1EARA

Crystal structure of bacillus pasteurii uree at 1.7 a. type ii crystal form.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
b'MVITKIVGHIDDLSHQIKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UREASE ACCESSORY PROTEIN UREE
molecule tags Chaperone
source organism Bacillus pasteurii
publication title Structural Basis for Ni2+ Transport and Assembly of the Urease Active Site by the Metallochaperone Uree from Bacillus Pasteurii
pubmed doi rcsb
total genus 38
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1earA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1earA02
2Q2GA 1GMUA 4J80A 3LA0A 3TJ8A 3TJAA 3AGXA 1EARA 1XAOA 2QLDA 3AGYA 2HFVA 3L9ZA 4L3KA 1NLTA 1GMWD 3AGZA 3I38A 3NXZA 1C3GA 3NY0A 3LZ8A 1GMVA 1EB0A 3TJ9A 2B26A 1GMWA
chains in the Genus database with same CATH superfamily
2KVIA 4TKTA 4ERDA 3HKZD 3SXLA 3V4IB 1U1MA 2HHHJ 5GAGI 1N36F 2VDIA 2QFJA 2B7CB 3DGPB 4WKRA 1AZSB 1JLCA 4DR7F 1AUDA 1RT6A 1DURA 2QIFA 2D9PA 1C2PA 1GFWB 3QGHA 1H2TZ 3GE9A 5F8JA 1UPPA 3D6HB 3KUGA 4ANCA 2F4FA 3HFVA 1VJQA 4ICLB 2I5JB 4NI2A 2RRNA 4ES2A 2Z58B 1GXLA 2PDAA 1IKYB 4R25A 2CG4A 2ZBCA 4RW9A 4IG3B 5IV3A 5GADI 2XCAA 3V6KA 3IGNA 2KB2A 3IG1A 3OT9A 4KGMA 4M5GA 4GKJF 1GMWD 1RHKB 1Z1ZA 2W2NP 3KG1A 2KDOA 4KV8B 4ECRA 1VC6A 2R7QA 3BF4A 1NK0A 3OW2R 2B9WA 1G7CB 5LJ5Y 4KC5A 3PW7A 3CC4S 4I7FB 3FKBA 3R6GB 4UT4A 2UVVA 3W2VA 1RUSA 4WFZA 5AXMA 2EK1A 3KJVB 4QCLA 4PQUB 2Q3PA 2JEFA 5F3TA 1I94F 2JLFA 3CJ4A 3FRZA 4M5DA 2LEPA 4QOTA 1YJRA 2LECA 1XC9A 4G1PA 2OH2A 2E7WA 1ICEB 1S99A 4KO0A 3ULHA 2FC8A 3VF0B 5M2PA 2E5JA 4OFZA 4B3MJ 4DR4F 2ZZMA 3R5JB 4C3KA 1RHJB 3J80U 4LT6A 3P5TL 4YOEA 2R7XA 2E44A 3BREA 3GR0A 2UUCF 1PAEX 3JTOA 1SB6A 3M8SA 1S4EA 1IKVA 3MEDA 2OD4A 1DQ9A 2B4UA 4R0EA 3KHRA 