1GMUA

Structure of uree
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
138
structure length
138
Chain Sequence
MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation.
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Metallochaperone
molecule keywords UREE
total genus 36
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmuA02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmuA01
2QLDA 3AGXA 3AGYA 1NLTA 1C3GA 3TJAA 1GMUA 3L9ZA 4J80A 3LA0A 3NXZA 3AGZA 3I38A 3TJ8A 3LZ8A 3TJ9A 2Q2GA 1EB0A 4L3KA 1GMWA 1XAOA 3NY0A 2B26A 1EARA 1GMWD 1GMVA 2HFVA
chains in the Genus database with same CATH superfamily
3VVUA 2X3DA 3KHRA 1I6JA 2APOA 2YPZA 2OFGX 4OZNA 3DRSB 3TJAA 4WFXA 4Y2KA 5K8PA 4PUOA 3GP9A 2L9DA 5DDOC 4EFAC 3KJVB 5LMNF 5DDPC 1I51B 4KGXB 2KRRA 2XCAA 1P6TA 3OR1B 1KVIA 1WDTA 4RU9A 1NK6A 3NCRA 1SH2A 2ZVIA 3D28A 3FDSA 1VJQA 2L41A 1RT7B 3VAFA 2IRXA 2CPJA 1KNZA 1U1MA 1EQ0A 1U26A 1XNRJ 4NXMF 3CJ4A 3HXMA 4JI3J 2XZWA 4QR2A 1K44A 3H8YA 5ETLA 1YTYA 4HKQA 3OFGA 3K5MA 3QLHB 4LBPA 2JFDA 3OUYA 3MEDB 3C6TA 1F5BA 2IDLA 3UNGC 4L3NA 1HPZB 2PD1A 4P9SA 4QIEA 1AXQA 4TU8A 3ENAA 2UVUA 4JV5J 2AEMA 1CJVB 5BR8J 4W92B 3AODA 2RRAA 1N32J 2J9EA 4DX8H 2KM8C 3NS7B 4X65J 1IJFB 2HNYA 2Y9HA 3C14B 1LW0A 1SJQA 2EI5A 3CJ2A 4KIAA 3GG0A 4ECZA 2YNHA 2XB2D 3KUGA 3IR5B 4USMA 3V81A 2M8HA 4DR4F 1NJZA 1JXEA 1VIOA 3OTBA 4MYTA 3B54A 4EO6A 4B3MJ 1AYEA 1F9EB 1SJRA 2BJ8A 4QR1A 2LECA 1NZ8A 1W7WA 2MZJA 3TZZA 1S99A 2WVDA 3ISZA 5G0RA 1FRLA 1YHQS 2RE1A 2QL7B 3MEGA 3EMTA 4DG1B 6AT1B 4P7VA 3KHLA 4B9VA 1ZZFA 3SYZA 2R42A 5G4DA 4X2BA 1TKZA 1FNXH 1U45A 4IG3A 1T02A 1REGX 1S7IA 2MXYA 4P2MA 4CDIA 1RTHB 3VQSA 2CVEA 4JI0J 2OEJA 2J5AA 2RKIA 1JLGB 5AT1B 2C28A 3MOJB 1TUGB 2B4PA 4G65A 2IYGA 2IC3A 4P75A 4CT9A 1GXLA 2DNKA 4Y2AA 2AJ4A 1HYSA 4V19X 2LYVA 3POTB 4IO1A 1X9WA 3F41A 3KLHA 1RAEB 1RU1A 2KVQE 3E01B 3M8ZA 3MCOA 4DL3A 2FHMA 3OQ2A 1Q0NA 1U02A 1Y0HA 1RTIB 1S1WB 3C16B 1QAYA 2OEKA 3K8VA 2RDJA 4FDFA 1YRXA 3M8PB 1S12A 2B6AB 1WC5A 2F7VA 2YVSA 3K2YA 1DTQA 4S0MA 1AROP 3RAMA 2IMOA 1HARA 4RW6B 4K0KF 1N36J 1TQLA 2QV6A 2WSCC 1FNOA 1RA7A 1YK9A 2ZEJA 1FEEA 3BH7B 4DUZF 1HI8A 3TANA 2Y1RI 1M5OC 4JI3F 4ED4A 1HWIA 1GXUA 2FDNA 1S4FA 3NKYA 3F73A 1HI1A 1VDHA 3SFGA 1WWHA 3W2WA 2IHR1 4WJBA 3HF5A 5THWA 4M5IA 4BWJA 5HLFB 4EEYA 1JJ4A 3QO9B 2Q66A 5AXKA 3JAMU 4ZN1A 3TZYA 1Q81T 4G3IA 3SFUA 1EP4B 1X5OA 2WONA 1Q82T 2NREA 1XIQA 4OX7A 1CULA 3AJ1A 3I32A 2R2TA 3HHNB 4RBUA 2ZH4A 2N4CA 3D5MA 2OP5A 2WRMA 2B4UA 2BUNA 2DY1A 4OI6A 5AXNA 4DSJA 2JZ5A 4DR3F 2BW7A 2VDIA 1ICEB 2BE7D 2V4JA 3IA0A 4ZVFA 5ETPA 2UXCF 5LMUJ 5B0AA 4EBDA 1TVRB 4KH1B 2VPZB 1JLBB 4LFAJ 5L46A 3EPGA 2V8PA 3PXGa 4PXCA 2BJ1A 2H54B 3D1QA 1CQMA 1JK9B 2JLEA 4JBCA 2IJRA 4WP8A 5T7LB 1RHMB 2KYXA 1C1BA 4CNYA 2AYGA 3DLEA 2ZKUA 4RBVA 5HMXA 4DV3F 5J2NA 3CMES 2F3JA 5GAHU 3ZZRA 2NQPA 4F67A 2GO8A 4QW9A 5FDLA 3KK2B 2HKEA 3CJKB 1RKIA 4LRCA 1RSCA 3GMGA 4I68A 2LEAA 4E8UA 5AJ3F 2KI2A 5LMUF 4ZCLA 2QLFB 3Q8PB 3M2UA 2P6TA 2YKAA 2H51B 4IH5A 5IT9Y 4WFYA 5KFVA 3ZZOA 1KTVA 4X4SA 4YR3A 2VOPA 1UW4A 3IO1A 1UMJA 5A76A 5DGBA 2QTWA 4KT0C 1L3UA 2CJ9A 3W60A 3LGHA 2O01C 2UVRA 2IM1A 2J7KA 1H6KX 2NUUG 1RJJA 3MM7B 5IV4A 3W63A 4H4OB 3BH6B 3AGZA 2W25A 1VHIA 3ELHA 1T95A 2G0CA 2QLWA 3LUYA 1RWVB 3NCQA 4C7QA 1R0AB 1SKWA 2UUBF 4J7CA 3MEEA 5JUMA 2WBRA 3KOAA 4ZVGA 4XAKA 5A8RB 3C15B 2L9NA 2CNNB 3G82A 3UDEA 3T9ZA 5B08A 5KT6A 2ALZA 1HBMA 1N0VC 4DUZJ 3EVMA 4ECTA 4B3OB 4UZCA 5CYMA 2HW3A 3UI3A 3NY0A 2GFFA 2IM2A 4WKYA 4RL1A 2VOOA 2CQPA 3AB2B 2DGOA 3MMCB 4USIA 1S1VA 1YJ9S 1U4BA 1FJGJ 3MF5A 1BWEA 2ROEA 1Q8LA 3KJQB 5GAEI 1KN6A 5EWEA 2DYAA 3C14A 4NZ0A 2V68A 3Q0AA 4M95A 2Z58B 3MMJA 4BBYA 1GFWB 2HNYB 5E3AA 1TAQA 2AYBA 1UFKA 4DCPB 3LP1A 4WWSA 1HR0J 3RBDA 5IFMA 5KFFA 3OVAA 4PG4A 1FJGF 1KLMA 3UR0A 1RHQB 1I5OB 2BW2A 4OYPA 3O44A 1S9FA 4CH7A 4RW4A 2YNFB 1TTHB 3BF4A 3G8QA 4DXLA 3AQOA 3FFIA 1LW2A 1C1CB 3OHBA 2HFZA 2P9GA 3MDFA 2CQBA 3F0NA 2U1AA 1FDAA 1FTRA 1MG7A 4KHRA 2XI2A 4WIQA 5I4MA 5KFEA 3GJSB 4HYKA 2FPHX 2JVOA 2Y0BB 2QL9B 1ZPWX 4DPYA 4YOEA 1TL5A 4KY3A 1EQMA 2AKWB 3OHAA 2Y1LB 2ZBRA 1GEHA 3DMJB 2RDDA 4I4BA 3H5YA 4F04B 1SC6A 3KWMA 3MWBA 2KH9A 4F2SA 4EUVA 3LP2A 4LREA 5GAEU 1AB8A 3T1AA 1U0SA 1PYSB 2B56A 2SXLA 4DR4J 2GJ2A 4RW8A 4DS4A 3CCES 1Y3KA 4Q45A 5D4OA 1XBWA 2H4YB 2OPRA 4ECXA 1S1TB 1Q79A 4DZDA 2MQOA 3E8OA 3IGVA 3MM6A 4FPIA 4DOZA 4EI2A 2XO6A 4ZN3A 2JEGA 4LF7J 2IPOB 4ZOSA 1WC6A 2DHHA 3FC9A 1RTIA 5AJ3J 1RTDA 1UJ5A 4NEYA 3CMQA 4IKAA 1BQMB 5A8KA 2POKA 1OQ3A 2ZZNA 2ZM6J 4F36A 3I5CA 4CLZA 5A6PA 1HNZJ 1FRJA 1MMDA 2V34A 1C0TA 4Y00A 4I7FA 2XQCA 4M94A 1IBCB 3OW2R 3RRGA 4CI0B 1OPIA 1CJVA 2NZ4A 1XNRF 3NGUA 3R27A 1VRUB 3I4PA 4GVBA 2EBGA 1GX6A 2BE2B 2W8KA 1W2BR 1RWWB 3IN5A 2YKNB 1MWYA 1KWMA 2XULA 2YNHB 2W1BA 4KB7A 4KO0A 1KDNA 1LW0B 1YBTA 3OJSA 5C2GA 4LUBA 3J7AN 5T41A 1JQGA 3FRYA 2CJAA 2MKCA 3DOKB 1CJTB 2E7VA 1PYTA 2RRBA 2MY7A 2ZOMA 3FCWA 3FKBA 2C3YA 3QGIA 3WZ0A 3QRPA 4ECQA 1N5VA 3V6HA 4PABA 4DZ6A 3CCQS 1X4BA 3O6QA 3PRVA 1FRXA 1V5VA 1TAUA 2GCFA 3MEGB 1ZM3A 2XBPA 4DX5A 3GPAA 1X5TA 3H4BA 4JYAJ 1N34F 2LDYA 3L4BC 5IV3A 1YBUA 1T05B 4LF6J 2HAIA 2PFDA 2V4QA 2MLXA 3NGTA 1G4CA 1UP1A 3E3XA 3K57A 2C2DA 2GHVC 1P27B 4Q43A 1NK8A 2C3PA 2B5JB 2RH3A 4HTIA 4J9VA 2RMLA 2Q3PA 3IC1A 4M5DB 2ZZTA 5C24A 2K3IA 1N48A 2IC3B 4X66J 3MD1A 1X5SA 2G1HA 2M8DB 1JKHA 2MGZA 1Q53A 3LH2S 3PO5A 3E01A 3ZC4A 4JUZA 2VQEF 4A4JA 1WNEA 5HMWA 3PW7A 1J5OB 1HYSB 1TMMA 3EJMA 2W2MP 1VISA 2OMOA 3OVBA 4H4MA 2LMIA 2KJVA 1FO1A 2BM1A 2DO4A 4K5SA 5L1JA 4C8ZA 2V63A 3D66A 5B0EA 1WEZA 2CXEA 2M70A 4UQTA 1SL1A 4M63A 2YNIB 3IBWA 5KFLA 1UVMA 4M5HA 5KG1A 3DRYA 4CLUA 3DLJA 1PJ6A 3M1VB 4DHVA 3M8RA 5E7OB 4E0DA 3CD6S 3HO1A 3I56S 2XGPA 5JVHQ 1DQAA 1V5IB 2ZE2B 1KEKA 1NB2A 4ZPBA 2W9AA 1K8AT 4LFBJ 2HAFA 3VV2B 1VK8A 4FZVA 5DZ6A 1T05A 1RTJA 2IJNA 3DRSA 3HCXA 6FD1A 2YKOA 5F8LA 1UVJA 3W9HA 4PYAA 4C8MA 2A6OA 2KT5A 3QZ8A 2WK4A 2MPUA 1WORA 2ZD1B 1VQOS 2HHSA 1DJ0A 4YQWA 3AKOB 2C2KB 2E5LF 2F9JA 3DRPA 5EWFA 3QO9A 4NLTA 4P7TA 1TK0A 2R7QA 3GG1A 2PIIA 1HD0A 1VCTA 3M8YA 2DHGA 2X1AA 1GMVA 4OQJA 1T7PA 2B7CB 1RKJA 1QAIA 2YKMB 1D09B 5A2QU 2DRAA 2G2ZA 4USWA 2YQ1A 3D54A 1FHTA 3I9V9 1YRUA 2DNLA 4OX8A 1X4DA 2FZGB 2PA3A 2VIHA 1IBMJ 3TR5A 1RE1B 3GV7B 5D0RA 3EGZA 4X65F 2GQCA 2M2BA 4DPTA 2CQHA 1OJ4A 1IN0A 4DV0F 4DQPA 1B7FA 2JDJA 1FD2A 2W4PA 3DRXA 4TN2A 4XDCA 1ZYQA 4JI2J 2A18A 4CLTA 1BQNB 3TVYA 3M8SA 2FLOA 3BKUA 4NLXA 1F60B 1SJ1A 5BXIA 4ICLB 1LW2B 1E6VA 2F8MA 1IM4A 4HI2A 2FLLA 1QTMA 5JVGQ 1KQGB 6FDRA 4UY8T 1TFYA 4ZITA 4ILRA 2HVDA 3DOLA 2XLJA 2AGPA 1KOHA 3ISNC 4CLKA 2GX8A 2HFVA 3HHDA 4OX6A 8RUCA 1LKZA 1ZS6A 3MUVP 1B0PA 3J7YI 4ED8A 3IBFB 4FYXB 1Q5VA 2KFYA 1WELA 3IRXB 4KGMA 2YH1A 1FJEB 2DNZA 1EKRA 1OO0B 1RHKB 1U8SA 3D3BJ 4AQYF 2B51A 3M9NB 2R7WA 2VUGA 1NDLA 4IR9A 3CF5Q 1P9QC 3P49B 4QYZK 1XMQF 3VGVA 4IRKA 1OPZA 4CYUA 2DGWA 1SJ3P 4WYLA 3BDPA 2D3O1 5KFUA 4CH0S 5D15A 4P10A 1IQZA 2MMYA 2AJ2A 3FQKA 4I6AA 4DV2F 4F4AA 3LWLA 1D1UA 2FJXA 5FLXU 3PVXA 2E9TA 1QY7A 2WBMA 1VRQC 3H5SA 3JSMB 3PEJA 1YLXA 2JVMA 2CJBA 1E6YA 1NDKA 4O4GA 4M5NA 2YWHA 4KBIA 4YB5A 2FVPA 3D1HA 4NCGB 2LEPA 4R5PB 1B4SA 2O66A 2VG5A 3GIRA 2Y8WA 5CD4H 1BD6A 4RNOA 4W98A 5KT3A 1Z4UA 4NL5A 1NO8A 5CCMA 4OJ3A 4JI8F 1R0AA 3QFHA 2Y1IA 5HBMA 3UN3A 5J1PA 3F44A 4OJGA 1K9MT 3SMZA 5CD4A 2Z0GA 3DFEA 5F8HA 1O51A 2KTQA 1T03B 1O8BA 2BV3A 2AP6A 2EK1A 4ZLPA 4YB1P 2FVRA 2FVSA 4RNNA 4N56A 2RF2B 3CPWR 3Q8UA 1NLKL 1Q1KA 2GS8A 2BE9B 2CPHA 2VV5A 3JAMY 4ZJQA 3PR5B 2R9LA 1B0TA 5IQQA 1T3NA 2Z2YB 3ILIA 5T14A 1VQPS 1S1VB 4UOFA 1ELOA 4B3RF 3CCUS 2R7TA 1K0TA 4QQBA 2PC6A 1PILA 4HH1A 4Q2MA 2E5LJ 4DUYJ 4PWDA 2FYXA 3QJJA 2RNEA 1UVIA 3CDEA 5C2CA 4IG0B 1F9HA 4XIUA 2NYHA 2HVZA 2ZBIA 1KC8T 1MN7A 3CTRA 5E3RA 4FS2A 4DSLA 1UWBA 5K14A 4XTTA 1LWEA 4ID8A 2B9XA 3UNYA 5B09A 1JLCB 5DETA 2ZH2A 3MMBB 4CIOA 3ISND 2I8EA 2JRSA 2ZDOA 1JIHA 1RI7A 4H4MB 4FVCA 3UDCA 3V5RA 2LQJA 4U6PA 1J5OA 2VODA 1WF1A 1H0HB 1REVA 1RWUA 3KYLA 2DNMA 4CLYA 2IAJA 2GHPA 1VGYA 1Z1ZA 1F0XA 4K4ZA 3QMQA 3NNHA 1BQMA 1HWLA 1SIZA 4F50A 4XK8C 4L72B 3PFEA 3VWSA 1RWKB 4YB7A 3EGVA 5FJ4A 2R2SA 3KG0A 2VQEJ 2B9YA 3THTA 2XGQA 4DLGA 4OJ1A 1X31C 3DRRB 3HVTB 4X4OA 2ADCA 5D0HA 1YJNS 1S5ZA 1PJ5A 1QSYA 2OAUA 3JQMA 2V2ZA 4PWWA 4DX7A 4RUCA 2MQ8A 1PSDA 2YKQA 3VZHA 5IQ6A 4HH0A 1S6PB 2L3MA 3O8WA 4TLRA 2E66A 1U09A 2J0XA 1WD6A 1YBAA 2JSXA 3SCJE 4HDHA 2A2CA 3ZNUA 3KK3A 5FD1A 2RQCA 1XTZA 3LPEA 3CCJS 2EC0A 4DR2J 3M30B 3T5KA 3D67A 4JYAF 3H20A 3P6YC 3ZTSA 4DV4J 3R8YA 4MKVA 3L09A 4O23A 4YDXA 4ZP9A 4F4ZA 4RUBA 1NXIA 2OGUA 2E9RX 1XEZA 1S1XB 2OHDA 5KFYA 2DJWA 2B9EA 4P73A 2HBQB 2OD6A 5HMYA 3W3SA 3UDVA 2HRTA 4DR1F 2VPXB 5K9FA 2DR5A 4AL6A 4BDPA 4F2RA 4OYWA 3OL8A 3CT9A 2PT0A 4AQYJ 1MSWD 2LXUA 4GKJJ 2NS1B 1GTEA 3ITHB 1RYSA 1AZSB 3C3LA 4NA3A 2RUGA 3MGJA 3DLBA 4LF5F 2OD4A 3LGNA 2Q43A 2ZOFA 3M2VA 2MLYA 2AHOB 5E33A 5H1SV 2CJYB 2LKZA 1TFWA 2R4FA 5ETVA 1WSVA 4MFBB 1WG1A 4BWMA 5KFPA 4IQXA 3C2PA 4ZP6A 4LBIA 1LV5A 2HGLA 1HNZF 4AL5A 4USVA 1NSPA 4N8OA 5HANA 1X4FA 3JB9k 2CWXA 3FSXA 5LL6d 3JTOA 4NI2A 5E0OA 1DTTA 1RHJB 4PXDA 1WKLA 4Z7YA 3CC2S 1RAGB 2NXJA 2VZ9A 3HMJG 2F4VF 2DNOA 8AT1B 1OYDA 1GT8A 3AH6A 1VQNS 2MHNA 5F8JA 5M2UA 3CW2C 2VICA 2IIHA 4F26A 5JJBA 1HNWJ 2WSFC 2XI3A 4LRAA 4M5DA 3MCNA 5J2QA 4CO3A 2IYIA 5KFRA 2GNKA 2N3LA 5A0YB 5EHHA 2VDHA 2QRRA 5LXYA 1XR6A 2DNYA 3V6KA 2KG1A 3UQSA 3B8HA 1PG5B 3C6TB 4WYWA 1KTQA 4DEZA 2BVZA 1OIAA 3DLKA 1FF2A 4QPTA 3I0RB 5C42B 3WQPA 1S1TA 1ZTTA 1N6QA 2DVIA 1BQXA 1U6FA 4R0JA 2Y3YA 3TZXA 3S7RA 2W4CA 2BMBA 2QYGA 3ZZYA 1GQEA 4UT4A 4NLSA 2PDAA 4DV1J 2CDQA 5GADU 2KXNB 1T0TV 1U7LA 1IR1A 3JTPA 5ETKA 4LFBF 2RHSB 1TKXA 2EG1A 3A3OB 2BA9A 3MR2A 1UJ6A 1C0TB 2Y1JA 4NCBA 5H9FK 4TQRA 1VBYA 2FHJD 4FYWB 3SQOP 1Q7YT 1HR0F 3VAKA 4GVLA 5J1EB 1TKDA 1HD1A 2YNGB 1SKUB 1B99A 1Y5IB 1TV6A 2DRDA 1KHVA 2U2FA 5KFBA 3GWCA 4K4UA 4N77A 1NKEA 1PJ7A 2R7RA 3BQ1A 1T9VA 3PX6A 1RCXB 4NA2A 4URSA 4Y34A 5KFIA 5DRKA 5M2PA 2BQUA 1G7CB 2B8PA 1IR0A 1WC3A 4AFFA 4DF8A 5J2PB 4H54A 3CJQA 3IAS9 4DFKA 4DR6J 3GJQB 3I0SB 2Z56B 1R27B 4I69A 3QBCA 4PQAA 1IQTA 4ZPDA 3TAQA 2C2ZB 1SKRA 5KOWA 1VQ4S 1H7WA 4HT5A 1Z2ZA 2V9KA 2UXDF 3NL0A 4DPWA 2I5JB 