1EARA

Crystal structure of bacillus pasteurii uree at 1.7 a. type ii crystal form.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
MVITKIVGHIDDLSHQIKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UREASE ACCESSORY PROTEIN UREE
publication title Structural Basis for Ni2+ Transport and Assembly of the Urease Active Site by the Metallochaperone Uree from Bacillus Pasteurii
pubmed doi rcsb
source organism Bacillus pasteurii
molecule tags Chaperone
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1earA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1earA02
1XAOA 2B26A 2QLDA 3I38A 3AGZA 1C3GA 3LZ8A 1EB0A 2Q2GA 3AGYA 3TJ9A 3AGXA 3LA0A 4L3KA 1NLTA 3TJAA 2HFVA 3NXZA 1GMVA 3TJ8A 3L9ZA 3NY0A 1GMWD 1GMUA 1EARA 4J80A 1GMWA
chains in the Genus database with same CATH superfamily
1FKPA 3BKFA 5FD1A 2EW9A 3U1MA 2MZRA 1VJQA 4PUOB 2B8QA 3GJSB 5AE2A 4RNFA 1P9YA 1SPBP 2Z30B 4BLGA 2CQDA 1VQKS 4K7QA 1KNZA 3SCKE 1S6OA 2FYXA 3CD6S 4H4KC 2G2OA 3M6XA 1OY9A 1RU1A 4QR2A 1YLXA 3IC1A 1FFWB 2QZ8A 4R5PA 5IQ6A 3LO3A 2JZ5A 4I1TA 2DNHA 5HROA 1UKUA 2RAQA 2XLKA 4ZCLA 4XDDA 2V2ZA 2C2EA 1LNQA 4Y28C 2DKOB 1SC1B 4JI6J 1VQ8S 2GVDA 4PZVA 1PO6A 2ZJQQ 2DNGA 4NLQA 3N6NA 4M5DB 1TK8A 2HGNA 4B9UA 3F73A 4O0IA 2VB6A 2J6UA 1YJRA 4YEAA 4MKVA 3PX4A 5KG3A 4QU7A 4YHHF 3DOMA 3HVWA 3MWBA 3W61A 2AHOB 2XMMA 4PG4A 2MJNA 5F9NA 2GHPA 4M5KA 1PJ7A 4J9RA 3CJ5A 2MSTA 4DF8A 1IKXA 1FRKA 3OL9A 1SH3A 3O1LA 2NUHA 1J5EF 4FF3A 1U0HA 1S0OA 3VTIA 4Y65A 3G8QA 4QR0A 3R8YA 1I51B 1WSVA 3TJ9A 4RU2A 4UOGA 2JLFA 2AX1A 4DSJA 4PYDA 1S79A 1UEKA 1Y5NB 2HFOA 3I4HX 5CD4H 4G65A 2DR8A 1T11A 1FK9A 1MW7A 1E6YB 1Y5IB 3W5YA 1N5YB 4LFBF 4OZ2A 3CDUA 2ZM6F 4H4OA 3HPOA 1UFLA 4JV5F 5J1EA 1REGX 3KK2B 2HS0A 4M1KA 1RZMA 5EX3A 4KPYA 4BC9A 4J9OA 3I38A 3M8SA 3UDEA 4DX8H 4TLRA 3I0RB 2HZAA 1JXVA 1N5SA 4O3QA 3PEHA 4O3PA 1M5OC 1APSA 1KLMA 5DLGA 4A8KA 1LOUA 2P6SA 3QT6A 5DG7A 1HNIA 4KPCA 1LFWA 4PPDA 2EK1A 3D67A 1UMJA 5AXKA 2GVZB 3CEDA 2MKYA 3CCMS 1NXIA 3W62A 1T9UA 1TU0B 2RQMA 2YNFA 4AQYF 5JUMA 1N34J 3PZPA 2V4QA 1AYEA 1WELA 2FLPA 4DQPA 3GE9A 3IAS9 3CCVS 1HQEB 3HFKA 3UD4P 3IAM9 3GFXA 4AFFA 3GFYA 3AJDA 3V6DA 3GIKA 3FQKA 5EWEA 3UCGA 1EAYC 5E2QA 4DX7A 4PWDB 2VFRA 2K2PA 1AB8A 3LP1A 3DI6B 2V4RA 1PCAA 3M32A 3C8YA 4JI5J 4OYMA 1XMQJ 4CM0A 2MKCA 3MUMP 2V8VA 1S1TB 3FBCA 5J2PB 1BLUA 3PDNA 2DISA 2CDQA 3ETOA 1JJ4A 4I2QB 2MZSA 3RJMB 2YH1A 4LR7A 3ZC4A 3GPAA 2XY6A 3CCJS 3W9JA 5HVFA 4NXNJ 1BD6A 1NUEA 5LJ3Y 4CO2A 4DR6F 4ERDA 2XS7A 4CLTA 2BR0A 3PJ9A 2ZKUA 4DQSA 1G2EA 3HCXA 4NL5A 3SYZA 2B9XA 5I3UB 4JI6F 3CJRA 3ETMA 5ETMA 1RAHB 3BSNA 4LQ3A 1TAQA 1Y3KA 1NHKL 8AT1B 1R89A 2GW8A 3PR4A 2GMHA 4U7UK 4C8YA 4QYZK 1HQUB 3LP0B 4A8YA 2FVQA 4DV4F 2JRSA 2MZ1A 3VGTA 3Q8RB 2H3EB 3FFIB 4O3OA 3HKZD 4DL6A 2ABYA 4FNHA 4LIRA 3KLFB 2IVMA 2KDOA 2W9BB 2IY5B 1CJTB 4DQQA 1S6QB 3GG1A 3LW5C 4PKDB 2HIQA 2BJ8A 1IBCB 2O67A 2XO6A 3D1OA 1RWKB 3EDRB 2W2QP 4DV7F 4ZLPA 4DXLA 1FTRA 5J2NB 4OJHA 1YBUA 1URNA 3ZXWA 2HFSA 1HWUA 2B0GA 3C16A 4ZP6A 2JDJA 1QAIA 1K44A 4S0MA 3S1TA 2MKIA 1T03A 2ZD1A 3MM9A 2CQCA 2H9ZA 3JQJA 4FF1A 2WVCA 3GR1A 1TFWA 4F3MA 2XWXA 5KT3A 1VRTB 2R7UA 1UJ4A 2KM8B 3SEOA 2Y0BB 2VFVA 4R8UB 3V4IA 1T05A 4DL4A 4X64J 2JEGA 4B9NA 3I32A 5KOXA 1PYTA 1H38A 2E5LF 5A76A 1LFPA 2HLUA 3HHLA 4L72B 4KYZA 1DY3A 2BANA 3T3FA 2NYHA 2HHHF 5DDRC 1V9OA 2E9RX 1KHVA 2K1RB 4JOUA 5AXMA 2ROPA 1NJIT 1XERA 3CCQS 1RKJA 1D0EA 4DSEA 1N34F 1CQMA 2UVVA 1H2VZ 2GQQA 4MK8A 4X4TA 2KG0A 1J5OB 2ZH8A 2XMKA 4ZPBA 2HHPA 4RUCA 1JLAB 3JB9k 3AA9A 2DD8S 2NLWA 4F36A 3TZXA 5F8JA 3V6HA 4DV0F 4WYWA 1RKIA 3AD8C 4F2RA 1JLGA 1O8BA 2PC6A 2DR9A 4QWEA 3OFEA 4JI5F 5JVGQ 2EC0A 3RR8A 3HJFA 4G6VB 4NLXA 5FIIA 3VZHA 1EP4A 4LF7J 1LW2B 1MMNA 2HNYA 3R5JB 4KFBA 1YDLA 5E0OA 1HR0J 2ILYA 3V2UC 1NDKA 4ZLJA 3V81B 4NXNF 3BBCA 3AXMA 2CUYA 1U45A 1F3VA 5J1NA 3MHYA 1GX5A 1N5VA 1Z2ZA 3TP2A 5KFEA 2CJBA 1B0PA 3PRDA 3BGUA 4O4RA 3BM7A 2F8EX 4N41A 2X3GA 4FPRA 2DPIA 4DSIA 3HVTA 1FVQA 3EGNA 3I0SA 2E1MC 1TL4A 4J9UE 4LR8A 5RUBA 1FEEA 2XMUA 3QJPA 1EKSA 5KFMA 4B3RF 2DRBA 5CCMA 3S6EA 2MQNA 3PFOA 4OYBA 4C11A 1T95A 2M3DA 4P72A 2ZWPA 1X4AA 5H1SV 3OHBA 3H90A 3OW2R 5K14A 1HHTP 4F4WA 3M9OB 2RRNA 1XBWA 3VVTA 1RWMB 5IM0A 3MMBB 2FVPA 4HYKA 1BXNA 4DN9A 3TAMA 3DM2B 4TU9A 4LQ9A 3UDCA 3G8SA 2OFGX 2ZC3A 3PJWA 3QPIA 2GMLA 4U7CA 2B4UA 2BABA 2O3DA 3QO9A 4WKRA 4OHWA 4FVCA 2IBOA 3PW2A 3G2XA 4ZHRB 4L6V3 4PABA 2HQIA 4R0JA 4RL1A 2XMWA 1U1RA 4B02A 2GAGC 4K4UA 5KFWA 4FBUA 5KFXA 5D8HB 4EK2A 4CO5A 5CQGA 3I5AA 1RTHB 3KJNB 1FESA 2VIHA 1VIXA 4MKYA 2DR6A 4ITSA 4XTTA 1X5SA 4LF5J 4XAKA 5KG6A 3N9UC 1NSKL 3TW0A 1DARA 1U1MA 4B9VA 4X4RA 2JWNA 4PG6A 5IS2A 3AD9C 4DV3J 1FDAA 2FJDB 5SZTA 3MEEA 4N77A 5DETA 2YKOA 2Y1JA 5E3RA 1LW0A 3D6TB 4WFYA 4IDKA 2ZH4A 1RTZA 4X64F 4USHA 2MQLA 1LEOA 3CF5Q 4B3OB 3MM6A 3HLUA 5B0DA 1X60A 4FF4A 5A8KA 1DBDA 1NU4A 3LGMA 4DOZA 5ETVA 1KKHA 2YWWA 5E3QA 1CVJA 4BCAA 1J2VA 2QFIA 2HK2A 1VBYA 3R6LB 1N8RT 4MIBA 1FRLA 5L9XA 3HULA 5J2MB 1M90T 1ACMB 3ET6B 3ZZZA 4CDIA 1P27B 1MROA 1BWVA 2OTLS 1CPZA 3G9CA 1TUWA 3TI0A 2DHGA 4U67Q 4IFYB 3M1VA 2PDAA 3OVBA 4FVMA 2ROEA 4ES3A 1SB6A 3C14A 4KAIA 3NLCA 3Q8VA 2IHR1 3H2LA 1UVKA 1WI8A 1CULB 2CPHA 2BJ7A 2XZWA 3P96A 3B4DA 2IA6A 8RUCA 1HI1A 4YQWA 1ZS6A 1SH0A 1KQKA 2CXEA 1RTDB 2FUG9 3R7BB 3RB3A 2HVIA 2WK4A 4Y2IA 5KFOA 1U0SA 3FQLA 1RTIB 2W4PA 4LRAA 3RB0A 1W2BR 2HQGA 3DDIA 4NXMJ 1U49A 1RHKB 1VMBA 1YRXA 2QO3A 3VWSA 4DV1J 1LXNA 2ODXA 3MI7X 2DR7A 3PR5B 4ZVUB 5IXUA 2NPFA 4CQ1A 3TA0A 2N3LA 3ZNJ1 4CYUA 1O6XA 3RBDA 4PXBA 3MM5B 3UE2A 2CQBA 1EX8A 3GJTB 4QIWD 4FPIA 2XLIA 1F9EB 1EB0A 3IGVA 4HACB 3OTBA 1YRUA 1LWFB 5KFKA 2B5JB 1LWCB 4GVBA 1CJVA 3HFVA 1UA1A 3WC0A 3MAAA 2MGZB 4IH7A 3HMJG 3KXDA 4RZRA 4UQTA 3TOQA 1HNWF 2BE2A 1OYDA 4RBVA 1GX6A 1MWQA 2AX0A 2HBQB 5D3GA 1S6UA 1UZHA 3KJVA 5LSOA 4F4YA 4OHXA 1RT7B 5AXNA 3MOZA 2UV8G 4PWUA 2XYPB 3NAIA 2PEBA 4I6YA 4I7FA 2B9YA 3RB6A 2RHQB 4DG1B 2R3VA 1Y3JA 2AZ3A 4FYVB 1HBUA 2RB7A 1SQFA 3NGSA 2HKEA 2J7KA 4LBPA 1U7LA 5C42B 3LOUA 5KFLA 4C9DA 2XNQA 4LF5F 2RT3A 3CO9A 2VD3A 1LWEA 3GV8B 3A1YG 3QT5A 2BW7A 5F8LA 4ED4A 4Q2MA 1YJWS 2ZC4A 4YDXA 4MIWA 2H5JB 2N7YA 2Z56B 5KFTA 3TZYA 2RNEA 4DFJA 2AGOA 2CNKB 3HHEA 3E3XA 3NP5A 1N6QA 2QYGA 1FWKA 1T9XA 1UJ6A 4JV2A 1XIQA 3ENWA 5GADI 3G8TA 2KTQA 2L9NA 3T19A 4KBIA 2VUGA 2HBYB 2AGPA 1MN9A 3IS9B 2X1GA 3KMQA 5HJXA 3NNAA 1H7WA 3NWRA 2NQPA 1XMOF 1H72C 1FKAF 4B3MJ 4USMA 2B4VA 5HVGA 4TXSA 4DCPB 4C4WA 4IQXA 2GZOA 2VA2A 1EARA 3KLHB 4PCQA 2XULA 1U4BA 3R9LA 3QLHB 1MG7A 1GTEA 1QVFR 2EG2A 1N5TA 2DGOA 3W2VA 3FZBA 4OX9F 4URGA 4UOFA 1RT3A 2J7WA 3GYXB 4LREA 1Q79A 2AYBA 1BC6A 1HMVB 5U47A 2HHUA 1ULRA 2UXBJ 4HT5A 4PUOA 3VGUA 2HGMA 1FWLA 3PG9A 3BGOP 4PR6A 4X4NA 2W2NP 3M9NB 2Y1IA 4KHMA 1IKVB 1JK9B 2FQQB 4P75A 1X5OA 4KTQA 5DZ6A 3KLVA 1WTBA 2VFTA 1K47A 4DPYA 2X1BA 2YNGB 4UY8T 2DXEA 2PE8A 4Y2MA 4ZJOA 3DCAA 2CQ4A 1AUSL 1Z1ZA 3DOLB 3SBMA 4DV1F 1S0NA 2WSEC 4QW8A 2IJFA 4K5SA 1Q8KA 3W9IA 1RAFB 4WFBQ 5B0CA 2DXDA 2B8PA 3AHPA 3US5A 3KMSA 4O0NA 2YY3A 2PEHA 2KZZA 2Z4PA 7FDRA 4MIAA 2EKYA 4BDPA 2E5GA 1JLFB 1F0XA 2AJQA 1SUQB 1TMJA 4K8RA 3BB5A 1QTNB 1JLQB 2F9DA 4M5LA 4CP5A 3O6QA 3CCZA 5EX0A 2UVRA 4K0KF 2HWHA 4B9MA 1M1HA 3CJTA 3Q8SB 1S6PB 4QOTA 4Q45A 1UFKA 1OS5A 3QZ8A 3TUPA 3JSYA 3UW1A 2ZEJA 1FDBA 2M5YA 4ZP7A 2EI5A 4NLUA 4JI0J 5HSPA 4N76A 3AOAA 3EVMA 5CH7B 4OHYA 1CJKB 4FKYA 4QIEA 1KTVA 1W2IA 1E6YA 1U26A 1N5YA 3GG0A 1FJCA 3HT3A 4FYXB 3PXGa 2VL1A 3R1LA 2QJ3A 3ICLA 3PYFA 2PFDA 2COLA 2DK2A 2NZ4A 4KHRA 4W4MA 4NLPA 1R7IA 3KK2A 1N4LA 2EBEA 2E5JA 1SCJB 3CCLS 2IVYA 2FLOA 2RSQA 2VG5B 4ILRA 2ZBIA 4JV0A 3I0RA 2YNIA 2QTWA 4PYAA 3L09A 3BN4A 1JXEA 4LF4F 1XWLA 1SC6A 2ZOMA 4QIFA 2W24A 2RD5C 3J80U 1ZA1B 2ZH9A 2FY1A 1LV5A 1I5OB 2YQ0A 3EVOA 2BRLA 4K4XA 4C0BA 3TA1A 3W64A 3EYZA 3G87A 2HVDA 1XC9A 3EVWA 1XNQJ 4PXCA 3NCPA 1SIWB 4Y6IA 1D9AA 2GVZA 1SKSA 3O44A 1OIAA 1RCXB 3K0JA 2G0JA 4HDHA 5GAEI 3H2UB 4ELTA 2E44A 4O3NA 4DR7J 2V8HA 1BQMB 2DNKA 3H7HB 5KFNA 1XR7A 4F02A 3RB4A 3QIDA 1NK6A 2D3UA 3A4TA 3EZ5A 3C15B 1Q53A 1HQEA 2BJ3A 4DV6J 3J80Y 4DJBA 4IOBA 3JSRA 5MAOA 5HMYA 4PWDA 1WF1A 2HEKA 3RW6A 1H2TZ 1ZOTA 3DI6A 4DN0A 1RQ0A 4A8OA 1WNEA 2UXBF 3IRWP 4CTAA 2OEMA 3DKDA 1S1TA 5J2PA 1VBXA 4I2QA 1S4FA 2FY8A 5HAOA 2O66A 1ZM4A 3DNCA 3NGRA 4M5JA 2QMXA 3R5AA 3ZTQA 2F8HA 3HFZB 2XY5A 3MCNA 1N54B 2POKA 2R7VA 3KLEB 1YX2A 3BV8A 1QY7A 1RHJB 2OFHX 5F0WA 3VV2B 2KU7A 4USIA 1ZTWA 3OL7A 1R0CB 1IR0A 2RS8A 2IIHA 1FXRA 1TAUA 4NRUA 1ZZFA 4LFCF 1URRA 1RT6B 4DDFA 4ZKAA 1Q82T 2RIJA 4DBQA 2PSZA 5H9FJ 3UCZP 2F5GA 2QG9B 2ZH7A 2OPPB 2Z2YB 3OTCA 1HQUA 1B64A 2NSCA 3LP0A 4Y3CA 2FGOA 2KKHA 3DGVA 3HKWA 1IKWB 1S1UB 3UN2A 3OVAA 3M30B 1RXOB 1HWJA 3FFIA 3I9V9 3OL6A 3CSKA 3W2WB 3OJSA 3IN5A 3KLFA 3DU5A 5IC6B 2VKZG 4ZLNA 3MECB 4LR9A 1T9VA 4EBCA 2E29A 2OHDA 1CJTA 2OEKA 1FRHA 2VH7A 4JI0F 4YY3J 1S6QA 2CKWA 2QIFA 5DGBA 2CPYA 2ZZNA 3GCXP 2FHMA 3H5YA 3NXZA 1AXQA 3EUNA 5DRKA 3C6EC 4JI3J 3AA8A 1U1KA 2OELA 2ZHOA 1RT5B 4NLWA 2CQGA 3DLHA 4NLGA 3QGPA 1W7WA 4TLQA 3WC2A 5J2NA 2PGCA 3K59A 2DNMA 3BGRB 1WUUA 2ZJPQ 3HJVA 2XM3A 3R2CJ 4X84A 3CNQP 3SMZA 2HMIA 1S7IA 3BR8A 2LA4A 1S0VA 4HH0A 4F7VA 3CJQA 5G0RB 5IV3A 4ZMMA 3PFEA 1Y5LB 1T7PA 1M5SA 1JMTA 3H42A 2AZ1A 2JFDA 1RAEB 4QWBA 1VRTA 2FC9A 1TV6B 2KHCA 1TK5A 5FDLB 4R8UA 5KFGA 2E1RA 2IVFB 4M63A 4QYRA 1OWXA 3BGFA 3N01A 1U0HB 3I6PA 4YP3A 2HLTA 2CG4A 2QV6A 3EICA 4TY9A 3CCWA 5GAHI 1YZ7A 1G3OA 2K1RA 2MDAA 2N3OA 1N0VC 2XHCA 4DL3A 2LQ8A 2FJXA 1OYEA 1PBAA 1NJYA 1J5OA 3FBEA 4PEOA 4ZK7M 1FX2A 2FGCA 1JLAA 4DV6F 4A4JA 2NUUG 4OYPA 4HHUA 4MMOA 5BYSA 2UUCF 1H73A 2MEWA 1JJHA 3R5DA 1I94F 3IWNC 4ZPVR 3DHWC 3U1LA 2YWEA 1QSYA 2C2KB 4FYDA 3KDOA 4ZLLA 3SZ2A 2RU9A 3M8QB 4WTOB 5CYMB 1X9SA 2JNJA 4XK8C 3TEHB 1LW2A 4LSNB 3CCUS 1R27B 3QRRA 3I4PA 3PY8A 3IM9A 3V81A 1UJ5A 3D5MA 4DU8A 1WHYA 5JXSA 2J7UA 3GYNA 2G2YA 4Y00A 4X4OA 1HPZB 4DSLA 1HNXF 1IWAA 4G1IA 2YNFB 3CW2C 5I42B 2BJ9A 2BYCA 3NKYA 4FN5A 4C2MA 1ZETA 2BE9B 3L95X 2QA4S 3THVA 4IFVB 2K7KA 2V8DA 2UUAF 2KXNB 5GAEU 5GMEA 3ITHB 4FXVA 1I6JA 3PV8A 4CO0A 4LF1A 2MKKA 4ID8A 1SJ3P 1T9WA 1NH7A 2JFKA 2ZNZA 3FGVA 2CFXA 4IO9Q 1RBLA 2CYYA 3V5RA 2HVZA 4CO3A 2Q66A 1UFWA 1LWXA 1T9YA 2N82B 2I6WA 2A0FB 2B51A 