3MMCB 1KRPA 5HJYA 3QGIA 2RT3A 3FDSA 3I56S 2MQNA 1F60B 1KBRA 2MHEA 2OPQA 1SC1B 4JI7J 4O3QA 1AB8A 4FS1A 1MMNA 3PV8A 1XR5A 2UZAA 1FKOA 2B8PA 1VQ8S 2DR6A 3EVWA 4JI0F 2GJFA 3POTA 2R7VA 3ENAA 3AT1B 3JTPA 4G3IA 3CIMA 3CW2C 2ZWOA 1B7FA 1FEEA 1JLAB 2EI5A 2ZKTA 3MPWA 4G1QB 1XQIA 2V2ZA 4HT5A 3R5BA 4J9KA 2BM0A 4DSEA 2WBMA 4AD6A 1J5EF 2J0XA 1NK4A 1QSSA 2VA2A 3DDIA 3AOAA 2RKIA 3HVTB 4PUOB 1TMMA 1W25A 2FHJD 4OI0A 1VQNS 3DOKB 3M9MB 5EWEA 3VZHA 4A4JA 3DLJA 3A8JA 4ECVA 4NMXA 1SC6A 2AMCB 5KFNA 2HNYA 3SI8A 4JBCA 2HHVA 4NASA 2COLA 1JX4A 1XJWB 3C66A 4IDKB 1PKUA 1GMUA 3TZWA 2XGQA 5K5MA 4WYLA 1RT6B 1K73T 2GCFA 1KFDA 2QL5B 3QLHB 4WFYA 4WFAQ 3VR1A 2FZGB 3KMSA 4LF8J 1KVJA 2DIVA 1XAOA 1N54B 2QGFB 5CYJA 5KT5A 4RW6A 1OO0B 3ILOA 3ET6B 3LF0A 3BGRA 2JNJA 5H1SV 3HHNB 3M30A 1S12A 2W9CB 3FNNA 4TVAB 1JQGA 5GMDA 3OTCA 5K14A 5BXIA 3Q24A 4ECXA 5HQ8A 3A13A 4ID5A 1RWKB 2C3PA 3AJDA 3RAMA 3DOLB 3HFZB 4CT8A 2WTFA 2EWHA 4DUZJ 4Q7AA 3K5LA 2J5AA 3HX9A 4EFAC 3T1YJ 1TL5A 4FN5A 3MM7B 3IR6B 3KK1B 5I42A 5KFXA 4NX9A 5DGBA 3BBCA 3PYEA 3J80Y 2AJ1A 1H7WA 3Q0AA 1T05B 3ZTRA 1ULRA 3ZZUA 3NCQA 2OPSB 3H98A 5HBMA 3W65A 3OJUA 2XHCA 1L3UA 3WHIA 2FLPA 4JI4J 4LR7A 4PCQA 3OVAA 3VTIA 1TKZB 4Z37A 3M8QA 4CYUB 2FGCA 4E98A 1Q7LB 3CXCR 3W3SA 4HL9A 1RT4B 3M8ZA 3MPYA 2BJ3A 2W2MP 2PFFB 3QT7A 2ZC4A 1O0PA 1LKZA 3KXDA 2KRBA 3L09A 1SL2A 3G6ES 1UVNA 3L9ZA 4OZ0A 4O4GA 4DX8H 4KJIA 2RDIA 1S5ZA 3VAJA 4A46A 5GMKa 5BYRA 2KKHA 2A6MA 2NR0A 1XR7A 5F8GA 3C2PA 5C25A 1VYAA 1UFKA 3MWBA 4CQ1A 5KFZA 1FJGF 2V2KA 2OPPB 1S9EB 3Q89A 1RTJB 1GMVA 4OZNA 3PKMA 3T9NA 2R7SA 4EMDA 1UFLA 5AT1B 2BVZA 2GGPA 3ONQA 4RW4A 2QA4G 1T9XA 3FGVA 1HNWJ 2DR8A 5T14A 2Y0SD 4YR2A 1K8AT 3BDEA 2VG7B 2HHXA 2UU9F 2DNQA 3LA0A 4MT1A 2XO7A 3DN9A 1ZM4A 3EGZA 3D7SB 4P74A 4RW7B 5ETRA 4N47A 