2NYIA 3TEGA 2UUWA 3H0PA 2VG7A 5D78A 2EKYA 1CJKA 4NRUA 3W61A 5KFJA 4A8XA 3BQ2A 1TKTB 3KFWX 4B9SA 2ASDA 3RAQA 3CJ8A 3D4JA 2HHVA 5G0RB 1N8RT 1VQ5S 1X4GA 2BX6A 4WTYA 4NX9A 2KYZA 1MMLA 4D3GA 4IFVB 3EZ5A 1RT1A 3OSPA 3UD3P 3H2LA 2AJQA 4RW6A 4ZVPB 1TKZB 3DLGA 1ZA1B 2C1EB 2M7SA 4EMDA 5A2QY 4RW7B 4DV7F 3BV8A 2XWYA 4KHPF 1HQUB 2NCKL 3DI6B 4WXOA 3MFHA 3K7RA 2DR7A 2DGQA 1DQ8A 3GU0A 2CQ4A 5B0FA 3ZNJ1 2JZ8A 2XMKA 2AQ4A 1PC5A 1UFLA 2DHSA 4DCJB 4YB6A 1NJXA 4X4RA 1TL1B 4O3OA 1X4AA 3JS9A 4DV3J 1XNQF 1N52B 4KKOB 1NK5A 4ID5B 3ETMA 1BLUA 5KFNA 3OVSA 1VQLS 4B08A 3M8PA 2Q2GA 2GIQA 1N5QA 2CPXA 3DLLQ 4LFAF 2XS2A 4X4NA 1ZBTA 2WONB 1GMWA 3CJ5A 3HLUA 3CCMS 4KHPJ 2OMLA 4DV7J 5EX3A 1KQKA 3QQCD 4LF7F 2LQBA 3J81U 1RB0A 4G6VB 4ZHRA 1ACMB 2OPPB 1U1QA 4Y3CA 1X4CA 3RRKA 2OEMA 5C7PA 3V6DA 4J91A 3QT7A 2EBEA 3GTYX 2V8DA 1UAWA 4C8KA 4U8YA 1G3OA 4KTQA 2DNHA 1TL7A 2HQIA 1RT2B 2NUHA 1JLAB 3FMBA 1GNKA 1S9GA 4HI1A 4DL4A 1VQMS 1D8ZA 3QWUA 4L73A 2HQFA 3FBEA 2G4BA 2K7KA 3PRBA 3HFKA 3RAXA 1VC0A 3SI8A 1TUWA 1KVKA 2VD3A 2RDIA 3H5UA 4NZ6A 4DFPA 3B6BA 4A48A 2N4DA 1WG5A 4I0WA 4EBEA 4JV2A 4YS2A 2FD2A 1H2VZ 3DM2A 4CWBA 3HULA 2CJKA 1RT5A 3NOGA 2R7SA 5FLXY 1U1OA 3H98A 1N5YB 3POTA 2AJFE 3BSAA 2I6WA 3VVTA 4ICLA 4A47A 3M4XA 4DR6F 4X4VA 2GMLA 2E5IA 1TU0B 1UVKA 3HSJA 3LOUA 4H4KA 3M9OB 1HFEL 2GC8A 3PV8A 2XZTB 4DMZA 1RCOB 3KG4A 3K5LA 1QUVA 2QSWA 5K5MA 1WOSA 4P2SA 3J7Z5 5E3QA 1ULRA 2ZUGA 1XC9A 4J80A 3HDSA 4USUA 3Q23A 4ILLA 3AOAA 4X4UA 4AYBD 1VS3A 5A0YA 1KHWA 1B3TA 4UF4A 3OSNA 1JLCA 1VBXA 2DR9A 3J7A1 5J2QB 2OO4A 2FY1A 2UUCF 2D41A 1TELA 3HD2A 4JP8A 5H9FJ 4OL8A 2K3KA 4JV1A 4QCLA 3P45B 3BGRB 4OZJA 2AF6A 3PDNA 3NAHA 1Y10A 1N6QB 5IT4A 3KLHB 1SVDA 1S6OA 1YWXA 1ZM4A 2HFNA 2M88A 3ETOA 1H7XA 2I38A 3BGUA 3M2RA 3M6VA 4CLPA 2W01A 1S9EA 2C22A 1EHWA 4ENOA 3R5GA 5DG8A 3MMCA 5LXRA 4X4PA 3OL7A 2H5EA 3CCSS 1ZTWA 2MKSA 4ZLJA 2B6AA 4OYMA 2JLFA 4R25A 5CHCB 5E3CA 3S01A 1Y11A 3B4MA 4WXWA 1WI6A 4B3MF 1R0CB 1A6LA 3G82B 4F0MA 1KLMB 1N88A 2KB2A 4C0BA 1K0VA 1IKXB 1PBUA 3GILA 1WTFA 2E1AA 1WSRA 2CNLB 2Q6CA 3C8YA 2HNDB 2LVWA 2QA1A 2YX7A 4OHVA 4TY8B 4WK3A 5J2NB 2NPFA 4K4TA 1EP4A 4P72A 5DLFA 1QJHA 2CZVC 4MFBA 3RBXA 3H40A 2V50A 1CSJA 5HVHA 4JV5F 2F4FA 5KG3A 3WIVA 5E41A 4USHA 2I1RA 4K8RA 4CO4A 3PW4A 2F1FA 3I5AA 1HW9A 1PIEA 2GW8A 3AB4B 4I2PB 5LSLA 5HI7A 3M2UB 2N3OA 5DM7Q 1X9SA 3TO8A 2V8VA 4OZLA 3UE2A 4FPRA 2MZQA 2FJBB 4WFNQ 3H25A 1KQSR 5HVFA 1IBLJ 2FLPA 4LF4J 1WEXA 3IWLA 1JLFA 1HWKA 1TVRA 2FIUA 1RISA 2XHCA 3LQVA 1DTTB 4QBUA 5A8WA 2ZHAA 4JI4F 1ZAVA 1KQFB 4NOHA 2XMTA 4HL9A 4F0HA 2UXCJ 1U6BA 2XYPB 4DR3J 2DPIA 4QU6A 4H4OA 8ATCB 2XZDB 2DTJA 1X60A 2C2NA 1M5KC 4MIWA 4FS1A 2EC2A 3RGIA 2OTLS 2UUAF 3VAMA 3DN9A 3D0GE 3HZEA 4P2XA 1RLDA 3CDAA 1FXLA 1RTDB 2RAQA 5L1KA 1FDBA 1WEYA 1PCAA 3R7NB 4RBTA 5F9NA 5F8GA 4WCEQ 3Q22A 1GMWD 1XK8A 3CDWA 1BGXT 4IYQA 5ETNA 1HHQA 3M6XA 1XR5A 3VQTA 5CABA 5I3QA 2ZH1A 2H48B 2XMMA 2BRLA 4MIAA 2DCUB 2FLNA 2ZITA 4KH0B 4U7CA 2HIQA 2DPJA 2H1YA 3L7UA 5KTQA 4IQMA 4F7VA 3NRBA 1SUQB 3MM8B 4ITSA 1OYEA 4J90A 4KKOA 4MT1A 4X62F 3MM9B 3PR4A 1UVLA 3AD9C 4ED3A 5D0EA 3RUBL 1EKSA 1LQ9A 1JJHA 3HVAA 1HWUA 3W65A 4EO8A 7AT1B 4J9QA 1WHVA 2F65A 2UVVA 3NWGA 4KGVB 4FP9A 5HP1B 1O5JA 2YQ0A 5C42A 3G87A 2W7PA 2R8GA 2YWEA 2CG8A 1VMBA 2QLJB 3DGPB 4LMZA 1S57A 4RUHA 3EVOA 4J9UE 4RW4B 1JMTA 1L3TA 1NM2A 2XMUA 4EU0A 4I67A 3RRHA 4OYXA 2HWTA 2HS3A 4ECYA 1CULB 1VRUA 4GVBB 3M30A 5HN0A 1DBDA 1QSLA 1KP6A 2J6UA 3C66A 2ZFHA 3NBPB 5L38A 2B7BB 4DU8A 3EDQB 4RX6A 4Q5VA 2MKIA 3QIPB 2V9WA 4USJC 5CZXA 4ZIWA 4CO0A 2WB1D 2CQDA 1VR6A 2ROGA 4DV1F 3HD1A 3O5TB 4JI6F 1DAXA 2RQMA 4JI1F 2HPUA 3UDLA 2EFQA 4NZ7A 2Z4PA 4L6V3 2MSSA 1A7GE 4MKBA 1URRA 3RYLA 3PKYA 2MQQA 2XCPA 4AE5A 4PPDA 4C11A 4L3KA 2P8IA 3SSSA 2BR0A 1JLEA 2Z30B 1Y5NB 4OI4A 2CJXB 3MECA 3CD5A 3D6TB 1OWXA 2E1RA 3DHXA 4GO5X 5SUHA 2HLTA 2LCWA 4ANDA 1FKOA 5AE3A 2BABA 3PYDA 3UN5A 5HO4A 1DFDA 4R8UB 3TOQA 4B02A 4TYBA 2XY5A 4K5RA 2CPDA 4MYUA 5DDQC 1HNWF 1MN9A 2WZ1A 2MQMA 1HNXF 3PACA 3EWGA 2Y8YA 3DOMA 3R3TA 3IG1A 4UW2A 1YRTA 2MKHA 3CCWA 3LW5C 4C0OC 4A8YA 1S1UB 1J5EF 4EZ6A 1RHUB 4O44B 3UCGA 4RW8B 4LF9F 3EGNA 1TL1A 1VJWA 3DU5A 2W8LA 2LA4A 3GYXB 4F3OA 4DR7J 3K89A 2LFVA 3AAWB 2CDRB 4LR8A 1I1GA 1RT6B 4JV0A 2G2OA 2GVZB 5KAKA 4ZVTB 1FE4A 1Q8BA 2VBYA 2YXLA 4G1IA 4LF8F 1IM6A 2KZZA 3RTVA 2C3UA 4NLYA 2OIHA 1R3NA 1WF2A 2XM3A 2QMWA 3BSCA 5KFAA 2VKRA 3SSRA 2DR6A 3HSGA 3TWZA 1K47A 2X3GA 3BYPA 5HJYA 3UVJA 4A8WA 4KGKA 1JLQA 2C2RA 4V19J 3LP0A 2DB1A 1H2UX 4TY9A 3CCZA 2J6SA 5IC6B 3JYTA 2UV8A 2HHQA 4RWWA 1S59A 3A3PB 3VR1A 2WSEC 3HVRA 4ED2A 1XMQJ 1NJIT 9RUBA 2IDEA 2IFXA 4ZK7M 1PC4A 3MI7X 4N41A 4NCAA 2RRNA 1XWLA 1S0OA 4U67Q 2B5JA 2CPIA 3EYZA 1KFSA 3DOLB 4NA1A 4FXWA 3FVYA 1RT5B 3GFYA 1PO6A 1CJTA 3A8IA 1VFJA 3FNNA 1C4AA 1FJ7A 2F5GA 4N76A 4DF4A 4MKAA 1CPZA 4OLPA 3G8SA 3RB0A 1WOOA 3SDEA 3OL9A 4KYZA 4ZVOB 4NLDA 1NCLA 1UA1A 1KONA 1MNEA 2DY9A 4E2FB 1S97A 1EETA 1LWFA 2X7IA 2W2OP 3KXDA 3N6LA 4I56A 1NSAA 3WBZA 2N7CA 1JLFB 5A8WB 1RK8A 3THPA 4CT8A 1XMOJ 2HHTA 3H2UB 3SQGA 3EVWA 4J9SA 4WKRA 5D6GA 2DKOB 2L9WA 3H7HB 2CQIA 3D68A 4YMEA 3EM1A 3IFEA 1RTJB 3U7JA 1NDCA 5I3PA 3DDNA 2GZOA 2VPYB 4ZP8A 1ZZNA 5GAGU 1R6VA 4CRJA 2E7XA 1CS4B 1FKPB 2MZSA 2DXDA 3FMWA 3LPYA 4DL0C 2C42A 2R8HA 1NSKL 3QLHA 2HBYB 4ALZA 2ZH8A 3J81Y 3N5FA 3FEXB 4XO0A 1LWCB 3J80U 4B9UA 3H90A 3MZIA 4WE1B 4ZVHA 4ED5A 3L95X 3V4IA 2YQ3A 4TXSA 3WIUA 4USKA 4ATNA 3T1YF 1RT4B 1ROFA 2HWHA 4FYDA 1NH8A 2GGPA 5D4NA 3OL6A 2LEBA 3RB4A 1D8YA 2CQGA 3FZBA 4FXDA 4LIRA 3AA8A 3L9ZA 2CRLA 2Q1LA 3IXQA 4ZPWR 5HVGA 1XN9A 2ZE2A 3MPYA 2KN4A 4OX9F 1LFWA 3AOBA 3SCLE 1FRKA 4FNHA 4FF2A 3RW7A 4PQUA 1HQEA 2HQGA 3GIJA 2QLBB 2EFVA 1MU2B 2BXJA 3V2UC 4NMLA 1KS2A 4WP3A 3VALA 2VA3A 5E3PA 3QJLA 1FDNA 5CXTA 4GO7X 3VZIA 1U1LA 2MJNA 3BS9A 2G9OA 1V3ZA 4CLSA 1BHNA 4Y2CA 5E2QA 3LF0A 2JLGA 1R43A 3BPDA 3BO4A 2JJ4D 2MZRA 4LSLA 4MTPA 1EAYC 2M0GB 3KUHA 2OPSB 1AUDA 3FUYA 2HQCA 4DWIA 4LT6A 3QT8A 2WW4A 2ZVSA 3BKTA 1AUSL 4Y6IA 4ZJLA 2IA0A 4G1QA 4ZJOA 5LSOA 2OELA 4DSFA 2IA6A 1RAFB 4DL7A 1G2EA 5KG5A 4JI8J 1KD1T 2PMWA 3KNGA 4QYZJ 4ZPAA 4C8NA 2B4VA 1RLCL 1WJ9A 4X66F 5D4PA 3MMBA 1SC1B 4QIWD 3Q24A 3TUPA 5GVQA 1BQNA 1SJFA 2WOMB 4DN0A 1FK9B 2K1RB 1UEUA 3BGFA 3CEDA 2VKZG 2JC0A 2KL8A 2WVCA 1MROA 4KFBB 3SCIE 3ICLA 2W7OA 3CE8A 4NLQA 4RNMA 3DDIA 2RQKA 3M6WA 1P8GA 4MJKA 3KLGB 5D3GA 4GKKJ 3DXBA 1LWXA 2IVMA 3R6GB 4B9MA 3SCKE 4PXEA 4XDDA 3T9NA 1M1GA 1OQ6A 4LJMA 2YKPA 3NOCA 4HT7A 1ZA2B 4Y2IA 4ZVQB 3WC0A 4CM0A 2QA4G 2VJUA 1UL3A 5BYQA 1IKWB 3ZO7A 2JRRA 1DTQB 4CO5A 4DFMA 3TAPA 1LFPA 1DY3A 1DZ5A 2FJVA 2XLKA 1RWPB 2NSCA 2DCLA 3BN4A 3FBBA 1HBUB 2HHPA 3RBEA 2CPFA 2NXNA 2DNQA 4K59A 1KKHA 5DDRC 4OI1A 4UUWA 4L74A 3KJVA 4DV5F 2MKJA 4NE9C 3MFIA 4K4VA 1U1NA 3Q83A 3W2WB 3G6XA 1CLFA 2J76E 4CQ1A 1NJYA 3FCHA 3Q8VA 1XQIA 5ETRA 2ILYA 4YY3F 2L48A 3HT3A 2VA2A 1CVJA 5C5JA 2WHOA 4LF8J 3EXYA 5D3GB 4O3RA 3R5DA 3MEDA 2EEYA 5KFWA 2IRYA 4LF4F 4WU3A 3HX9A 2BQRA 3W8PA 1D9FA 5HP1A 2OH2A 4DR7F 1OY8A 5JMNA 3JSMA 1JWWA 5GADI 2BOPA 2VH7A 2OKQA 2AWZA 2HNZA 3FQLA 4IFYB 4ECWA 3AGYA 2E5JA 3O2IA 3TAMB 3B78A 4Q44A 2D3ZA 1J5EJ 1K1QA 4JI2F 1ZH5A 4DN9A 1WHWA 3I96A 1GXTA 1CC8A 1U6ZA 2ASJA 1SB6A 2VG5B 2QMUB 2YKMA 3NS5A 2KJWA 4W90B 2C2MB 1RACB 1NKBA 1Q5YA 1R0BG 1Q95G 2DGXA 4L75A 4MMOA 3D9BA 3MUTP 4A8MP 2RS2A 3HHLC 5CYQB 2AD9A 1UTAA 2MQNA 1HLWA 1T9TA 2GQQA 3OPKA 3PYGA 4P74A 3BM7A 5K14B 3KHGA 1YJ7A 3MURP 1IKXA 2H4WB 3UN2A 1T94A 3ZZ0A 4C11B 1PGZA 4U9RA 4DQIA 1SH3A 1KFDA 1FCAA 1XR7A 2CWKA 3QIDA 2HURA 2CZ4A 5KG4A 4ZVUB 4U95A 4HLBA 1E6VB 3CNQP 1YKWA 1EETB 1LWFB 1HW8A 1MWQA 2KRBA 3B4DA 3GSDA 3K17A 3N4WA 2AV5A 4DFJA 5L8RC 1QAJA 1WF0A 2VHGA 3GR0A 4B3SF 4PG5A 5J2MA 5HK4A 2RILA 1U48A 1H98A 3BJYA 1SC3B 5KG2A 4YFUA 1J27A 3QT5A 3ZTOA 3CVKA 4BS2A 3KK2A 2ROPA 1BXNA 3OFEA 2VF3A 2W24A 2VPWB 4IDKB 1QSSA 2CPEA 4RLEA 1B64A 2HLUA 1S1UA 4PRFA 1FE0A 4DCOB 1S77D 4Q0BB 3AJ2A 4I2QA 5I3UA 2W2NP 2XEXA 3IR6B 1RAOA 1P1LA 4RW9B 5CZVA 2JEJA 2HHUA 1GH8A 3U1NA 2HS0A 3W9JA 3DU6A 2E5HA 3OTCA 1Q7LB 4F4XA 3EUNA 4B17A 4EWTA 7FDRA 3AT1B 2W2PP 3P5TL 4NLRA 5CAAA 2GHWA 2D3UA 2IM3A 2JC1A 4FKXA 3PX0A 2AYEA 4PR6A 2OJ3A 3IWNC 1H73A 1QD1A 3GYNA 2XHWA 2X1FA 3MCMA 4Y65A 3Q8SB 5KT7A 3M6UA 2DNRA 2Y0SD 2AZ3A 4AL7A 2ZJQQ 2N82B 2DNNA 4KJIA 3VAGA 3CCTA 5IZHA 3C6UA 2F8EX 3T19A 4DSIA 4ILMA 2HQDA 1X4EA 2QT7A 4LF6F 2LA6A 2YNGA 4HEA9 1HL6A 1VHFA 4M5KA 1FXDA 3V6JA 2UUBJ 1EJ7L 3RG6A 4OZ2A 2A6MA 1SUQA 2OSQA 1RAHB 2EVZA 2LU1A 2XMJA 3MM8A 1RT6A 4MK8A 1HQ2A 5AXMA 4CTAB 4QIGA 3T1HJ 5K8OA 1S6QB 2HRYA 2KT2A 2HHXA 3NMRA 5KFGA 1XAOA 1S49A 3J7ZT 3IGNA 2KU7A 2UUAJ 1T03A 3US5A 3CJSA 1JB0C 3N28A 3N79A 4KE5A 2PO4A 3KDNA 3M8WA 2CZ9A 4RUAA 1HBOB 1ZOTA 4NLPA 3MR3A 1IKVA 2CG4A 3AOCA 3AD8C 3DMJA 3ZZZA 4XPCA 3JYTB 4BCAA 4JI4J 1DHMA 1FD8A 1H72C 5B7WA 1BE4A 2FTRA 1IVZA 1NK7A 1IBLF 4DJBA 1AW0A 4R0EA 4LF2A 1MLAA 3OLBA 4BC7A 2OPRB 4Y0FA 3HHLA 5D4LA 1TL4A 4KQZA 2ZM6F 3OT9A 4KRWA 4ZPCA 1LOUA 3CSKA 2AJ0A 3EICA 3HSDA 1YJVA 2HZCA 2LQ8A 2DGUA 5KG7A 2DRBA 3W9IA 2E1CA 4IOCQ 2O1PA 3V4MA 3MCSA 1VI7A 3PNIA 1FWKA 1HNVA 2I0XA 2QL5B 1S0MA 1J2VA 3MMAA 4NI2B 3NEKA 2DK2A 5GMKa 3U1MA 1BUXA 5KFDA 3KK1B 4F4WA 3C16A 1BC6A 5ADZA 3TARA 3MECB 1NRKA 2DBBA 1M5PC 2MZTA 4ER8A 2AIRB 5AXLA 2DITA 3MM6B 3T6JA 4OYIA 4TKTA 1S4EA 1R8BA 4ID5A 4PG7A 5ETOA 4OHZA 3R97A 3T5LA 2DGVA 2YKNA 1KLNA 1JLGA 3KNAA 2W7AA 1MU2A 4ELUA 3H5XA 2HFUA 3LAKA 1FX4A 4P2FA 2W9BA 1N33F 3EPIA 4B3OA 4A8OA 1EB0A 2VL1A 5M2RA 1UEKA 1YITS 3DLHA 1HBMB 3PZPA 1WG4A 1RXOB 3QPIA 3OD2A 3CIMA 5F9LA 4ERDA 3A12A 1AFJA 3WX4A 1Y7PA 2JWNA 4QWCA 2YWWA 2KHCA 2BJDA 2VFRA 4HR2A 2ATLA 1NJWA 2UUCJ 3HM9A 5HSPA 2LP4A 2BE2A 1FERA 1S9GB 1NPKA 2ZWPA 5DQGA 4J9MA 2AGQA 3NGKA 3NS6A 1NEEA 3MAAB 4I64A 4C0HA 3NXZA 4LQ3A 2RT3A 3TVKA 3HT0A 3GR1A 3L7OA 3HKWA 5CYQA 3JXOA 5KFKA 4K50A 3DOKA 1FWPA 2CAJA 5C24B 4JI0F 4WTOB 4A8KA 1VC5A 4CM2A 3HHKA 5KOXA 3RB6A 2RB7A 1N5YA 2RS8A 2WOMA 2R7UA 2XS5A 1Y9OA 4LSLB 5D77A 1Q16B 2GAGC 2ZOGA 2EFPA 3KLGA 1C1CA 2HBRB 4M5JA 2V0NA 2ABYA 4QZVB 3C6EC 2EFOA 2VONA 2DR8A 3J7YU 2HVHA 5FDLB 1HNIA 3I87A 1S76D 3M32B 1UWAA 1VQYA 4G1QB 3G2XA 1UKUA 1QUPA 4LF1A 1RBLA 3LWMA 1F5AA 3U1LA 2Q6BA 