2AJ0A 5E5NA 4RPFA 1EJ7L 1TZ0A 2CPXA 1WEZA 3MMBA 4PQAA 2VG7B 4J37A 2V6AA 3DM2A 3SDEB 5L9NA 2APOA 3MUTP 3SCJE 4CO1A 3JQKA 1S9FA 1VRQC 4YY3F 2DNOA 2C3OA 4ZHRA 4JI3F 1H98A 4FS2A 1P1TA 4CM2A 2C2OB 2NXJA 3AT1B 2V50A 5K20B 3W8GA 2YKPA 2P9EA 3AY0A 4I0WA 1RA6A 1RTHA 2QLDA 4R25A 2FJAB 3LWLA 1VQ6S 2AJ2A 3T5HA 2KT2A 3AXKA 2BDPA 1RU2A 2JEJA 4A47A 2RJZA 3U02A 2DRDA 4FS1A 3RGIA 1UWBA 2LECA 3KK1B 2JVOA 4FDFA 3B8HA 2AW0A 3VHQA 1YZ6A 3M8WA 2MXYA 4KT0C 4ZVEA 3PJXA 2FJBB 2IC3B 4B3OA 5L46A 2V2KA 2AKWB 4MTPA 2RH3A 1L3KA 3GJQB 5HO4A 2EPIA 2YXLA 3V6KA 3HX9A 3QRQA 2ZH2A 1Y0HA 3BO3A 2WBMA 4P9SA 2IA0A 1Q8LA 1GMVA 1UA0A 5J2MA 2ATLA 2PMHA 1HHSA 3ET6A 2PA3A 4YOEA 4WK3A 3BR9A 4IH6A 2RQCA 3QATA 3IM8A 3VCDA 1YJVA 4IFYA 2XI2A 2ZD1B 5E3PA 2JOQA 1DZ5A 1B4SA 4C0HA 1FDDA 4E98A 5CA5A 4IG0B 2CNNB 2O1PA 3T41A 2GIQA 3TAPA 3H5SA 2G13A 4U96A 5KT6A 2FZKB 1SL1A 2LQ5A 3NBPB 4LFAJ 2MY8A 4KGMA 4E8UA 1RTDA 1SV5B 5HATA 4P7VA 1R6YA 1V6HA 4Y2KA 4OI3A 5FLXY 2FC8A 3LGNA 2FJEB 1X8DA 1RTIA 1D3WA 4B9LA 3J7Z5 3M8ZA 4JB8B 3T1HJ 1FA0A 5IWAF 4NRTA 3IG1A 3H5XA 2OJ3A 5AJ3F 1XTZA 4JI1F 4P52A 4ZOSA 1FE4A 3G6XA 3RG6A 4C8KA 2NXUA 3KHGA 2EFOA 1Q81T 2YNHB 3QGHA 4ZN1A 5F3TA 3CCSS 4YR2A 1TKZB 2CADA 4IH5A 2UXDF 4J7CA 1N5QA 3NOGA 5I4MA 4PQUB 2DITA 2VFSA 3E51A 4HACA 2Z58B 1UW9A 1LWFA 3ZZUA 4LSLB 3ZTSA 1FVSA 4CLUA 1LWCA 2UUBJ 2HAFA 2XGPA 3A8KA 1KEKA 2MGZA 1R6VA 1XMBA 1Y4ZB 1S0MA 2OPQB 4UQGA 3HI9A 2WRMA 4DPWA 2PI4A 1RT7A 5F8GA 5ETQA 4YB7A 4CLYA 1L5UA 5IT4A 5ETNA 4DG1A 5K8OA 3CC7S 7AT1B 2MQMA 3P49B 1L3TA 4ZPDA 4ANDA 3NRBA 1ITPA 5C42A 3SFGA 1K1SA 3EGWB 2UVWA 4RO0A 4KH0B 1TL1B 2CJYB 1GK8A 1RWNB 1NDPA 1YJ9S 4RW9B 2DHHA 4DI6A 2HWTA 2CG8A 1AUDA 3U27A 4K4YA 1FFSB 1R8BA 1N36F 2HIYA 1N32J 1WOOA 2R7TA 5IM0B 4KKOB 1ZH5A 2MZJA 3G86A 3WIUA 4L75A 3HP6A 1CG2A 1KP6A 3IRXB 4TU7A 2F9JA 1TL5A 3PIPQ 2V4JB 3LAMA 2K3IA 2KT3A 4AD6A 2Z8QA 3RAQA 1Y00A 1YQHA 1N0UA 1WC1A 3BPSP 3T5JA 4K2JA 4DSFA 4ED6A 4M8LA 3ONQA 2CJQA 4C0OC 3C6TA 4ID5B 1O51A 3C2PA 1F6TA 4ATNA 2WB1D 5KFDA 3GB0A 3N6MA 2UXCJ 4YDDB 4EZ6A 3KLHA 3VAHA 1DRZA 4O3RA 3QLHA 2PMZD 2Q79A 3KG1A 4AT1B 3FRYA 3UD5A 1TKDA 1VK3A 1UVLA 3IFEA 2P9GA 1PYSB 2BM1A 2IJRA 2YWFA 2BM0A 2AYEA 4OI4A 1FRJA 1X9WA 1X4CA 3DLJA 4J91A 2PO4A 3MUVP 1SJ4P 1GQEA 3IP0A 2BW2A 1MNEA 4IDKB 4LFAF 1CBKA 5LMNF 1IKVA 1PC4A 1RACB 4YB1P 2DGTA 2I8EA 4JI2J 3CO0P 2VICA 3PEJA 5D4PA 3GIMA 4K5RA 5DLFA 3B82A 2Z2MA 1CC8A 5LOQA 5HQMA 1NO8A 5L1KA 1JLBB 2YNGA 1U1NA 4ECYA 3QMQA 5KFHA 3DOLA 1L3VA 3L7OA 5CCLA 3K17A 1EQMA 4DS4A 1ROFA 4KGVB 3WBZA 1AZSB 1WC5A 3PHEA 2ZH3A 1IBLJ 3M05A 3RAMA 2DGSA 3BH6B 4DR5J 2DXFA 3PCOB 1S72S 3IO1A 1JLFA 1U8SA 4Q5VA 5KT7A 4C98A 4I69A 2D69A 2B43A 1SUQA 1EIYB 3KLGB 1ELOA 3D28A 3E2EA 1JLQA 3JQMA 3CMES 2UUBF 4FYWB 1RWXB 3O2IA 4QPXA 1A7GE 4Q2LA 3NG8A 4LSZB 2EC2A 2AT1B 2VOPA 5EHHA 2YVSA 2ZVSA 3PX0A 3Q8QB 1S6PA 3HHKA 5DQHA 4CLSA 4YR3A 2ZOGA 3D68A 3EX7B 1VRUB 3TQ1A 4A48A 1HWKA 2OAUA 3QFWA 5DG8A 1IVZA 2GQCA 3MMAA 1CJKA 2VPWB 3GV7B 1QD1A 3PNIA 3VALA 4DL5A 1K0TA 4MK7A 2KXFA 3R7NB 2EG1A 2HW3A 3NGDA 4GO5X 1NSQA 2LQ9A 2VQFJ 4DZ6A 3C66A 2GHWA 4C3MA 5ETOA 2VG5A 3TEGA 1NB7A 4LF6J 1U6ZA 2BXJA 4L3KA 3KNAA 1U2CA 2HS4A 3CVKA 1SC3B 3GSDA 1UW4A 2ZITA 3MM8B 4WK1A 4Y2AA 4DV5F 2C3UA 2LXUA 1I3OB 3MAQA 3LH2S 4M5MA 4ELUA 3H5UA 2GGPB 2FVRA 3X1LB 2FHJA 2XZDB 5D0GA 2ZVIA 1UTAA 4QIGA 1PIEA 2FLLA 3M8YA 5B0AA 2DCUB 1BQMA 4PAAA 2E7WA 4WWSA 1F5BA 1HBUB 3MPYA 3F56A 3C15A 2JRRA 3DMJB 3M6UA 3UPFA 4TN2A 4ETXA 1OMSA 1SBRA 4ZJLA 2ZOFA 4NASA 1HA1A 1Q16B 2L08A 1ZM3A 4KC5A 1U24A 2LDIA 4CLZA 2DEIA 3HHDA 3VF0B 3H40A 1FJGJ 3PW5A 2CQ2A 3DRRB 2DNRA 3CWJA 2MSSA 4OI2A 2HQFA 3QWPA 1X5PA 3MOJB 3J7YU 4JI2F 4UOHA 1ZA2B 3Q86A 3C3LA 1YBTA 3N0VA 2J0QD 3KLEA 3HT0A 1PJ6A 3PM9A 2YWGA 3EDQB 3AH6A 2EFGA 2WVEA 4NZ7A 2BX6A 1VC6A 1RT6A 3MDFA 3HD1A 1XJWB 4TYAA 2MZQA 4TNOA 1OJ4A 4RWWA 2Q6BA 4EEYA 2OPPA 3BSAA 3C19A 2JVRA 4YN3B 3OXFA 1WF0A 3W2VB 2R7XA 1NK5A 1IKWA 4Z7YA 1S1UA 4EMDA 4JBCA 3FVYA 3M30A 2YKMB 1N48A 1KTQA 3KHHA 3W2WA 4ECZA 2P9CA 5KFFA 2CWKA 3MECA 2HBRB 1S57A 2R7QA 1DLOA 2DRAA 1RP5A 4IQMA 4DCJB 2W7AA 2DNPA 2Q3PA 1XNRF 4ECVA 3HSGA 1RAJA 2VOOA 2YKAA 2BUNA 3M2UB 1C1CB 2GQ2A 3OTOJ 1RT5A 4DZDA 4USJC 1C2PA 4MYUA 4AL7A 2DBBA 3BGRA 5KFJA 1C0TB 1U47A 4F4XA 3W66A 1IM6A 4HH1A 3DXBA 2M8DB 4CLLA 3OPKA 3NS6A 3MR7A 1GMWD 5KFSA 2XBPA 1D9FA 2FLNA 3D3CJ 2W9CB 1N52B 3B78A 2XO7A 5G0RA 4LF6F 1JLEB 2A6OA 1WOPA 2DYAA 2B6AB 2PA8D 4Y34A 1YJNS 3D9BA 2D3OR 3J7ZT 5J2QB 3M9MB 1TV6A 1TFYA 4ED1A 2GFFA 1IJFB 5FDLA 3FEYB 2OMOA 3NS7B 5DS7A 3MCOA 3GYGA 1G1XA 4RJVA 1HIYA 3ILOA 2GA7A 2J8AA 4LT6A 1HL6A 3M6WA 3BDPA 2XYGB 4XPCA 3CD7A 3DLGA 2B9EA 3RTVA 3H98A 4OI0A 2AP6A 2LEBA 3HZGA 4Z37A 4OV1A 3AAWB 1RA7A 1B3TA 2HNDB 4FBTA 3LGHA 4K4TA 4NYPA 3LZ8A 4WBFA 2PD1A 1QVGR 2QA1A 1WSRA 2LYVA 3ISNC 1HFEL 4EI2A 2GHVC 4U95A 1K1QA 5DDPC 3CDEA 1RTJB 3M8QA 2HRTA 1QM9A 2OGUA 2VFUA 1KFSA 5CYMA 4DUYJ 2YNIB 2CPJA 3RYLA 2WCXA 2R2UA 4LSNA 2AMCB 1G7CB 1RT2B 4L76A 5LJ5Y 4QIVA 3MR2A 4JYAJ 4WFZA 5B0BA 4J9NA 2C3YA 2MQQA 3ILIA 3OSNA 3DLEB 5HJYA 2XMAA 1RI7A 1HPZA 3JTNA 3TUIC 2I0XA 1HYSB 3BDEA 4C6AA 5I42A 4LRCA 3KHRA 2FJVA 1PG5B 4GKJJ 1Z2LA 2ZUGA 3JS9A 4IFVA 2Y0SD 2JLEA 5DGAA 2LU1A 5CD4A 3ITHA 4IYQA 3MFIA 5L38A 3SV3A 4DR1F 2RE1A 4KGXB 4GKKJ 4QYZJ 3W65A 4OZ5A 1YHQS 1SKRA 3VAMA 3HVAA 1N33J 1HKAA 5KFIA 3Q89A 2DO4A 2E5HA 3K8WA 1WG5A 3CJ4A 2UU9J 1J27A 2HK3A 1T02A 3V6JA 4CTAB 4WPAA 1SQGA 5C2CA 2VG7A 3BS9A 3S8SA 3PYEA 4CLWA 5L8RC 5HLFB 3SDEA 4DFPA 3NCRA 1ZZNA 2CZ4A 2W2OP 1SVDA 3UD3P 4AXIA 1GTHA 1HNVB 3ULHA 4N8OA 1QLNA 2YQ3A 4ZCKA 1VBKA 1VGYA 3KUGA 4K4WA 3TX0A 5DG9A 3GCWP 3LPEA 1WG1A 4RUAA 2VPXB 2EFVA 2ZKTA 3AQOA 4A8WA 1WHVA 2WTFA 5KG1A 3OR1B 3MAHA 2OPRB 5A2QU 2ZBPA 1DHMA 4NYOA 4KV8A 5ETPA 2IYIA 2X3DA 4MFBB 2FIUA 3M2RB 3KK1A 4MYTA 3C6UB 4ZS6A 2YPYA 1SXLA 4D3HA 2NXNA 1VISA 2GCFA 2IC3A 5DDOC 3NMAA 4ZVSB 2ERRA 4I67A 1QE1B 2J0WA 1UEUA 3FCHA 1UZDA 3OFGA 2U2FA 3CIMA 1KOOA 2BJ1A 5A2QY 1SL0A 3NOCA 4L73A 2DNLA 3LANA 4OLOA 3D0HE 1JJCB 3N4WA 1FFGB 1JKHB 4OYWA 4F26A 3EPIA 3GR0A 3KKFA 3NGUA 4LRBA 2R8IA 3I82A 2HMIB 3BH7B 4Q8FA 4WP8A 1YTYA 4UY85 2F7VA 2DY9A 4DUYF 2VF3A 4ZDNA 1Q0NA 1NPRA 2ZNYA 2A2CA 1WJ9A 3SQOP 4IG0A 5HI7A 3QWUA 2G9OA 4X4UA 1FT8A 1UPPA 2M4MA 4C3LA 4ZPCA 3T1AA 3HHLC 2HS3A 1IR2A 3S01A 2HPUA 2HHWA 3NBPA 4NE9C 2J0XA 2VBWA 4JI7J 1SV5A 3KG4A 2G2ZA 2ZH5A 4P2SA 1N56A 3W3SA 3KTQA 1PILA 4ES1A 3TZZA 1KHWA 4FYYB 4WF9Q 5L1LA 4LJMA 2ZDOA 2KHDA 4QZVB 3GONA 2HHXA 2HHVA 2YNHA 1NEEA 3DHXA 5HVHA 2V2VA 3NL0A 4E2FB 3GIJA 1JXLA 1QAYA 5AXLA 1TKZA 3VR1A 2H51B 2RQKA 3BO4A 4IG3B 4DR3J 5M2RA 4PQUA 2YX4A 1XMQF 4ZA1A 3CE8A 3HVRA 4LUBA 1SJFA 4LSLA 4TU8A 1CLFA 5KT5A 2M7SA 2KG1A 4QU6A 4OJGA 4ZVPB 4KQZA 1KLNA 4TY8A 2NCKL 1S9GA 5GMKa 3MGJA 3MMCA 2OPQA 1B99A 3CUNA 3GSIA 4B17A 2OPSB 2O01C 1Q5VA 1RDRA 2HFZA 4R0EA 1TMMA 3FCVA 3LTOA 8ATCB 2JLGA 6AT1B 2Y1LB 2YWHA 4YMEA 1R8PA 3N6LA 3DGPB 2VKRA 3A13A 1UVJA 1YWXA 3P5BP 1V3ZA 4RW6B 5SUHA 3KJFB 2QLBB 1IWGA 2JH3A 3KK3B 3R3TA 4GC7A 2FB0A 2HRYA 4B3TJ 2PIIA 1TL1A 2XLJA 4FXWA 1TL7B 3LAKA 4P2FA 3TVZA 1QSLA 2CIMA 2QGFB 1B0VA 3T6JA 4RW9A 4IR9A 1FWPA 3QGGA 2EVZA 4MKAA 3PW7A 2VONA 3EM1A 2AYMA 2LEPA 3PACA 3QBCA 1EQ0A 3RZAA 4KKOA 3QSYB 4Q8EA 2PFFB 2ZBCA 1YG0A 4CNZA 3IRXA 4X62J 2V4JA 2MQPA 5G4DA 3M6VA 3CJ3A 2JEIA 3G82B 2J9DE 1RCOB 1NKCA 3TUJC 1Y7PA 3BQ1A 1WF2A 3TANA 2R42A 1HNZJ 2NPIA 5I3QA 2X7IA 2J8SA 4DR2J 4A8SA 4NLVA 3RRGA 5AE1A 4ID5A 4AUKA 1ZAWA 3L7UA 4P2XA 4F0KA 4TYBA 4YUDA 2F63A 2OSQA 2CJ9A 3I5CA 4AL5A 3PIOQ 1U8WA 1PGZA 2JL9A 2W7OA 3AOBA 1WWHA 3M4XA 3G6ES 4G3IA 1XEZA 4YFUA 3G71S 1BWEA 2HHTA 5A8RB 1V5IB 2QLWA 1KSPA 2JEFA 2G0IA 3NGKA 5H9EK 4D3GA 1UWBB 3NNCA 3CDBA 4DPTA 4O23A 3W1YC 2W7PA 4WU3A 5F9LA 2DJWA 4RNOA 1FJEB 3EMTA 4OLPA 2B56A 4GMKA 4JV1A 3R1HA 3QZ7A 2V94A 3P8BB 3D6HB 1RWVB 3ZZRA 3BEGB 5C2GA 1C1BB 1JLBA 2FDNA 2AV5A 2BA9A 1EETB 3MPUB 3W63A 5LM7E 1KONA 2KFZA 3DOKB 4J9VA 4DFMA 1KOHA 4ZPAA 1NK8A 1SC4B 3I55S 3ENVA 1GMUA 1AZSA 2IM1A 3DXSX 4IRCA 1NDCA 3M8PB 1D8ZA 1RLCL 1Q4RA 4RUBA 4OYIA 3IWXA 5L39A 2Q1LA 2OIHA 3MZIA 5KOWA 3K57A 1FXDA 2H54B 5ADZA 4U9RA 1S5ZA 2BV3A 4EFAC 1SIZA 3KLGA 4LF7F 2KZMA 3CDAA 4YHHJ 1S49A 2RKIA 3KNGA 1HR0F 3SCIE 4WE1B 4G1PA 3BQ0A 4URQU 5BYRA 2DGQA 1GXTA 4EBDA 2MLXA 3C46A 3R27A 4ZVFA 3NAHA 3LUYA 3W7BA 2YTCA 2MY7A 2FHKA 1RYRA 2HSEB 1VRUA 2HG4A 2KJVA 4UOCA 3TRGA 2I5JB 4ZIWA 3LQVA 4HLBA 4OYAA 2W01A 3RR7A 1VBZA 2VA3A 4PWWA 5CZXA 5C24A 3VGVA 3IG1B 4ICLB 3HDSA 2ZBQA 1QDUB 5E7OB 1KVJA 4LFBJ 3P45B 2ZM6J 1OY6A 1YRTA 3FSYA 3OXGA 4A8MP 3I56S 3D54A 1FHTA 1G4CA 3LA0A 2YX7A 2D3O1 4LBIA 1TL3B 2XTJP 2RQ4A 4BBYA 3FNNA 2AEMA 4CO4A 1NDLA 1WKKA 1VC5A 3CULA 5KT2A 3DC2A 2XMTA 3CJKB 4EYHB 2RMLA 3MM8A 3M2VA 1S59A 2IBKA 4J9PA 4X62F 2LFVA 1BGXT 5IFMA 2GGPA 2KVQE 3PVXA 2DIVA 2VDHA 5B0FA 5HBMB 1HNZF 4QBUA 4HTJA 4EYIB 4IOCQ 3OFFA 2ASLA 2D74B 2DIUA 2GX8A 2WVFA 2D7SA 4WZMA 3LPYA 4DR2F 2VZ9A 1RBAA 2V34A 4ZVQB 4K4ZA 3JSMB 3GV5B 1YITS 5AE3A 1VK8A 2OD4A 5D6GA 1F9HA 1HI8A 3DMJA 4KY3A 3AOCA 3OVSA 1R43A 4OI6A 4W92B 2WSCC 3SCLE 4LRFA 4CZCA 5KFBA 3FBFA 1PSDA 1NSAA 1NJWA 3WQPA 4DV3F 2L9DA 2AJ1A 1T94A 2M2BA 3QNWB 4J9QA 4JP8A 4DX5A 4EWTA 1QAJA 2HHQA 4K4SA 1S76D 1OSDA 1OPIA 2C28A 4DHVA 2CJAA 3DRRA 3GFHA 1OQ6A 5EN1A 2EXUA 1IBMJ 2MHNA 2RUSA 3MFHA 2QX0A 3V4MA 5K8NA 1VDHA 4C97A 4DL0C 3AB2B 4OX6A 2XSFA 1HBNB 5F0UA 3HD2A 4OZ3A 1U1OA 1S10A 2FD2A 5KFPA 4O3SA 4DR6J 5M2PA 4NZ6A 3T6BA 1F2GA 1FKOB 3VAKA 1HARA 3TNVA 4J9KA 1Y9OA 2ZUAA 5EUHA 4UTGA 2KB2A 1NKBA 3D1QA 2KJWA 3HSDA 2CA9A 5A0YB 3C6TB 4H4KA 4X4QA 3JAMU 2RRAA 2MYFA 1D1UA 2BVZA 2XZTB 4ETZA 3L7PA 1L3UA 4CT9A 4U8YA 2IPOB 2YX1A 4C8MA 4DV4J 5JJBA 2R7OA 4ED8A 1BE4A 2YKMA 3ADAC 2XB2D 4USTA 2AJFE 4AL6A 2IDLA 3CTRA 3CT9A 3N79A 5CYQB 1XN9A 5A6PA 3CJ8A 2A18A 2EWHA 3MPDA 1CQNA 3TJ8A 3JAMY 2QL9B 3MPWA 4QR1A 1S77D 1YJ7A 4M94A 2VHGA 2F40A 1MU2B 2JC0A 4DFKA 2CQHA 3OR2B 3OV7A 5KT4A 3M2UA 4NXMF 1C1CA 4DMZA 3NGTA 2J9DA 3BGLA 1TKTB 2F8MA 3QGIA 1RWUA 3Q2SC 1P8GA 3C5XC 1WKJA 5IZHA 3SQGB 3K89A 2ZHAA 4DV7J 2GJIA 1C0TA 3EE3A 5DM7Q 2KL8A 2DTJA 2KI2A 4RBTA 5HQLA 5KFVA 1RAAB 4F4AA 2RF2B 2W9CA 4DSKA 5F8IA 3NWGA 3VQTA 1C0UB 1JLEA 1K0VA 2MZTA 2B6AA 3GILA 2VC1A 2JC1A 