3UNGC 3M1VA 3M2VB 2VPZB 2DEIA 4K5RA 2FHKA 5K8MA 1N32J 2QN6B 4ZPVR 1CS4B 4P2FA 3UN3A 1QD1A 3IRXA 2RDDA 2FQQB 3DLEA 5DG8A 2BMBA 1NH8A 2H48B 3C16A 3TEGA 3CF5Q 2IM1A 4D3GA 4F04B 4A8WA 4DV6J 3C15A 2DJWA 2K3KA 2UXBJ 2EPIA 1YJ9S 4ZHRA 5HJXA 4DFMA 3CDBA 2KJWA 1BD6A 2YPYA 1W7WA 1YKWA 3I5AA 3N5BA 3LP1A 4M5MA 1X4CA 1F5CA 4CO3A 1C0TB 1U8WA 4C7QA 4FS2A 2QRRA 3AB2B 1UL3A 1FXDA 1VRTB 3NAIA 4J91A 5EGYA 1YGYA 3ET6A 5J1EA 5FLXY 4DL2A 1KQSR 2LU2A 4GKKJ 4ZCMA 9RUBA 4M95A 5F8HA 2M8DB 2VG6B 1EKRA 3CJRA 4RNOA 1EQMA 1HFEL 3MPVA 4LBPA 3W9IA 2WW4A 5CZXA 5AJ3J 4OYAA 2EFQA 3AD8C 2HFUA 4IDKA 3C15B 3GJTB 5RUBA 4J9QA 5HVHA 5DDQC 1N34F 1HYSA 4IOBA 4XK8C 1U8SA 2CAJA 3RU0A 2XNRA 2EFPA 3U1NA 3ENQA 2F3JA 2GZOA 3TUZC 1K0VA 3SSRA 3OJSA 3RRGA 4UQTA 4F02A 2I8EA 4DV3F 3RB3A 4P71A 4TY8A 4O3NA 2QA1A 2H5EA 1HNIA 1RAHB 3UDEA 3GIKA 3P5BP 4JV2A 1GQEA 4WZQA 4ZDNA 4AQYJ 5AE3A 4R5PA 1MWZA 2G2YA 1TR0A 2W4PA 3R5CA 1RT1A 3CJ0A 1FFSB 2RILA 4ITSA 2YWKA 4URSA 2X1GA 2D74B 3N9UC 1OIAA 1VQ7S 4NL5A 2DHSA 3KWMA 4QZVB 1Q81T 1R0AB 1HWIA 4OX9J 5KFRA 2XM3A 1X5TA 1S1XA 3TA1A 1SH2A 4YDDB 1EARA 3CMES 2G0JA 1R0BG 1Z2ZA 4KT0C 4L73A 4OX7A 1UVKA 2V5HG 4J7CA 5HROB 3DHXA 3MAAB 1GNKA 1KKHA 2R9LA 4DV2J 5D4PA 2HGMA 2NUHA 3AQPA 3EDRB 4MYUA 4O4GB 4LR9A 2AZ1A 2WB1D 1QY7A 4LF9F 2DO4A 3OXFA 4RNMA 2ADCA 1RTDB 4PYDA 1TL7B 5D0GA 5D0HA 4JI6J 1Y9OA 2VQFJ 2HFSA 2H4YB 2P9GA 4BC9A 4F26A 5GAHI 1OY9A 3BKTA 3MDFA 2YNGA 2B43A 2Y3YA 3QBCA 4DSIA 4CLUA 2HSEB 2VF3A 2WVFA 1HI8A 3BB5A 1PSDA 4XO0A 4AQYF 1N56A 4ECWA 4WFNQ 3DFEA 1REVB 2HNDB 4N7TA 2QO3A 3K58A 1T05A 4ZA1A 3I96A 4OYPA 2F9DA 5CQGA 5A0YB 4F4KA 4U7UD 2LYVA 4IRKA 4J9OA 3GB0A 1TUVA 1UVMA 2OEKA 2M4MA 4MIBA 3OTEA 4KHPJ 4CI0B 4XIUA 2E5HA 2FUG9 3P8BB 4QR2A 4JI8J 2IM0A 3MM9A 3EDQB 2V94A 5I3PA 3PACA 