2A0FB 3FSIA 2FQQB 5DG7A 4QPXA 2QFJA 1FX2A 2AEFA 2HZAA 1JLBA 2MQLA 5GAHI 1M1HA 5KFCA 2ZNYA 3C19A 3K0JA 2XNRA 1JXLA 3QGPA 3QFWA 4I2QB 5I3UB 1TKTA 2V8GA 1FESA 4KFBA 3W1YC 3AA9A 4Q0BA 1CJKB 4FF3A 4ES2A 4C8OA 3R7SB 2MZ1A 3TUZC 4WFBQ 3MM7A 4DQQA 1T9XA 1U2CA 1VBKA 3MR7A 3RR7A 4F0KA 4O3SA 3IRWP 1H3DA 1RT1B 2RU9A 1VIXA 3ET6B 1TMJA 4C9DA 1VC6A 5RUBA 2B26A 3SEOA 3QSIA 4HHJA 4AXJA 3KLFB 3T41A 3BR9A 3FK4A 5KFZA 2CADA 4C8LA 3PW0A 4RW7A 3BQ0A 2ZBQA 4QYRA 4WZMA 4QW8A 1EIYB 3W5XA 1FI4A 1LWCA 3AHPA 2RVJA 2DGTA 3D6MB 3Q8RB 1N4LA 1RT4A 2QLXA 3HJFA 2VFTA 1FKAF 4DR5F 3UWTA 5L39A 1T9UA 3BGRA 3CC7S 2GMJA 4KV8A 5IT0A 2B0GA 2UXBF 2OLWA 1O6XA 3M2RB 1TKXB 1F1BB 3GLJA 4M5GA 1V3SA 3D3CJ 3RZAA 4Z2XA 4MKYA 4X84A 2JH3A 4LIWA 4RR5A 2JNJA 3DM2B 5J1EA 3PIOQ 2E7WA 4OZ1A 3T1HF 2WW8A 2MKYA 3ZTPA 4OHYA 3OXGA 3DC2A 2HNZB 1L3SA 3X1LB 5I42B 3KDOA 3JQJA 4MK7A 1XERA 2HG4A 5L1IA 2ASLA 1VK3A 3OR2A 4DR2F 1NLTA 2FJWA 2XG8A 4K2XA 3GIIA 4A8SA 1WKKA 3I6PA 3L3CA 2ZH6A 1FNMA 2Z57B 3NP5A 3G9CA 2CQCA 2V69A 2DH7A 3DGVA 3SXLA 3BR8A 5J2MB 1NU4A 2BYCA 2GMHA 5DO2A 1N36F 4K0KJ 3OJUA 4KC5A 5MAOA 3Q8YA 2OPQB 3JSBA 4X4TA 1HBNB 3QSYB 4F4KA 2PFFB 3P3DA 2FHKA 2I5JA 4J9NA 4IR1A 2OTJS 2KDOA 2VG7B 2MTLA 1IUJA 2DIUA 1HNVB 4YDDB 3IAM9 1SKSA 1SQEA 2EXUA 4YR0A 1YIJS 3NG8A 4JB8B 1TL3B 2J9DA 4BLGA 4DX6A 2G0IA 2FVCA 4ZPVR 4TU7A 3G6ES 1F2GA 3CXCR 1JNRB 2GV1A 3P4UB 3CCLS 2P2CB 1KSPA 4KSEB 4Q2LA 5IWAJ 4A8FA 1RWMB 3MR5A 4PAAA 3CGIA 5E5NA 3TW0A 2C2OB 5J1NA 3KK1A 1ZETA 3KMSA 1R8HA 2FJDB 3L7PA 1CC7A 1C3GA 2A2DA 1OSDA 1UZDA 2ZBPA 2XSJA 3QAUA 4FYVB 4X64J 2BDPA 1HMVA 2DT9A 1WACA 2H65B 2YY3A 1R8PA 3R7BB 3HP6A 4IUFA 1U1RA 4KGZB 3K58A 3OFHA 2HZVA 1HBUA 4QWAA 1NPPA 3TZWA 4OHXA 4AT1B 2Z2LA 4N5SA 4RKUC 1ZPVA 1WHXA 3A8EA 2W9CA 3PW2A 4OX9J 2IMWP 4Q7AA 3I82A 3OXFA 5HL7Q 4L76A 1WC0A 1LEOA 1S79A 2ZD1A 4LR7A 3NGDA 1HHTP 5KFQA 1T8EA 2YBVA 1TK5A 3KLIB 4QOTA 3GFZA 3MPUB 2XC9A 2AEJA 4KAIA 1QE1A 2HFOA 4CO2A 2P9CA 4M8LA 4O3PA 5K20B 4NPOA 4ZA1A 2WB4A 1KBRA 5U47A 3W7BA 1TK8A 2E1MC 3SBMA 4GC7A 2Z2ZA 4M5MA 3I4HX 5DGAA 3K5OA 1NSQA 5IC4B 2F4VJ 4ED1A 2VG6A 1AT1B 4WFZA 1WTBA 3I9ZA 4WZQA 4DL5A 2MYFA 4WK1A 3VAHA 3D0HE 3TVZA 2EFGA 3VGUA 5HAOA 2BJ7A 1JLEB 1SQGA 3CJ0A 4YUDA 1XMOF 2CIMA 1S6QA 2UVWA 2ZHBA 4QWDA 4UTGA 4ZVSB 5K8MA 3KMQA 5C25B 1R7IA 1RDRA 4M1KA 4HTJA 4R8UA 1FFWB 5DG9A 3WHIA 4NXMJ 5GMEA 4YY3J 1S0VA 2MB0B 3KKFA 1NUEA 1RP5A 1V9OA 3IS9A 4OZ0A 4OZ3A 3UW1A 2BANA 3FEYB 9ATCB 2QE5A 2H3EB 3MM5A 1UWBB 5LJ5Y 3CCRS 3CUNA 2EKNA 1G6BA 2NR0A 1QM9A 5LMNJ 4C6AA 2AT1B 3NGSA 2V67A 3VHQA 1Q78A 2JHEA 3P96A 4LVOP 4MH8A 3RJMB 2XMAA 1DARA 3MXHP 1RT7A 2XY6A 1SH0A 2QX0A 3H4DA 1N56A 4B9TA 5LJ3Y 4DDFA 1H38A 5DQHA 3UCUP 4HACA 1REVB 1YX2A 2GO9A 4IDKA 4ANCA 2P9EA 1KVJA 4NXNJ 3GIMA 1OY9A 2W9BB 3QNWB 2J8AA 4ECUA 2WVFA 2FZKB 1SXLA 2DEIA 1E6YB 2HRUA 2HVEA 2F9DA 1UEVA 3G86A 3OBIA 3R5CA 2QLDA 3IG1B 5DQIA 3KJFB 2ZHOA 3OLAA 1VQKS 4JOUA 3M7VA 3PHTA 1IBKF 1Q86T 1X8DA 3R5AA 3OR1A 4ZCKA 3TP2A 2I9SA 1H2TZ 4EBCA 1NPRA 2RJZA 2VQFF 4LBHA 3BB5A 2XMVA 5B0GA 3M8QB 3GE9A 4LR9A 3NBPA 4LF9J 3ENQA 4ED6A 3PY8A 1P1TA 2YWGA 2A10A 3S6EA 3BSOA 4PG8A 3CJTA 1C2PA 2HVIA 3VAIA 4JI7F 2FVQA 1NNDA 2RSQA 4FBUA 1SV5B 2UU9J 1YZ7A 2DXEA 2RF2A 1W25A 4CNZA 2FY8A 2R2RA 4GC6A 2O5DA 4TY8A 1U47A 2LDIA 1AFIA 1QDUB 3BZQA 4N8NA 4MK9A 4DS5A 3M32A 1DQ9A 1RT3A 3FEZA 2UV8G 1HNIB 3SZ2A 1XMBA 1OS5A 1T9WA 2IRUA 4PPZA 4DG1A 4W4MA 3HFZB 1NDPA 4IRCA 2XNQA 1S72S 2BEFA 4GMKA 3SQGB 1QVGR 2RHQB 5F3TA 4DU7A 4IG3B 1DLOA 1HBNA 3CJKA 1M5VC 4IOBA 2BKNA 4JI6J 2HS4A 2O67A 2QG9B 5L1LA 3K5NA 3T1YJ 4DI6A 3TA0A 4ZLNA 3N5BA 1OMSA 3OV7A 2DNGA 4B3RJ 2KXHA 3WC2A 1NAQA 1C4CA 2YX1A 3UFCX 1NH7A 2IVFB 3C46A 3I0RA 2ZNZA 1V6HA 4NASA 4ZVRB 2ZH9A 2ATCB 1HHSA 4ES1A 2XWXA 2VC1A 3G96A 5IWAF 4QWBA 5B0DA 3S8SA 2ZBCA 4C3MA 2PMZD 1U1KA 3BEGB 4J9KA 3UR3C 1FRHA 1R6YA 3C5XC 3DDKA 1TP7A 3S1TA 1WC4A 3DRRA 2ZJRQ 3DOMB 4DQSA 1A9NB 2VQFJ 2PMHA 2QN6B 2NZCA 3C15A 4O4GB 1JLQB 1RWNB 1LK7A 1UCNA 1ZAXA 1U49A 4CCHA 1IBKJ 1V3RA 4O44A 4C3KA 4RWXA 2HHHJ 4KV8B 3DXSX 1UZHA 1NBEB 2D69A 1RAAB 1CG2A 4CYUB 4Z37A 1SJ4P 2W4DA 3DHWC 2M4MA 3EZOA 3MPWA 4RPFA 1S1WA 2D9PA 4DPXA 4DPUA 1OY6A 2HK2A 2AJ1A 3MM9A 2WVBA 2NLWA 3HI9A 1R31A 3TA2A 4EYHB 2MKKA 1FJCA 2Z2MA 3H2VE 2J8SA 4OFZA 3CDUA 1D0EA 3MOZA 2PEHA 2HGNA 3K8WA 4ZIVA 3BSNA 5IM0B 3G8TA 4C4WA 2QSFA 4ZCMA 5J2PA 2J9CA 4K4SA 2JX2A 1S0NA 2QA2A 4PQUB 1X7VA 2NXEA 1RUSA 1B7YB 3HJVA 3IR7B 2XYGB 4NWBA 4OV6A 3AXKA 2YWKA 4O3NA 3G6YA 2V2KA 1YJUA 2AGOA 4DV6J 1RYRA 4IRDA 3QZ7A 5EN1A 3QGHA 4ZKAA 1X0FA 1F3FA 2XS7A 3PKMA 4U8VA 2CQ2A 5L9XA 1FRIA 1FFGB 3DLEB 4HHUA 2H5JB 3ZTQA 2BKPA 4I6YA 2FJEB 2J9DE 4U7UK 5HQLA 3TYTA 1RTHA 1U0HA 1JNZB 4IOAQ 2C2EA 3GJRB 1FT8A 2AX1A 4UQGA 2HHWA 2IM0A 1CS4A 3TX0A 2KHDA 5I42A 3GB0A 3W2VA 2BOAA 4N47A 4U7UD 1RZMA 2D9OA 3LP2B 3KG1A 1SIWB 1W26A 1D3WA 4URQU 4WE1A 3X3UA 2RD5C 3BBBA 5DM6Q 2F40A 2QJ3A 2XSJB 3EX7B 1HKAA 1HMVB 4DPOA 1NHVA 5ETTA 2LXIA 3N0VA 3N6MA 1FA0A 3Q2SC 1IBMF 3VF0B 2OI2A 3NGRA 2LQ9A 3MEEB 2JVRA 1WDDA 3LGMA 4LRBA 2COLA 4NLOA 5B0BA 5IT9U 2VU5A 5IS2A 4JI5J 1NMEB 1HQEB 1T11A 4K2JA 4NYOA 2KXFA 3ILJA 4Z7CA 3PIPQ 2G2YA 2FGOA 4KPCA 1TL3A 1NZAA 4PCQA 4BC9A 3NNCA 1VOMA 4MAKA 2ZH5A 5BYSA 4UUXA 3HFVA 4CLLA 1EARA 4I1TA 1R8CA 2J7WA 4HHHA 2R8JA 2OPPA 3MD3A 1SPBP 1CEZA 4JI1J 5IXUA 1KRPA 1MMNA 2NXUA 3KLIA 4QIVA 3FJ2A 2DGSA 4V1Ak 4F3QA 1QLNA 1EZZB 3KLFA 2CQ1A 2R7XA 4MIBA 3SSQA 1RWXB 1JLAA 4J9OA 4OLOA 5BJRA 3AXMA 2QGFB 4WIIA 1SI9A 3OUYB 2KVIA 3GFHA 2M3DA 5EUHA 1U2FA 2MHEA 3OTDA 3ZXWA 2VG6B 4C2MA 1VYAA 2RQ4A 3ZFVA 1RGVA 4DBQA 4DLEA 2KG0A 4NEZA 4IH6A 2HK3A 4ED7A 2FZCB 1Y5LB 2HYIB 3F56A 1RA6A 3I5BA 3IWXA 3KHHA 3PW5A 2HMIA 2EG2A 1MWZA 7FD1A 4ZMMA 2PA8D 1SL2A 2QYCA 2ZDPA 3PO4A 2ZC3A 4ES3A 3I0SA 3IS9B 5AE1A 1YQHA 4XPEA 3TQEA 2IBKA 5EWGA 1Y3JA 1TUVA 4TNOA 3ADAC 2XO7A 1YJRA 3E51A 4FKYA 4OYBA 3ZZTA 3TI0A 1UVNA 4WPAA 1L5UA 3SV3A 4DL6A 3QWPA 5SZTA 2CQ3A 3PJWA 4U96A 3CWJA 2K2PA 1N34J 2CA9A 3UD5A 2H9ZA 3MTKA 1C1BB 1FK9A 2K1RA 5ETMA 2F63A 5KFTA 3GJTB 4FF4A 5L9NA 3PG9A 2IJFA 3UPFA 4ED0A 4B3TF 3Q86A 1VRTA 3H42A 3M1VA 2J7UA 3BGLA 5A8RA 2R8IA 5EGYA 3RBZA 2V6AA 2YH0A 5HQ8A 3A8KA 3DLGB 4NMXA 4C97A 2UXBJ 2UUTA 4OMFG 4LSNB 3R2DJ 2ZC4A 2H5IB 2OFHX 2YTCA 3A1YG 4DSEA 1YVFA 4DR5J 1Z2LA 2MLZA 3HK2A 1VQSA 2NXCA 3C6UB 3GQCA 2BJ3A 1LXJA 1FVSA 1M0SA 2D74B 1CJUA 2G13A 5GAGI 1NK0A 5LM7E 4OYOA 4UZBA 4NRTA 5DJBA 2V4RA 2PI4A 2WTFA 2IVYA 4KO0B 1JXVA 1NK4A 3CB4A 2AYMA 3R1LA 2V5HG 3DRPB 1RBOB 1NB7A 3NNAA 2CPYA 2E29A 2ODXA 1GTHA 4FVMA 1SV5A 3MR6A 3VAJA 1WI8A 4Q8FA 4ZCIA 5CYMB 4J9PA 3GCXP 2ACYA 2CUYA 2W9CB 3AD7C 4J9LA 1TV6B 2PEBA 1GAOA 1O0PA 3CIZA 3CD7A 4IFYA 4OI0A 3OXLA 1RT3B 4WFAQ 3RW6A 3VCDA 1ZAWA 5IOLA 1FXRA 3OFFA 5AE2A 2X51A 5HMZA 4DQRA 1UA0A 5HROA 1M1KT 4ANEA 2Z8QA 3JTNA 2XYHB 4D3HA 3CMAS 3RB3A 2NSBA 5F8NA 3GFXA 1VLYA 2QMXA 2V2QA 4J9RA 1SL0A 4B9NA 2DNPA 2QFIA 1TL7B 1RTZA 4QJVA 2B4OA 4CTAA 3ONQA 4DL2A 3QJPA 3D0IE 4A46A 3CULA 2DHXA 3T5HA 3GCWP 4HDGA 4LFCJ 3AQPA 1OSCA 3R9LA 4QU7A 2YX4A 1MW7A 2M52A 4M5LA 4OIXA 5KFSA 4YP3A 1F9FA 1WKJA 2DHAA 3PHEA 3KLEB 1YG0A 4ZP7A 4CLFA 2R3VA 1DRZA 3ILLA 1N5SA 3W2VB 3U02A 3T3FA 1SBRA 3FRZA 3CC4S 3BO2A 2D7SA 2FB0A 3TNVA 1LK5A 2B9WA 3QYYA 5C25A 1UETA 3A4TA 1WHYA 2DIVA 1T9YA 3BN7A 2FC9A 4NYZA 1PAUB 2MY8A 2ZJPQ 1N54B 3O3LA 1HQUA 1H74A 3DI6A 4N7TA 5KG6A 2CPZA 3EZUA 4RNHA 4FXVA 3FGVA 3PM9A 3MEKA 3OTEA 4O0NA 2MQPA 4RW9A 3MPDA 2A1BA 3DGPA 4IFVA 2HIYA 3J80Y 4B3SJ 3LTOA 3BKFA 3PX4A 1X4HA 2HGMA 3O1LA 5H9EJ 3THVA 4LFCF 4OZ5A 2R7OA 5IM0A 3PJ9A 4O4RA 2BQ3A 1U8WA 3KUEA 2PI5A 2DEJA 1KOOA 3AGXA 3NCPA 1T3OA 3FCVA 2GIFA 5HQMA 1L3VA 2R8KA 4AXIA 2HEKA 1X0PA 2VBXA 4NLGA 1ZM9A 1NK9A 2MJUA 3QIPA 2VC0A 2MSTA 3EXCX 4P71A 3NMAA 4URGA 3V6DB 3CJRA 1IKVB 2FHJA 2VASA 3KJNB 3HSZA 1F2HA 4GRSA 4PG6A 1BY9A 3TAMA 4ETZA 1BMQB 4P6QA 1UFWA 2HNDA 5MLCV 1SC4B 2BZ2A 4FN5A 5KG0A 2KKHA 3M8QA 1N0UA 4RO0A 5CH7B 1Y4ZB 3BREA 2PN6A 1VQ6S 3TRGA 1U25A 3H59A 1NKCA 1K1SA 4UY85 5BR8F 3N6NA 2VFVA 1U0HB 5ITHA 2ALYB 5F8IA 1K73T 1JKHB 2MGZB 1PKUA 2XTJP 3N9UC 2I2YA 1Q4RA 2CYYA 4ZHRB 5CQGA 3N01A 1XNQJ 3W5ZA 2P5VA 1RHRB 1R89A 1UW9A 2LXFA 3AFGA 1SQFA 1QTNB 3BPSP 4RJVA 2EFNA 4UOHA 4AUKA 4F4YA 2AMCB 1KR4A 2ERRA 2E9ZA 4WU2A 1NHUA 2GAHC 1CQNA 1RT2A 1FEHA 2BJ9A 4DUTA 5CCLA 1C0UA 3R5JB 4TU9A 2GA7A 5F0WA 4ECVA 1IKYA 4IO9Q 2VJVA 4KPYA 2Q79A 1X9MA 4LF5J 1S7HA 1WUUA 3QT6A 1U2RA 3A3NB 3G4SS 4DV5J 2E5GA 1Q8KA 1DLOB 1VRTB 2ZWOA 2AX0A 1I3OB 5LT5A 3GV8B 3RR8A 1S10A 1FTCA 3ET6A 2CVIA 2ZH3A 4J5OA 4ZPTR 4B3TJ 4UOCA 2BJEA 4ZS6A 2R7VA 3M9MB 2QA4S 2VB6A 3MMAB 4TVAB 3PYEA 4ZDNA 3DNCA 3W8GA 2YNIA 3T6BA 1LNQA 3LANA 1IR2A 1IJEB 2IY5B 1S9EB 2J0SD 1U24A 4RZRA 3Q2TC 4GKKF 2AW0A 3CO9A 2BKOA 2UXDJ 3I31A 1D9AA 1XJWB 2MDAA 1W2IA 2PGCA 5HLFA 3BDEA 3D7SB 4IH7A 1RADB 2LLZA 3HKZD 3ZZPA 4C3LA 5F3ZA 3KK3B 2GVDB 2JEFA 4P52A 1JJCB 1RWOB 4K4WA 3BBFA 3ENVA 5JXSA 4OJHA 1YSJA 3T5JA 3QRQA 2G1DA 2C3MA 3MTJA 2ILZA 2J0WA 4PKDB 3B82A 1U1PA 2HMIB 1I94F 2FC8A 1SCJB 2EW9A 3CD0A 3A13A 3GV5B 2ZH7A 2V4JB 4LRDA 1BWVA 2G0JA 2QO3A 3ILOA 5KT4A 3MUMP 1ITPA 3EE3A 5FIIA 2GJIA 2ZZMA 5HROB 3SDEB 1WOPA 2AZ1A 3TX8A 4Y28C 4WP9A 3Q8QB 4ZLLA 4CH1A 5F8MA 3PFOA 1AZSA 4J37A 2XY7A 1M90T 2M9KA 3TUJC 1EX8A 4FYYB 1UPPA 3FBFA 1VQ7S 4G1PA 4OV1A 2JEIA 3MAAA 2XLIA 2KT3A 1HBOA 3UO0A 5KFHA 3CCVS 2ADBA 2UP1A 3J81j 2YWFA 3HZGA 4F8RA 2UZAA 2OSRA 1S48A 2RKIB 3TJ9A 2CNKB 2KM8B 3JSYA 3V81B 2CJQA 3W64A 4YHHJ 3DYAA 4EK2A 2RUSA 3PCOB 1P9YA 2C3OA 3PRDA 3PYFA 2AU0A 2JFKA 4H4KC 3IM8A 2D1CA 2E1PA 3D6HB 4TYAA 4KHMA 1RU2A 3TEHB 3HHLB 1HIYA 1N33J 2KZMA 1F5CA 2GJFA 2CKWA 3TUIC 3GZ7A 3FZ2A 4FNIA 3G6VA 4K4XA 4FBTA 2VBZA 4JI5F 3EGWB 4I2PA 4Q8EA 1FKOB 3VGTA 4LSZB 2UU9F 2BACA 5KFOA 1URNA 3UD4P 2VFSA 1X5PA 5F0UA 4F3MA 2FGCA 3LA0A 5KFXA 5KT2A 2HBZB 3QATA 3A8JA 4PUOB 4ECRA 3IRXA 2FJAB 4OHWA 1N32F 1IWGA 2JOQA 2NPIA 4CLWA 4PEOA 2RIJA 4YEAA 1TZ0A 2CFXA 1RQ0A 1R8AA 5EX0A 3P8BB 1TR0A 1UJ4A 5CA5A 5K8NA 1F3VA 2N7YA 1VQ8S 3WX8A 1APSA 3SIPB 3HHEA 2B8QA 4WF9Q 3IM9A 1QVFR 1HI0P 1A0OB 1UPMB 2GGPB 2DH9A 2P6SA 3BBCA 2EPIA 3Q89A 4AD6A 3PTWA 4CP5A 4YR2A 2OUGA 1Q8IA 3HHLD 2J0QD 1NHKL 1HA1A 1QE1B 3LO3A 4LSNA 4NLWA 