2ACMA 2CAJA 3NY0A 5J2QA 3FSIA 3TQEA 4OQJA 2XSJB 2R4FA 3KDNA 3OFHA 5HK4A 1RLDA 2AJ4A 3KYLA 3BBBA 3MEKA 4TQRA 2L41A 4XIUA 2XGQA 2ADBA 5KG5A 2E5LJ 3AB4B 2QEXS 4MT1A 3MMAB 2HHHJ 4O4GB 4M5IA 1M5KC 3RW7A 3QRPA 4W98A 1R0AB 3QT7A 1KQGB 2KFYA 2HNDA 1B0TA 2I1RA 6FD1A 4OZLA 3UFCX 2ZDPA 4I4BA 2K06A 4HVZA 1BQNB 1RTJA 4DV0J 4QJVA 4EO6A 2RVJA 5K8MA 4FP9A 3ILJA 2OEJA 4GO7X 2EFNA 3ISND 1S1VB 2DGUA 3MCMA 1TTHB 3I87A 5DQIA 1QTMA 1RT2A 4ZVGA 1IBMF 5K9FA 5KTQA 1L3SA 3R97A 1ZTTA 4BHQA 1DQAA 2CPZA 4I56A 2NSBA 2GIFA 3L3CA 3ZZYA 4FNIA 1CEZA 1UCNA 4UZCA 3DLEA 4ZVTB 2M70A 2F1FA 3GJRB 2MHEA 1VQ9S 2D1CA 2E1PA 4C7QA 1HYSA 3O5TB 2N7CA 4G1QA 2FVSA 4OI1A 4USWA 5EGYA 3BSOA 2Q2GA 4B3MF 2RDIA 3K5NA 3TAQA 3VGSA 3RRHA 5D0RA 1S97A 4NLOA 1JJ2R 4ZP8A 5JMNA 1IUJA 3QSIA 4DX6A 4GVLA 2QT7A 5M2UA 1CJUB 2R8GA 2GMJA 1GH8A 3FCWA 4B3RJ 2HVHA 5DZ7A 1NRKA 2R8HA 2XS2A 4ER8A 1Q86T 4DPXA 1NM2A 3DRPB 4UF4A 2DGXA 2Q6CA 2LLZA 1XQIA 2K3KA 4NWBA 5HLFA 2D9OA 2DNYA 1YSJA 2X51A 2I9SA 5CYJA 2DT9A 3Q23A 3GWCA 2R8JA 1HNVA 4ECUA 1C4AA 1AW0A 3L4BC 5GADU 3LF0A 3WX8A 3DYAB 1TP7A 1H74A 3PKYA 3J7AN 4CH0S 3MR5A 1HBOB 2XG8A 4Q43A 5KFRA 3PKMA 2DH7A 5ETKA 1VQYA 5D77A 1ZYQA 4DR4J 3K5MA 2RILA 2MMYA 2GS8A 4I68A 3KLIB 3OR1A 2OPRA 4RW4B 2NXCA 4KE5A 2H65B 4F4ZA 5BR8J 1BQXA 2QSWA 4L3NA 4MFBA 4HL9A 3TYTA 4BWJA 3M2RA 3KHLA 1VQLS 4C8OA 3VQSA 4NA3A 1RT4B 3C6UA 3IMQJ 2WBRA 2XMVA 1X4BA 4PXEA 4ZITA 2R7RA 5IT0A 2WVDA 4H4MB 1M1KT 3DRYA 3RU0A 1KQSR 2H4YB 1DLOB 3KUEA 3Q83A 5T7LB 2DPJA 1QE1A 1QJHA 4OFZA 1FE0A 3MTJA 3IWLA 3PHTA 2QMWA 3K58A 4KO0B 5LMUJ 3FMBA 4NMXA 3DDKA 2BMBA 1WEYA 3ZTOA 2WW4A 2VBYA 2ZE2B 3TO8A 2KFNA 1FNOA 3IBCB 4ECXA 2SXLA 1JKHA 2KYXA 2LU2A 1KC8T 3BKUA 2ZHBA 4WU2A 4C48A 4O44B 2E1AA 3UDLA 2KM8C 1DQ9A 1DAXA 1AROP 2VG6B 4F3QA 1HHQA 2XYHB 2FZGB 1NKEA 3TARA 4W90B 3QT8A 3J81U 1C4CA 4ED3A 1KDNA 2OD6A 2B4OA 9ATCB 4DPOA 3I5BA 1R3NA 3HZEA 4JI8J 2CQ1A 3OD2A 3EWGA 1XNQF 4M5HA 3MF5A 1WI6A 3PRVA 2XHWA 4AXJA 2H4WB 3DLGB 3HHLD 4PPZA 4OZJA 1DTTB 1KN6A 3H2VE 4DR7F 4Q44A 1KRPA 3RBXA 2KN4A 4N5SA 3BKTA 4OYXA 1WC3A 3SI8A 3OLBA 2DB1A 3J81Y 2DH9A 4Q0BB 4YR0A 3CJ0A 4WZQA 1B70B 1RHMB 2AWZA 2DO0A 1PAUB 4NEYA 1LK7A 4IG3A 4WXOA 4ED0A 1SKUB 2HQCA 1FDNA 1D9DA 1X4EA 3DLBA 5KG4A 2UUWA 1K9MT 2MLZA 3FBBA 4N47A 2AQ4A 2H5EA 2G0CA 1NJZA 3PRBA 2CVIA 1HNWJ 2OPSA 1YGYA 4RR5A 2E66A 1SKWA 1TQLA 4NOHA 1ZM2A 2LXFA 1MMDA 2RRBA 2RHSB 1TKXB 1KS2A 3DGPA 1T8EA 1P9QC 2F4VJ 4DCOB 2MQ8A 4OZ0A 4RW6A 1VHIA 1BUXA 4Z2XA 2LCWA 4MKBA 4DR4F 2ZBRA 3KK3A 1VFJA 3D66A 4TKTA 2IM2A 2BQ3A 4RWXA 1TL7A 2P2CB 3RBZA 2J0SD 1CC7A 2IRUA 3JYTB 2P6TA 1WC6A 4ZPTR 4RW8B 5B08A 2CQ3A 4YB6A 5BR8F 1AA1B 4DUZJ 4PRFA 5F3ZA 4P74A 1RAIB 2CPEA 3JXOA 3TA2A 2DEJA 2CZ9A 1U1QA 1VC0A 2R8KA 5B0GA 3X3UA 2QN6B 5HMZA 2UUTA 2Z2ZA 2B7BB 3G82A 1VQOS 1X4HA 3BJYA 3U1NA 5CZVA 2O5DA 5LMUF 3GZ7A 2HVEA 3OL8A 3PX6A 2FJWA 5LT5A 2AYGA 5LSLA 2BJDA 2JJ4D 2YKNB 1R8HA 4LVNP 3UI3A 4P10A 1XMOJ 1F5AA 4ECQA 3W5ZA 4DLEA 1UWAA 1WKLA 3CCRS 3E01B 4PG5A 3QJLA 3B6BA 3NMRA 3PTWA 1UEVA 2V0NA 3H20A 2JSXA 1REVA 5KFCA 5A8RA 3OSPA 3AFGA 1G6BA 1B7FA 4OX9J 3CC2S 4KGZB 1FRMA 4KSEB 4KV8B 1IKYB 5HQ8A 3MD3A 5KFYA 3SXLA 2D9PA 4CI0B 2BEFA 5B0EA 5HMXA 4JI8F 3UNGC 1BHNA 2GO9A 5HP1A 2BACA 2QL5B 5D4NA 4DQIA 3IXQA 4PG7A 2E7XA 1GNKA 5D4LA 4DLGA 4PG8A 5IT9U 3D1HA 1HD0A 1C1BA 5B7WA 3B54A 2C2DA 1Q8IA 1EETA 2H5IB 4WFXA 3FKBA 4EGLA 3DOKA 1WEXA 2JVMA 2C1EB 4E0DA 1RISA 3THTA 3QJJA 3OJUA 4NX9A 3IGNA 1VQ4S 3R5CA 3GQCA 1E6VB 3MEGA 3KOAA 5LXYA 3M8PA 2R7SA 4I2PB 4ELVA 1VQPS 2HQ3A 3UWTA 3H4BA 3IR7B 2WB4A 4WIQA 3OTDA 3W5XA 2XWYA 1IQZA 5DDQC 1S48A 4HDGA 2WONA 3QQCD 2LVWA 4K59A 4YS2A 5IT9Y 2FHOB 1OSCA 1DTQB 3H59A 5T41A 3MR3A 3UO0A 4WE1A 1FI4A 3W60A 3OBIA 4PXDA 1OO0B 3GLJA 4K0KJ 5KFAA 3D4JA 1SI9A 3QIPB 4OJ1A 4V1Ak 4ENOA 4U7UD 2RDJA 2I5JA 1PYOB 1S7HA 1FJ7A 1U02A 4WIIA 4MJKA 5D0HA 4CNYA 2F4VF 2Z57B 4XDCA 3SSRA 3FJ2A 1D8YA 4ICLA 5GAHU 1M5VC 4LF2A 5F8HA 4KB7A 3CJSA 4OIXA 1U6FA 2OP5A 2OO4A 3R5BA 3RAXA 2CNOB 2VBXA 3ZO7A 1T3NA 1K8AT 4WYLA 1H2UX 1NSPA 1RT1B 4F4KA 2V5HG 3VAGA 2ALYB 1TL3A 3QAEA 5CXTA 1OPZA 2XNRA 4KRWA 1YI2S 4DUZF 5CHCB 1MLAA 1XR5A 5E3AA 4ILMA 1SH2A 4DWIA 4MK9A 1S9EB 3CJKA 3UN3A 1WDTA 2Z0GA 4LF4J 4J5OA 4ANEA 3Q24A 3FZ2A 4TY8B 1X4FA 1S9GB 3MMCB 2F4FA 1NK7A 1LKZA 2HBZB 5F41A 2W9AA 2LEAA 3F44A 4CH7A 2G4BA 2LP4A 5KFQA 1FERA 5IV4A 4Y0FA 5HBMA 1A0OB 4CCHA 2E9ZA 2F3JA 2VDIA 3POTB 2LA6A 4ECTA 5L1JA 3HK2A 3ZZPA 3JSMA 1NB2A 2HGLA 3T1YJ 3BREA 2ACYA 2R7WA 2ZZMA 2HZVA 4NLRA 2ROGA 4N8NA 3ZNUA 4UUXA 4K4VA 4ED5A 2CPDA 2HZCA 1U1LA 1W25A 3AQPA 3ENAA 3H0PA 3MXHP 3D6MB 1IQTA 3BBFA 2XEXA 3UN5A 1W26A 2LKZA 2DVIA 1P6TA 1S99A 3A3NB 1GFWB 2QYCA 5DJBA 2W2MP 2IFXA 2RDDA 4AE5A 1HBNA 3NNHA 3OQ2A 2G1HA 1JLCB 3TZWA 1XAOA 1RUSA 1Z4UA 1DJ0A 4F50A 2YH0A 4FKXA 3RRKA 3WZ0A 1FKOA 2DHXA 4BC7A 4K50A 2MJUA 3D7SB 2ZZTA 5A0YA 3T5LA 3GP9A 3CMQA 1U6BA 4LFCJ 4DV2J 2IM0A 2I2YA 1U2FA 1RGVA 4B3SJ 3OLAA 4M5DA 3T9ZA 2C2MB 2KT5A 1H0HB 1HW8A 4LVOP 3THPA 1NLTA 2NXEA 1JB0C 4FXDA 5DQGA 2UVUA 4RUHA 1T9TA 1WC0A 1O0PA 2A10A 4N56A 5D78A 2CQPA 2AD9A 1VS3A 3DLKB 5CYQA 4LF8J 4RNNA 3ZZTA 3EJMA 2R9LA 4XPEA 5LL6d 2AEJA 4OYZA 1CS4B 4OX8A 5K5MA 4FF2A 4FZVA 1NCLA 1MU2A 3TVYA 3OR2A 3SIPB 3T1HF 2XI3A 1S1XB 3A3OB 4ZP9A 1NZ8A 1TKTA 2BKPA 4B9TA 3MPVA 3J81j 2ATCB 1RHUB 3SQGA 4X2BA 1TUVA 2KRBA 1UAWA 4B08A 4X4PA 3H8YA 1YJUA 2BBEA 2ASYA 1VQ5S 2P5VA 2RF2A 2J6SA 4TQSA 4WFNQ 4NLTA 4JI4J 2LQJA 2XC9A 4P71A 1C0UA 4WKYA 1S1WB 3D0IE 5E41A 1NK4A 3DRSB 2RKIB 2BJEA 4NLSA 1AFIA 3TJAA 4A46A 1S4EA 3I31A 1FTCA 4EUVA 4NI2B 4OMFG 2XSJA 4HT7A 2HHSA 1Y11A 3VZIA 3TUZC 2NREA 2WOMB 3BQ2A 2A1BA 3GTYX 3PO5A 4WTYA 2N4CA 4CT8A 2V8PA 4DL2A 2HRUA 1RHRB 2M52A 1FCAA 1IN0A 3LP2B 1X4GA 3WDOA 4NYZA 1UETA 1R31A 5C25B 4O4GA 3M8RA 4DF4A 5C24B 2CDRB 1R0AA 4ED7A 3EGZA 2BOAA 2CVEA 1T3OA 3T1YF 2V68A 1YJTA 4OHVA 3UVJB 1M5HA 1FX4A 2KYZA 2P8IA 1SL2A 1WOSA 2UUCJ 1I94J 2HFVA 9RUBA 1BQNA 1PJ5A 5T14A 4KJIA 2GV1A 3K7RA 2I38A 3CXCR 4J80A 3MR6A 2GIRA 3NS5A 3OUYB 1N32F 2MLYA 4C3KA 1S1VA 2W4DA 2HWIA 1WORA 1QSSA 3M2VB 1XR6A 4ECRA 2DHSA 2EFQA 5A6WA 4KH1B 2BQRA 3NEKA 4ZCIA 5A8WB 2Y8WA 3GMGA 4BS2A 2FPHX 2W4CA 4HKQA 2DNQA 2HNZB 1D09B 2IAJB 2LXIA 1HNXJ 4NCGB 3AODA 4LBHA 4U6PA 2N4DA 2K8GA 3E8OA 3AGXA 1HQ2A 5I3UA 1QUVA 2JZ8A 2UXCF 1Q5YA 4AYBD 3HSZA 4RW7B 4CWBA 1NNDA 4IKAA 3R7SB 5ETSA 4DV2F 3MM7B 2CPIA 2UUAJ 3H4DA 3HXMA 1X5TA 3MEDB 4B3SF 2KXHA 1CJUA 1HBMB 1KR4A 5J1PA 2R2TA 1TVRB 4M95A 4RU9A 1V3SA 6FDRA 3ZZOA 5JVHQ 3DRPA 2M9KA 1FKPB 7FD1A 1X4DA 2IYGA 4C8ZA 1Q8BA 3FEZA 4LF8F 3FK4A 3WIVA 2W25A 1WTFA 3IR5B 3GIRA 3VVUA 2W9BA 1U09A 4X65J 4K2XA 1Y10A 5GVQA 4J9SA 2MKSA 4B9SA 2H1YA 1NK0A 4WCEQ 1FRXA 2CWXA 3MMJA 1ICEB 1DQ8A 1U1PA 4R5PB 1MN7A 3PO4A 5CABA 3DYAA 4L74A 2VJUA 2M0GB 2KO1A 2QFJA 1VYAA 2CJKA 3UCUP 1TELA 5HROB 1BY9A 1R8AA 1HBOA 1X0FA 4I6AA 4NLDA 2QMUB 2VV5A 3PYDA 4KHPJ 2L3MA 1IBLF 1HI0P 2GVDB 3OXLA 1RADB 2UZAA 4DR5F 4KGKA 1IXKA 4P2MA 5H9FK 1GMWA 2JHEA 4CLPA 1NK9A 3KLIA 2E5IA 4JI4F 4ZVHA 1MWYA 3CCTA 1TR0A 4NCAA 2BZ2A 4HI1A 4RW4A 2C3PA 3A3PB 1KQFB 4EU0A 1V5VA 3DOMB 2Z2LA 2PI5A 3HM9A 5KG2A 1RT4A 1SJ1A 3MTKA 1AT1B 3IA0A 2MPUA 3DN9A 1FEHA 1IKXB 2A3JA 3F0NA 4H4MA 1NHUA 2C2RA 4QQBA 2AF6A 5FJ4A 1KVIA 3HO1A 5T7LA 2XMJA 4ANCA 1NJXA 2VC0A 4P73A 4KO0A 2JX2A 2V67A 2L48A 4RX6A 2V2QA 5F8NA 1FK9B 2ZE2A 4N7TA 3HSJA 3K8VA 5E3CA 1ZPVA 2MKJA 1JX4A 4H4OB 1JWWA 3K2YA 2VQFF 5J1EB 4O44A 4I6WA 3A12A 1F9FA 4WP3A 4EO8A 2DGVA 3AJ2A 2VG6A 5MLCV 5KFZA 1UVMA 4M5NA 4HHJA 2WSFC 1MWZA 2UP1A 1CSJA 1PKUA 1KVKA 3IBWA 3D2WA 2MQOA 4RNMA 4RBUA 2QRRA 3TX8A 4F0MA 3T5KA 1GEHA 1KLMB 2GC8A 1VJWA 1IJEB 5HANA 1R8CA 2QC3A 2BKNA 1HNIB 4DEZA 3A8EA 2NS1B 1U2RA 1SJRA 1N88A 1F2HA 2FVCA 1DTTA 3CJ2A 1FXLA 4OZ1A 3CGIA 2LDYA 4ECSA 1NPPA 4J90A 5IWAJ 1KWMA 1RAOA 1VLOA 3D0GE 2C2ZB 4Q0BA 5AJ3J 2X1FA 3NCQA 4JI1J 2YKQA 5IOLA 3V6DB 1VQ7S 4F2SA 5BJRA 2IDEA 4J9MA 4CLFA 1A9NB 3GU0A 3AKOB 2F65A 4DQRA 2UV8A 3RUBL 2WVBA 3UNYA 4F67A 3LP1B 2UXDJ 2IMOA 1FJGF 4NEZA 3M32B 2AGQA 3BPDA 3N5FA 4A8XA 4KIAA 3O8WA 3BYRA 2HAIA 2B26A 5EWFA 3SFUA 2J9EA 3R6GB 2OMLA 4X65F 3MCSA 3FUYA 5K8PA 3VAIA 3LALA 1V3RA 3ENQA 4Y2CA 3CMAS 1FNXH 5C5JA 3KWMA 4G1QB 1TKXA 4UZBA 1JQGA 2WW8A 4KHPF 4H54A 1TUGB 2V69A 3D6FB 4Q7AA 4A8QA 3JYTA 3JTPA 4RW8A 1IR1A 1RE1B 1A6LA 1GT8A 2DY1A 2GNKA 1HW9A 2G1DA 1U25A 2D41A 1RABB 3FDSA 5GAGI 1IM4A 1N36J 2X1AA 3DDNA 1NPKA 2VPYB 3UR0A 3W8PA 2DHAA 5HL7Q 2ZWOA 2BKOA 4Z7CA 2OSRA 4CRJA 1F5CA 2C22A 3W9HA 3I96A 2QSFA 4U8VA 2RS2A 1H3DA 4LIWA 1VIOA 3Q0AA 1WC4A 2XY7A 3VAJA 2OLWA 2C42A 3OTOF 4C8LA 3EGVA 3AD7C 4F3OA 3P5TL 1FD8A 2V9KA 4JUZA 2YKNA 2YWKA 1EHWA 1XK8A 2AIRB 2QLFB 5DO2A 2KH9A 2YPZA 3WHIA 3CD5A 2DH8A 4GC6A 3E01A 1KD1T 3FEXB 3C16B 4IR1A 5FLXU 2DNNA 1VQNS 3PW4A 4P6QA 5E33A 1T03B 2W2PP 3BSCA 4ZCMA 1BMQB 3MM9B 1RBOB 1IKYA 1KBRA 2FTRA 5LXRA 2CPFA 1C3GA 1RJJA 4C8NA 2MB0B 2OI2A 2XQCA 2L9WA 1CULA 4NA2A 1EKRA 2FZCB 3V4IB 1FNMA 1T05B 4QWCA 1OY8A 3ISZA 2B9WA 5LMNJ 4OV6A 2YQ1A 2V9WA 2BOPA 4I64A 1FO1A 1H6KX 5THWA 4WFAQ 3TVKA 3HHLB 1GXUA 4A8FA 3KFWX 4IRDA 2BANB 2ASJA 3VAFA 1IBKJ 2GJFA 3CC4S 3IBFB 4ZVRB 5ETLA 2ZFHA 3R5GA 2YBVA 4CLKA 2VBZA 5DM6Q 3AGZA 4HR2A 4USKA 5IQQA 2ZH6A 3G6YA 1E6VA 3OHAA 4USVA 4F04B 2BE7D 4I2PA 1FD2A 4UW2A 2NR0A 1UVNA 1AFJA 4DL7A 1PC5A 1X31C 2GJ2A 4DS5A 3MM5A 3SSQA 2RU3A 3OT9A 3EZOA 1HWIA 3IR6B 3K5LA 1JLGB 3PW0A 2C3MA 3RBEA 4UUWA 3ZFVA 2B5JA 1DTQA 1EP4B 1ZPWX 2HNYB 4TVAB 4KFBB 3SSSA 1WG4A 4JYAF 1ZAXA 4EZ9A 2ADCA 3QIPA 2Y1RI 4IO1A 4NZ0A 2EK6A 2C2NA 2MTLA 4NMLA 4GKJF 3ILLA 4EBEA 4OL8A 1RWWB 3N5BA 1F3FA 5F8MA 3HVTB 2LMIA 1MMLA 1QUPA 3CB4A 3I0SB 3GIIA 1NLKL 4UT4A 3FC9A 4WP9A 1QAXA 4ALZA 1Q7YT 2VODA 4QW9A 4GKKF 1RT1A 3DLLQ 4OHZA 2PT0A 4F25A 1HWLA 3R2DJ 1PBUA 1N33F 1RWOB 4MH8A 4DUTA 5D0EA 2U1AA 2QA4G 4C11B 2OTJS 5ETRA 2ZH1A 2UU9F 1VCTA 3J7YI 4V19X 3HF5A 2QLJB 1S9EA 3ELHA 5K14B 2OH2A 1WDDA 3G96A 1F60B 2IM3A 5BXIA 1NAQA 1M1GA 1SJQA 2CZVC 5ETTA 3TAMB 2IRYA 2W8LA 1ZM9A 4X66J 4DV5J 4OX7A 1X0PA 1YKWA 2VQEJ 1UVIA 5KFUA 4LF9J 3EZUA 1DURA 3UDVA 3QO9B 3BO2A 3IS9A 2Y8YA 1M5PC 4M5GA 1TK0A 1X7VA 1H7XA 4LMZA 5CAAA 2DNZA 3POTA 5LSRA 2ALZA 1K73T 2XCAA 3EXYA 1OQ3A 1NMEB 4USUA 1WD6A 1P1LA 2VASA 3EXCX 