2L3MA 4LSLA 1U1NA 4M5LA 1IBCB 3LPEA 3O6QA 3RRHA 3R9LA 4DL3A 2HGLA 2HRUA 4UOFA 1X9WA 1T02A 2VL1A 4A8MP 1CLFA 1LXJA 3IG1B 2QMUB 3GQCA 1JJ2R 3D67A 4I6WA 4GC7A 2VOPA 3GILA 1JLEA 2IAJB 2D41A 3WIVA 3IM8A 2RRBA 2GVDB 3HF5A 3D0IE 4NLRA 5KFQA 1X5OA 2CPEA 2M9KA 1N36J 1WG1A 3NGKA 4U7CA 4JYAF 3THTA 2WRMA 2DRDA 3DDKA 4XPEA 4ED3A 2LEAA 1SKRA 1ZS6A 1G4CA 4URGA 1S4FA 1NDCA 4DR3J 5KG4A 2BX6A 1VIXA 2FPHX 1HWLA 4FKXA 2J9CA 5LMUJ 3QRQA 1V5VA 1PC4A 5B0FA 1WF0A 3H0PA 4I2QB 5FDLA 5C42B 1WOPA 4OI3A 3QIDA 2NYIA 3PFOA 2ZEJA 2HWIA 3NKYA 1VQ9S 1GX6A 3KNGA 4RUBA 2BKPA 3F73A 4DV7F 3SEOA 3RGIA 2CADA 3LAMA 3VV2B 2ILZA 2FJDB 2X51A 2EK6A 3SQGA 4F4AA 1NSKL 2CWXA 4U95A 3OVBA 2VBXA 2EFNA 2VV5A 1Y4ZB 4HHJA 3L95X 3VVUA 5I3UB 5E3RA 4A8OA 1NPRA 2FZKB 3F44A 3TJAA 3MM6A 4USVA 4DL0C 2SXLA 5H9EK 4JV1A 3KLFB 3MMAB 4PG8A 1UEUA 1FDAA 1F0XA 1S1WA 3TARA 2HFZA 3OR1B 3MMCA 1PC5A 1RTDA 3T3FA 1FNXH 4DQPA 1RCOB 4F2SA 4YFUA 3RR8A 3I0SB 1K1QA 1RBAA 3JSMA 2V8PA 2ZJPQ 1KP6A 4EBDA 4CT9A 3NXZA 3WC2A 1F9HA 2AKWB 3ENWA 3NAHA 2WVBA 1R6VA 4Q5VA 4FYDA 4ZVGA 3K7RA 3JS9A 1F3VA 2PFDA 3GCXP 4ANDA 1WC5A 3GJQB 3M8WA 4L76A 2QL9B 4KQZA 2FJVA 2MLYA 1V6HA 4Q43A 3BZQA 3KJVA 2VA3A 4EGLA 4RO0A 2RQKA 3TAMB 4UUWA 1X0FA 3VGUA 1HNIB 3MAQA 3G2XA 4DSJA 1MMLA 4XDDA 1U1LA 4KH0B 4C9DA 1WSRA 2MY8A 1P27B 3TNVA 1Y3KA 1WTBA 2RE1A 2Z57B 3C14B 2QJ3A 3HSDA 2GVZB 2R2RA 2XY6A 1YIJS 2E1AA 3B78A 2XNQA 1XMOF 2W2PP 3R1LA 3OR2A 3A12A 1SL0A 2D3ZA 4DPOA 4B3OA 1WHWA 4L6V3 4P6QA 4P73A 5EX0A 5HATA 2XLKA 4F4ZA 4PG4A 2DNHA 2MJUA 4N8OA 2GAGC 1AXQA 2DBBA 1AZSA 1JLCB 1SI9A 1H74A 1WF2A 3CSKA 2WCXA 1Y11A 3IAS9 1VC0A 1D9FA 4DJBA 1U0HB 2IRXA 2YVSA 4DV2F 2O1PA 1XERA 2V2VA 1WHYA 3DLGB 3LGNA 2XHWA 4C8OA 2VBYA 5IQQA 2C2KB 1TUGB 4C11A 5J1EB 2N7CA 5IT9Y 1QTNB 3Q8PB 3MUMP 4RU2A 