1YI2S 4C8YA 2XSFA 3LP1B 1HPZA 2JL9A 2QZ8A 5KT5A 3HVTA 4OYZA 3P5BP 4NXNF 3E2EA 1VQ9S 4GKJF 3LAMA 5DZ7A 3MHYA 3PJXA 4NLVA 2B3TB 4DV6F 2CNOB 4NCGA 3BGOP 4R5PA 4O0IA 4NLUA 4PXBA 2BBEA 4DR1J 1FVQA 3W62A 2ZKTA 4ETXA 3AY0A 4PWDB 4QIFA 1S6PA 3SV4A 3TJ8A 4EYIB 3CO0P 2BM0A 2B43A 1MROB 3QRRA 2XMWA 3NWRA 3FSYA 2K8GA 2GIRA 2OPSA 3IMQJ 3R6LB 3W66A 5HBMB 3ENWA 2ZUAA 5LSRA 3OTOJ 4DV4F 4K7QA 1FWLA 3KLEA 3ULHA 4HVZA 4Y2MA 4X4QA 1G1XA 2D3OR 5HATA 1IKWA 5HJXA 2LU2A 2V2VA 3GYGA 1RAIB 1CBKA 3OR2B 4B9LA 4OI3A 1WC1A 3NAIA 5DLGA 2HSEB 2CQ0A 3I55S 3UCZP 2HHHF 2KFZA 2ACMA 3FBCA 4KR0B 3W5YA 3TQ1A 5T7LA 4IG0A 4PZVA 3WDOA 1HWJA 2QIFA 1IXKA 2HQ3A 1YZ6A 5ETSA 1B70B 1YDLA 2KO1A 1PAEX 2OPQA 1FRMA 4C98A 3K59A 3ZZUA 3GIKA 2DO0A 3M05A 4BHQA 3BO3A 3G71S 3GONA 5A8KB 1RABB 2ASYA 4DV0J 1LWEB 2L08A 5DS7A 3DLKB 4C48A 1YJWS 1HNXJ 3CDBA 1FKPA 2A3JA 4QWEA 2F8HA 2IBOA 2X1GA 3JQKA 4LQ9A 3R5BA 2BANB 2WCXA 3QAEA 4WBFA 5EDWA 3R1HA 2EWHA 3ZTRA 4I7FB 4UOGA 4I6WA 4EZ9A 5D8HB 3R2CJ 4CO1A 1QAXA 5ETQA 3MAQA 1RAJA 3PEHA 4PWUA 2WAQD 3V4IB 3QGGA 2IAJB 5D0GA 1D9DA 2GQ2A 4F25A 2VFUA 4PYDA 2W2QP 4HACB 3RU0A 3U27A 2PSZA 4YHHF 4EGLA 4F02A 1IWAA 4NYPA 3TA1A 1AA1B 2R2UA 4DUYF 1ZM2A 3NLCA 3I38A 2GVDA 2LQ5A 2DXFA 3UVJB 3LALA 3VGSA 1M5HA 3LZ8A 5GMDA 3KLVA 1VLOA 3K5PA 1PBAA 5KFMA 2KFNA 4OI2A 4CZCA 1L3KA 3AJDA 1CJUB 3D1OA 3ITHA 5CYJA 4X64F 3IBCB 4ECSA 3MAHA 1FFSB 2DISA 2WVEA 2X1BA 2FHOB 2GVZA 2V94A 3D6FB 2J6TA 1F6TA 3M2VB 1GK8A 2M5YA 2QC3A 5H9EK 1S6UA 2PE8A 2VBWA 4LRFA 5BYRA 4ELTA 4JI7J 4DSKA 4E98A 2DH8A 1S1XA 1DURA 4A8QA 1VBZA 4USTA 4LVNP 2V8HA 4TQSA 1I94J 1GMUA 3LP0B 2YPYA 3BYRA 3MPVA 4RU2A 3JSRA 4FF1A 3D2WA 3MM5B 2DD8S 1PYOB 1Y00A 4QR0A 4TLQA 1LXNA 3DYAB 2RU3A 1JX4A 1IKYB 4RNFA 5A6WA 2FUG9 4ZVEA 2MEWA 3IP0A 1JJ2R 1C0UB 4X62J 4K4YA 2QEXS 3KTQA 1RBAA 1M5SA 4OYAA 2HFSA 3FFIB 1GX5A 1YGYA 4YN3B 4O3QA 3DCAA 3HPOA 3HVWA 2YNFA 1N5TA 3CJ3A 5B0CA 2EK6A 1B0VA 2HWIA 2BRKA 3GSIA 2E44A 3VTIA 5F41A 4ELVA 5LOQA 4DV2J 2K7JA 1FDDA 2O3DA 3OTOF 2K06A 1YJTA 3EDRB 3DKDA
chains in the Genus database with same CATH topology
2QLDA 3AGXA 3AGYA 1NLTA 1C3GA 3TJAA 1GMUA 3L9ZA 4J80A 3LA0A 3NXZA 3AGZA 3I38A 3TJ8A 3LZ8A 3TJ9A 2Q2GA 1EB0A 4L3KA 1GMWA 1XAOA 3NY0A 2B26A 1EARA 1GMWD 1GMVA 2HFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLD A;  3AGX A;  3AGY A;  1NLT A;  1C3G A;  3TJA A;  1GMU A;  3L9Z A;  4J80 A;  3LA0 A;  3NXZ A;  3AGZ A;  3I38 A;  3TJ8 A;  3LZ8 A;  3TJ9 A;  2Q2G A;  1EB0 A;  4L3K A;  1GMW A;  1XAO A;  3NY0 A;  2B26 A;  1EAR A;  1GMW D;  1GMV A;  2HFV A; 
#chains in the Genus database with same CATH topology
 3VVU A;  2X3D A;  3KHR A;  1I6J A;  2APO A;  2YPZ A;  2OFG X;  4OZN A;  3DRS B;  3TJA A;  4WFX A;  4Y2K A;  5K8P A;  4PUO A;  3GP9 A;  2L9D A;  5DDO C;  4EFA C;  3KJV B;  5LMN F;  5DDP C;  1I51 B;  4KGX B;  2KRR A;  2XCA A;  1P6T A;  3OR1 B;  1KVI A;  1WDT A;  4RU9 A;  1NK6 A;  3NCR A;  1SH2 A;  2ZVI A;  3D28 A;  3FDS A;  1VJQ A;  2L41 A;  1RT7 B;  3VAF A;  2IRX A;  2CPJ A;  1KNZ A;  1U1M A;  1EQ0 A;  1U26 A;  1XNR J;  4NXM F;  3CJ4 A;  3HXM A;  4JI3 J;  2XZW A;  4QR2 A;  1K44 A;  3H8Y A;  5ETL A;  1YTY A;  4HKQ A;  3OFG A;  3K5M A;  3QLH B;  4LBP A;  2JFD A;  3OUY A;  3MED B;  3C6T A;  1F5B A;  2IDL A;  3UNG C;  4L3N A;  1HPZ B;  2PD1 A;  4P9S A;  4QIE A;  1AXQ A;  4TU8 A;  3ENA A;  2UVU A;  4JV5 J;  2AEM A;  1CJV B;  5BR8 J;  4W92 B;  3AOD A;  2RRA A;  1N32 J;  2J9E A;  4DX8 H;  2KM8 C;  3NS7 B;  4X65 J;  1IJF B;  2HNY A;  2Y9H A;  3C14 B;  1LW0 A;  1SJQ A;  2EI5 A;  3CJ2 A;  4KIA A;  3GG0 A;  4ECZ A;  2YNH A;  2XB2 D;  3KUG A;  3IR5 B;  4USM A;  3V81 A;  2M8H A;  4DR4 F;  1NJZ A;  1JXE A;  1VIO A;  3OTB A;  4MYT A;  3B54 A;  4EO6 A;  4B3M J;  1AYE A;  1F9E B;  1SJR A;  2BJ8 A;  4QR1 A;  2LEC A;  1NZ8 A;  1W7W A;  2MZJ A;  3TZZ A;  1S99 A;  2WVD A;  3ISZ A;  5G0R A;  1FRL A;  1YHQ S;  2RE1 A;  2QL7 B;  3MEG A;  3EMT A;  4DG1 B;  6AT1 B;  4P7V A;  3KHL A;  4B9V A;  1ZZF A;  3SYZ A;  2R42 A;  5G4D A;  4X2B A;  1TKZ A;  1FNX H;  1U45 A;  4IG3 A;  1T02 A;  1REG X;  1S7I A;  2MXY A;  4P2M A;  4CDI A;  1RTH B;  3VQS A;  2CVE A;  4JI0 J;  2OEJ A;  2J5A A;  2RKI A;  1JLG B;  5AT1 B;  2C28 A;  3MOJ B;  1TUG B;  2B4P A;  4G65 A;  2IYG A;  2IC3 A;  4P75 A;  4CT9 A;  1GXL A;  2DNK A;  4Y2A A;  2AJ4 A;  1HYS A;  4V19 X;  2LYV A;  3POT B;  4IO1 A;  1X9W A;  3F41 A;  3KLH A;  1RAE B;  1RU1 A;  2KVQ E;  3E01 B;  3M8Z A;  3MCO A;  4DL3 A;  2FHM A;  3OQ2 A;  1Q0N A;  1U02 A;  1Y0H A;  1RTI B;  1S1W B;  3C16 B;  1QAY A;  2OEK A;  3K8V A;  2RDJ A;  4FDF A;  1YRX A;  3M8P B;  1S12 A;  2B6A B;  1WC5 A;  2F7V A;  2YVS A;  3K2Y A;  1DTQ A;  4S0M A;  1ARO P;  3RAM A;  2IMO A;  1HAR A;  4RW6 B;  4K0K F;  1N36 J;  1TQL A;  2QV6 A;  2WSC C;  1FNO A;  1RA7 A;  1YK9 A;  2ZEJ A;  1FEE A;  3BH7 B;  4DUZ F;  1HI8 A;  3TAN A;  2Y1R I;  1M5O C;  4JI3 F;  4ED4 A;  1HWI A;  1GXU A;  2FDN A;  1S4F A;  3NKY A;  3F73 A;  1HI1 A;  1VDH A;  3SFG A;  1WWH A;  3W2W A;  2IHR 1;  4WJB A;  3HF5 A;  5THW A;  4M5I A;  4BWJ A;  5HLF B;  4EEY A;  1JJ4 A;  3QO9 B;  2Q66 A;  5AXK A;  3JAM U;  4ZN1 A;  3TZY A;  1Q81 T;  4G3I A;  3SFU A;  1EP4 B;  1X5O A;  2WON A;  1Q82 T;  2NRE A;  1XIQ A;  4OX7 A;  1CUL A;  3AJ1 A;  3I32 A;  2R2T A;  3HHN B;  4RBU A;  2ZH4 A;  2N4C A;  3D5M A;  2OP5 A;  2WRM A;  2B4U A;  2BUN A;  2DY1 A;  4OI6 A;  5AXN A;  4DSJ A;  2JZ5 A;  4DR3 F;  2BW7 A;  2VDI A;  1ICE B;  2BE7 D;  2V4J A;  3IA0 A;  4ZVF A;  5ETP A;  2UXC F;  5LMU J;  5B0A A;  4EBD A;  1TVR B;  4KH1 B;  2VPZ B;  1JLB B;  4LFA J;  5L46 A;  3EPG A;  2V8P A;  3PXG a;  4PXC A;  2BJ1 A;  2H54 B;  3D1Q A;  1CQM A;  1JK9 B;  2JLE A;  4JBC A;  2IJR A;  4WP8 A;  5T7L B;  1RHM B;  2KYX A;  1C1B A;  4CNY A;  2AYG A;  3DLE A;  2ZKU A;  4RBV A;  5HMX A;  4DV3 F;  5J2N A;  3CME S;  2F3J A;  5GAH U;  3ZZR A;  2NQP A;  4F67 A;  2GO8 A;  4QW9 A;  5FDL A;  3KK2 B;  2HKE A;  3CJK B;  1RKI A;  4LRC A;  1RSC A;  3GMG A;  4I68 A;  2LEA A;  4E8U A;  5AJ3 F;  2KI2 A;  5LMU F;  4ZCL A;  2QLF B;  3Q8P B;  3M2U A;  2P6T A;  2YKA A;  2H51 B;  4IH5 A;  5IT9 Y;  4WFY A;  5KFV A;  3ZZO A;  1KTV A;  4X4S A;  4YR3 A;  2VOP A;  1UW4 A;  3IO1 A;  1UMJ A;  5A76 A;  5DGB A;  2QTW A;  4KT0 C;  1L3U A;  2CJ9 A;  3W60 A;  3LGH A;  2O01 C;  2UVR A;  2IM1 A;  2J7K A;  1H6K X;  2NUU G;  1RJJ A;  3MM7 B;  5IV4 A;  3W63 A;  4H4O B;  3BH6 B;  3AGZ A;  2W25 A;  1VHI A;  3ELH A;  1T95 A;  2G0C A;  2QLW A;  3LUY A;  1RWV B;  3NCQ A;  4C7Q A;  1R0A B;  1SKW A;  2UUB F;  4J7C A;  3MEE A;  5JUM A;  2WBR A;  3KOA A;  4ZVG A;  4XAK A;  5A8R B;  3C15 B;  2L9N A;  2CNN B;  3G82 A;  3UDE A;  3T9Z A;  5B08 A;  5KT6 A;  2ALZ A;  1HBM A;  1N0V C;  4DUZ J;  3EVM A;  4ECT A;  4B3O B;  4UZC A;  5CYM A;  2HW3 A;  3UI3 A;  3NY0 A;  2GFF A;  2IM2 A;  4WKY A;  4RL1 A;  2VOO A;  2CQP A;  3AB2 B;  2DGO A;  3MMC B;  4USI A;  1S1V A;  1YJ9 S;  1U4B A;  1FJG J;  3MF5 A;  1BWE A;  2ROE A;  1Q8L A;  3KJQ B;  5GAE I;  1KN6 A;  5EWE A;  2DYA A;  3C14 A;  4NZ0 A;  2V68 A;  3Q0A A;  4M95 A;  2Z58 B;  3MMJ A;  4BBY A;  1GFW B;  2HNY B;  5E3A A;  1TAQ A;  2AYB A;  1UFK A;  4DCP B;  3LP1 A;  4WWS A;  1HR0 J;  3RBD A;  5IFM A;  5KFF A;  3OVA A;  4PG4 A;  1FJG F;  1KLM A;  3UR0 A;  1RHQ B;  1I5O B;  2BW2 A;  4OYP A;  3O44 A;  1S9F A;  4CH7 A;  4RW4 A;  2YNF B;  1TTH B;  3BF4 A;  3G8Q A;  4DXL A;  3AQO A;  3FFI A;  1LW2 A;  1C1C B;  3OHB A;  2HFZ A;  2P9G A;  3MDF A;  2CQB A;  3F0N A;  2U1A A;  1FDA A;  1FTR A;  1MG7 A;  4KHR A;  2XI2 A;  4WIQ A;  5I4M A;  5KFE A;  3GJS B;  4HYK A;  2FPH X;  2JVO A;  2Y0B B;  2QL9 B;  1ZPW X;  4DPY A;  4YOE A;  1TL5 A;  4KY3 A;  1EQM A;  2AKW B;  3OHA A;  2Y1L B;  2ZBR A;  1GEH A;  3DMJ B;  2RDD A;  4I4B A;  3H5Y A;  4F04 B;  1SC6 A;  3KWM A;  3MWB A;  2KH9 A;  4F2S A;  4EUV A;  3LP2 A;  4LRE A;  5GAE U;  1AB8 A;  3T1A A;  1U0S A;  1PYS B;  2B56 A;  2SXL A;  4DR4 J;  2GJ2 A;  4RW8 A;  4DS4 A;  3CCE S;  1Y3K A;  4Q45 A;  5D4O A;  1XBW A;  2H4Y B;  2OPR A;  4ECX A;  1S1T B;  1Q79 A;  4DZD A;  2MQO A;  3E8O A;  3IGV A;  3MM6 A;  4FPI A;  4DOZ A;  4EI2 A;  2XO6 A;  4ZN3 A;  2JEG A;  4LF7 J;  2IPO B;  4ZOS A;  1WC6 A;  2DHH A;  3FC9 A;  1RTI A;  5AJ3 J;  1RTD A;  1UJ5 A;  4NEY A;  3CMQ A;  4IKA A;  1BQM B;  5A8K A;  2POK A;  1OQ3 A;  2ZZN A;  2ZM6 J;  4F36 A;  3I5C A;  4CLZ A;  5A6P A;  1HNZ J;  1FRJ A;  1MMD A;  2V34 A;  1C0T A;  4Y00 A;  4I7F A;  2XQC A;  4M94 A;  1IBC B;  3OW2 R;  3RRG A;  4CI0 B;  1OPI A;  1CJV A;  2NZ4 A;  1XNR F;  3NGU A;  3R27 A;  1VRU B;  3I4P A;  4GVB A;  2EBG A;  1GX6 A;  2BE2 B;  2W8K A;  1W2B R;  1RWW B;  3IN5 A;  2YKN B;  1MWY A;  1KWM A;  2XUL A;  2YNH B;  2W1B A;  4KB7 A;  4KO0 A;  1KDN A;  1LW0 B;  1YBT A;  3OJS A;  5C2G A;  4LUB A;  3J7A N;  5T41 A;  1JQG A;  3FRY A;  2CJA A;  2MKC A;  3DOK B;  1CJT B;  2E7V A;  1PYT A;  2RRB A;  2MY7 A;  2ZOM A;  3FCW A;  3FKB A;  2C3Y A;  3QGI A;  3WZ0 A;  3QRP A;  4ECQ A;  1N5V A;  3V6H A;  4PAB A;  4DZ6 A;  3CCQ S;  1X4B A;  3O6Q A;  3PRV A;  1FRX A;  1V5V A;  1TAU A;  2GCF A;  3MEG B;  1ZM3 A;  2XBP A;  4DX5 A;  3GPA A;  1X5T A;  3H4B A;  4JYA J;  1N34 F;  2LDY A;  3L4B C;  5IV3 A;  1YBU A;  1T05 B;  4LF6 J;  2HAI A;  2PFD A;  2V4Q A;  2MLX A;  3NGT A;  1G4C A;  1UP1 A;  3E3X A;  3K57 A;  2C2D A;  2GHV C;  1P27 B;  4Q43 A;  1NK8 A;  2C3P A;  2B5J B;  2RH3 A;  4HTI A;  4J9V A;  2RML A;  2Q3P A;  3IC1 A;  4M5D B;  2ZZT A;  5C24 A;  2K3I A;  1N48 A;  2IC3 B;  4X66 J;  3MD1 A;  1X5S A;  2G1H A;  2M8D B;  1JKH A;  2MGZ A;  1Q53 A;  3LH2 S;  3PO5 A;  3E01 A;  3ZC4 A;  4JUZ A;  2VQE F;  4A4J A;  1WNE A;  5HMW A;  3PW7 A;  1J5O B;  1HYS B;  1TMM A;  3EJM A;  2W2M P;  1VIS A;  2OMO A;  3OVB A;  4H4M A;  2LMI A;  2KJV A;  1FO1 A;  2BM1 A;  2DO4 A;  4K5S A;  5L1J A;  4C8Z A;  2V63 A;  3D66 A;  5B0E A;  1WEZ A;  2CXE A;  2M70 A;  4UQT A;  1SL1 A;  4M63 A;  2YNI B;  3IBW A;  5KFL A;  1UVM A;  4M5H A;  5KG1 A;  3DRY A;  4CLU A;  3DLJ A;  1PJ6 A;  3M1V B;  4DHV