5KG0A 4OJ3A 2PN6A 3ZZ0A 2IRXA 2B4PA 1ZBTA 5BYQA 2OKQA 3DRXA 3TWZA 4NPOA 3MEEB 5C7PA 5H9EJ 1HMVA 3L9ZA 1LXJA 3CD0A 2HURA 2HQDA 2EBGA 4QWDA 3DU6A 1RAGB 2EKNA 1YVFA 1LW0B 4ZPWR 3K5OA 4DPUA 3FSXA 3BN7A 1B7YB 4HI2A 1Q7LB 1LK5A 2D3ZA 5IC4B 1RSCA 5GAGU 3F41A 2CNLB 5D4OA 3PYGA 1JLCA 3MM6B 2CRLA 1PAEX 2H48B 3G4SS 4QWAA 3A8JA 1SQEA 3P4UB 1IBKF 3CDWA 3ZTRA 1R0BG 5A8KB 3QYYA 4HHHA 1UP1A 1RWPB 1S12A 2VPZB 2WHOA 4YB5A 3P6YC 3AJ1A 1UL3A 4ECWA 2VJVA 2AU0A 3N28A 4BWMA 2IMWP 2GO8A 3FMWA 4ED2A 2EFPA 2E9TA 2HFNA 1MROB 3TR5A 3U7JA 4IUFA 5AT1B 2M8HA 4OYOA 2XCPA 3LWMA 1NHVA 2GAHC 3EPGA 1REVB 3M1VB 1X9MA 3Q22A 4NCBA 4HEA9 3C14B 3CCES 2J76E 2Y9HA 2BQUA 1RB0A 1VR6A 2R2SA 2PMWA 2ILZA 4RNHA 5D15A 3DLKA 4NA1A 4ZJQA 2XS5A 5HMWA 2LQBA 4JI7F 3HHNB 3JSBA 5HP1B 3G6VA 1CS4A 3I9ZA 1T0TV 2R2RA 5HN0A 4ILLA 1XNRJ 1Q78A 1MSWD 4KR0B 4WJBA 2HFUA 3T9NA 5B09A 1S1XA 2J9CA 3BF4A 1U48A 3M7VA 2E1CA 1NZAA 3O3LA 2Y3YA 2Q43A 1JIHA 1Q1KA 1GXLA 2OUGA 3BZQA 4F8RA 3MEGB 4WXWA 3Q8PB 4NLYA 2ASDA 3Q2TC 2W1BA 2CJXB 3KUHA 3QAUA 5ITHA 4DR3F 4CYUB 3CPWR 1VI7A 3KG0A 5KG7A 1ZAVA 1WACA 1O5JA 4V19J 4GRSA 1S1WA 3DFEA 3JTOA 2RUGA 1HD1A 2WONB 1RK8A 3DRSA 3ZTPA 5I3PA 4RLEA 2E7VA 4X4SA 1UPMB 4GVBB 4NI2A 2V63A 1CJVB 2HYIB 1YK9A 4HTIA 3A8IA 4X66F 2WOMA 1NBEB 3MAAB 2WAQD 3SV4A 4CIOA 4ZVOB 1FRIA 1VQSA 2VQEF 3J7A1 1M0SA 1KFDA 1J5EJ 2BE2B 4LF9F 5D3GB 2AEFA 3KJVB 3LP2A 4QPTA 4X4VA 2J5AA 5C25A 4QCLA 2K7JA 2V8GA 3P3DA 4I7FB 5L1IA 4ZN3A 2BRKA 4RKUC 1VOMA 2QE5A 1LQ9A 1YBAA 2WZ1A 3UVJA 3FRZA 1RYSA 1EZZB 2NYIA 1VHFA 2QA2A 1RHQB 4B3TF 2VU5A 1HLWA 2CQ0A 5KAKA 2J6TA 5EWGA 2QL7B 2DGWA 1LWEB 4JV5J 1WHXA 2B7CB 4P7TA 3OUYA 1WHWA 5GMDA 2CQIA 3AGYA 1I1GA 2B3TB 2EEYA 2ZJRQ 4URSA 2W8KA 1N6QB 1FF2A 3H25A 3GFZA 2KVIA 2M88A 4ZIVA 4J9LA 2A2DA 1Q95G 1NH8A 5A8WA 1DFDA 1JNZB 2DCLA 3BYPA 2FHJD 3QFHA 2HNZA 4LRDA 4XO0A 2IAJA 4NCGA 1JNRB 2KRRA 3MD1A 3UR3C 4IOAQ 1F1BB 4AQYJ 4DU7A 5EDWA 3MURP 1VLYA 4RW7A 1VQMS 3MM7A 3B4MA 3MEDA 3S7RA 4ES2A 2DR5A 4F0HA 3UQSA 4MAKA 2MKHA 1HBMA 3OTEA 4DR1J 3K5PA 4IRKA 3WX4A 3D3BJ 3Q8UA 1TVRA 3Q8YA 2QLXA 3KJQB 4OZNA 3CIZA 1RT3B 1GAOA 2IJNA 4CH1A 2A6MA 2NZCA 1YIJS
chains in the Genus database with same CATH topology
1XAOA 2B26A 2QLDA 3I38A 3AGZA 1C3GA 3LZ8A 1EB0A 2Q2GA 3AGYA 3TJ9A 3AGXA 3LA0A 4L3KA 1NLTA 3TJAA 2HFVA 3NXZA 1GMVA 3TJ8A 3L9ZA 3NY0A 1GMWD 1GMUA 1EARA 4J80A 1GMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XAO A;  2B26 A;  2QLD A;  3I38 A;  3AGZ A;  1C3G A;  3LZ8 A;  1EB0 A;  2Q2G A;  3AGY A;  3TJ9 A;  3AGX A;  3LA0 A;  4L3K A;  1NLT A;  3TJA A;  2HFV A;  3NXZ A;  1GMV A;  3TJ8 A;  3L9Z A;  3NY0 A;  1GMW D;  1GMU A;  1EAR A;  4J80 A;  1GMW A; 
#chains in the Genus database with same CATH topology
 1FKP A;  3BKF A;  5FD1 A;  2EW9 A;  3U1M A;  2MZR A;  1VJQ A;  4PUO B;  2B8Q A;  3GJS B;  5AE2 A;  4RNF A;  1P9Y A;  1SPB P;  2Z30 B;  4BLG A;  2CQD A;  1VQK S;  4K7Q A;  1KNZ A;  3SCK E;  1S6O A;  2FYX A;  3CD6 S;  4H4K C;  2G2O A;  3M6X A;  1OY9 A;  1RU1 A;  4QR2 A;  1YLX A;  3IC1 A;  1FFW B;  2QZ8 A;  4R5P A;  5IQ6 A;  3LO3 A;  2JZ5 A;  4I1T A;  2DNH A;  5HRO A;  1UKU A;  2RAQ A;  2XLK A;  4ZCL A;  4XDD A;  2V2Z A;  2C2E A;  1LNQ A;  4Y28 C;  2DKO B;  1SC1 B;  4JI6 J;  1VQ8 S;  2GVD A;  4PZV A;  1PO6 A;  2ZJQ Q;  2DNG A;  4NLQ A;  3N6N A;  4M5D B;  1TK8 A;  2HGN A;  4B9U A;  3F73 A;  4O0I A;  2VB6 A;  2J6U A;  1YJR A;  4YEA A;  4MKV A;  3PX4 A;  5KG3 A;  4QU7 A;  4YHH F;  3DOM A;  3HVW A;  3MWB A;  3W61 A;  2AHO B;  2XMM A;  4PG4 A;  2MJN A;  5F9N A;  2GHP A;  4M5K A;  1PJ7 A;  4J9R A;  3CJ5 A;  2MST A;  4DF8 A;  1IKX A;  1FRK A;  3OL9 A;  1SH3 A;  3O1L A;  2NUH A;  1J5E F;  4FF3 A;  1U0H A;  1S0O A;  3VTI A;  4Y65 A;  3G8Q A;  4QR0 A;  3R8Y A;  1I51 B;  1WSV A;  3TJ9 A;  4RU2 A;  4UOG A;  2JLF A;  2AX1 A;  4DSJ A;  4PYD A;  1S79 A;  1UEK A;  1Y5N B;  2HFO A;  3I4H X;  5CD4 H;  4G65 A;  2DR8 A;  1T11 A;  1FK9 A;  1MW7 A;  1E6Y B;  1Y5I B;  3W5Y A;  1N5Y B;  4LFB F;  4OZ2 A;  3CDU A;  2ZM6 F;  4H4O A;  3HPO A;  1UFL A;  4JV5 F;  5J1E A;  1REG X;  3KK2 B;  2HS0 A;  4M1K A;  1RZM A;  5EX3 A;  4KPY A;  4BC9 A;  4J9O A;  3I38 A;  3M8S A;  3UDE A;  4DX8 H;  4TLR A;  3I0R B;  2HZA A;  1JXV A;  1N5S A;  4O3Q A;  3PEH A;  4O3P A;  1M5O C;  1APS A;  1KLM A;  5DLG A;  4A8K A;  1LOU A;  2P6S A;  3QT6 A;  5DG7 A;  1HNI A;  4KPC A;  1LFW A;  4PPD A;  2EK1 A;  3D67 A;  1UMJ A;  5AXK A;  2GVZ B;  3CED A;  2MKY A;  3CCM S;  1NXI A;  3W62 A;  1T9U A;  1TU0 B;  2RQM A;  2YNF A;  4AQY F;  5JUM A;  1N34 J;  3PZP A;  2V4Q A;  1AYE A;  1WEL A;  2FLP A;  4DQP A;  3GE9 A;  3IAS 9;  3CCV S;  1HQE B;  3HFK A;  3UD4 P;  3IAM 9;  3GFX A;  4AFF A;  3GFY A;  3AJD A;  3V6D A;  3GIK A;  3FQK A;  5EWE A;  3UCG A;  1EAY C;  5E2Q A;  4DX7 A;  4PWD B;  2VFR A;  2K2P A;  1AB8 A;  3LP1 A;  3DI6 B;  2V4R A;  1PCA A;  3M32 A;  3C8Y A;  4JI5 J;  4OYM A;  1XMQ J;  4CM0 A;  2MKC A;  3MUM P;  2V8V A;  1S1T B;  3FBC A;  5J2P B;  1BLU A;  3PDN A;  2DIS A;  2CDQ A;  3ETO A;  1JJ4 A;  4I2Q B;  2MZS A;  3RJM B;  2YH1 A;  4LR7 A;  3ZC4 A;  3GPA A;  2XY6 A;  3CCJ S;  3W9J A;  5HVF A;  4NXN J;  1BD6 A;  1NUE A;  5LJ3 Y;  4CO2 A;  4DR6 F;  4ERD A;  2XS7 A;  4CLT A;  2BR0 A;  3PJ9 A;  2ZKU A;  4DQS A;  1G2E A;  3HCX A;  4NL5 A;  3SYZ A;  2B9X A;  5I3U B;  4JI6 F;  3CJR A;  3ETM A;  5ETM A;  1RAH B;  3BSN A;  4LQ3 A;  1TAQ A;  1Y3K A;  1NHK L;  8AT1 B;  1R89 A;  2GW8 A;  3PR4 A;  2GMH A;  4U7U K;  4C8Y A;  4QYZ K;  1HQU B;  3LP0 B;  4A8Y A;  2FVQ A;  4DV4 F;  2JRS A;  2MZ1 A;  3VGT A;  3Q8R B;  2H3E B;  3FFI B;  4O3O A;  3HKZ D;  4DL6 A;  2ABY A;  4FNH A;  4LIR A;  3KLF B;  2IVM A;  2KDO A;  2W9B B;  2IY5 B;  1CJT B;  4DQQ A;  1S6Q B;  3GG1 A;  3LW5 C;  4PKD B;  2HIQ A;  2BJ8 A;  1IBC B;  2O67 A;  2XO6 A;  3D1O A;  1RWK B;  3EDR B;  2W2Q P;  4DV7 F;  4ZLP A;  4DXL A;  1FTR A;  5J2N B;  4OJH A;  1YBU A;  1URN A;  3ZXW A;  2HFS A;  1HWU A;  2B0G A;  3C16 A;  4ZP6 A;  2JDJ A;  1QAI A;  1K44 A;  4S0M A;  3S1T A;  2MKI A;  1T03 A;  2ZD1 A;  3MM9 A;  2CQC A;  2H9Z A;  3JQJ A;  4FF1 A;  2WVC A;  3GR1 A;  1TFW A;  4F3M A;  2XWX A;  5KT3 A;  1VRT B;  2R7U A;  1UJ4 A;  2KM8 B;  3SEO A;  2Y0B B;  2VFV A;  4R8U B;  3V4I A;  1T05 A;  4DL4 A;  4X64 J;  2JEG A;  4B9N A;  3I32 A;  5KOX A;  1PYT A;  1H38 A;  2E5L F;  5A76 A;  1LFP A;  2HLU A;  3HHL A;  4L72 B;  4KYZ A;  1DY3 A;  2BAN A;  3T3F A;  2NYH A;  2HHH F;  5DDR C;  1V9O A;  2E9R X;  1KHV A;  2K1R B;  4JOU A;  5AXM A;  2ROP A;  1NJI T;  1XER A;  3CCQ S;  1RKJ A;  1D0E A;  4DSE A;  1N34 F;  1CQM A;  2UVV A;  1H2V Z;  2GQQ A;  4MK8 A;  4X4T A;  2KG0 A;  1J5O B;  2ZH8 A;  2XMK A;  4ZPB A;  2HHP A;  4RUC A;  1JLA B;  3JB9 k;  3AA9 A;  2DD8 S;  2NLW A;  4F36 A;  3TZX A;  5F8J A;  3V6H A;  4DV0 F;  4WYW A;  1RKI A;  3AD8 C;  4F2R A;  1JLG A;  1O8B A;  2PC6 A;  2DR9 A;  4QWE A;  3OFE A;  4JI5 F;  5JVG Q;  2EC0 A;  3RR8 A;  3HJF A;  4G6V B;  4NLX A;  5FII A;  3VZH A;  1EP4 A;  4LF7 J;  1LW2 B;  1MMN A;  2HNY A;  3R5J B;  4KFB A;  1YDL A;  5E0O A;  1HR0 J;  2ILY A;  3V2U C;  1NDK A;  4ZLJ A;  3V81 B;  4NXN F;  3BBC A;  3AXM A;  2CUY A;  1U45 A;  1F3V A;  5J1N A;  3MHY A;  1GX5 A;  1N5V A;  1Z2Z A;  3TP2 A;  5KFE A;  2CJB A;  1B0P A;  3PRD A;  3BGU A;  4O4R A;  3BM7 A;  2F8E X;  4N41 A;  2X3G A;  4FPR A;  2DPI A;  4DSI A;  3HVT A;  1FVQ A;  3EGN A;  3I0S A;  2E1M C;  1TL4 A;  4J9U E;  4LR8 A;  5RUB A;  1FEE A;  2XMU A;  3QJP A;  1EKS A;  5KFM A;  4B3R F;  2DRB A;  5CCM A;  3S6E A;  2MQN A;  3PFO A;  4OYB A;  4C11 A;  1T95 A;  2M3D A;  4P72 A;  2ZWP A;  1X4A A;  5H1S V;  3OHB A;  3H90 A;  3OW2 R;  5K14 A;  1HHT P;  4F4W A;  3M9O B;  2RRN A;  1XBW A;  3VVT A;  1RWM B;  5IM0 A;  3MMB B;  2FVP A;  4HYK A;  1BXN A;  4DN9 A;  3TAM A;  3DM2 B;  4TU9 A;  4LQ9 A;  3UDC A;  3G8S A;  2OFG X;  2ZC3 A;  3PJW A;  3QPI A;  2GML A;  4U7C A;  2B4U A;  2BAB A;  2O3D A;  3QO9 A;  4WKR A;  4OHW A;  4FVC A;  2IBO A;  3PW2 A;  3G2X A;  4ZHR B;  4L6V 3;  4PAB A;  2HQI A;  4R0J A;  4RL1 A;  2XMW A;  1U1R A;  4B02 A;  2GAG C;  4K4U A;  5KFW A;  4FBU A;  5KFX A;  5D8H B;  4EK2 A;  4CO5 A;  5CQG A;  3I5A A;  1RTH B;  3KJN B;  1FES A;  2VIH A;  1VIX A;  4MKY A;  2DR6 A;  4ITS A;  4XTT A;  1X5S A;  4LF5 J;  4XAK A;  5KG6 A;  3N9U C;  1NSK L;  3TW0 A;  1DAR A;  1U1M A;  4B9V A;  4X4R A;  2JWN A;  4PG6 A;  5IS2 A;  3AD9 C;  4DV3 J;  1FDA A;  2FJD B;  5SZT A;  3MEE A;  4N77 A;  5DET A;  2YKO A;  2Y1J A;  5E3R A;  1LW0 A;  3D6T B;  4WFY A;  4IDK A;  2ZH4 A;  1RTZ A;  4X64 F;  4USH A;  2MQL A;  1LEO A;  3CF5 Q;  4B3O B;  3MM6 A;  3HLU A;  5B0D A;  1X60 A;  4FF4 A;  5A8K A;  1DBD A;  1NU4 A;  3LGM A;  4DOZ A;  5ETV A;  1KKH A;  2YWW A;  5E3Q A;  1CVJ A;  4BCA A;  1J2V A;  2QFI A;  2HK2 A;  1VBY A;  3R6L B;  1N8R T;  4MIB A;  1FRL A;  5L9X A;  3HUL A;  5J2M B;  1M90 T;  1ACM B;  3ET6 B;  3ZZZ A;  4CDI A;  1P27 B;  1MRO A;  1BWV A;  2OTL S;  1CPZ A;  3G9C A;  1TUW A;  3TI0 A;  2DHG A;  4U67 Q;  4IFY B;  3M1V A;  2PDA A;  3OVB A;  4FVM A;  2ROE A;  4ES3 A;  1SB6 A;  3C14 A;  4KAI A;  3NLC A;  3Q8V A;  2IHR 1;  3H2L A;  1UVK A;  1WI8 A;  1CUL B;  2CPH A;  2BJ7 A;  2XZW A;  3P96 A;  3B4D A;  2IA6 A;  8RUC A;  1HI1 A;  4YQW A;  1ZS6 A;  1SH0 A;  1KQK A;  2CXE A;  1RTD B;  2FUG 9;  3R7B B;  3RB3 A;  2HVI A;  2WK4 A;  4Y2I A;  5KFO A;  1U0S A;  3FQL A;  1RTI B;  2W4P A;  4LRA A;  3RB0 A;  1W2B R;  2HQG A;  3DDI A;  4NXM J;  1U49 A;  1RHK B;  1VMB A;  1YRX A;  2QO3 A;  3VWS A;  4DV1 J;  1LXN A;  2ODX A;  3MI7 X;  2DR7 A;  3PR5 B;  4ZVU B;  5IXU A;  2NPF A;  4CQ1 A;  3TA0 A;  2N3L A;  3ZNJ 1;  4CYU A;  1O6X A;  3RBD A;  4PXB A;  3MM5 B;  3UE2 A;  2CQB A;  1EX8 A;  3GJT B;  4QIW D;  4FPI A;  2XLI A;  1F9E B;  1EB0 A;  3IGV A;  4HAC B;  3OTB A;  1YRU A;  1LWF B;  5KFK A;  2B5J B;  1LWC B;  4GVB A;  1CJV A;  3HFV A;  1UA1 A;  3WC0 A;  3MAA A;  2MGZ B;  4IH7 A;  3HMJ G;  3KXD A;  4RZR A;  4UQT A;  3TOQ A;  1HNW F;  2BE2 A;  1OYD A;  4RBV A;  1GX6 A;  1MWQ A;  2AX0 A;  2HBQ B;  5D3G A;  