1SJRA 4JP8A 5B0DA 2C22A 3L7UA 2ZM6F 1FXRA 1T11A 4ZHRB 5KOXA 4LR8A 1TKTB 2CQIA 3FCHA 2HQFA 2KO1A 2LVWA 4MYTA 2A18A 4WE1B 4ZJLA 3UWTA 4F50A 1Q7YT 1FHTA 2BV3A 2YQ1A 2YKPA 5F8LA 5J2NB 4RKUC 5ETMA 5HMXA 1XN9A 3MR6A 1YBTA 2HHHF 2MHNA 3PRVA 2WBRA 1ZA1B 1NUEA 3UD4P 3T1YF 1NSAA 3HXMA 2DGVA 4MKBA 1VK8A 2V50A 1SBRA 1S7HA 1C1BB 1AUSL 1SC4B 4NCGA 2XYPB 4OV6A 3UNYA 1FDDA 2WB4A 3HP6A 2CA9A 4DLEA 1RDRA 3X1LB 5A8WA 1TKXB 2G9OA 2VKZG 2AJ0A 1IM6A 3IFEA 1LWXA 5E2QA 3ZTOA 4CP5A 1RT7B 2DXDA 1RTJA 3T6JA 1JJCB 4YMEA 1TFYA 2ADBA 2GQCA 1C4AA 4YR0A 5C24B 3WQPA 2HEKA 1AYEA 5HAOA 4NLUA 3OL8A 4C3LA 1MSWD 2AP6A 2ILYA 4DXLA 2NXJA 1Q0NA 2VQFF 1PAUB 2UUWA 3D68A 3H20A 3WC0A 3FEZA 3BEGB 3O5TB 4TU9A 3LWLA 5J2MA 1TL3B 1HBNA 4YB7A 2CJKA 2KHCA 2V9WA 4F3QA 1N5VA 3DRSA 2AQ4A 3LWMA 2YKMB 1ITPA 3THVA 1R0CB 2LXUA 1KLMA 1B70B 1HBOA 2EFOA 1RHRB 1RT3B 1S1UA 3A8KA 4HR2A 2JL9A 2B26A 4K4XA 4F2RA 3PX6A 1C0UB 1RWOB 2F8HA 8RUCA 3PKYA 4ENOA 1JXEA 4KBIA 5HL7Q 2OFGX 3DHWC 4AL7A 3AA9A 2RJZA 3QFHA 3H90A 4W4MA 4F4YA 1X4BA 3MEEB 2LA4A 2RQCA 5D4NA 2IY5B 3UFCX 1SL1A 1UP1A 4GVBA 4O3RA 4ZPDA 1NNDA 1IJFB 3AD9C 4YHHJ 3CB4A 2FJWA 1HBUB 1L3KA 1Q5YA 1QAIA 2FLLA 1EX8A 4DR5F 2GMHA 4ID5B 1AROP 2ZUAA 3T5JA 2KH9A 1QJHA 1R8HA 1CJUB 3VGVA 1WEXA 4TLQA 1YJNS 3TW0A 1RKJA 5C5JA 4IR1A 3HHLD 2BJ7A 3MM5A 3PR4A 4LQ3A 2F1FA 4RW6B 1NSQA 4KHMA 2WONA 1EJ7L 5LJ3Y 4DSFA 2C28A 1HMVB 4DBQA 1I3OB 3OTBA 4DLGA 2WAQD 4ZIWA 1RT5B 3D28A 2ZHAA 5KFWA 2HHPA 2DY1A 2HK2A 1K44A 1WC1A 2GMJA 4G65A 3BPDA 3ICLA 4O44B 1RWUA 3WIUA 2XO6A 4DF4A 2L9DA 2V8GA 5EDWA 2CVEA 2FY8A 2V8VA 4JV0A 1VQPS 2HNYB 2OAUA 1CJVA 5T41A 5SZTA 2XTJP 2ZD1B 3K57A 4WK3A 4RUAA 1QDUB 2JOQA 1XNRF 5GAHU 4ZLJA 1VLOA 3M32A 2HVHA 1MWYA 2P9EA 1NJWA 2G13A 3LP2B 4FVCA 5E5NA 2HFVA 1LW2A 2IMOA 2RVJA 