A;  3M8R A;  5E7O B;  4E0D A;  3CD6 S;  3HO1 A;  3I56 S;  2XGP A;  5JVH Q;  1DQA A;  1V5I B;  2ZE2 B;  1KEK A;  1NB2 A;  4ZPB A;  2W9A A;  1K8A T;  4LFB J;  2HAF A;  3VV2 B;  1VK8 A;  4FZV A;  5DZ6 A;  1T05 A;  1RTJ A;  2IJN A;  3DRS A;  3HCX A;  6FD1 A;  2YKO A;  5F8L A;  1UVJ A;  3W9H A;  4PYA A;  4C8M A;  2A6O A;  2KT5 A;  3QZ8 A;  2WK4 A;  2MPU A;  1WOR A;  2ZD1 B;  1VQO S;  2HHS A;  1DJ0 A;  4YQW A;  3AKO B;  2C2K B;  2E5L F;  2F9J A;  3DRP A;  5EWF A;  3QO9 A;  4NLT A;  4P7T A;  1TK0 A;  2R7Q A;  3GG1 A;  2PII A;  1HD0 A;  1VCT A;  3M8Y A;  2DHG A;  2X1A A;  1GMV A;  4OQJ A;  1T7P A;  2B7C B;  1RKJ A;  1QAI A;  2YKM B;  1D09 B;  5A2Q U;  2DRA A;  2G2Z A;  4USW A;  2YQ1 A;  3D54 A;  1FHT A;  3I9V 9;  1YRU A;  2DNL A;  4OX8 A;  1X4D A;  2FZG B;  2PA3 A;  2VIH A;  1IBM J;  3TR5 A;  1RE1 B;  3GV7 B;  5D0R A;  3EGZ A;  4X65 F;  2GQC A;  2M2B A;  4DPT A;  2CQH A;  1OJ4 A;  1IN0 A;  4DV0 F;  4DQP A;  1B7F A;  2JDJ A;  1FD2 A;  2W4P A;  3DRX A;  4TN2 A;  4XDC A;  1ZYQ A;  4JI2 J;  2A18 A;  4CLT A;  1BQN B;  3TVY A;  3M8S A;  2FLO A;  3BKU A;  4NLX A;  1F60 B;  1SJ1 A;  5BXI A;  4ICL B;  1LW2 B;  1E6V A;  2F8M A;  1IM4 A;  4HI2 A;  2FLL A;  1QTM A;  5JVG Q;  1KQG B;  6FDR A;  4UY8 T;  1TFY A;  4ZIT A;  4ILR A;  2HVD A;  3DOL A;  2XLJ A;  2AGP A;  1KOH A;  3ISN C;  4CLK A;  2GX8 A;  2HFV A;  3HHD A;  4OX6 A;  8RUC A;  1LKZ A;  1ZS6 A;  3MUV P;  1B0P A;  3J7Y I;  4ED8 A;  3IBF B;  4FYX B;  1Q5V A;  2KFY A;  1WEL A;  3IRX B;  4KGM A;  2YH1 A;  1FJE B;  2DNZ A;  1EKR A;  1OO0 B;  1RHK B;  1U8S A;  3D3B J;  4AQY F;  2B51 A;  3M9N B;  2R7W A;  2VUG A;  1NDL A;  4IR9 A;  3CF5 Q;  1P9Q C;  3P49 B;  4QYZ K;  1XMQ F;  3VGV A;  4IRK A;  1OPZ A;  4CYU A;  2DGW A;  1SJ3 P;  4WYL A;  3BDP A;  2D3O 1;  5KFU A;  4CH0 S;  5D15 A;  4P10 A;  1IQZ A;  2MMY A;  2AJ2 A;  3FQK A;  4I6A A;  4DV2 F;  4F4A A;  3LWL A;  1D1U A;  2FJX A;  5FLX U;  3PVX A;  2E9T A;  1QY7 A;  2WBM A;  1VRQ C;  3H5S A;  3JSM B;  3PEJ A;  1YLX A;  2JVM A;  2CJB A;  1E6Y A;  1NDK A;  4O4G A;  4M5N A;  2YWH A;  4KBI A;  4YB5 A;  2FVP A;  3D1H A;  4NCG B;  2LEP A;  4R5P B;  1B4S A;  2O66 A;  2VG5 A;  3GIR A;  2Y8W A;  5CD4 H;  1BD6 A;  4RNO A;  4W98 A;  5KT3 A;  1Z4U A;  4NL5 A;  1NO8 A;  5CCM A;  4OJ3 A;  4JI8 F;  1R0A A;  3QFH A;  2Y1I A;  5HBM A;  3UN3 A;  5J1P A;  3F44 A;  4OJG A;  1K9M T;  3SMZ A;  5CD4 A;  2Z0G A;  3DFE A;  5F8H A;  1O51 A;  2KTQ A;  1T03 B;  1O8B A;  2BV3 A;  2AP6 A;  2EK1 A;  4ZLP A;  4YB1 P;  2FVR A;  2FVS A;  4RNN A;  4N56 A;  2RF2 B;  3CPW R;  3Q8U A;  1NLK L;  1Q1K A;  2GS8 A;  2BE9 B;  2CPH A;  2VV5 A;  3JAM Y;  4ZJQ A;  3PR5 B;  2R9L A;  1B0T A;  5IQQ A;  1T3N A;  2Z2Y B;  3ILI A;  5T14 A;  1VQP S;  1S1V B;  4UOF A;  1ELO A;  4B3R F;  3CCU S;  2R7T A;  1K0T A;  4QQB A;  2PC6 A;  1PIL A;  4HH1 A;  4Q2M A;  2E5L J;  4DUY J;  4PWD A;  2FYX A;  3QJJ A;  2RNE A;  1UVI A;  3CDE A;  5C2C A;  4IG0 B;  1F9H A;  4XIU A;  2NYH A;  2HVZ A;  2ZBI A;  1KC8 T;  1MN7 A;  3CTR A;  5E3R A;  4FS2 A;  4DSL A;  1UWB A;  5K14 A;  4XTT A;  1LWE A;  4ID8 A;  2B9X A;  3UNY A;  5B09 A;  1JLC B;  5DET A;  2ZH2 A;  3MMB B;  4CIO A;  3ISN D;  2I8E A;  2JRS A;  2ZDO A;  1JIH A;  1RI7 A;  4H4M B;  4FVC A;  3UDC A;  3V5R A;  2LQJ A;  4U6P A;  1J5O A;  2VOD A;  1WF1 A;  1H0H B;  1REV A;  1RWU A;  3KYL A;  2DNM A;  4CLY A;  2IAJ A;  2GHP A;  1VGY A;  1Z1Z A;  1F0X A;  4K4Z A;  3QMQ A;  3NNH A;  1BQM A;  1HWL A;  1SIZ A;  4F50 A;  4XK8 C;  4L72 B;  3PFE A;  3VWS A;  1RWK B;  4YB7 A;  3EGV A;  5FJ4 A;  2R2S A;  3KG0 A;  2VQE J;  2B9Y A;  3THT A;  2XGQ A;  4DLG A;  4OJ1 A;  1X31 C;  3DRR B;  3HVT B;  4X4O A;  2ADC A;  5D0H A;  1YJN S;  1S5Z A;  1PJ5 A;  1QSY A;  2OAU A;  3JQM A;  2V2Z A;  4PWW A;  4DX7 A;  4RUC A;  2MQ8 A;  1PSD A;  2YKQ A;  3VZH A;  5IQ6 A;  4HH0 A;  1S6P B;  2L3M A;  3O8W A;  4TLR A;  2E66 A;  1U09 A;  2J0X A;  1WD6 A;  1YBA A;  2JSX A;  3SCJ E;  4HDH A;  2A2C A;  3ZNU A;  3KK3 A;  5FD1 A;  2RQC A;  1XTZ A;  3LPE A;  3CCJ S;  2EC0 A;  4DR2 J;  3M30 B;  3T5K A;  3D67 A;  4JYA F;  3H20 A;  3P6Y C;  3ZTS A;  4DV4 J;  3R8Y A;  4MKV A;  3L09 A;  4O23 A;  4YDX A;  4ZP9 A;  4F4Z A;  4RUB A;  1NXI A;  2OGU A;  2E9R X;  1XEZ A;  1S1X B;  2OHD A;  5KFY A;  2DJW A;  2B9E A;  4P73 A;  2HBQ B;  2OD6 A;  5HMY A;  3W3S A;  3UDV A;  2HRT A;  4DR1 F;  2VPX B;  5K9F A;  2DR5 A;  4AL6 A;  4BDP A;  4F2R A;  4OYW A;  3OL8 A;  3CT9 A;  2PT0 A;  4AQY J;  1MSW D;  2LXU A;  4GKJ J;  2NS1 B;  1GTE A;  3ITH B;  1RYS A;  1AZS B;  3C3L A;  4NA3 A;  2RUG A;  3MGJ A;  3DLB A;  4LF5 F;  2OD4 A;  3LGN A;  2Q43 A;  2ZOF A;  3M2V A;  2MLY A;  2AHO B;  5E33 A;  5H1S V;  2CJY B;  2LKZ A;  1TFW A;  2R4F A;  5ETV A;  1WSV A;  4MFB B;  1WG1 A;  4BWM A;  5KFP A;  4IQX A;  3C2P A;  4ZP6 A;  4LBI A;  1LV5 A;  2HGL A;  1HNZ F;  4AL5 A;  4USV A;  1NSP A;  4N8O A;  5HAN A;  1X4F A;  3JB9 k;  2CWX A;  3FSX A;  5LL6 d;  3JTO A;  4NI2 A;  5E0O A;  1DTT A;  1RHJ B;  4PXD A;  1WKL A;  4Z7Y A;  3CC2 S;  1RAG B;  2NXJ A;  2VZ9 A;  3HMJ G;  2F4V F;  2DNO A;  8AT1 B;  1OYD A;  1GT8 A;  3AH6 A;  1VQN S;  2MHN A;  5F8J A;  5M2U A;  3CW2 C;  2VIC A;  2IIH A;  4F26 A;  5JJB A;  1HNW J;  2WSF C;  2XI3 A;  4LRA A;  4M5D A;  3MCN A;  5J2Q A;  4CO3 A;  2IYI A;  5KFR A;  2GNK A;  2N3L A;  5A0Y B;  5EHH A;  2VDH A;  2QRR A;  5LXY A;  1XR6 A;  2DNY A;  3V6K A;  2KG1 A;  3UQS A;  3B8H A;  1PG5 B;  3C6T B;  4WYW A;  1KTQ A;  4DEZ A;  2BVZ A;  1OIA A;  3DLK A;  1FF2 A;  4QPT A;  3I0R B;  5C42 B;  3WQP A;  1S1T A;  1ZTT A;  1N6Q A;  2DVI A;  1BQX A;  1U6F A;  4R0J A;  2Y3Y A;  3TZX A;  3S7R A;  2W4C A;  2BMB A;  2QYG A;  3ZZY A;  1GQE A;  4UT4 A;  4NLS A;  2PDA A;  4DV1 J;  2CDQ A;  5GAD U;  2KXN B;  1T0T V;  1U7L A;  1IR1 A;  3JTP A;  5ETK A;  4LFB F;  2RHS B;  1TKX A;  2EG1 A;  3A3O B;  2BA9 A;  3MR2 A;  1UJ6 A;  1C0T B;  2Y1J A;  4NCB A;  5H9F K;  4TQR A;  1VBY A;  2FHJ D;  4FYW B;  3SQO P;  1Q7Y T;  1HR0 F;  3VAK A;  4GVL A;  5J1E B;  1TKD A;  1HD1 A;  2YNG B;  1SKU B;  1B99 A;  1Y5I B;  1TV6 A;  2DRD A;  1KHV A;  2U2F A;  5KFB A;  3GWC A;  4K4U A;  4N77 A;  1NKE A;  1PJ7 A;  2R7R A;  3BQ1 A;  1T9V A;  3PX6 A;  1RCX B;  4NA2 A;  4URS A;  4Y34 A;  5KFI A;  5DRK A;  5M2P A;  2BQU A;  1G7C B;  2B8P A;  1IR0 A;  1WC3 A;  4AFF A;  4DF8 A;  5J2P B;  4H54 A;  3CJQ A;  3IAS 9;  4DFK A;  4DR6 J;  3GJQ B;  3I0S B;  2Z56 B;  1R27 B;  4I69 A;  3QBC A;  4PQA A;  1IQT A;  4ZPD A;  3TAQ A;  2C2Z B;  1SKR A;  5KOW A;  1VQ4 S;  1H7W A;  4HT5 A;  1Z2Z A;  2V9K A;  2UXD F;  3NL0 A;  4DPW A;  2I5J B;  2NYI A;  3TEG A;  2UUW A;  3H0P A;  2VG7 A;  5D78 A;  2EKY A;  1CJK A;  4NRU A;  3W61 A;  5KFJ A;  4A8X A;  3BQ2 A;  1TKT B;  3KFW X;  4B9S A;  2ASD A;  3RAQ A;  3CJ8 A;  3D4J A;  2HHV A;  5G0R B;  1N8R T;  1VQ5 S;  1X4G A;  2BX6 A;  4WTY A;  4NX9 A;  2KYZ A;  1MML A;  4D3G A;  4IFV B;  3EZ5 A;  1RT1 A;  3OSP A;  3UD3 P;  3H2L A;  2AJQ A;  4RW6 A;  4ZVP B;  1TKZ B;  3DLG A;  1ZA1 B;  2C1E B;  2M7S A;  4EMD A;  5A2Q Y;  4RW7 B;  4DV7 F;  3BV8 A;  2XWY A;  4KHP F;  1HQU B;  2NCK L;  3DI6 B;  4WXO A;  3MFH A;  3K7R A;  2DR7 A;  2DGQ A;  1DQ8 A;  3GU0 A;  2CQ4 A;  5B0F A;  3ZNJ 1;  2JZ8 A;  2XMK A;  2AQ4 A;  1PC5 A;  1UFL A;  2DHS A;  4DCJ B;  4YB6 A;  1NJX A;  4X4R A;  1TL1 B;  4O3O A;  1X4A A;  3JS9 A;  4DV3 J;  1XNQ F;  1N52 B;  4KKO B;  1NK5 A;  4ID5 B;  3ETM A;  1BLU A;  5KFN A;  3OVS A;  1VQL S;  4B08 A;  3M8P A;  2Q2G A;  2GIQ A;  1N5Q A;  2CPX A;  3DLL Q;  4LFA F;  2XS2 A;  4X4N A;  1ZBT A;  2WON B;  1GMW A;  3CJ5 A;  3HLU A;  3CCM S;  4KHP J;  2OML A;  4DV7 J;  5EX3 A;  1KQK A;  3QQC D;  4LF7 F;  2LQB A;  3J81 U;  1RB0 A;  4G6V B;  4ZHR A;  1ACM B;  2OPP B;  1U1Q A;  4Y3C A;  1X4C A;  3RRK A;  2OEM A;  5C7P A;  3V6D A;  4J91 A;  3QT7 A;  2EBE A;  3GTY X;  2V8D A;  1UAW A;  4C8K A;  4U8Y A;  1G3O A;  4KTQ A;  2DNH A;  1TL7 A;  2HQI A;  1RT2 B;  2NUH A;  1JLA B;  3FMB A;  1GNK A;  1S9G A;  4HI1 A;  4DL4 A;  1VQM S;  1D8Z A;  3QWU A;  4L73 A;  2HQF A;  3FBE A;  2G4B A;  2K7K A;  3PRB A;  3HFK A;  3RAX A;  1VC0 A;  3SI8 A;  1TUW A;  1KVK A;  2VD3 A;  2RDI A;  3H5U A;  4NZ6 A;  4DFP A;  3B6B A;  4A48 A;  2N4D A;  1WG5 A;  4I0W A;  4EBE A;  4JV2 A;  4YS2 A;  2FD2 A;  1H2V Z;  3DM2 A;  4CWB A;  3HUL A;  2CJK A;  1RT5 A;  3NOG A;  2R7S A;  5FLX Y;  1U1O A;  3H98 A;  1N5Y B;  3POT A;  2AJF E;  3BSA A;  2I6W A;  3VVT A;  4ICL A;  4A47 A;  3M4X A;  4DR6 F;  4X4V A;  2GML A;  2E5I A;  1TU0 B;  1UVK A;  3HSJ A;  3LOU A;  4H4K A;  3M9O B;  1HFE L;  2GC8 A;  3PV8 A;  2XZT B;  4DMZ A;  1RCO B;  3KG4 A;  3K5L A;  1QUV A;  2QSW A;  5K5M A;  1WOS A;  4P2S A;  3J7Z 5;  5E3Q A;  1ULR A;  2ZUG A;  1XC9 A;  4J80 A;  3HDS A;  4USU A;  3Q23 A;  4ILL A;  3AOA A;  4X4U A;  4AYB D;  1VS3 A;  5A0Y A;  1KHW A;  1B3T A;  4UF4 A;  3OSN A;  1JLC A;  1VBX A;  2DR9 A;  3J7A 1;  5J2Q B;  2OO4 A;  2FY1 A;  2UUC F;  2D41 A;  1TEL A;  3HD2 A;  4JP8 A;  5H9F J;  4OL8 A;  2K3K A;  4JV1 A;  4QCL A;  3P45 B;  3BGR B;  4OZJ A;  2AF6 A;  3PDN A;  3NAH A;  1Y10 A;  1N6Q B;  5IT4 A;  3KLH B;  1SVD A;  1S6O A;  1YWX A;  1ZM4 A;  2HFN A;  2M88 A;  3ETO A;  1H7X A;  2I38 A;  3BGU A;  3M2R A;  3M6V A;  4CLP A;  2W01 A;  1S9E A;  2C22 A;  1EHW A;  4ENO A;  3R5G A;  5DG8 A;  3MMC A;  5LXR A;  4X4P A;  3OL7 A;  2H5E A;  3CCS S;  1ZTW A;  2MKS A;  4ZLJ A;  2B6A A;  4OYM A;  2JLF A;  4R25 A;  5CHC B;  5E3C A;  3S01 A;  1Y11 A;  3B4M A;  4WXW A;  1WI6 A;  4B3M F;  1R0C B;  1A6L A;  3G82 B;  4F0M A;  1KLM B;  1N88 A;  2KB2 A;  4C0B A;  1K0V A;  1IKX B;  1PBU A;  3GIL A;  1WTF A;  2E1A A;  1WSR A;  2CNL B;  2Q6C A;  3C8Y A;  2HND B;  2LVW A;  2QA1 A;  2YX7 A;  4OHV A;  4TY8 B;  4WK3 A;  5J2N B;  2NPF A;  4K4T A;  1EP4 A;  4P72 A;  5DLF A;  1QJH A;  2CZV C;  4MFB A;  3RBX A;  3H40 A;  2V50 A;  1CSJ A;  5HVH A;  4JV5 F;  2F4F A;  5KG3 A;  3WIV A;  5E41 A;  4USH A;  2I1R A;  4K8R A;  4CO4 A;  3PW4 A;  2F1F A;  