1S6U A;  1UZH A;  3KJV A;  5LSO A;  4F4Y A;  4OHX A;  1RT7 B;  5AXN A;  3MOZ A;  2UV8 G;  4PWU A;  2XYP B;  3NAI A;  2PEB A;  4I6Y A;  4I7F A;  2B9Y A;  3RB6 A;  2RHQ B;  4DG1 B;  2R3V A;  1Y3J A;  2AZ3 A;  4FYV B;  1HBU A;  2RB7 A;  1SQF A;  3NGS A;  2HKE A;  2J7K A;  4LBP A;  1U7L A;  5C42 B;  3LOU A;  5KFL A;  4C9D A;  2XNQ A;  4LF5 F;  2RT3 A;  3CO9 A;  2VD3 A;  1LWE A;  3GV8 B;  3A1Y G;  3QT5 A;  2BW7 A;  5F8L A;  4ED4 A;  4Q2M A;  1YJW S;  2ZC4 A;  4YDX A;  4MIW A;  2H5J B;  2N7Y A;  2Z56 B;  5KFT A;  3TZY A;  2RNE A;  4DFJ A;  2AGO A;  2CNK B;  3HHE A;  3E3X A;  3NP5 A;  1N6Q A;  2QYG A;  1FWK A;  1T9X A;  1UJ6 A;  4JV2 A;  1XIQ A;  3ENW A;  5GAD I;  3G8T A;  2KTQ A;  2L9N A;  3T19 A;  4KBI A;  2VUG A;  2HBY B;  2AGP A;  1MN9 A;  3IS9 B;  2X1G A;  3KMQ A;  5HJX A;  3NNA A;  1H7W A;  3NWR A;  2NQP A;  1XMO F;  1H72 C;  1FKA F;  4B3M J;  4USM A;  2B4V A;  5HVG A;  4TXS A;  4DCP B;  4C4W A;  4IQX A;  2GZO A;  2VA2 A;  1EAR A;  3KLH B;  4PCQ A;  2XUL A;  1U4B A;  3R9L A;  3QLH B;  1MG7 A;  1GTE A;  1QVF R;  2EG2 A;  1N5T A;  2DGO A;  3W2V A;  3FZB A;  4OX9 F;  4URG A;  4UOF A;  1RT3 A;  2J7W A;  3GYX B;  4LRE A;  1Q79 A;  2AYB A;  1BC6 A;  1HMV B;  5U47 A;  2HHU A;  1ULR A;  2UXB J;  4HT5 A;  4PUO A;  3VGU A;  2HGM A;  1FWL A;  3PG9 A;  3BGO P;  4PR6 A;  4X4N A;  2W2N P;  3M9N B;  2Y1I A;  4KHM A;  1IKV B;  1JK9 B;  2FQQ B;  4P75 A;  1X5O A;  4KTQ A;  5DZ6 A;  3KLV A;  1WTB A;  2VFT A;  1K47 A;  4DPY A;  2X1B A;  2YNG B;  4UY8 T;  2DXE A;  2PE8 A;  4Y2M A;  4ZJO A;  3DCA A;  2CQ4 A;  1AUS L;  1Z1Z A;  3DOL B;  3SBM A;  4DV1 F;  1S0N A;  2WSE C;  4QW8 A;  2IJF A;  4K5S A;  1Q8K A;  3W9I A;  1RAF B;  4WFB Q;  5B0C A;  2DXD A;  2B8P A;  3AHP A;  3US5 A;  3KMS A;  4O0N A;  2YY3 A;  2PEH A;  2KZZ A;  2Z4P A;  7FDR A;  4MIA A;  2EKY A;  4BDP A;  2E5G A;  1JLF B;  1F0X A;  2AJQ A;  1SUQ B;  1TMJ A;  4K8R A;  3BB5 A;  1QTN B;  1JLQ B;  2F9D A;  4M5L A;  4CP5 A;  3O6Q A;  3CCZ A;  5EX0 A;  2UVR A;  4K0K F;  2HWH A;  4B9M A;  1M1H A;  3CJT A;  3Q8S B;  1S6P B;  4QOT A;  4Q45 A;  1UFK A;  1OS5 A;  3QZ8 A;  3TUP A;  3JSY A;  3UW1 A;  2ZEJ A;  1FDB A;  2M5Y A;  4ZP7 A;  2EI5 A;  4NLU A;  4JI0 J;  5HSP A;  4N76 A;  3AOA A;  3EVM A;  5CH7 B;  4OHY A;  1CJK B;  4FKY A;  4QIE A;  1KTV A;  1W2I A;  1E6Y A;  1U26 A;  1N5Y A;  3GG0 A;  1FJC A;  3HT3 A;  4FYX B;  3PXG a;  2VL1 A;  3R1L A;  2QJ3 A;  3ICL A;  3PYF A;  2PFD A;  2COL A;  2DK2 A;  2NZ4 A;  4KHR A;  4W4M A;  4NLP A;  1R7I A;  3KK2 A;  1N4L A;  2EBE A;  2E5J A;  1SCJ B;  3CCL S;  2IVY A;  2FLO A;  2RSQ A;  2VG5 B;  4ILR A;  2ZBI A;  4JV0 A;  3I0R A;  2YNI A;  2QTW A;  4PYA A;  3L09 A;  3BN4 A;  1JXE A;  4LF4 F;  1XWL A;  1SC6 A;  2ZOM A;  4QIF A;  2W24 A;  2RD5 C;  3J80 U;  1ZA1 B;  2ZH9 A;  2FY1 A;  1LV5 A;  1I5O B;  2YQ0 A;  3EVO A;  2BRL A;  4K4X A;  4C0B A;  3TA1 A;  3W64 A;  3EYZ A;  3G87 A;  2HVD A;  1XC9 A;  3EVW A;  1XNQ J;  4PXC A;  3NCP A;  1SIW B;  4Y6I A;  1D9A A;  2GVZ A;  1SKS A;  3O44 A;  1OIA A;  1RCX B;  3K0J A;  2G0J A;  4HDH A;  5GAE I;  3H2U B;  4ELT A;  2E44 A;  4O3N A;  4DR7 J;  2V8H A;  1BQM B;  2DNK A;  3H7H B;  5KFN A;  1XR7 A;  4F02 A;  3RB4 A;  3QID A;  1NK6 A;  2D3U A;  3A4T A;  3EZ5 A;  3C15 B;  1Q53 A;  1HQE A;  2BJ3 A;  4DV6 J;  3J80 Y;  4DJB A;  4IOB A;  3JSR A;  5MAO A;  5HMY A;  4PWD A;  1WF1 A;  2HEK A;  3RW6 A;  1H2T Z;  1ZOT A;  3DI6 A;  4DN0 A;  1RQ0 A;  4A8O A;  1WNE A;  2UXB F;  3IRW P;  4CTA A;  2OEM A;  3DKD A;  1S1T A;  5J2P A;  1VBX A;  4I2Q A;  1S4F A;  2FY8 A;  5HAO A;  2O66 A;  1ZM4 A;  3DNC A;  3NGR A;  4M5J A;  2QMX A;  3R5A A;  3ZTQ A;  2F8H A;  3HFZ B;  2XY5 A;  3MCN A;  1N54 B;  2POK A;  2R7V A;  3KLE B;  1YX2 A;  3BV8 A;  1QY7 A;  1RHJ B;  2OFH X;  5F0W A;  3VV2 B;  2KU7 A;  4USI A;  1ZTW A;  3OL7 A;  1R0C B;  1IR0 A;  2RS8 A;  2IIH A;  1FXR A;  1TAU A;  4NRU A;  1ZZF A;  4LFC F;  1URR A;  1RT6 B;  4DDF A;  4ZKA A;  1Q82 T;  2RIJ A;  4DBQ A;  2PSZ A;  5H9F J;  3UCZ P;  2F5G A;  2QG9 B;  2ZH7 A;  2OPP B;  2Z2Y B;  3OTC A;  1HQU A;  1B64 A;  2NSC A;  3LP0 A;  4Y3C A;  2FGO A;  2KKH A;  3DGV A;  3HKW A;  1IKW B;  1S1U B;  3UN2 A;  3OVA A;  3M30 B;  1RXO B;  1HWJ A;  3FFI A;  3I9V 9;  3OL6 A;  3CSK A;  3W2W B;  3OJS A;  3IN5 A;  3KLF A;  3DU5 A;  5IC6 B;  2VKZ G;  4ZLN A;  3MEC B;  4LR9 A;  1T9V A;  4EBC A;  2E29 A;  2OHD A;  1CJT A;  2OEK A;  1FRH A;  2VH7 A;  4JI0 F;  4YY3 J;  1S6Q A;  2CKW A;  2QIF A;  5DGB A;  2CPY A;  2ZZN A;  3GCX P;  2FHM A;  3H5Y A;  3NXZ A;  1AXQ A;  3EUN A;  5DRK A;  3C6E C;  4JI3 J;  3AA8 A;  1U1K A;  2OEL A;  2ZHO A;  1RT5 B;  4NLW A;  2CQG A;  3DLH A;  4NLG A;  3QGP A;  1W7W A;  4TLQ A;  3WC2 A;  5J2N A;  2PGC A;  3K59 A;  2DNM A;  3BGR B;  1WUU A;  2ZJP Q;  3HJV A;  2XM3 A;  3R2C J;  4X84 A;  3CNQ P;  3SMZ A;  2HMI A;  1S7I A;  3BR8 A;  2LA4 A;  1S0V A;  4HH0 A;  4F7V A;  3CJQ A;  5G0R B;  5IV3 A;  4ZMM A;  3PFE A;  1Y5L B;  1T7P A;  1M5S A;  1JMT A;  3H42 A;  2AZ1 A;  2JFD A;  1RAE B;  4QWB A;  1VRT A;  2FC9 A;  1TV6 B;  2KHC A;  1TK5 A;  5FDL B;  4R8U A;  5KFG A;  2E1R A;  2IVF B;  4M63 A;  4QYR A;  1OWX A;  3BGF A;  3N01 A;  1U0H B;  3I6P A;  4YP3 A;  2HLT A;  2CG4 A;  2QV6 A;  3EIC A;  4TY9 A;  3CCW A;  5GAH I;  1YZ7 A;  1G3O A;  2K1R A;  2MDA A;  2N3O A;  1N0V C;  2XHC A;  4DL3 A;  2LQ8 A;  2FJX A;  1OYE A;  1PBA A;  1NJY A;  1J5O A;  3FBE A;  4PEO A;  4ZK7 M;  1FX2 A;  2FGC A;  1JLA A;  4DV6 F;  4A4J A;  2NUU G;  4OYP A;  4HHU A;  4MMO A;  5BYS A;  2UUC F;  1H73 A;  2MEW A;  1JJH A;  3R5D A;  1I94 F;  3IWN C;  4ZPV R;  3DHW C;  3U1L A;  2YWE A;  1QSY A;  2C2K B;  4FYD A;  3KDO A;  4ZLL A;  3SZ2 A;  2RU9 A;  3M8Q B;  4WTO B;  5CYM B;  1X9S A;  2JNJ A;  4XK8 C;  3TEH B;  1LW2 A;  4LSN B;  3CCU S;  1R27 B;  3QRR A;  3I4P A;  3PY8 A;  3IM9 A;  3V81 A;  1UJ5 A;  3D5M A;  4DU8 A;  1WHY A;  5JXS A;  2J7U A;  3GYN A;  2G2Y A;  4Y00 A;  4X4O A;  1HPZ B;  4DSL A;  1HNX F;  1IWA A;  4G1I A;  2YNF B;  3CW2 C;  5I42 B;  2BJ9 A;  2BYC A;  3NKY A;  4FN5 A;  4C2M A;  1ZET A;  2BE9 B;  3L95 X;  2QA4 S;  3THV A;  4IFV B;  2K7K A;  2V8D A;  2UUA F;  2KXN B;  5GAE U;  5GME A;  3ITH B;  4FXV A;  1I6J A;  3PV8 A;  4CO0 A;  4LF1 A;  2MKK A;  4ID8 A;  1SJ3 P;  1T9W A;  1NH7 A;  2JFK A;  2ZNZ A;  3FGV A;  2CFX A;  4IO9 Q;  1RBL A;  2CYY A;  3V5R A;  2HVZ A;  4CO3 A;  2Q66 A;  1UFW A;  1LWX A;  1T9Y A;  2N82 B;  2I6W A;  2A0F B;  2B51 A;  2AJ0 A;  5E5N A;  4RPF A;  1EJ7 L;  1TZ0 A;  2CPX A;  1WEZ A;  3MMB A;  4PQA A;  2VG7 B;  4J37 A;  2V6A A;  3DM2 A;  3SDE B;  5L9N A;  2APO A;  3MUT P;  3SCJ E;  4CO1 A;  3JQK A;  1S9F A;  1VRQ C;  4YY3 F;  2DNO A;  2C3O A;  4ZHR A;  4JI3 F;  1H98 A;  4FS2 A;  1P1T A;  4CM2 A;  2C2O B;  2NXJ A;  3AT1 B;  2V50 A;  5K20 B;  3W8G A;  2YKP A;  2P9E A;  3AY0 A;  4I0W A;  1RA6 A;  1RTH A;  2QLD A;  4R25 A;  2FJA B;  3LWL A;  1VQ6 S;  2AJ2 A;  3T5H A;  2KT2 A;  3AXK A;  2BDP A;  1RU2 A;  2JEJ A;  4A47 A;  2RJZ A;  3U02 A;  2DRD A;  4FS1 A;  3RGI A;  1UWB A;  2LEC A;  3KK1 B;  2JVO A;  4FDF A;  3B8H A;  2AW0 A;  3VHQ A;  1YZ6 A;  3M8W A;  2MXY A;  4KT0 C;  4ZVE A;  3PJX A;  2FJB B;  2IC3 B;  4B3O A;  5L46 A;  2V2K A;  2AKW B;  4MTP A;  2RH3 A;  1L3K A;  3GJQ B;  5HO4 A;  2EPI A;  2YXL A;  3V6K A;  3HX9 A;  3QRQ A;  2ZH2 A;  1Y0H A;  3BO3 A;  2WBM A;  4P9S A;  2IA0 A;  1Q8L A;  1GMV A;  1UA0 A;  5J2M A;  2ATL A;  2PMH A;  1HHS A;  3ET6 A;  2PA3 A;  4YOE A;  4WK3 A;  3BR9 A;  4IH6 A;  2RQC A;  3QAT A;  3IM8 A;  3VCD A;  1YJV A;  4IFY A;  2XI2 A;  2ZD1 B;  5E3P A;  2JOQ A;  1DZ5 A;  1B4S A;  4C0H A;  1FDD A;  4E98 A;  5CA5 A;  4IG0 B;  2CNN B;  2O1P A;  3T41 A;  2GIQ A;  3TAP A;  3H5S A;  2G13 A;  4U96 A;  5KT6 A;  2FZK B;  1SL1 A;  2LQ5 A;  3NBP B;  4LFA J;  2MY8 A;  4KGM A;  4E8U A;  1RTD A;  1SV5 B;  5HAT A;  4P7V A;  1R6Y A;  1V6H A;  4Y2K A;  4OI3 A;  5FLX Y;  2FC8 A;  3LGN A;  2FJE B;  1X8D A;  1RTI A;  1D3W A;  4B9L A;  3J7Z 5;  3M8Z A;  4JB8 B;  3T1H J;  1FA0 A;  5IWA F;  4NRT A;  3IG1 A;  3H5X A;  2OJ3 A;  5AJ3 F;  1XTZ A;  4JI1 F;  4P52 A;  4ZOS A;  1FE4 A;  3G6X A;  3RG6 A;  4C8K A;  2NXU A;  3KHG A;  2EFO A;  1Q81 T;  2YNH B;  3QGH A;  4ZN1 A;  5F3T A;  3CCS S;  4YR2 A;  1TKZ B;  2CAD A;  4IH5 A;  2UXD F;  4J7C A;  1N5Q A;  3NOG A;  5I4M A;  4PQU B;  2DIT A;  2VFS A;  3E51 A;  4HAC A;  2Z58 B;  1UW9 A;  1LWF A;  3ZZU A;  4LSL B;  3ZTS A;  1FVS A;  4CLU A;  1LWC A;  2UUB J;  2HAF A;  2XGP A;  3A8K A;  1KEK A;  2MGZ A;  1R6V A;  1XMB A;  1Y4Z B;  1S0M A;  2OPQ B;  4UQG A;  3HI9 A;  2WRM A;  4DPW A;  2PI4 A;  1RT7 A;  5F8G A;  5ETQ A;  4YB7 A;  4CLY A;  1L5U A;  5IT4 A;  5ETN A;  4DG1 A;  5K8O A;  3CC7 S;  7AT1 B;  2MQM A;  3P49 B;  1L3T A;  4ZPD A;  4AND A;  3NRB A;  1ITP A;  5C42 A;  3SFG A;  1K1S A;  3EGW B;  2UVW A;  4RO0 A;  4KH0 B;  1TL1 B;  2CJY B;  1GK8 A;  1RWN B;  1NDP A;  1YJ9 S;  4RW9 B;  2DHH A;  4DI6 A;  2HWT A;  2CG8 A;  1AUD A;  3U27 A;  4K4Y A;  1FFS B;  1R8B A;  1N36 F;  2HIY A;  1N32 J;  1WOO A;  2R7T A;  5IM0 B;  4KKO B;  1ZH5 A;  2MZJ A;  3G86 A;  3WIU A;  4L75 A;  3HP6 A;  1CG2 A;  1KP6 A;  3IRX B;  4TU7 A;  2F9J A;  1TL5 A;  3PIP Q;  2V4J B;  3LAM A;  2K3I A;  2KT3 A;  4AD6 A;  2Z8Q A;  3RAQ A;  1Y00 A;  1YQH A;  1N0U A;  1WC1 A;  3BPS P;  3T5J A;  4K2J A;  4DSF A;  4ED6 A;  4M8L A;  3ONQ A;  2CJQ A;  4C0O C;  3C6T A;  4ID5 B;  1O51 A;  3C2P A;  1F6T A;  4ATN A;  2WB1 D;  5KFD A;  3GB0 A;  3N6M A;  2UXC J;  4YDD B;  4EZ6 A;  3KLH A;  3VAH A;  1DRZ A;  4O3R A;  3QLH A;  2PMZ D;  2Q79 A;  3KG1 A;  4AT1 B;  3FRY A;  3UD5 A;  1TKD A;  1VK3 A;  1UVL A;  3IFE A;  2P9G A;  1PYS B;  2BM1 A;  2IJR A;  2YWF A;  2BM0 A;  2AYE A;  4OI4 A;  1FRJ A;  1X9W A;  1X4C A;  3DLJ A;  4J91 A;  2PO4 A;  3MUV P;  1SJ4 P;  1GQE A;  3IP0 A;  2BW2 A;  1MNE A;  4IDK B;  4LFA F;  1CBK A;  5LMN F;  1IKV A;  1PC4 A;  1RAC B;  4YB1 P;  2DGT A;  2I8E A;  4JI2 J;  3CO0 P;  2VIC A;  3PEJ A;  5D4P A;  3GIM A;  4K5R A;  5DLF A;  