4LR9 A;  1RHK B;  2DNN A;  3MMB A;  5A8K B;  8RUC A;  2BBE A;  3OL8 A;  4FF3 A;  1WC6 A;  1BQX A;  3BDP A;  3BDE A;  4WTO B;  1UZH A;  2ZFH A;  1D9A A;  4KHR A;  2MQN A; 
#chains in the Genus database with same CATH homology
 2Q2G A;  3AGY A;  4L3K A;  1NLT A;  3AGX A;  1XAO A;  3TJ8 A;  3TJA A;  1GMW D;  3TJ9 A;  3AGZ A;  3L9Z A;  3NXZ A;  2B26 A;  1EAR A;  3I38 A;  1GMU A;  2QLD A;  3NY0 A;  4J80 A;  1GMW A;  3LA0 A;  2HFV A;  1GMV A;  1C3G A;  3LZ8 A;  1EB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...