3I5A A;  1HW9 A;  1PIE A;  2GW8 A;  3AB4 B;  4I2P B;  5LSL A;  5HI7 A;  3M2U B;  2N3O A;  5DM7 Q;  1X9S A;  3TO8 A;  2V8V A;  4OZL A;  3UE2 A;  4FPR A;  2MZQ A;  2FJB B;  4WFN Q;  3H25 A;  1KQS R;  5HVF A;  1IBL J;  2FLP A;  4LF4 J;  1WEX A;  3IWL A;  1JLF A;  1HWK A;  1TVR A;  2FIU A;  1RIS A;  2XHC A;  3LQV A;  1DTT B;  4QBU A;  5A8W A;  2ZHA A;  4JI4 F;  1ZAV A;  1KQF B;  4NOH A;  2XMT A;  4HL9 A;  4F0H A;  2UXC J;  1U6B A;  2XYP B;  4DR3 J;  2DPI A;  4QU6 A;  4H4O A;  8ATC B;  2XZD B;  2DTJ A;  1X60 A;  2C2N A;  1M5K C;  4MIW A;  4FS1 A;  2EC2 A;  3RGI A;  2OTL S;  2UUA F;  3VAM A;  3DN9 A;  3D0G E;  3HZE A;  4P2X A;  1RLD A;  3CDA A;  1FXL A;  1RTD B;  2RAQ A;  5L1K A;  1FDB A;  1WEY A;  1PCA A;  3R7N B;  4RBT A;  5F9N A;  5F8G A;  4WCE Q;  3Q22 A;  1GMW D;  1XK8 A;  3CDW A;  1BGX T;  4IYQ A;  5ETN A;  1HHQ A;  3M6X A;  1XR5 A;  3VQT A;  5CAB A;  5I3Q A;  2ZH1 A;  2H48 B;  2XMM A;  2BRL A;  4MIA A;  2DCU B;  2FLN A;  2ZIT A;  4KH0 B;  4U7C A;  2HIQ A;  2DPJ A;  2H1Y A;  3L7U A;  5KTQ A;  4IQM A;  4F7V A;  3NRB A;  1SUQ B;  3MM8 B;  4ITS A;  1OYE A;  4J90 A;  4KKO A;  4MT1 A;  4X62 F;  3MM9 B;  3PR4 A;  1UVL A;  3AD9 C;  4ED3 A;  5D0E A;  3RUB L;  1EKS A;  1LQ9 A;  1JJH A;  3HVA A;  1HWU A;  3W65 A;  4EO8 A;  7AT1 B;  4J9Q A;  1WHV A;  2F65 A;  2UVV A;  3NWG A;  4KGV B;  4FP9 A;  5HP1 B;  1O5J A;  2YQ0 A;  5C42 A;  3G87 A;  2W7P A;  2R8G A;  2YWE A;  2CG8 A;  1VMB A;  2QLJ B;  3DGP B;  4LMZ A;  1S57 A;  4RUH A;  3EVO A;  4J9U E;  4RW4 B;  1JMT A;  1L3T A;  1NM2 A;  2XMU A;  4EU0 A;  4I67 A;  3RRH A;  4OYX A;  2HWT A;  2HS3 A;  4ECY A;  1CUL B;  1VRU A;  4GVB B;  3M30 A;  5HN0 A;  1DBD A;  1QSL A;  1KP6 A;  2J6U A;  3C66 A;  2ZFH A;  3NBP B;  5L38 A;  2B7B B;  4DU8 A;  3EDQ B;  4RX6 A;  4Q5V A;  2MKI A;  3QIP B;  2V9W A;  4USJ C;  5CZX A;  4ZIW A;  4CO0 A;  2WB1 D;  2CQD A;  1VR6 A;  2ROG A;  4DV1 F;  3HD1 A;  3O5T B;  4JI6 F;  1DAX A;  2RQM A;  4JI1 F;  2HPU A;  3UDL A;  2EFQ A;  4NZ7 A;  2Z4P A;  4L6V 3;  2MSS A;  1A7G E;  4MKB A;  1URR A;  3RYL A;  3PKY A;  2MQQ A;  2XCP A;  4AE5 A;  4PPD A;  4C11 A;  4L3K A;  2P8I A;  3SSS A;  2BR0 A;  1JLE A;  2Z30 B;  1Y5N B;  4OI4 A;  2CJX B;  3MEC A;  3CD5 A;  3D6T B;  1OWX A;  2E1R A;  3DHX A;  4GO5 X;  5SUH A;  2HLT A;  2LCW A;  4AND A;  1FKO A;  5AE3 A;  2BAB A;  3PYD A;  3UN5 A;  5HO4 A;  1DFD A;  4R8U B;  3TOQ A;  4B02 A;  4TYB A;  2XY5 A;  4K5R A;  2CPD A;  4MYU A;  5DDQ C;  1HNW F;  1MN9 A;  2WZ1 A;  2MQM A;  1HNX F;  3PAC A;  3EWG A;  2Y8Y A;  3DOM A;  3R3T A;  3IG1 A;  4UW2 A;  1YRT A;  2MKH A;  3CCW A;  3LW5 C;  4C0O C;  4A8Y A;  1S1U B;  1J5E F;  4EZ6 A;  1RHU B;  4O44 B;  3UCG A;  4RW8 B;  4LF9 F;  3EGN A;  1TL1 A;  1VJW A;  3DU5 A;  2W8L A;  2LA4 A;  3GYX B;  4F3O A;  4DR7 J;  3K89 A;  2LFV A;  3AAW B;  2CDR B;  4LR8 A;  1I1G A;  1RT6 B;  4JV0 A;  2G2O A;  2GVZ B;  5KAK A;  4ZVT B;  1FE4 A;  1Q8B A;  2VBY A;  2YXL A;  4G1I A;  4LF8 F;  1IM6 A;  2KZZ A;  3RTV A;  2C3U A;  4NLY A;  2OIH A;  1R3N A;  1WF2 A;  2XM3 A;  2QMW A;  3BSC A;  5KFA A;  2VKR A;  3SSR A;  2DR6 A;  3HSG A;  3TWZ A;  1K47 A;  2X3G A;  3BYP A;  5HJY A;  3UVJ A;  4A8W A;  4KGK A;  1JLQ A;  2C2R A;  4V19 J;  3LP0 A;  2DB1 A;  1H2U X;  4TY9 A;  3CCZ A;  2J6S A;  5IC6 B;  3JYT A;  2UV8 A;  2HHQ A;  4RWW A;  1S59 A;  3A3P B;  3VR1 A;  2WSE C;  3HVR A;  4ED2 A;  1XMQ J;  1NJI T;  9RUB A;  2IDE A;  2IFX A;  4ZK7 M;  1PC4 A;  3MI7 X;  4N41 A;  4NCA A;  2RRN A;  1XWL A;  1S0O A;  4U67 Q;  2B5J A;  2CPI A;  3EYZ A;  1KFS A;  3DOL B;  4NA1 A;  4FXW A;  3FVY A;  1RT5 B;  3GFY A;  1PO6 A;  1CJT A;  3A8I A;  1VFJ A;  3FNN A;  1C4A A;  1FJ7 A;  2F5G A;  4N76 A;  4DF4 A;  4MKA A;  1CPZ A;  4OLP A;  3G8S A;  3RB0 A;  1WOO A;  3SDE A;  3OL9 A;  4KYZ A;  4ZVO B;  4NLD A;  1NCL A;  1UA1 A;  1KON A;  1MNE A;  2DY9 A;  4E2F B;  1S97 A;  1EET A;  1LWF A;  2X7I A;  2W2O P;  3KXD A;  3N6L A;  4I56 A;  1NSA A;  3WBZ A;  2N7C A;  1JLF B;  5A8W B;  1RK8 A;  3THP A;  4CT8 A;  1XMO J;  2HHT A;  3H2U B;  3SQG A;  3EVW A;  4J9S A;  4WKR A;  5D6G A;  2DKO B;  2L9W A;  3H7H B;  2CQI A;  3D68 A;  4YME A;  3EM1 A;  3IFE A;  1RTJ B;  3U7J A;  1NDC A;  5I3P A;  3DDN A;  2GZO A;  2VPY B;  4ZP8 A;  1ZZN A;  5GAG U;  1R6V A;  4CRJ A;  2E7X A;  1CS4 B;  1FKP B;  2MZS A;  2DXD A;  3FMW A;  3LPY A;  4DL0 C;  2C42 A;  2R8H A;  1NSK L;  3QLH A;  2HBY B;  4ALZ A;  2ZH8 A;  3J81 Y;  3N5F A;  3FEX B;  4XO0 A;  1LWC B;  3J80 U;  4B9U A;  3H90 A;  3MZI A;  4WE1 B;  4ZVH A;  4ED5 A;  3L95 X;  3V4I A;  2YQ3 A;  4TXS A;  3WIU A;  4USK A;  4ATN A;  3T1Y F;  1RT4 B;  1ROF A;  2HWH A;  4FYD A;  1NH8 A;  2GGP A;  5D4N A;  3OL6 A;  2LEB A;  3RB4 A;  1D8Y A;  2CQG A;  3FZB A;  4FXD A;  4LIR A;  3AA8 A;  3L9Z A;  2CRL A;  2Q1L A;  3IXQ A;  4ZPW R;  5HVG A;  1XN9 A;  2ZE2 A;  3MPY A;  2KN4 A;  4OX9 F;  1LFW A;  3AOB A;  3SCL E;  1FRK A;  4FNH A;  4FF2 A;  3RW7 A;  4PQU A;  1HQE A;  2HQG A;  3GIJ A;  2QLB B;  2EFV A;  1MU2 B;  2BXJ A;  3V2U C;  4NML A;  1KS2 A;  4WP3 A;  3VAL A;  2VA3 A;  5E3P A;  3QJL A;  1FDN A;  5CXT A;  4GO7 X;  3VZI A;  1U1L A;  2MJN A;  3BS9 A;  2G9O A;  1V3Z A;  4CLS A;  1BHN A;  4Y2C A;  5E2Q A;  3LF0 A;  2JLG A;  1R43 A;  3BPD A;  3BO4 A;  2JJ4 D;  2MZR A;  4LSL A;  4MTP A;  1EAY C;  2M0G B;  3KUH A;  2OPS B;  1AUD A;  3FUY A;  2HQC A;  4DWI A;  4LT6 A;  3QT8 A;  2WW4 A;  2ZVS A;  3BKT A;  1AUS L;  4Y6I A;  4ZJL A;  2IA0 A;  4G1Q A;  4ZJO A;  5LSO A;  2OEL A;  4DSF A;  2IA6 A;  1RAF B;  4DL7 A;  1G2E A;  5KG5 A;  4JI8 J;  1KD1 T;  2PMW A;  3KNG A;  4QYZ J;  4ZPA A;  4C8N A;  2B4V A;  1RLC L;  1WJ9 A;  4X66 F;  5D4P A;  3MMB A;  1SC1 B;  4QIW D;  3Q24 A;  3TUP A;  5GVQ A;  1BQN A;  1SJF A;  2WOM B;  4DN0 A;  1FK9 B;  2K1R B;  1UEU A;  3BGF A;  3CED A;  2VKZ G;  2JC0 A;  2KL8 A;  2WVC A;  1MRO A;  4KFB B;  3SCI E;  3ICL A;  2W7O A;  3CE8 A;  4NLQ A;  4RNM A;  3DDI A;  2RQK A;  3M6W A;  1P8G A;  4MJK A;  3KLG B;  5D3G A;  4GKK J;  3DXB A;  1LWX A;  2IVM A;  3R6G B;  4B9M A;  3SCK E;  4PXE A;  4XDD A;  3T9N A;  1M1G A;  1OQ6 A;  4LJM A;  2YKP A;  3NOC A;  4HT7 A;  1ZA2 B;  4Y2I A;  4ZVQ B;  3WC0 A;  4CM0 A;  2QA4 G;  2VJU A;  1UL3 A;  5BYQ A;  1IKW B;  3ZO7 A;  2JRR A;  1DTQ B;  4CO5 A;  4DFM A;  3TAP A;  1LFP A;  1DY3 A;  1DZ5 A;  2FJV A;  2XLK A;  1RWP B;  2NSC A;  2DCL A;  3BN4 A;  3FBB A;  1HBU B;  2HHP A;  3RBE A;  2CPF A;  2NXN A;  2DNQ A;  4K59 A;  1KKH A;  5DDR C;  4OI1 A;  4UUW A;  4L74 A;  3KJV A;  4DV5 F;  2MKJ A;  4NE9 C;  3MFI A;  4K4V A;  1U1N A;  3Q83 A;  3W2W B;  3G6X A;  1CLF A;  2J76 E;  4CQ1 A;  1NJY A;  3FCH A;  3Q8V A;  1XQI A;  5ETR A;  2ILY A;  4YY3 F;  2L48 A;  3HT3 A;  2VA2 A;  1CVJ A;  5C5J A;  2WHO A;  4LF8 J;  3EXY A;  5D3G B;  4O3R A;  3R5D A;  3MED A;  2EEY A;  5KFW A;  2IRY A;  4LF4 F;  4WU3 A;  3HX9 A;  2BQR A;  3W8P A;  1D9F A;  5HP1 A;  2OH2 A;  4DR7 F;  1OY8 A;  5JMN A;  3JSM A;  1JWW A;  5GAD I;  2BOP A;  2VH7 A;  2OKQ A;  2AWZ A;  2HNZ A;  3FQL A;  4IFY B;  4ECW A;  3AGY A;  2E5J A;  3O2I A;  3TAM B;  3B78 A;  4Q44 A;  2D3Z A;  1J5E J;  1K1Q A;  4JI2 F;  1ZH5 A;  4DN9 A;  1WHW A;  3I96 A;  1GXT A;  1CC8 A;  1U6Z A;  2ASJ A;  1SB6 A;  2VG5 B;  2QMU B;  2YKM A;  3NS5 A;  2KJW A;  4W90 B;  2C2M B;  1RAC B;  1NKB A;  1Q5Y A;  1R0B G;  1Q95 G;  2DGX A;  4L75 A;  4MMO A;  3D9B A;  3MUT P;  4A8M P;  2RS2 A;  3HHL C;  5CYQ B;  2AD9 A;  1UTA A;  2MQN A;  1HLW A;  1T9T A;  2GQQ A;  3OPK A;  3PYG A;  4P74 A;  3BM7 A;  5K14 B;  3KHG A;  1YJ7 A;  3MUR P;  1IKX A;  2H4W B;  3UN2 A;  1T94 A;  3ZZ0 A;  4C11 B;  1PGZ A;  4U9R A;  4DQI A;  1SH3 A;  1KFD A;  1FCA A;  1XR7 A;  2CWK A;  3QID A;  2HUR A;  2CZ4 A;  5KG4 A;  4ZVU B;  4U95 A;  4HLB A;  1E6V B;  3CNQ P;  1YKW A;  1EET B;  1LWF B;  1HW8 A;  1MWQ A;  2KRB A;  3B4D A;  3GSD A;  3K17 A;  3N4W A;  2AV5 A;  4DFJ A;  5L8R C;  1QAJ A;  1WF0 A;  2VHG A;  3GR0 A;  4B3S F;  4PG5 A;  5J2M A;  5HK4 A;  2RIL A;  1U48 A;  1H98 A;  3BJY A;  1SC3 B;  5KG2 A;  4YFU A;  1J27 A;  3QT5 A;  3ZTO A;  3CVK A;  4BS2 A;  3KK2 A;  2ROP A;  1BXN A;  3OFE A;  2VF3 A;  2W24 A;  2VPW B;  4IDK B;  1QSS A;  2CPE A;  4RLE A;  1B64 A;  2HLU A;  1S1U A;  4PRF A;  1FE0 A;  4DCO B;  1S77 D;  4Q0B B;  3AJ2 A;  4I2Q A;  5I3U A;  2W2N P;  2XEX A;  3IR6 B;  1RAO A;  1P1L A;  4RW9 B;  5CZV A;  2JEJ A;  2HHU A;  1GH8 A;  3U1N A;  2HS0 A;  3W9J A;  3DU6 A;  2E5H A;  3OTC A;  1Q7L B;  4F4X A;  3EUN A;  4B17 A;  4EWT A;  7FDR A;  3AT1 B;  2W2P P;  3P5T L;  4NLR A;  5CAA A;  2GHW A;  2D3U A;  2IM3 A;  2JC1 A;  4FKX A;  3PX0 A;  2AYE A;  4PR6 A;  2OJ3 A;  3IWN C;  1H73 A;  1QD1 A;  3GYN A;  2XHW A;  2X1F A;  3MCM A;  4Y65 A;  3Q8S B;  5KT7 A;  3M6U A;  2DNR A;  2Y0S D;  2AZ3 A;  4AL7 A;  2ZJQ Q;  2N82 B;  2DNN A;  4KJI A;  3VAG A;  3CCT A;  5IZH A;  3C6U A;  2F8E X;  3T19 A;  4DSI A;  4ILM A;  2HQD A;  1X4E A;  2QT7 A;  4LF6 F;  2LA6 A;  2YNG A;  4HEA 9;  1HL6 A;  1VHF A;  4M5K A;  1FXD A;  3V6J A;  2UUB J;  1EJ7 L;  3RG6 A;  4OZ2 A;  2A6M A;  1SUQ A;  2OSQ A;  1RAH B;  2EVZ A;  2LU1 A;  2XMJ A;  3MM8 A;  1RT6 A;  4MK8 A;  1HQ2 A;  5AXM A;  4CTA B;  4QIG A;  3T1H J;  5K8O A;  1S6Q B;  2HRY A;  2KT2 A;  2HHX A;  3NMR A;  5KFG A;  1XAO A;  1S49 A;  3J7Z T;  3IGN A;  2KU7 A;  2UUA J;  1T03 A;  3US5 A;  3CJS A;  1JB0 C;  3N28 A;  3N79 A;  4KE5 A;  2PO4 A;  3KDN A;  3M8W A;  2CZ9 A;  4RUA A;  1HBO B;  1ZOT A;  4NLP A;  3MR3 A;  1IKV A;  2CG4 A;  3AOC A;  3AD8 C;  3DMJ A;  3ZZZ A;  4XPC A;  3JYT B;  4BCA A;  4JI4 J;  1DHM A;  1FD8 A;  1H72 C;  5B7W A;  1BE4 A;  2FTR A;  1IVZ A;  1NK7 A;  1IBL F;  4DJB A;  1AW0 A;  4R0E A;  4LF2 A;  1MLA A;  3OLB A;  4BC7 A;  2OPR B;  4Y0F A;  3HHL A;  5D4L A;  1TL4 A;  4KQZ A;  2ZM6 F;  3OT9 A;  4KRW A;  4ZPC A;  1LOU A;  3CSK A;  2AJ0 A;  3EIC A;  3HSD A;  1YJV A;  2HZC A;  2LQ8 A;  2DGU A;  5KG7 A;  2DRB A;  3W9I A;  2E1C A;  4IOC Q;  2O1P A;  3V4M A;  3MCS A;  1VI7 A;  3PNI A;  1FWK