3B82 A;  2Z2M A;  1CC8 A;  5LOQ A;  5HQM A;  1NO8 A;  5L1K A;  1JLB B;  2YNG A;  1U1N A;  4ECY A;  3QMQ A;  5KFH A;  3DOL A;  1L3V A;  3L7O A;  5CCL A;  3K17 A;  1EQM A;  4DS4 A;  1ROF A;  4KGV B;  3WBZ A;  1AZS B;  1WC5 A;  3PHE A;  2ZH3 A;  1IBL J;  3M05 A;  3RAM A;  2DGS A;  3BH6 B;  4DR5 J;  2DXF A;  3PCO B;  1S72 S;  3IO1 A;  1JLF A;  1U8S A;  4Q5V A;  5KT7 A;  4C98 A;  4I69 A;  2D69 A;  2B43 A;  1SUQ A;  1EIY B;  3KLG B;  1ELO A;  3D28 A;  3E2E A;  1JLQ A;  3JQM A;  3CME S;  2UUB F;  4FYW B;  1RWX B;  3O2I A;  4QPX A;  1A7G E;  4Q2L A;  3NG8 A;  4LSZ B;  2EC2 A;  2AT1 B;  2VOP A;  5EHH A;  2YVS A;  2ZVS A;  3PX0 A;  3Q8Q B;  1S6P A;  3HHK A;  5DQH A;  4CLS A;  4YR3 A;  2ZOG A;  3D68 A;  3EX7 B;  1VRU B;  3TQ1 A;  4A48 A;  1HWK A;  2OAU A;  3QFW A;  5DG8 A;  1IVZ A;  2GQC A;  3MMA A;  1CJK A;  2VPW B;  3GV7 B;  1QD1 A;  3PNI A;  3VAL A;  4DL5 A;  1K0T A;  4MK7 A;  2KXF A;  3R7N B;  2EG1 A;  2HW3 A;  3NGD A;  4GO5 X;  1NSQ A;  2LQ9 A;  2VQF J;  4DZ6 A;  3C66 A;  2GHW A;  4C3M A;  5ETO A;  2VG5 A;  3TEG A;  1NB7 A;  4LF6 J;  1U6Z A;  2BXJ A;  4L3K A;  3KNA A;  1U2C A;  2HS4 A;  3CVK A;  1SC3 B;  3GSD A;  1UW4 A;  2ZIT A;  3MM8 B;  4WK1 A;  4Y2A A;  4DV5 F;  2C3U A;  2LXU A;  1I3O B;  3MAQ A;  3LH2 S;  4M5M A;  4ELU A;  3H5U A;  2GGP B;  2FVR A;  3X1L B;  2FHJ A;  2XZD B;  5D0G A;  2ZVI A;  1UTA A;  4QIG A;  1PIE A;  2FLL A;  3M8Y A;  5B0A A;  2DCU B;  1BQM A;  4PAA A;  2E7W A;  4WWS A;  1F5B A;  1HBU B;  3MPY A;  3F56 A;  3C15 A;  2JRR A;  3DMJ B;  3M6U A;  3UPF A;  4TN2 A;  4ETX A;  1OMS A;  1SBR A;  4ZJL A;  2ZOF A;  4NAS A;  1HA1 A;  1Q16 B;  2L08 A;  1ZM3 A;  4KC5 A;  1U24 A;  2LDI A;  4CLZ A;  2DEI A;  3HHD A;  3VF0 B;  3H40 A;  1FJG J;  3PW5 A;  2CQ2 A;  3DRR B;  2DNR A;  3CWJ A;  2MSS A;  4OI2 A;  2HQF A;  3QWP A;  1X5P A;  3MOJ B;  3J7Y U;  4JI2 F;  4UOH A;  1ZA2 B;  3Q86 A;  3C3L A;  1YBT A;  3N0V A;  2J0Q D;  3KLE A;  3HT0 A;  1PJ6 A;  3PM9 A;  2YWG A;  3EDQ B;  3AH6 A;  2EFG A;  2WVE A;  4NZ7 A;  2BX6 A;  1VC6 A;  1RT6 A;  3MDF A;  3HD1 A;  1XJW B;  4TYA A;  2MZQ A;  4TNO A;  1OJ4 A;  4RWW A;  2Q6B A;  4EEY A;  2OPP A;  3BSA A;  3C19 A;  2JVR A;  4YN3 B;  3OXF A;  1WF0 A;  3W2V B;  2R7X A;  1NK5 A;  1IKW A;  4Z7Y A;  1S1U A;  4EMD A;  4JBC A;  3FVY A;  3M30 A;  2YKM B;  1N48 A;  1KTQ A;  3KHH A;  3W2W A;  4ECZ A;  2P9C A;  5KFF A;  2CWK A;  3MEC A;  2HBR B;  1S57 A;  2R7Q A;  1DLO A;  2DRA A;  1RP5 A;  4IQM A;  4DCJ B;  2W7A A;  2DNP A;  2Q3P A;  1XNR F;  4ECV A;  3HSG A;  1RAJ A;  2VOO A;  2YKA A;  2BUN A;  3M2U B;  1C1C B;  2GQ2 A;  3OTO J;  1RT5 A;  4DZD A;  4USJ C;  1C2P A;  4MYU A;  4AL7 A;  2DBB A;  3BGR A;  5KFJ A;  1C0T B;  1U47 A;  4F4X A;  3W66 A;  1IM6 A;  4HH1 A;  3DXB A;  2M8D B;  4CLL A;  3OPK A;  3NS6 A;  3MR7 A;  1GMW D;  5KFS A;  2XBP A;  1D9F A;  2FLN A;  3D3C J;  2W9C B;  1N52 B;  3B78 A;  2XO7 A;  5G0R A;  4LF6 F;  1JLE B;  2A6O A;  1WOP A;  2DYA A;  2B6A B;  2PA8 D;  4Y34 A;  1YJN S;  3D9B A;  2D3O R;  3J7Z T;  5J2Q B;  3M9M B;  1TV6 A;  1TFY A;  4ED1 A;  2GFF A;  1IJF B;  5FDL A;  3FEY B;  2OMO A;  3NS7 B;  5DS7 A;  3MCO A;  3GYG A;  1G1X A;  4RJV A;  1HIY A;  3ILO A;  2GA7 A;  2J8A A;  4LT6 A;  1HL6 A;  3M6W A;  3BDP A;  2XYG B;  4XPC A;  3CD7 A;  3DLG A;  2B9E A;  3RTV A;  3H98 A;  4OI0 A;  2AP6 A;  2LEB A;  3HZG A;  4Z37 A;  4OV1 A;  3AAW B;  1RA7 A;  1B3T A;  2HND B;  4FBT A;  3LGH A;  4K4T A;  4NYP A;  3LZ8 A;  4WBF A;  2PD1 A;  1QVG R;  2QA1 A;  1WSR A;  2LYV A;  3ISN C;  1HFE L;  4EI2 A;  2GHV C;  4U95 A;  1K1Q A;  5DDP C;  3CDE A;  1RTJ B;  3M8Q A;  2HRT A;  1QM9 A;  2OGU A;  2VFU A;  1KFS A;  5CYM A;  4DUY J;  2YNI B;  2CPJ A;  3RYL A;  2WCX A;  2R2U A;  4LSN A;  2AMC B;  1G7C B;  1RT2 B;  4L76 A;  5LJ5 Y;  4QIV A;  3MR2 A;  4JYA J;  4WFZ A;  5B0B A;  4J9N A;  2C3Y A;  2MQQ A;  3ILI A;  3OSN A;  3DLE B;  5HJY A;  2XMA A;  1RI7 A;  1HPZ A;  3JTN A;  3TUI C;  2I0X A;  1HYS B;  3BDE A;  4C6A A;  5I42 A;  4LRC A;  3KHR A;  2FJV A;  1PG5 B;  4GKJ J;  1Z2L A;  2ZUG A;  3JS9 A;  4IFV A;  2Y0S D;  2JLE A;  5DGA A;  2LU1 A;  5CD4 A;  3ITH A;  4IYQ A;  3MFI A;  5L38 A;  3SV3 A;  4DR1 F;  2RE1 A;  4KGX B;  4GKK J;  4QYZ J;  3W65 A;  4OZ5 A;  1YHQ S;  1SKR A;  3VAM A;  3HVA A;  1N33 J;  1HKA A;  5KFI A;  3Q89 A;  2DO4 A;  2E5H A;  3K8W A;  1WG5 A;  3CJ4 A;  2UU9 J;  1J27 A;  2HK3 A;  1T02 A;  3V6J A;  4CTA B;  4WPA A;  1SQG A;  5C2C A;  2VG7 A;  3BS9 A;  3S8S A;  3PYE A;  4CLW A;  5L8R C;  5HLF B;  3SDE A;  4DFP A;  3NCR A;  1ZZN A;  2CZ4 A;  2W2O P;  1SVD A;  3UD3 P;  4AXI A;  1GTH A;  1HNV B;  3ULH A;  4N8O A;  1QLN A;  2YQ3 A;  4ZCK A;  1VBK A;  1VGY A;  3KUG A;  4K4W A;  3TX0 A;  5DG9 A;  3GCW P;  3LPE A;  1WG1 A;  4RUA A;  2VPX B;  2EFV A;  2ZKT A;  3AQO A;  4A8W A;  1WHV A;  2WTF A;  5KG1 A;  3OR1 B;  3MAH A;  2OPR B;  5A2Q U;  2ZBP A;  1DHM A;  4NYO A;  4KV8 A;  5ETP A;  2IYI A;  2X3D A;  4MFB B;  2FIU A;  3M2R B;  3KK1 A;  4MYT A;  3C6U B;  4ZS6 A;  2YPY A;  1SXL A;  4D3H A;  2NXN A;  1VIS A;  2GCF A;  2IC3 A;  5DDO C;  3NMA A;  4ZVS B;  2ERR A;  4I67 A;  1QE1 B;  2J0W A;  1UEU A;  3FCH A;  1UZD A;  3OFG A;  2U2F A;  3CIM A;  1KOO A;  2BJ1 A;  5A2Q Y;  1SL0 A;  3NOC A;  4L73 A;  2DNL A;  3LAN A;  4OLO A;  3D0H E;  1JJC B;  3N4W A;  1FFG B;  1JKH B;  4OYW A;  4F26 A;  3EPI A;  3GR0 A;  3KKF A;  3NGU A;  4LRB A;  2R8I A;  3I82 A;  2HMI B;  3BH7 B;  4Q8F A;  4WP8 A;  1YTY A;  4UY8 5;  2F7V A;  2DY9 A;  4DUY F;  2VF3 A;  4ZDN A;  1Q0N A;  1NPR A;  2ZNY A;  2A2C A;  1WJ9 A;  3SQO P;  4IG0 A;  5HI7 A;  3QWU A;  2G9O A;  4X4U A;  1FT8 A;  1UPP A;  2M4M A;  4C3L A;  4ZPC A;  3T1A A;  3HHL C;  2HS3 A;  1IR2 A;  3S01 A;  2HPU A;  2HHW A;  3NBP A;  4NE9 C;  2J0X A;  2VBW A;  4JI7 J;  1SV5 A;  3KG4 A;  2G2Z A;  2ZH5 A;  4P2S A;  1N56 A;  3W3S A;  3KTQ A;  1PIL A;  4ES1 A;  3TZZ A;  1KHW A;  4FYY B;  4WF9 Q;  5L1L A;  4LJM A;  2ZDO A;  2KHD A;  4QZV B;  3GON A;  2HHX A;  2HHV A;  2YNH A;  1NEE A;  3DHX A;  5HVH A;  2V2V A;  3NL0 A;  4E2F B;  3GIJ A;  1JXL A;  1QAY A;  5AXL A;  1TKZ A;  3VR1 A;  2H51 B;  2RQK A;  3BO4 A;  4IG3 B;  4DR3 J;  5M2R A;  4PQU A;  2YX4 A;  1XMQ F;  4ZA1 A;  3CE8 A;  3HVR A;  4LUB A;  1SJF A;  4LSL A;  4TU8 A;  1CLF A;  5KT5 A;  2M7S A;  2KG1 A;  4QU6 A;  4OJG A;  4ZVP B;  4KQZ A;  1KLN A;  4TY8 A;  2NCK L;  1S9G A;  5GMK a;  3MGJ A;  3MMC A;  2OPQ A;  1B99 A;  3CUN A;  3GSI A;  4B17 A;  2OPS B;  2O01 C;  1Q5V A;  1RDR A;  2HFZ A;  4R0E A;  1TMM A;  3FCV A;  3LTO A;  8ATC B;  2JLG A;  6AT1 B;  2Y1L B;  2YWH A;  4YME A;  1R8P A;  3N6L A;  3DGP B;  2VKR A;  3A13 A;  1UVJ A;  1YWX A;  3P5B P;  1V3Z A;  4RW6 B;  5SUH A;  3KJF B;  2QLB B;  1IWG A;  2JH3 A;  3KK3 B;  3R3T A;  4GC7 A;  2FB0 A;  2HRY A;  4B3T J;  2PII A;  1TL1 A;  2XLJ A;  4FXW A;  1TL7 B;  3LAK A;  4P2F A;  3TVZ A;  1QSL A;  2CIM A;  2QGF B;  1B0V A;  3T6J A;  4RW9 A;  4IR9 A;  1FWP A;  3QGG A;  2EVZ A;  4MKA A;  3PW7 A;  2VON A;  3EM1 A;  2AYM A;  2LEP A;  3PAC A;  3QBC A;  1EQ0 A;  3RZA A;  4KKO A;  3QSY B;  4Q8E A;  2PFF B;  2ZBC A;  1YG0 A;  4CNZ A;  3IRX A;  4X62 J;  2V4J A;  2MQP A;  5G4D A;  3M6V A;  3CJ3 A;  2JEI A;  3G82 B;  2J9D E;  1RCO B;  1NKC A;  3TUJ C;  1Y7P A;  3BQ1 A;  1WF2 A;  3TAN A;  2R42 A;  1HNZ J;  2NPI A;  5I3Q A;  2X7I A;  2J8S A;  4DR2 J;  4A8S A;  4NLV A;  3RRG A;  5AE1 A;  4ID5 A;  4AUK A;  1ZAW A;  3L7U A;  4P2X A;  4F0K A;  4TYB A;  4YUD A;  2F63 A;  2OSQ A;  2CJ9 A;  3I5C A;  4AL5 A;  3PIO Q;  1U8W A;  1PGZ A;  2JL9 A;  2W7O A;  3AOB A;  1WWH A;  3M4X A;  3G6E S;  4G3I A;  1XEZ A;  4YFU A;  3G71 S;  1BWE A;  2HHT A;  5A8R B;  1V5I B;  2QLW A;  1KSP A;  2JEF A;  2G0I A;  3NGK A;  5H9E K;  4D3G A;  1UWB B;  3NNC A;  3CDB A;  4DPT A;  4O23 A;  3W1Y C;  2W7P A;  4WU3 A;  5F9L A;  2DJW A;  4RNO A;  1FJE B;  3EMT A;  4OLP A;  2B56 A;  4GMK A;  4JV1 A;  3R1H A;  3QZ7 A;  2V94 A;  3P8B B;  3D6H B;  1RWV B;  3ZZR A;  3BEG B;  5C2G A;  1C1B B;  1JLB A;  2FDN A;  2AV5 A;  2BA9 A;  1EET B;  3MPU B;  3W63 A;  5LM7 E;  1KON A;  2KFZ A;  3DOK B;  4J9V A;  4DFM A;  1KOH A;  4ZPA A;  1NK8 A;  1SC4 B;  3I55 S;  3ENV A;  1GMU A;  1AZS A;  2IM1 A;  3DXS X;  4IRC A;  1NDC A;  3M8P B;  1D8Z A;  1RLC L;  1Q4R A;  4RUB A;  4OYI A;  3IWX A;  5L39 A;  2Q1L A;  2OIH A;  3MZI A;  5KOW A;  3K57 A;  1FXD A;  2H54 B;  5ADZ A;  4U9R A;  1S5Z A;  2BV3 A;  4EFA C;  1SIZ A;  3KLG A;  4LF7 F;  2KZM A;  3CDA A;  4YHH J;  1S49 A;  2RKI A;  3KNG A;  1HR0 F;  3SCI E;  4WE1 B;  4G1P A;  3BQ0 A;  4URQ U;  5BYR A;  2DGQ A;  1GXT A;  4EBD A;  2MLX A;  3C46 A;  3R27 A;  4ZVF A;  3NAH A;  3LUY A;  3W7B A;  2YTC A;  2MY7 A;  2FHK A;  1RYR A;  2HSE B;  1VRU A;  2HG4 A;  2KJV A;  4UOC A;  3TRG A;  2I5J B;  4ZIW A;  3LQV A;  4HLB A;  4OYA A;  2W01 A;  3RR7 A;  1VBZ A;  2VA3 A;  4PWW A;  5CZX A;  5C24 A;  3VGV A;  3IG1 B;  4ICL B;  3HDS A;  2ZBQ A;  1QDU B;  5E7O B;  1KVJ A;  4LFB J;  3P45 B;  2ZM6 J;  1OY6 A;  1YRT A;  3FSY A;  3OXG A;  4A8M P;  3I56 S;  3D54 A;  1FHT A;  1G4C A;  3LA0 A;  2YX7 A;  2D3O 1;  4LBI A;  1TL3 B;  2XTJ P;  2RQ4 A;  4BBY A;  3FNN A;  2AEM A;  4CO4 A;  1NDL A;  1WKK A;  1VC5 A;  3CUL A;  5KT2 A;  3DC2 A;  2XMT A;  3CJK B;  4EYH B;  2RML A;  3MM8 A;  3M2V A;  1S59 A;  2IBK A;  4J9P A;  4X62 F;  2LFV A;  1BGX T;  5IFM A;  2GGP A;  2KVQ E;  3PVX A;  2DIV A;  2VDH A;  5B0F A;  5HBM B;  1HNZ F;  4QBU A;  4HTJ A;  4EYI B;  4IOC Q;  3OFF A;  2ASL A;  2D74 B;  2DIU A;  2GX8 A;  2WVF A;  2D7S A;  4WZM A;  3LPY A;  4DR2 F;  2VZ9 A;  1RBA A;  2V34 A;  4ZVQ B;  4K4Z A;  3JSM B;  3GV5 B;  1YIT S;  5AE3 A;  1VK8 A;  2OD4 A;  5D6G A;  1F9H A;  1HI8 A;  3DMJ A;  4KY3 A;  3AOC A;  3OVS A;  1R43 A;  4OI6 A;  4W92 B;  2WSC C;  3SCL E;  4LRF A;  4CZC A;  5KFB A;  3FBF A;  1PSD A;  1NSA A;  1NJW A;  3WQP A;  4DV3 F;  2L9D A;  2AJ1 A;  1T94 A;  2M2B A;  3QNW B;  4J9Q A;  4JP8 A;  4DX5 A;  4EWT A;  1QAJ A;  2HHQ A;  4K4S A;  1S76 D;  1OSD A;  1OPI A;  