A;  1HNV A;  2I0X A;  2QL5 B;  1S0M A;  1J2V A;  3MMA A;  4NI2 B;  3NEK A;  2DK2 A;  5GMK a;  3U1M A;  1BUX A;  5KFD A;  3KK1 B;  4F4W A;  3C16 A;  1BC6 A;  5ADZ A;  3TAR A;  3MEC B;  1NRK A;  2DBB A;  1M5P C;  2MZT A;  4ER8 A;  2AIR B;  5AXL A;  2DIT A;  3MM6 B;  3T6J A;  4OYI A;  4TKT A;  1S4E A;  1R8B A;  4ID5 A;  4PG7 A;  5ETO A;  4OHZ A;  3R97 A;  3T5L A;  2DGV A;  2YKN A;  1KLN A;  1JLG A;  3KNA A;  2W7A A;  1MU2 A;  4ELU A;  3H5X A;  2HFU A;  3LAK A;  1FX4 A;  4P2F A;  2W9B A;  1N33 F;  3EPI A;  4B3O A;  4A8O A;  1EB0 A;  2VL1 A;  5M2R A;  1UEK A;  1YIT S;  3DLH A;  1HBM B;  3PZP A;  1WG4 A;  1RXO B;  3QPI A;  3OD2 A;  3CIM A;  5F9L A;  4ERD A;  3A12 A;  1AFJ A;  3WX4 A;  1Y7P A;  2JWN A;  4QWC A;  2YWW A;  2KHC A;  2BJD A;  2VFR A;  4HR2 A;  2ATL A;  1NJW A;  2UUC J;  3HM9 A;  5HSP A;  2LP4 A;  2BE2 A;  1FER A;  1S9G B;  1NPK A;  2ZWP A;  5DQG A;  4J9M A;  2AGQ A;  3NGK A;  3NS6 A;  1NEE A;  3MAA B;  4I64 A;  4C0H A;  3NXZ A;  4LQ3 A;  2RT3 A;  3TVK A;  3HT0 A;  3GR1 A;  3L7O A;  3HKW A;  5CYQ A;  3JXO A;  5KFK A;  4K50 A;  3DOK A;  1FWP A;  2CAJ A;  5C24 B;  4JI0 F;  4WTO B;  4A8K A;  1VC5 A;  4CM2 A;  3HHK A;  5KOX A;  3RB6 A;  2RB7 A;  1N5Y A;  2RS8 A;  2WOM A;  2R7U A;  2XS5 A;  1Y9O A;  4LSL B;  5D77 A;  1Q16 B;  2GAG C;  2ZOG A;  2EFP A;  3KLG A;  1C1C A;  2HBR B;  4M5J A;  2V0N A;  2ABY A;  4QZV B;  3C6E C;  2EFO A;  2VON A;  2DR8 A;  3J7Y U;  2HVH A;  5FDL B;  1HNI A;  3I87 A;  1S76 D;  3M32 B;  1UWA A;  1VQY A;  4G1Q B;  3G2X A;  1UKU A;  1QUP A;  4LF1 A;  1RBL A;  3LWM A;  1F5A A;  3U1L A;  2Q6B A;  2A0F B;  3FSI A;  2FQQ B;  5DG7 A;  4QPX A;  2QFJ A;  1FX2 A;  2AEF A;  2HZA A;  1JLB A;  2MQL A;  5GAH I;  1M1H A;  5KFC A;  2ZNY A;  3C19 A;  3K0J A;  2XNR A;  1JXL A;  3QGP A;  3QFW A;  4I2Q B;  5I3U B;  1TKT A;  2V8G A;  1FES A;  4KFB A;  3W1Y C;  3AA9 A;  4Q0B A;  1CJK B;  4FF3 A;  4ES2 A;  4C8O A;  3R7S B;  2MZ1 A;  3TUZ C;  4WFB Q;  3MM7 A;  4DQQ A;  1T9X A;  1U2C A;  1VBK A;  3MR7 A;  3RR7 A;  4F0K A;  4O3S A;  3IRW P;  1H3D A;  1RT1 B;  2RU9 A;  1VIX A;  3ET6 B;  1TMJ A;  4C9D A;  1VC6 A;  5RUB A;  2B26 A;  3SEO A;  3QSI A;  4HHJ A;  4AXJ A;  3KLF B;  3T41 A;  3BR9 A;  3FK4 A;  5KFZ A;  2CAD A;  4C8L A;  3PW0 A;  4RW7 A;  3BQ0 A;  2ZBQ A;  4QYR A;  4WZM A;  4QW8 A;  1EIY B;  3W5X A;  1FI4 A;  1LWC A;  3AHP A;  2RVJ A;  2DGT A;  3D6M B;  3Q8R B;  1N4L A;  1RT4 A;  2QLX A;  3HJF A;  2VFT A;  1FKA F;  4DR5 F;  3UWT A;  5L39 A;  1T9U A;  3BGR A;  3CC7 S;  2GMJ A;  4KV8 A;  5IT0 A;  2B0G A;  2UXB F;  2OLW A;  1O6X A;  3M2R B;  1TKX B;  1F1B B;  3GLJ A;  4M5G A;  1V3S A;  3D3C J;  3RZA A;  4Z2X A;  4MKY A;  4X84 A;  2JH3 A;  4LIW A;  4RR5 A;  2JNJ A;  3DM2 B;  5J1E A;  3PIO Q;  2E7W A;  4OZ1 A;  3T1H F;  2WW8 A;  2MKY A;  3ZTP A;  4OHY A;  3OXG A;  3DC2 A;  2HNZ B;  1L3S A;  3X1L B;  5I42 B;  3KDO A;  3JQJ A;  4MK7 A;  1XER A;  2HG4 A;  5L1I A;  2ASL A;  1VK3 A;  3OR2 A;  4DR2 F;  1NLT A;  2FJW A;  2XG8 A;  4K2X A;  3GII A;  4A8S A;  1WKK A;  3I6P A;  3L3C A;  2ZH6 A;  1FNM A;  2Z57 B;  3NP5 A;  3G9C A;  2CQC A;  2V69 A;  2DH7 A;  3DGV A;  3SXL A;  3BR8 A;  5J2M B;  1NU4 A;  2BYC A;  2GMH A;  5DO2 A;  1N36 F;  4K0K J;  3OJU A;  4KC5 A;  5MAO A;  3Q8Y A;  2OPQ B;  3JSB A;  4X4T A;  1HBN B;  3QSY B;  4F4K A;  2PFF B;  3P3D A;  2FHK A;  2I5J A;  4J9N A;  4IR1 A;  2OTJ S;  2KDO A;  2VG7 B;  2MTL A;  1IUJ A;  2DIU A;  1HNV B;  4YDD B;  3IAM 9;  1SKS A;  1SQE A;  2EXU A;  4YR0 A;  1YIJ S;  3NG8 A;  4JB8 B;  1TL3 B;  2J9D A;  4BLG A;  4DX6 A;  2G0I A;  2FVC A;  4ZPV R;  4TU7 A;  3G6E S;  1F2G A;  3CXC R;  1JNR B;  2GV1 A;  3P4U B;  3CCL S;  2P2C B;  1KSP A;  4KSE B;  4Q2L A;  5IWA J;  4A8F A;  1RWM B;  3MR5 A;  4PAA A;  3CGI A;  5E5N A;  3TW0 A;  2C2O B;  5J1N A;  3KK1 A;  1ZET A;  3KMS A;  1R8H A;  2FJD B;  3L7P A;  1CC7 A;  1C3G A;  2A2D A;  1OSD A;  1UZD A;  2ZBP A;  2XSJ A;  3QAU A;  4FYV B;  4X64 J;  2BDP A;  1HMV A;  2DT9 A;  1WAC A;  2H65 B;  2YY3 A;  1R8P A;  3R7B B;  3HP6 A;  4IUF A;  1U1R A;  4KGZ B;  3K58 A;  3OFH A;  2HZV A;  1HBU A;  4QWA A;  1NPP A;  3TZW A;  4OHX A;  4AT1 B;  2Z2L A;  4N5S A;  4RKU C;  1ZPV A;  1WHX A;  3A8E A;  2W9C A;  3PW2 A;  4OX9 J;  2IMW P;  4Q7A A;  3I82 A;  3OXF A;  5HL7 Q;  4L76 A;  1WC0 A;  1LEO A;  1S79 A;  2ZD1 A;  4LR7 A;  3NGD A;  1HHT P;  5KFQ A;  1T8E A;  2YBV A;  1TK5 A;  3KLI B;  4QOT A;  3GFZ A;  3MPU B;  2XC9 A;  2AEJ A;  4KAI A;  1QE1 A;  2HFO A;  4CO2 A;  2P9C A;  4M8L A;  4O3P A;  5K20 B;  4NPO A;  4ZA1 A;  2WB4 A;  1KBR A;  5U47 A;  3W7B A;  1TK8 A;  2E1M C;  3SBM A;  4GC7 A;  2Z2Z A;  4M5M A;  3I4H X;  5DGA A;  3K5O A;  1NSQ A;  5IC4 B;  2F4V J;  4ED1 A;  2VG6 A;  1AT1 B;  4WFZ A;  1WTB A;  3I9Z A;  4WZQ A;  4DL5 A;  2MYF A;  4WK1 A;  3VAH A;  3D0H E;  3TVZ A;  2EFG A;  3VGU A;  5HAO A;  2BJ7 A;  1JLE B;  1SQG A;  3CJ0 A;  4YUD A;  1XMO F;  2CIM A;  1S6Q A;  2UVW A;  2ZHB A;  4QWD A;  4UTG A;  4ZVS B;  5K8M A;  3KMQ A;  5C25 B;  1R7I A;  1RDR A;  4M1K A;  4HTJ A;  4R8U A;  1FFW B;  5DG9 A;  3WHI A;  4NXM J;  5GME A;  4YY3 J;  1S0V A;  2MB0 B;  3KKF A;  1NUE A;  1RP5 A;  1V9O A;  3IS9 A;  4OZ0 A;  4OZ3 A;  3UW1 A;  2BAN A;  3FEY B;  9ATC B;  2QE5 A;  2H3E B;  3MM5 A;  1UWB B;  5LJ5 Y;  3CCR S;  3CUN A;  2EKN A;  1G6B A;  2NR0 A;  1QM9 A;  5LMN J;  4C6A A;  2AT1 B;  3NGS A;  2V67 A;  3VHQ A;  1Q78 A;  2JHE A;  3P96 A;  4LVO P;  4MH8 A;  3RJM B;  2XMA A;  1DAR A;  3MXH P;  1RT7 A;  2XY6 A;  1SH0 A;  2QX0 A;  3H4D A;  1N56 A;  4B9T A;  5LJ3 Y;  4DDF A;  1H38 A;  5DQH A;  3UCU P;  4HAC A;  1REV B;  1YX2 A;  2GO9 A;  4IDK A;  4ANC A;  2P9E A;  1KVJ A;  4NXN J;  3GIM A;  1OY9 A;  2W9B B;  3QNW B;  2J8A A;  4ECU A;  2WVF A;  2FZK B;  1SXL A;  2DEI A;  1E6Y B;  2HRU A;  2HVE A;  2F9D A;  1UEV A;  3G86 A;  3OBI A;  3R5C A;  2QLD A;  3IG1 B;  5DQI A;  3KJF B;  2ZHO A;  3OLA A;  1VQK S;  4JOU A;  3M7V A;  3PHT A;  1IBK F;  1Q86 T;  1X8D A;  3R5A A;  3OR1 A;  4ZCK A;  3TP2 A;  2I9S A;  1H2T Z;  4EBC A;  1NPR A;  2RJZ A;  2VQF F;  4LBH A;  3BB5 A;  2XMV A;  5B0G A;  3M8Q B;  3GE9 A;  4LR9 A;  3NBP A;  4LF9 J;  3ENQ A;  4ED6 A;  3PY8 A;  1P1T A;  2YWG A;  2A10 A;  3S6E A;  3BSO A;  4PG8 A;  3CJT A;  1C2P A;  2HVI A;  3VAI A;  4JI7 F;  2FVQ A;  1NND A;  2RSQ A;  4FBU A;  1SV5 B;  2UU9 J;  1YZ7 A;  2DXE A;  2RF2 A;  1W25 A;  4CNZ A;  2FY8 A;  2R2R A;  4GC6 A;  2O5D A;  4TY8 A;  1U47 A;  2LDI A;  1AFI A;  1QDU B;  3BZQ A;  4N8N A;  4MK9 A;  4DS5 A;  3M32 A;  1DQ9 A;  1RT3 A;  3FEZ A;  2UV8 G;  1HNI B;  3SZ2 A;  1XMB A;  1OS5 A;  1T9W A;  2IRU A;  4PPZ A;  4DG1 A;  4W4M A;  3HFZ B;  1NDP A;  4IRC A;  2XNQ A;  1S72 S;  2BEF A;  4GMK A;  3SQG B;  1QVG R;  2RHQ B;  5F3T A;  4DU7 A;  4IG3 B;  1DLO A;  1HBN A;  3CJK A;  1M5V C;  4IOB A;  2BKN A;  4JI6 J;  2HS4 A;  2O67 A;  2QG9 B;  5L1L A;  3K5N A;  3T1Y J;  4DI6 A;  3TA0 A;  4ZLN A;  3N5B A;  1OMS A;  3OV7 A;  2DNG A;  4B3R J;  2KXH A;  3WC2 A;  1NAQ A;  1C4C A;  2YX1 A;  3UFC X;  1NH7 A;  2IVF B;  3C46 A;  3I0R A;  2ZNZ A;  1V6H A;  4NAS A;  4ZVR B;  2ZH9 A;  2ATC B;  1HHS A;  4ES1 A;  2XWX A;  2VC1 A;  3G96 A;  5IWA F;  4QWB A;  5B0D A;  3S8S A;  2ZBC A;  4C3M A;  2PMZ D;  1U1K A;  3BEG B;  4J9K A;  3UR3 C;  1FRH A;  1R6Y A;  3C5X C;  3DDK A;  1TP7 A;  3S1T A;  1WC4 A;  3DRR A;  2ZJR Q;  3DOM B;  4DQS A;  1A9N B;  2VQF J;  2PMH A;  2QN6 B;  2NZC A;  3C15 A;  4O4G B;  1JLQ B;  1RWN B;  1LK7 A;  1UCN A;  1ZAX A;  1U49 A;  4CCH A;  1IBK J;  1V3R A;  4O44 A;  4C3K A;  4RWX A;  2HHH J;  4KV8 B;  3DXS X;  1UZH A;  1NBE B;  2D69 A;  1RAA B;  1CG2 A;  4CYU B;  4Z37 A;  1SJ4 P;  2W4D A;  3DHW C;  2M4M A;  3EZO A;  3MPW A;  4RPF A;  1S1W A;  2D9P A;  4DPX A;  4DPU A;  1OY6 A;  2HK2 A;  2AJ1 A;  3MM9 A;  2WVB A;  2NLW A;  3HI9 A;  1R31 A;  3TA2 A;  4EYH B;  2MKK A;  1FJC A;  2Z2M A;  3H2V E;  2J8S A;  4OFZ A;  3CDU A;  1D0E A;  3MOZ A;  2PEH A;  2HGN A;  3K8W A;  4ZIV A;  3BSN A;  5IM0 B;  3G8T A;  4C4W A;  2QSF A;  4ZCM A;  5J2P A;  2J9C A;  4K4S A;  2JX2 A;  1S0N A;  2QA2 A;  4PQU B;  1X7V A;  2NXE A;  1RUS A;  1B7Y B;  3HJV A;  3IR7 B;  2XYG B;  4NWB A;  4OV6 A;  3AXK A;  2YWK A;  4O3N A;  3G6Y A;  2V2K A;  1YJU A;  2AGO A;  4DV6 J;  1RYR A;  4IRD A;  3QZ7 A;  5EN1 A;  3QGH A;  4ZKA A;  1X0F A;  1F3F A;  2XS7 A;  3PKM A;  4U8V A;  2CQ2 A;  5L9X A;  1FRI A;  1FFG B;  3DLE B;  4HHU A;  2H5J B;  3ZTQ A;  2BKP A;  4I6Y A;  2FJE B;  2J9D E;  4U7U K;  5HQL A;  3TYT A;  1RTH A;  1U0H A;  1JNZ B;  4IOA Q;  2C2E A;  3GJR B;  1FT8 A;  2AX1 A;  4UQG A;  2HHW A;  2IM0 A;  1CS4 A;  3TX0 A;  2KHD A;  5I42 A;  3GB0 A;  3W2V A;  2BOA A;  4N47 A;  4U7U D;  1RZM A;  2D9O A;  3LP2 B;  3KG1 A;  1SIW B;  1W26 A;  1D3W A;  4URQ U;  4WE1 A;  3X3U A;  2RD5 C;  3BBB A;  5DM6 Q;  2F40 A;  2QJ3 A;  2XSJ B;  3EX7 B;  1HKA A;  1HMV B;  4DPO A;  1NHV A;  5ETT A;  2LXI A;  3N0V A;  3N6M A;  1FA0 A;  3Q2S C;  1IBM F;  3VF0 B;  2OI2 A;  3NGR A;  2LQ9 A;  3MEE B;  2JVR A;  1WDD A;  3LGM A;  4LRB A;  2COL A;  4NLO A;  5B0B A;  5IT9 U;  2VU5 A;  5IS2 A;  4JI5 J;  1NME B;  1HQE B;  1T11 A;  4K2J A;  4NYO A;  2KXF A;  3ILJ A;  4Z7C A;  3PIP Q;  2G2Y A;  2FGO A;  4KPC A;  1TL3 A;  1NZA A;  4PCQ A;  4BC9 A;  3NNC A;  1VOM A;  4MAK A;  2ZH5 A;  5BYS A;  4UUX A;  3HFV A;  4CLL A;  1EAR A;  4I1T A;  1R8C A;  2J7W A;  4HHH A;  2R8J A;  2OPP A;  3MD3 A;  1SPB P;  1CEZ A;  4JI1 J;  5IXU A;  1KRP A;  1MMN A;  2NXU A;  3KLI A;  4QIV A;  3FJ2 A;  2DGS A;  4V1A k;  4F3Q A;  1QLN A;  1EZZ B;  3KLF A;  2CQ1 A;  2R7X A;  4MIB A;  3SSQ A;  1RWX B;  1JLA A;  4J9O A;  4OLO A;  5BJR A;  3AXM A;  2QGF B;  4WII A;  1SI9 A;  3OUY B;  2KVI A;  3GFH A;  2M3D A;  5EUH A;  1U2F A;  2MHE A;  3OTD A;  3ZXW A;  2VG6 B;  4C2M A;  1VYA A;  2RQ4 A;  3ZFV A;  1RGV A;  4DBQ A;  4DLE A;  2KG0 A;  4NEZ A;  4IH6 A;  2HK3 A;  4ED7 A;  2FZC B;  1Y5L B;  2HYI B;  3F56 A;  1RA6 A;  3I5B A;  3IWX A;  3KHH A;  3PW5 A;  2HMI A;  2EG2 A;  1MWZ A;  7FD1 A;  4ZMM A;  2PA8 D;  1SL2 A;  2QYC A;  2ZDP A;  3PO4 A;  2ZC3 A;  4ES3 A;  3I0S A;  3IS9 B;  5AE1 A;  1YQH A;  4XPE A;  3TQE A;  2IBK A;  5EWG A;  1Y3J A;  1TUV A;  4TNO A;  3ADA C;  2XO7 A;  1YJR A;  3E51 A;  4FKY A;  4OYB A;  3ZZT A;  3TI0 A;  1UVN A;  4WPA A;  1L5U A;  3SV3 A;  4DL6 A;  3QWP A;  5SZT A;  2CQ3 A;  3PJW A;  4U96 A;  3CWJ A;  2K2P A;  1N34 J;  2CA9 A;  3UD5 A;  2H9Z A;  3MTK A;  1C1B B;  1FK9 A;  2K1R A;  5ETM A;  2F63 A;  5KFT A;  3GJT B;  4FF4 A;  5L9N A;  3PG9 A;  2IJF A;  3UPF A;  4ED0 A;  4B3T F;  3Q86 A;  1VRT A;  3H42 A;  3M1V A;  2J7U A;  3BGL A;  5A8R A;  2R8I A;  5EGY A;  3RBZ A;  2V6A A;  2YH0 A;  5HQ8 A;  3A8K A;  3DLG B;  4NMX A;  4C97 A;  2UXB J;  2UUT A;  4OMF G;  4LSN B;  3R2D J;  2ZC4 A;  2H5I B;  2OFH X;  2YTC A;  3A1Y G;  4DSE A;  1YVF A;  4DR5 J;  1Z2L A;  2MLZ A;  3HK2 A;  1VQS A;  2NXC A;  3C6U B;  3GQC A;  2BJ3 A;  1LXJ A;  1FVS A;  1M0S A;  2D74 B;  1CJU A;  2G13 A;  5GAG I;  1NK0 A;  5LM7 E;  4OYO A;  4UZB A;  4NRT A;  5DJB A;  2V4R A;  2PI4 A;  2WTF A;  2IVY A;  4KO0 B;  1JXV A;  1NK4 A;  3CB4 A;  2AYM A;  3R1L A;  2V5H G;  3DRP B;  1RBO B;  1NB7 A;  3NNA A;  2CPY A;  2E29 A;  2ODX A;  1GTH A;  4FVM A;  1SV5 A;  3MR6 A;  3VAJ A;  1WI8 A;  4Q8F A;  4ZCI A;  5CYM B;  4J9P A;  3GCX P;  2ACY A;  2CUY A;  2W9C B;  3AD7 C;  4J9L A;  1TV6 B;  2PEB A;  1GAO A;  1O0P A;  3CIZ A;  3CD7 A;  4IFY A;  4OI0 A;  3OXL A;  1RT3 B;  4WFA Q;  3RW6 A;  3VCD A;  1ZAW A;  5IOL A;  1FXR A;  3OFF A;  5AE2 A;  2X51 A;  5HMZ A;  4DQR A;  1UA0 A;  5HRO A;  1M1K T;  4ANE A;  2Z8Q A;  3JTN A;  2XYH B;  4D3H A;  3CMA S;  3RB3 A;  2NSB A;  5F8N A;  3GFX A;  1VLY A;  2QMX A;  2V2Q A;  4J9R A;  1SL0 A;  4B9N A;  2DNP A;  2QFI A;  1TL7 B;  1RTZ A;  4QJV A;  2B4O A;  4CTA A;  3ONQ A;  4DL2 A;  3QJP A;  3D0I E;  4A46 A;  3CUL A;  2DHX A;  3T5H A;  3GCW P;  4HDG A;  4LFC J;  3AQP A;  1OSC A;  3R9L A;  4QU7 A;  2YX4 A;  1MW7 A;  2M52 A;  4M5L A;  4OIX A;  5KFS A;  4YP3 A;  1F9F A;  1WKJ A;  2DHA A;  3PHE A;  3KLE B;  1YG0 A;  4ZP7 A;  4CLF A;  2R3V A;  1DRZ A;  3ILL A;  1N5S A;  3W2V B;  3U02 A;  3T3F A;  1SBR A;  3FRZ A;  3CC4 S;  3BO2 A;  2D7S A;  2FB0 A;  3TNV A;  1LK5 A;  2B9W A;  3QYY A;  5C25 A;  1UET A;  3A4T A;  1WHY A;  2DIV A;  1T9Y A;  3BN7 A;  2FC9 A;  4NYZ A;  1PAU B;  2MY8 A;  2ZJP Q;  1N54 B;  3O3L A;  1HQU A;  1H74 A;  3DI6 A;  4N7T A;  5KG6 A;  2CPZ A;  3EZU A;  4RNH A;  4FXV A;  3FGV A;  3PM9 A;  3MEK A;  3OTE A;  4O0N A;  2MQP A;  4RW9 A;  3MPD A;  2A1B A;  3DGP A;  4IFV A;  2HIY A;  3J80 Y;  4B3S J;  3LTO A;  3BKF A;  3PX4 A;  1X4H A;  2HGM A;  3O1L A;  5H9E J;  3THV A;  4LFC F;  4OZ5 A;  2R7O A;  5IM0 A;  3PJ9 A;  4O4R A;  2BQ3 A;  1U8W A;  3KUE A;  2PI5 A;  2DEJ A;  1KOO A;  3AGX A;  3NCP A;  1T3O A;  3FCV A;  2GIF A;  5HQM A;  1L3V A;  2R8K A;  4AXI A;  2HEK A;  1X0P A;  2VBX A;  4NLG A;  1ZM9 A;  1NK9 A;  2MJU A;  3QIP A;  2VC0 A;  2MST A;  3EXC X;  4P71 A;  3NMA A;  4URG A;  3V6D B;  3CJR A;  1IKV B;  2FHJ A;  2VAS A;  3KJN B;  3HSZ A;  1F2H A;  4GRS A;  4PG6 A;  1BY9 A;  3TAM A;  4ETZ A;  1BMQ B;  4P6Q A;  1UFW A;  2HND A;  5MLC V;  1SC4 B;  2BZ2 A;  4FN5 A;  5KG0 A;  2KKH A;  3M8Q A;  1N0U A;  4RO0 A;  5CH7 B;  1Y4Z B;  3BRE A;  2PN6 A;  1VQ6 S;  3TRG A;  1U25 A;  3H59 A;  1NKC A;  1K1S A;  4UY8 5;  5BR8 F;  3N6N A;  2VFV A;  1U0H B;  5ITH A;  2ALY B;  5F8I A;  1K73 T;  1JKH B;  2MGZ B;  1PKU A;  2XTJ P;  3N9U C;  2I2Y A;  1Q4R A;  2CYY A;  4ZHR B;  5CQG A;  3N01 A;  1XNQ J;  3W5Z A;  2P5V A;  1RHR B;  1R89 A;  1UW9 A;  2LXF A;  3AFG A;  1SQF A;  1QTN B;  3BPS P;  4RJV A;  2EFN A;  4UOH A;  4AUK A;  4F4Y A;  2AMC B;  1KR4 A;  2ERR A;  2E9Z A;  4WU2 A;  1NHU A;  2GAH C;  1CQN A;  1RT2 A;  1FEH A;  2BJ9 A;  4DUT A;  5CCL A;  1C0U A;  3R5J B;  4TU9 A;  2GA7 A;  5F0W A;  4ECV A;  1IKY A;  4IO9 Q;  2VJV A;  4KPY A;  2Q79 A;  1X9M A;  4LF5 J;  1S7H A;  1WUU A;  3QT6 A;  1U2R A;  3A3N B;  3G4S S;  4DV5 J;  2E5G A;  1Q8K A;  1DLO B;  1VRT B;  2ZWO A;  2AX0 A;  1I3O B;  5LT5 A;  3GV8 B;  3RR8 A;  1S10 A;  1FTC A;  3ET6 A;  2CVI A;  2ZH3 A;  4J5O A;  4ZPT R;  4B3T J;  4UOC A;  2BJE A;  4ZS6 A;  2R7V A;  3M9M B;  2QA4 S;  2VB6 A;  3MMA B;  4TVA B;  3PYE A;  4ZDN A;  3DNC A;  3W8G A;  2YNI A;  3T6B A;  1LNQ A;  3LAN A;  1IR2 A;  1IJE B;  2IY5 B;  1S9E B;  2J0S D;  1U24 A;  4RZR A;  3Q2T C;  4GKK F;  2AW0 A;  3CO9 A;  2BKO A;  2UXD J;  3I31 A;  1D9A A;  1XJW B;  2MDA A;  1W2I A;  2PGC A;  5HLF A;  3BDE A;  3D7S B;  4IH7 A;  1RAD B;  2LLZ A;  3HKZ D;  3ZZP A;  4C3L A;  5F3Z A;  3KK3 B;  2GVD B;  2JEF A;  4P52 A;  1JJC B;  1RWO B;  4K4W A;  3BBF A;  3ENV A;  5JXS A;  4OJH A;  1YSJ A;  3T5J A;  3QRQ A;  2G1D A;  2C3M A;  3MTJ A;  2ILZ A;  2J0W A;  4PKD B;  3B82 A;  1U1P A;  2HMI B;  1I94 F;  2FC8 A;  1SCJ B;  2EW9 A;  3CD0 A;  3A13 A;  3GV5 B;  2ZH7 A;  2V4J B;  4LRD A;  1BWV A;  2G0J A;  2QO3 A;  3ILO A;  5KT4 A;  3MUM P;  1ITP A;  3EE3 A;  5FII A;  2GJI A;  2ZZM A;  5HRO B;  3SDE B;  1WOP A;  2AZ1 A;  3TX8 A;  4Y28 C;  4WP9 A;  3Q8Q B;  4ZLL A;  4CH1 A;  5F8M A;  3PFO A;  1AZS A;  4J37 A;  2XY7 A;  1M90 T;  2M9K A;  3TUJ C;  1EX8 A;  4FYY B;  1UPP A;  3FBF A;  1VQ7 S;  4G1P A;  4OV1 A;  2JEI A;  3MAA A;  2XLI A;  2KT3 A;  1HBO A;  3UO0 A;  5KFH A;  3CCV S;  2ADB A;  2UP1 A;  3J81 j;  2YWF A;  3HZG A;  4F8R A;  2UZA A;  2OSR A;  1S48 A;  2RKI B;  3TJ9 A;  2CNK B;  2KM8 B;  3JSY A;  3V81 B;  2CJQ A;  3W64 A;  4YHH J;  3DYA A;  4EK2 A;  2RUS A;  3PCO B;  1P9Y A;  2C3O A;  3PRD A;  3PYF A;  2AU0 A;  2JFK A;  4H4K C;  3IM8 A;  2D1C A;  2E1P A;  3D6H B;  4TYA A;  4KHM A;  1RU2 A;  3TEH B;  3HHL B;  1HIY A;  1N33 J;  2KZM A;  1F5C A;  2GJF A;  2CKW A;  3TUI C;  3GZ7 A;  3FZ2 A;  4FNI A;  3G6V A;  4K4X A;  4FBT A;  2VBZ A;  4JI5 F;  3EGW B;  4I2P A;  4Q8E A;  1FKO B;  3VGT A;  4LSZ B;  2UU9 F;  2BAC A;  5KFO A;  1URN A;  3UD4 P;  2VFS A;  1X5P A;  5F0U A;  4F3M A;  2FGC A;  3LA0 A;  5KFX A;  5KT2 A;  2HBZ B;  3QAT A;  3A8J A;  4PUO B;  4ECR A;  3IRX A;  2FJA B;  4OHW A;  1N32 F;  1IWG A;  2JOQ A;  2NPI A;  4CLW A;  4PEO A;  2RIJ A;  4YEA A;  1TZ0 A;  2CFX A;  1RQ0 A;  1R8A A;  5EX0 A;  3P8B B;  1TR0 A;  1UJ4 A;  5CA5 A;  5K8N A;  1F3V A;  2N7Y A;  1VQ8 S;  3WX8 A;  1APS A;  3SIP B;  3HHE A;  2B8Q A;  4WF9 Q;  3IM9 A;  1QVF R;  1HI0 P;  1A0O B;  1UPM B;  2GGP B;  2DH9 A;  2P6S A;  3BBC A;  2EPI A;  3Q89 A;  4AD6 A;  3PTW A;  4CP5 A;  4YR2 A;  2OUG A;  1Q8I A;  3HHL D;  2J0Q D;  1NHK L;  1HA1 A;  1QE1 B;  3LO3 A;  4LSN A;  4NLW A;  1YI2 S;  4C8Y A;  2XSF A;  3LP1 B;  1HPZ A;  2JL9 A;  2QZ8 A;  5KT5 A;  3HVT A;  4OYZ A;  3P5B P;  4NXN F;  3E2E A;  1VQ9 S;  4GKJ F;  3LAM A;  5DZ7 A;  3MHY A;  3PJX A;  4NLV A;  2B3T B;  4DV6 F;  2CNO B;  4NCG A;  3BGO P;  4R5P A;  4O0I A;  4NLU A;  4PXB A;  2BBE A;  4DR1 J;  1FVQ A;  3W62 A;  2ZKT A;  4ETX A;  3AY0 A;  4PWD B;  4QIF A;  1S6P A;  3SV4 A;  3TJ8 A;  4EYI B;  3CO0 P;  2BM0 A;  2B43 A;  1MRO B;  3QRR A;  2XMW A;  3NWR A;  3FSY A;  2K8G A;  2GIR A;  2OPS A;  3IMQ J;  3R6L B;  3W66 A;  5HBM B;  3ENW A;  2ZUA A;  5LSR A;  3OTO J;  4DV4 F;  4K7Q A;  1FWL A;  3KLE A;  3ULH A;  4HVZ A;  4Y2M A;  4X4Q A;  1G1X A;  2D3O R;  5HAT A;  1IKW A;  5HJX A;  2LU2 A;  2V2V A;  3GYG A;  1RAI B;  1CBK A;  3OR2 B;  4B9L A;  4OI3 A;  1WC1 A;  3NAI A;  5DLG A;  2HSE B;  2CQ0 A;  3I55 S;  3UCZ P;  2HHH F;  2KFZ A;  2ACM A;  3FBC A;  4KR0 B;  3W5Y A;  3TQ1 A;  5T7L A;  4IG0 A;  4PZV A;  3WDO A;  1HWJ A;  2QIF A;  1IXK A;  2HQ3 A;  1YZ6 A;  5ETS A;  1B70 B;  1YDL A;  2KO1 A;  1PAE X;  2OPQ A;  1FRM A;  4C98 A;  3K59 A;  3ZZU A;  3GIK A;  2DO0 A;  3M05 A;  4BHQ A;  3BO3 A;  3G71 S;  3GON A;  5A8K B;  1RAB B;  2ASY A;  4DV0 J;  1LWE B;  2L08 A;  5DS7 A;  3DLK B;  4C48 A;  1YJW S;  1HNX J;  3CDB A;  1FKP A;  2A3J A;  4QWE A;  2F8H A;  2IBO A;  2X1G A;  3JQK A;  4LQ9 A;  3R5B A;  2BAN B;  2WCX A;  3QAE A;  4WBF A;  5EDW A;  3R1H A;  2EWH A;  3ZTR A;  4I7F B;  4UOG A;  4I6W A;  4EZ9 A;  5D8H B;  3R2C J;  4CO1 A;  1QAX A;  5ETQ A;  3MAQ A;  1RAJ A;  3PEH A;  4PWU A;  2WAQ D;  3V4I B;  3QGG A;  2IAJ B;  5D0G A;  1D9D A;  2GQ2 A;  4F25 A;  2VFU A;  4PYD A;  2W2Q P;  4HAC B;  3RU0 A;  3U27 A;  2PSZ A;  4YHH F;  4EGL A;  4F02 A;  1IWA A;  4NYP A;  3TA1 A;  1AA1 B;  2R2U A;  4DUY F;  1ZM2 A;  3NLC A;  3I38 A;  2GVD A;  2LQ5 A;  2DXF A;  3UVJ B;  3LAL A;  3VGS A;  1M5H A;  3LZ8 A;  5GMD A;  3KLV A;  1VLO A;  3K5P A;  1PBA A;  5KFM A;  2KFN A;  4OI2 A;  4CZC A;  1L3K A;  3AJD A;  1CJU B;  3D1O A;  3ITH A;  5CYJ A;  4X64 F;  3IBC B;  4ECS A;  3MAH A;  1FFS B;  2DIS A;  2WVE A;  2X1B A;  2FHO B;  2GVZ A;  2V94 A;  3D6F B;  2J6T A;  1F6T A;  3M2V B;  1GK8 A;  2M5Y A;  2QC3 A;  5H9E K;  1S6U A;  2PE8 A;  2VBW A;  4LRF A;  5BYR A;  4ELT A;  4JI7 J;  4DSK A;  4E98 A;  2DH8 A;  1S1X A;  1DUR A;  4A8Q A;  1VBZ A;  4UST A;  4LVN P;  2V8H A;  4TQS A;  1I94 J;  1GMU A;  3LP0 B;  2YPY A;  3BYR A;  3MPV A;  4RU2 A;  3JSR A;  4FF1 A;  3D2W A;  3MM5 B;  2DD8 S;  1PYO B;  1Y00 A;  4QR0 A;  4TLQ A;  1LXN A;  3DYA B;  2RU3 A;  1JX4 A;  1IKY B;  4RNF A;  5A6W A;  2FUG 9;  4ZVE A;  2MEW A;  3IP0 A;  1JJ2 R;  1C0U B;  4X62 J;  4K4Y A;  2QEX S;  3KTQ A;  1RBA A;  1M5S A;  4OYA A;  2HFS A;  3FFI B;  1GX5 A;  1YGY A;  4YN3 B;  4O3Q A;  3DCA A;  3HPO A;  3HVW A;  2YNF A;  1N5T A;  3CJ3 A;  5B0C A;  2EK6 A;  1B0V A;  2HWI A;  2BRK A;  3GSI A;  2E44 A;  3VTI A;  5F41 A;  4ELV A;  5LOQ A;  4DV2 J;  2K7J A;  1FDD A;  2O3D A;  3OTO F;  2K06 A;  1YJT A;  3EDR B;  3DKD A; 
#chains in the Genus database with same CATH homology
 2QLD A;  3AGX A;  3AGY A;  1NLT A;  1C3G A;  3TJA A;  1GMU A;  3L9Z A;  4J80 A;  3LA0 A;  3NXZ A;  3AGZ A;  3I38 A;  3TJ8 A;  3LZ8 A;  3TJ9 A;  2Q2G A;  1EB0 A;  4L3K A;  1GMW A;  1XAO A;  3NY0 A;  2B26 A;  1EAR A;  1GMW D;  1GMV A;  2HFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...