2C28 A;  4DHV A;  2CJA A;  3DRR A;  3GFH A;  1OQ6 A;  5EN1 A;  2EXU A;  1IBM J;  2MHN A;  2RUS A;  3MFH A;  2QX0 A;  3V4M A;  5K8N A;  1VDH A;  4C97 A;  4DL0 C;  3AB2 B;  4OX6 A;  2XSF A;  1HBN B;  5F0U A;  3HD2 A;  4OZ3 A;  1U1O A;  1S10 A;  2FD2 A;  5KFP A;  4O3S A;  4DR6 J;  5M2P A;  4NZ6 A;  3T6B A;  1F2G A;  1FKO B;  3VAK A;  1HAR A;  3TNV A;  4J9K A;  1Y9O A;  2ZUA A;  5EUH A;  4UTG A;  2KB2 A;  1NKB A;  3D1Q A;  2KJW A;  3HSD A;  2CA9 A;  5A0Y B;  3C6T B;  4H4K A;  4X4Q A;  3JAM U;  2RRA A;  2MYF A;  1D1U A;  2BVZ A;  2XZT B;  4ETZ A;  3L7P A;  1L3U A;  4CT9 A;  4U8Y A;  2IPO B;  2YX1 A;  4C8M A;  4DV4 J;  5JJB A;  2R7O A;  4ED8 A;  1BE4 A;  2YKM A;  3ADA C;  2XB2 D;  4UST A;  2AJF E;  4AL6 A;  2IDL A;  3CTR A;  3CT9 A;  3N79 A;  5CYQ B;  1XN9 A;  5A6P A;  3CJ8 A;  2A18 A;  2EWH A;  3MPD A;  1CQN A;  3TJ8 A;  3JAM Y;  2QL9 B;  3MPW A;  4QR1 A;  1S77 D;  1YJ7 A;  4M94 A;  2VHG A;  2F40 A;  1MU2 B;  2JC0 A;  4DFK A;  2CQH A;  3OR2 B;  3OV7 A;  5KT4 A;  3M2U A;  4NXM F;  1C1C A;  4DMZ A;  3NGT A;  2J9D A;  3BGL A;  1TKT B;  2F8M A;  3QGI A;  1RWU A;  3Q2S C;  1P8G A;  3C5X C;  1WKJ A;  5IZH A;  3SQG B;  3K89 A;  2ZHA A;  4DV7 J;  2GJI A;  1C0T A;  3EE3 A;  5DM7 Q;  2KL8 A;  2DTJ A;  2KI2 A;  4RBT A;  5HQL A;  5KFV A;  1RAA B;  4F4A A;  2RF2 B;  2W9C A;  4DSK A;  5F8I A;  3NWG A;  3VQT A;  1C0U B;  1JLE A;  1K0V A;  2MZT A;  2B6A A;  3GIL A;  2VC1 A;  2JC1 A;  2ACM A;  2CAJ A;  3NY0 A;  5J2Q A;  3FSI A;  3TQE A;  4OQJ A;  2XSJ B;  2R4F A;  3KDN A;  3OFH A;  5HK4 A;  1RLD A;  2AJ4 A;  3KYL A;  3BBB A;  3MEK A;  4TQR A;  2L41 A;  4XIU A;  2XGQ A;  2ADB A;  5KG5 A;  2E5L J;  3AB4 B;  2QEX S;  4MT1 A;  3MMA B;  2HHH J;  4O4G B;  4M5I A;  1M5K C;  3RW7 A;  3QRP A;  4W98 A;  1R0A B;  3QT7 A;  1KQG B;  2KFY A;  2HND A;  1B0T A;  2I1R A;  6FD1 A;  4OZL A;  3UFC X;  2ZDP A;  4I4B A;  2K06 A;  4HVZ A;  1BQN B;  1RTJ A;  4DV0 J;  4QJV A;  4EO6 A;  2RVJ A;  5K8M A;  4FP9 A;  3ILJ A;  2OEJ A;  4GO7 X;  2EFN A;  3ISN D;  1S1V B;  2DGU A;  3MCM A;  1TTH B;  3I87 A;  5DQI A;  1QTM A;  1RT2 A;  4ZVG A;  1IBM F;  5K9F A;  5KTQ A;  1L3S A;  3R97 A;  1ZTT A;  4BHQ A;  1DQA A;  2CPZ A;  4I56 A;  2NSB A;  2GIF A;  3L3C A;  3ZZY A;  4FNI A;  1CEZ A;  1UCN A;  4UZC A;  3DLE A;  4ZVT B;  2M70 A;  2F1F A;  3GJR B;  2MHE A;  1VQ9 S;  2D1C A;  2E1P A;  4C7Q A;  1HYS A;  3O5T B;  2N7C A;  4G1Q A;  2FVS A;  4OI1 A;  4USW A;  5EGY A;  3BSO A;  2Q2G A;  4B3M F;  2RDI A;  3K5N A;  3TAQ A;  3VGS A;  3RRH A;  5D0R A;  1S97 A;  4NLO A;  1JJ2 R;  4ZP8 A;  5JMN A;  1IUJ A;  3QSI A;  4DX6 A;  4GVL A;  2QT7 A;  5M2U A;  1CJU B;  2R8G A;  2GMJ A;  1GH8 A;  3FCW A;  4B3R J;  2HVH A;  5DZ7 A;  1NRK A;  2R8H A;  2XS2 A;  4ER8 A;  1Q86 T;  4DPX A;  1NM2 A;  3DRP B;  4UF4 A;  2DGX A;  2Q6C A;  2LLZ A;  1XQI A;  2K3K A;  4NWB A;  5HLF A;  2D9O A;  2DNY A;  1YSJ A;  2X51 A;  2I9S A;  5CYJ A;  2DT9 A;  3Q23 A;  3GWC A;  2R8J A;  1HNV A;  4ECU A;  1C4A A;  1AW0 A;  3L4B C;  5GAD U;  3LF0 A;  3WX8 A;  3DYA B;  1TP7 A;  1H74 A;  3PKY A;  3J7A N;  4CH0 S;  3MR5 A;  1HBO B;  2XG8 A;  4Q43 A;  5KFR A;  3PKM A;  2DH7 A;  5ETK A;  1VQY A;  5D77 A;  1ZYQ A;  4DR4 J;  3K5M A;  2RIL A;  2MMY A;  2GS8 A;  4I68 A;  3KLI B;  3OR1 A;  2OPR A;  4RW4 B;  2NXC A;  4KE5 A;  2H65 B;  4F4Z A;  5BR8 J;  1BQX A;  2QSW A;  4L3N A;  4MFB A;  4HL9 A;  3TYT A;  4BWJ A;  3M2R A;  3KHL A;  1VQL S;  4C8O A;  3VQS A;  4NA3 A;  1RT4 B;  3C6U A;  3IMQ J;  2WBR A;  2XMV A;  1X4B A;  4PXE A;  4ZIT A;  2R7R A;  5IT0 A;  2WVD A;  4H4M B;  1M1K T;  3DRY A;  3RU0 A;  1KQS R;  2H4Y B;  1DLO B;  3KUE A;  3Q83 A;  5T7L B;  2DPJ A;  1QE1 A;  1QJH A;  4OFZ A;  1FE0 A;  3MTJ A;  3IWL A;  3PHT A;  2QMW A;  3K58 A;  4KO0 B;  5LMU J;  3FMB A;  4NMX A;  3DDK A;  2BMB A;  1WEY A;  3ZTO A;  2WW4 A;  2VBY A;  2ZE2 B;  3TO8 A;  2KFN A;  1FNO A;  3IBC B;  4ECX A;  2SXL A;  1JKH A;  2KYX A;  2LU2 A;  1KC8 T;  3BKU A;  2ZHB A;  4WU2 A;  4C48 A;  4O44 B;  2E1A A;  3UDL A;  2KM8 C;  1DQ9 A;  1DAX A;  1ARO P;  2VG6 B;  4F3Q A;  1HHQ A;  2XYH B;  2FZG B;  1NKE A;  3TAR A;  4W90 B;  3QT8 A;  3J81 U;  1C4C A;  4ED3 A;  1KDN A;  2OD6 A;  2B4O A;  9ATC B;  4DPO A;  3I5B A;  1R3N A;  3HZE A;  4JI8 J;  2CQ1 A;  3OD2 A;  3EWG A;  1XNQ F;  4M5H A;  3MF5 A;  1WI6 A;  3PRV A;  2XHW A;  4AXJ A;  2H4W B;  3DLG B;  3HHL D;  4PPZ A;  4OZJ A;  1DTT B;  1KN6 A;  3H2V E;  4DR7 F;  4Q44 A;  1KRP A;  3RBX A;  2KN4 A;  4N5S A;  3BKT A;  4OYX A;  1WC3 A;  3SI8 A;  3OLB A;  2DB1 A;  3J81 Y;  2DH9 A;  4Q0B B;  4YR0 A;  3CJ0 A;  4WZQ A;  1B70 B;  1RHM B;  2AWZ A;  2DO0 A;  1PAU B;  4NEY A;  1LK7 A;  4IG3 A;  4WXO A;  4ED0 A;  1SKU B;  2HQC A;  1FDN A;  1D9D A;  1X4E A;  3DLB A;  5KG4 A;  2UUW A;  1K9M T;  2MLZ A;  3FBB A;  4N47 A;  2AQ4 A;  2H5E A;  2G0C A;  1NJZ A;  3PRB A;  2CVI A;  1HNW J;  2OPS A;  1YGY A;  4RR5 A;  2E66 A;  1SKW A;  1TQL A;  4NOH A;  1ZM2 A;  2LXF A;  1MMD A;  2RRB A;  2RHS B;  1TKX B;  1KS2 A;  3DGP A;  1T8E A;  1P9Q C;  2F4V J;  4DCO B;  2MQ8 A;  4OZ0 A;  4RW6 A;  1VHI A;  1BUX A;  4Z2X A;  2LCW A;  4MKB A;  4DR4 F;  2ZBR A;  3KK3 A;  1VFJ A;  3D66 A;  4TKT A;  2IM2 A;  2BQ3 A;  4RWX A;  1TL7 A;  2P2C B;  3RBZ A;  2J0S D;  1CC7 A;  2IRU A;  3JYT B;  2P6T A;  1WC6 A;  4ZPT R;  4RW8 B;  5B08 A;  2CQ3 A;  4YB6 A;  5BR8 F;  1AA1 B;  4DUZ J;  4PRF A;  5F3Z A;  4P74 A;  1RAI B;  2CPE A;  3JXO A;  3TA2 A;  2DEJ A;  2CZ9 A;  1U1Q A;  1VC0 A;  2R8K A;  5B0G A;  3X3U A;  2QN6 B;  5HMZ A;  2UUT A;  2Z2Z A;  2B7B B;  3G82 A;  1VQO S;  1X4H A;  3BJY A;  3U1N A;  5CZV A;  2O5D A;  5LMU F;  3GZ7 A;  2HVE A;  3OL8 A;  3PX6 A;  2FJW A;  5LT5 A;  2AYG A;  5LSL A;  2BJD A;  2JJ4 D;  2YKN B;  1R8H A;  4LVN P;  3UI3 A;  4P10 A;  1XMO J;  1F5A A;  4ECQ A;  3W5Z A;  4DLE A;  1UWA A;  1WKL A;  3CCR S;  3E01 B;  4PG5 A;  3QJL A;  3B6B A;  3NMR A;  3PTW A;  1UEV A;  2V0N A;  3H20 A;  2JSX A;  1REV A;  5KFC A;  5A8R A;  3OSP A;  3AFG A;  1G6B A;  1B7F A;  4OX9 J;  3CC2 S;  4KGZ B;  1FRM A;  4KSE B;  4KV8 B;  1IKY B;  5HQ8 A;  3MD3 A;  5KFY A;  3SXL A;  2D9P A;  4CI0 B;  2BEF A;  5B0E A;  5HMX A;  4JI8 F;  3UNG C;  1BHN A;  2GO9 A;  5HP1 A;  2BAC A;  2QL5 B;  5D4N A;  4DQI A;  3IXQ A;  4PG7 A;  2E7X A;  1GNK A;  5D4L A;  4DLG A;  4PG8 A;  5IT9 U;  3D1H A;  1HD0 A;  1C1B A;  5B7W A;  3B54 A;  2C2D A;  1Q8I A;  1EET A;  2H5I B;  4WFX A;  3FKB A;  4EGL A;  3DOK A;  1WEX A;  2JVM A;  2C1E B;  4E0D A;  1RIS A;  3THT A;  3QJJ A;  3OJU A;  4NX9 A;  3IGN A;  1VQ4 S;  3R5C A;  3GQC A;  1E6V B;  3MEG A;  3KOA A;  5LXY A;  3M8P A;  2R7S A;  4I2P B;  4ELV A;  1VQP S;  2HQ3 A;  3UWT A;  3H4B A;  3IR7 B;  2WB4 A;  4WIQ A;  3OTD A;  3W5X A;  2XWY A;  1IQZ A;  5DDQ C;  1S48 A;  4HDG A;  2WON A;  3QQC D;  2LVW A;  4K59 A;  4YS2 A;  5IT9 Y;  2FHO B;  1OSC A;  1DTQ B;  3H59 A;  5T41 A;  3MR3 A;  3UO0 A;  4WE1 A;  1FI4 A;  3W60 A;  3OBI A;  4PXD A;  1OO0 B;  3GLJ A;  4K0K J;  5KFA A;  3D4J A;  1SI9 A;  3QIP B;  4OJ1 A;  4V1A k;  4ENO A;  4U7U D;  2RDJ A;  2I5J A;  1PYO B;  1S7H A;  1FJ7 A;  1U02 A;  4WII A;  4MJK A;  5D0H A;  4CNY A;  2F4V F;  2Z57 B;  4XDC A;  3SSR A;  3FJ2 A;  1D8Y A;  4ICL A;  5GAH U;  1M5V C;  4LF2 A;  5F8H A;  4KB7 A;  3CJS A;  4OIX A;  1U6F A;  2OP5 A;  2OO4 A;  3R5B A;  3RAX A;  2CNO B;  2VBX A;  3ZO7 A;  1T3N A;  1K8A T;  4WYL A;  1H2U X;  1NSP A;  1RT1 B;  4F4K A;  2V5H G;  3VAG A;  2ALY B;  1TL3 A;  3QAE A;  5CXT A;  1OPZ A;  2XNR A;  4KRW A;  1YI2 S;  4DUZ F;  5CHC B;  1MLA A;  1XR5 A;  5E3A A;  4ILM A;  1SH2 A;  4DWI A;  4MK9 A;  1S9E B;  3CJK A;  3UN3 A;  1WDT A;  2Z0G A;  4LF4 J;  4J5O A;  4ANE A;  3Q24 A;  3FZ2 A;  4TY8 B;  1X4F A;  1S9G B;  3MMC B;  2F4F A;  1NK7 A;  1LKZ A;  2HBZ B;  5F41 A;  2W9A A;  2LEA A;  3F44 A;  4CH7 A;  2G4B A;  2LP4 A;  5KFQ A;  1FER A;  5IV4 A;  4Y0F A;  5HBM A;  1A0O B;  4CCH A;  2E9Z A;  2F3J A;  2VDI A;  3POT B;  2LA6 A;  4ECT A;  5L1J A;  3HK2 A;  3ZZP A;  3JSM A;  1NB2 A;  2HGL A;  3T1Y J;  3BRE A;  2ACY A;  2R7W A;  2ZZM A;  2HZV A;  4NLR A;  2ROG A;  4N8N A;  3ZNU A;  4UUX A;  4K4V A;  4ED5 A;  2CPD A;  2HZC A;  1U1L A;  1W25 A;  3AQP A;  3ENA A;  3H0P A;  3MXH P;  3D6M B;  1IQT A;  3BBF A;  2XEX A;  3UN5 A;  1W26 A;  2LKZ A;  2DVI A;  1P6T A;  1S99 A;  3A3N B;  1GFW B;  2QYC A;  5DJB A;  2W2M P;  2IFX A;  2RDD A;  4AE5 A;  1HBN A;  3NNH A;  3OQ2 A;  2G1H A;  1JLC B;  3TZW A;  1XAO A;  1RUS A;  1Z4U A;  1DJ0 A;  4F50 A;  2YH0 A;  4FKX A;  3RRK A;  3WZ0 A;  1FKO A;  2DHX A;  4BC7 A;  4K50 A;  2MJU A;  3D7S B;  2ZZT A;  5A0Y A;  3T5L A;  3GP9 A;  3CMQ A;  1U6B A;  4LFC J;  4DV2 J;  2IM0 A;  2I2Y A;  1U2F A;  1RGV A;  4B3S J;  3OLA A;  4M5D A;  3T9Z A;  2C2M B;  2KT5 A;  1H0H B;  1HW8 A;  4LVO P;  3THP A;  1NLT A;  2NXE A;  1JB0 C;  4FXD A;  5DQG A;  2UVU A;  4RUH A;  1T9T A;  1WC0 A;  1O0P A;  2A10 A;  4N56 A;  5D78 A;  2CQP A;  2AD9 A;  1VS3 A;  3DLK B;  5CYQ A;  4LF8 J;  4RNN A;  3ZZT A;  3EJM A;  2R9L A;  4XPE A;  5LL6 d;  2AEJ A;  4OYZ A;  1CS4 B;  4OX8 A;  5K5M A;  4FF2 A;  4FZV A;  1NCL A;  1MU2 A;  3TVY A;  3OR2 A;  3SIP B;  3T1H F;  2XI3 A;  1S1X B;  3A3O B;  4ZP9 A;  1NZ8 A;  1TKT A;  2BKP A;  4B9T A;  3MPV A;  3J81 j;  2ATC B;  1RHU B;  3SQG A;  4X2B A;  1TUV A;  2KRB A;  1UAW A;  4B08 A;  4X4P A;  3H8Y A;  1YJU A;  2BBE A;  2ASY A;  1VQ5 S;  2P5V A;  2RF2 A;  2J6S A;  4TQS A;  4WFN Q;  4NLT A;  4JI4 J;  2LQJ A;  2XC9 A;  4P71 A;  1C0U A;  4WKY A;  1S1W B;  3D0I E;  5E41 A;  1NK4 A;  3DRS B;  2RKI B;  2BJE A;  4NLS A;  1AFI A;  3TJA A;  4A46 A;  1S4E A;  3I31 A;  1FTC A;  4EUV A;  4NI2 B;  4OMF G;  2XSJ A;  4HT7 A;  2HHS A;  1Y11 A;  3VZI A;  3TUZ C;  2NRE A;  2WOM B;  3BQ2 A;  2A1B A;  3GTY X;  3PO5 A;  4WTY A;  2N4C A;  4CT8 A;  2V8P A;  4DL2 A;  2HRU A;  1RHR B;  2M52 A;  1FCA A;  1IN0 A;  3LP2 B;  1X4G A;  3WDO A;  4NYZ A;  1UET A;  1R31 A;  5C25 B;  4O4G A;  3M8R A;  4DF4 A;  5C24 B;  2CDR B;  1R0A A;  4ED7 A;  3EGZ A;  2BOA A;  2CVE A;  1T3O A;  3T1Y F;  2V68 A;  1YJT A;  4OHV A;  3UVJ B;  1M5H A;  1FX4 A;  2KYZ A;  2P8I A;  1SL2 A;  1WOS A;  2UUC J;  1I94 J;  2HFV A;  9RUB A;  1BQN A;  1PJ5 A;  5T14 A;  4KJI A;  2GV1 A;  3K7R A;  2I38 A;  3CXC R;  4J80 A;  3MR6 A;  2GIR A;  3NS5 A;  3OUY B;  1N32 F;  2MLY A;  4C3K A;  1S1V A;  2W4D A;  2HWI A;  1WOR A;  1QSS A;  3M2V B;  1XR6 A;  4ECR A;  2DHS A;  2EFQ A;  5A6W A;  4KH1 B;  2BQR A;  3NEK A;  4ZCI A;  5A8W B;  2Y8W A;  3GMG A;  4BS2 A;  2FPH X;  2W4C A;  4HKQ A;  2DNQ A;  2HNZ B;  1D09 B;  2IAJ B;  2LXI A;  1HNX J;  4NCG B;  3AOD A;  4LBH A;  4U6P A;  2N4D A;  2K8G A;  3E8O A;  3AGX A;  1HQ2 A;  5I3U A;  1QUV A;  2JZ8 A;  2UXC F;  1Q5Y A;  4AYB D;  3HSZ A;  4RW7 B;  4CWB A;  1NND A;  4IKA A;  3R7S B;  5ETS A;  4DV2 F;  3MM7 B;  2CPI A;  2UUA J;  3H4D A;  3HXM A;  1X5T A;  3MED B;  4B3S F;  2KXH A;  1CJU A;  1HBM B;  1KR4 A;  5J1P A;  2R2T A;  1TVR B;  4M95 A;  4RU9 A;  1V3S A;  6FDR A;  3ZZO A;  5JVH Q;  3DRP A;  2M9K A;  1FKP B;  7FD1 A;  1X4D A;  2IYG A;  4C8Z A;  1Q8B A;  3FEZ A;  4LF8 F;  3FK4 A;  3WIV A;  2W25 A;  1WTF A;  3IR5 B;  3GIR A;  3VVU A;  2W9B A;  1U09 A;  4X65 J;  4K2X A;  1Y10 A;  5GVQ A;  4J9S A;  2MKS A;  4B9S A;  2H1Y A;  1NK0 A;  4WCE Q;  1FRX A;  2CWX A;  3MMJ A;  1ICE B;  1DQ8 A;  1U1P A;  4R5P B;  1MN7 A;  3PO4 A;  5CAB A;  3DYA A;  4L74 A;  2VJU A;  2M0G B;  2KO1 A;  2QFJ A;  1VYA A;  2CJK A;  3UCU P;  1TEL A;  5HRO B;  1BY9 A;  1R8A A;  1HBO A;  1X0F A;  4I6A A;  4NLD A;  2QMU B;  2VV5 A;  3PYD A;  4KHP J;  2L3M A;  1IBL F;  1HI0 P;  2GVD B;  3OXL A;  1RAD B;  2UZA A;  4DR5 F;  4KGK A;  1IXK A;  4P2M A;  5H9F K;  1GMW A;  2JHE A;  4CLP A;  1NK9 A;  3KLI A;  2E5I A;  4JI4 F;  4ZVH A;  1MWY A;  3CCT A;  1TR0 A;  4NCA A;  2BZ2 A;  4HI1 A;  4RW4 A;  2C3P A;  3A3P B;  1KQF B;  4EU0 A;  1V5V A;  3DOM B;  2Z2L A;  2PI5 A;  3HM9 A;  5KG2 A;  1RT4 A;  1SJ1 A;  3MTK A;  1AT1 B;  3IA0 A;  2MPU A;  3DN9 A;  1FEH A;  1IKX B;  2A3J A;  3F0N A;  4H4M A;  1NHU A;  2C2R A;  4QQB A;  2AF6 A;  5FJ4 A;  1KVI A;  3HO1 A;  5T7L A;  2XMJ A;  4ANC A;  1NJX A;  2VC0 A;  4P73 A;  4KO0 A;  2JX2 A;  2V67 A;  2L48 A;  4RX6 A;  2V2Q A;  5F8N A;  1FK9 B;  2ZE2 A;  4N7T A;  3HSJ A;  3K8V A;  5E3C A;  1ZPV A;  2MKJ A;  1JX4 A;  4H4O B;  1JWW A;  3K2Y A;  2VQF F;  5J1E B;  4O44 A;  4I6W A;  3A12 A;  1F9F A;  4WP3 A;  4EO8 A;  2DGV A;  3AJ2 A;  2VG6 A;  5MLC V;  5KFZ A;  1UVM A;  4M5N A;  4HHJ A;  2WSF C;  1MWZ A;  2UP1 A;  1CSJ A;  1PKU A;  1KVK A;  3IBW A;  3D2W A;  2MQO A;  4RNM A;  4RBU A;  2QRR A;  3TX8 A;  4F0M A;  3T5K A;  1GEH A;  1KLM B;  2GC8 A;  1VJW A;  1IJE B;  5HAN A;  1R8C A;  2QC3 A;  2BKN A;  1HNI B;  4DEZ A;  3A8E A;  2NS1 B;  1U2R A;  1SJR A;  1N88 A;  1F2H A;  2FVC A;  1DTT A;  3CJ2 A;  1FXL A;  4OZ1 A;  3CGI A;  2LDY A;  4ECS A;  1NPP A;  4J90 A;  5IWA J;  1KWM A;  1RAO A;  1VLO A;  3D0G E;  2C2Z B;  4Q0B A;  5AJ3 J;  2X1F A;  3NCQ A;  4JI1 J;  2YKQ A;  5IOL A;  3V6D B;  1VQ7 S;  4F2S A;  5BJR A;  2IDE A;  4J9M A;  4CLF A;  1A9N B;  3GU0 A;  3AKO B;  2F65 A;  4DQR A;  2UV8 A;  3RUB L;  2WVB A;  3UNY A;  4F67 A;  3LP1 B;  2UXD J;  2IMO A;  1FJG F;  4NEZ A;  3M32 B;  2AGQ A;  3BPD A;  3N5F A;  4A8X A;  4KIA A;  3O8W A;  3BYR A;  2HAI A;  2B26 A;  5EWF A;  3SFU A;  2J9E A;  3R6G B;  2OML A;  4X65 F;  3MCS A;  3FUY A;  5K8P A;  3VAI A;  3LAL A;  1V3R A;  3ENQ A;  4Y2C A;  3CMA S;  1FNX H;  5C5J A;  3KWM A;  4G1Q B;  1TKX A;  4UZB A;  1JQG A;  2WW8 A;  4KHP F;  4H54 A;  1TUG B;  2V69 A;  3D6F B;  4Q7A A;  4A8Q A;  3JYT A;  3JTP A;  4RW8 A;  1IR1 A;  1RE1 B;  1A6L A;  1GT8 A;  2DY1 A;  2GNK A;  1HW9 A;  2G1D A;  1U25 A;  2D41 A;  1RAB B;  3FDS A;  5GAG I;  1IM4 A;  1N36 J;  2X1A A;  3DDN A;  1NPK A;  2VPY B;  3UR0 A;  3W8P A;  2DHA A;  5HL7 Q;  2ZWO A;  2BKO A;  4Z7C A;  2OSR A;  4CRJ A;  1F5C A;  2C22 A;  3W9H A;  3I96 A;  2QSF A;  4U8V A;  2RS2 A;  1H3D A;  4LIW A;  1VIO A;  3Q0A A;  1WC4 A;  2XY7 A;  3VAJ A;  2OLW A;  2C42 A;  3OTO F;  4C8L A;  3EGV A;  3AD7 C;  4F3O A;  3P5T L;  1FD8 A;  2V9K A;  4JUZ A;  2YKN A;  2YWK A;  1EHW A;  1XK8 A;  2AIR B;  2QLF B;  5DO2 A;  2KH9 A;  2YPZ A;  3WHI A;  3CD5 A;  2DH8 A;  4GC6 A;  3E01 A;  1KD1 T;  3FEX B;  3C16 B;  4IR1 A;  5FLX U;  2DNN A;  1VQN S;  3PW4 A;  4P6Q A;  5E33 A;  1T03 B;  2W2P P;  3BSC A;  4ZCM A;  1BMQ B;  3MM9 B;  1RBO B;  1IKY A;  1KBR A;  2FTR A;  5LXR A;  2CPF A;  1C3G A;  1RJJ A;  4C8N A;  2MB0 B;  2OI2 A;  2XQC A;  2L9W A;  1CUL A;  4NA2 A;  1EKR A;  2FZC B;  3V4I B;  1FNM A;  1T05 B;  4QWC A;  1OY8 A;  3ISZ A;  2B9W A;  5LMN J;  4OV6 A;  2YQ1 A;  2V9W A;  2BOP A;  4I64 A;  1FO1 A;  1H6K X;  5THW A;  4WFA Q;  3TVK A;  3HHL B;  1GXU A;  4A8F A;  3KFW X;  4IRD A;  2BAN B;  2ASJ A;  3VAF A;  1IBK J;  2GJF A;  3CC4 S;  3IBF B;  4ZVR B;  5ETL A;  2ZFH A;  3R5G A;  2YBV A;  4CLK A;  2VBZ A;  5DM6 Q;  3AGZ A;  4HR2 A;  4USK A;  5IQQ A;  2ZH6 A;  3G6Y A;  1E6V A;  3OHA A;  4USV A;  4F04 B;  2BE7 D;  4I2P A;  1FD2 A;  4UW2 A;  2NR0 A;  1UVN A;  1AFJ A;  4DL7 A;  1PC5 A;  1X31 C;  2GJ2 A;  4DS5 A;  3MM5 A;  3SSQ A;  2RU3 A;  3OT9 A;  3EZO A;  1HWI A;  3IR6 B;  3K5L A;  1JLG B;  3PW0 A;  2C3M A;  3RBE A;  4UUW A;  3ZFV A;  2B5J A;  1DTQ A;  1EP4 B;  1ZPW X;  2HNY B;  4TVA B;  4KFB B;  3SSS A;  1WG4 A;  4JYA F;  1ZAX A;  4EZ9 A;  2ADC A;  3QIP A;  2Y1R I;  4IO1 A;  4NZ0 A;  2EK6 A;  2C2N A;  2MTL A;  4NML A;  4GKJ F;  3ILL A;  4EBE A;  4OL8 A;  1RWW B;  3N5B A;  1F3F A;  5F8M A;  3HVT B;  2LMI A;  1MML A;  1QUP A;  3CB4 A;  3I0S B;  3GII A;  1NLK L;  4UT4 A;  3FC9 A;  4WP9 A;  1QAX A;  4ALZ A;  1Q7Y T;  2VOD A;  4QW9 A;  4GKK F;  1RT1 A;  3DLL Q;  4OHZ A;  2PT0 A;  4F25 A;  1HWL A;  3R2D J;  1PBU A;  1N33 F;  1RWO B;  4MH8 A;  4DUT A;  5D0E A;  2U1A A;  2QA4 G;  4C11 B;  2OTJ S;  5ETR A;  2ZH1 A;  2UU9 F;  1VCT A;  3J7Y I;  4V19 X;  3HF5 A;  2QLJ B;  1S9E A;  3ELH A;  5K14 B;  2OH2 A;  1WDD A;  3G96 A;  1F60 B;  2IM3 A;  5BXI A;  1NAQ A;  1M1G A;  1SJQ A;  2CZV C;  5ETT A;  3TAM B;  2IRY A;  2W8L A;  1ZM9 A;  4X66 J;  4DV5 J;  4OX7 A;  1X0P A;  1YKW A;  2VQE J;  1UVI A;  5KFU A;  4LF9 J;  3EZU A;  1DUR A;  3UDV A;  3QO9 B;  3BO2 A;  3IS9 A;  2Y8Y A;  1M5P C;  4M5G A;  1TK0 A;  1X7V A;  1H7X A;  4LMZ A;  5CAA A;  2DNZ A;  3POT A;  5LSR A;  2ALZ A;  1K73 T;  2XCA A;  3EXY A;  1OQ3 A;  1NME B;  4USU A;  1WD6 A;  1P1L A;  2VAS A;  3EXC X;  5KG0 A;  4OJ3 A;  2PN6 A;  3ZZ0 A;  2IRX A;  2B4P A;  1ZBT A;  5BYQ A;  2OKQ A;  3DRX A;  3TWZ A;  4NPO A;  3MEE B;  5C7P A;  5H9E J;  1HMV A;  3L9Z A;  1LXJ A;  3CD0 A;  2HUR A;  2HQD A;  2EBG A;  4QWD A;  3DU6 A;  1RAG B;  2EKN A;  1YVF A;  1LW0 B;  4ZPW R;  3K5O A;  4DPU A;  3FSX A;  3BN7 A;  1B7Y B;  4HI2 A;  1Q7L B;  1LK5 A;  2D3Z A;  5IC4 B;  1RSC A;  5GAG U;  3F41 A;  2CNL B;  5D4O A;  3PYG A;  1JLC A;  3MM6 B;  2CRL A;  1PAE X;  2H48 B;  3G4S S;  4QWA A;  3A8J A;  1SQE A;  3P4U B;  1IBK F;  3CDW A;  3ZTR A;  1R0B G;  5A8K B;  3QYY A;  4HHH A;  1UP1 A;  1RWP B;  1S12 A;  2VPZ B;  2WHO A;  4YB5 A;  3P6Y C;  3AJ1 A;  1UL3 A;  4ECW A;  2VJV A;  2AU0 A;  3N28 A;  4BWM A;  2IMW P;  2GO8 A;  3FMW A;  4ED2 A;  2EFP A;  2E9T A;  2HFN A;  1MRO B;  3TR5 A;  3U7J A;  4IUF A;  5AT1 B;  2M8H A;  4OYO A;  2XCP A;  3LWM A;  1NHV A;  2GAH C;  3EPG A;  1REV B;  3M1V B;  1X9M A;  3Q22 A;  4NCB A;  4HEA 9;  3C14 B;  3CCE S;  2J76 E;  2Y9H A;  2BQU A;  1RB0 A;  1VR6 A;  2R2S A;  2PMW A;  2ILZ A;  4RNH A;  5D15 A;  3DLK A;  4NA1 A;  4ZJQ A;  2XS5 A;  5HMW A;  2LQB A;  4JI7 F;  3HHN B;  3JSB A;  5HP1 B;  3G6V A;  1CS4 A;  3I9Z A;  1T0T V;  2R2R A;  5HN0 A;  4ILL A;  1XNR J;  1Q78 A;  1MSW D;  4KR0 B;  4WJB A;  2HFU A;  3T9N A;  5B09 A;  1S1X A;  2J9C A;  3BF4 A;  1U48 A;  3M7V A;  2E1C A;  1NZA A;  3O3L A;  2Y3Y A;  2Q43 A;  1JIH A;  1Q1K A;  1GXL A;  2OUG A;  3BZQ A;  4F8R A;  3MEG B;  4WXW A;  3Q8P B;  4NLY A;  2ASD A;  3Q2T C;  2W1B A;  2CJX B;  3KUH A;  3QAU A;  5ITH A;  4DR3 F;  4CYU B;  3CPW R;  1VI7 A;  3KG0 A;  5KG7 A;  1ZAV A;  1WAC A;  1O5J A;  4V19 J;  4GRS A;  1S1W A;  3DFE A;  3JTO A;  2RUG A;  1HD1 A;  2WON B;  1RK8 A;  3DRS A;  3ZTP A;  5I3P A;  4RLE A;  2E7V A;  4X4S A;  1UPM B;  4GVB B;  4NI2 A;  2V63 A;  1CJV B;  2HYI B;  1YK9 A;  4HTI A;  3A8I A;  4X66 F;  2WOM A;  1NBE B;  3MAA B;  2WAQ D;  3SV4 A;  4CIO A;  4ZVO B;  1FRI A;  1VQS A;  2VQE F;  3J7A 1;  1M0S A;  1KFD A;  1J5E J;  2BE2 B;  4LF9 F;  5D3G B;  2AEF A;  3KJV B;  3LP2 A;  4QPT A;  4X4V A;  2J5A A;  5C25 A;  4QCL A;  2K7J A;  2V8G A;  3P3D A;  4I7F B;  5L1I A;  4ZN3 A;  2BRK A;  4RKU C;  1VOM A;  2QE5 A;  1LQ9 A;  1YBA A;  2WZ1 A;  3UVJ A;  3FRZ A;  1RYS A;  1EZZ B;  2NYI A;  1VHF A;  2QA2 A;  1RHQ B;  4B3T F;  2VU5 A;  1HLW A;  2CQ0 A;  5KAK A;  2J6T A;  5EWG A;  2QL7 B;  2DGW A;  1LWE B;  4JV5 J;  1WHX A;  2B7C B;  4P7T A;  3OUY A;  1WHW A;  5GMD A;  2CQI A;  3AGY A;  1I1G A;  2B3T B;  2EEY A;  2ZJR Q;  4URS A;  2W8K A;  1N6Q B;  1FF2 A;  3H25 A;  3GFZ A;  2KVI A;  2M88 A;  4ZIV A;  4J9L A;  2A2D A;  1Q95 G;  1NH8 A;  5A8W A;  1DFD A;  1JNZ B;  2DCL A;  3BYP A;  2FHJ D;  3QFH A;  2HNZ A;  4LRD A;  4XO0 A;  2IAJ A;  4NCG A;  1JNR B;  2KRR A;  3MD1 A;  3UR3 C;  4IOA Q;  1F1B B;  4AQY J;  4DU7 A;  5EDW A;  3MUR P;  1VLY A;  4RW7 A;  1VQM S;  3MM7 A;  3B4M A;  3MED A;  3S7R A;  4ES2 A;  2DR5 A;  4F0H A;  3UQS A;  4MAK A;  2MKH A;  1HBM A;  3OTE A;  4DR1 J;  3K5P A;  4IRK A;  3WX4 A;  3D3B J;  3Q8U A;  1TVR A;  3Q8Y A;  2QLX A;  3KJQ B;  4OZN A;  3CIZ A;  1RT3 B;  1GAO A;  2IJN A;  4CH1 A;  2A6M A;  2NZC A;  1YIJ S; 
#chains in the Genus database with same CATH homology
 1XAO A;  2B26 A;  2QLD A;  3I38 A;  3AGZ A;  1C3G A;  3LZ8 A;  1EB0 A;  2Q2G A;  3AGY A;  3TJ9 A;  3AGX A;  3LA0 A;  4L3K A;  1NLT A;  3TJA A;  2HFV A;  3NXZ A;  1GMV A;  3TJ8 A;  3L9Z A;  3NY0 A;  1GMW D;  1GMU A;  1EAR A;  4J80 A;  1GMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...