4J37A 3HVTA 2HLUA 4NA1A 4OYXA 4CTAA 4QPXA 3PZPA 5KFSA 2M2BA 4PUOA 1IVZA 1R8BA 3FBCA 1IKWB 3W60A 5AXNA 1OMSA 1JXLA 2GIRA 3NLCA 1JLAA 2AJ2A 5L1IA 3US5A 1RYSA 1BY9A 4B9UA 2IPOB 1EB0A 3CMQA 3OVSA 2PEHA 3P96A 1YWXA 2R2UA 5KFIA 4ZK7M 4QWAA 4YB1P 4CH7A 2N3OA 3EJMA 2DO0A 4UOGA 1FKOB 4EO8A 2RUGA 5CCMA 3TQEA 3SV3A 5DRKA 5IT0A 3TZXA 5CD4H 2R8JA 5KFGA 4LRBA 4OI1A 2OPQB 2QLXA 2V8HA 2ODXA 1HQUA 2KVQE 3D0HE 4ZP9A 4EO6A 1RJJA 1JLFA 4IYQA 5DG7A 4A8QA 3H59A 3CD6S 3I82A 5HP1A 4MTPA 1X9MA 4OHZA 2LDIA 3H5YA 2B7BB 3GV7B 3HCXA 2LQ9A 3GV5B 2BJ8A 3FFIB 1ZAVA 4JOUA 2C2DA 1HNXJ 3DM2A 3AOCA 2BUNA 2H5JB 3AXKA 3HHLA 3JTNA 3ZTSA 4O3SA 2HNZB 4NCAA 1XK8A 2EG1A 2C2NA 2FJBB 2K1RA 3PJ9A 3CCUS 4NLOA 3TRGA 2VPYB 4KH1B 1JJ4A 2DHGA 5IFMA 3BPSP 3ZZZA 2XI3A 2N4DA 4X64F 1RTIB 1SKUB 1KHWA 4Z7CA 2DNMA 1NJZA 1LWFB 1NHUA 1S0NA 1HR0J 4QWCA 3MFHA 1GXTA 3EVMA 1OY8A 3CJ5A 1NHKL 3N6MA 1TK5A 3ZZ0A 2XS2A 4PXBA 4RW9B 3P4UB 3JYTA 3RUBL 1XMQF 1VBYA 4DL4A 1OYEA 4O0NA 4X4OA 2EC2A 2C2OB 3I4HX 3SQOP 3OFEA 3M2RA 4QW9A 2IJRA 2CZVC 2RU9A 2ASLA 2XCPA 1G1XA 1G2EA 1O5JA 1U25A 1V3ZA 2VB6A 1XMOJ 3C3LA 2LLZA 3SCJE 1HKAA 3TJ8A 3U02A 1KQKA 2AYEA 2XMTA 3HKWA 1S6PA 4JUZA 3W61A 3PTWA 3LW5C 2HHWA 3AH6A 5K8OA 1HR0F 1QTMA 4K50A 2NLWA 3I5CA 2BRLA 2JVMA 1RTHA 2FC9A 4RJVA 4A48A 1L3SA 4J9PA 1U0HA 1FE0A 3CCJS 1U1PA 2VFSA 1WNEA 4I68A 2Y9HA 1GTHA 1SJQA 4F3OA 1UA0A 2DR5A 5D8HB 4Y2KA 4RW8B 3W2WB 1FI4A 4DR1J 2E5LJ 4LF4J 3KLHA 3A1YG 2QZ8A 4A8YA 1KVIA 1RAJA 2Y1RI 1FKPA 2CNKB 3OR2B 1ZPVA 2LQJA 2VUGA 4DQRA 2Q79A 3TA0A 1OQ6A 3ETOA 5KFYA 2BA9A 1BQNB 4LIRA 5B08A 2X1BA 5A6PA 4PKDB 3QGPA 2MDAA 4AYBD 3QWPA 5DO2A 4EU0A 2J8SA 1LK5A 1RE1B 3I87A 4WKYA 4E2FB 4O23A 3PW0A 4C4WA 2QLDA 4OMFG 1T95A 1VQKS 3QWUA 2Q6BA 4B3MF 2Z30B 4CM0A 3H5UA 4ZLPA 3G4SS 4V1Ak 4DR4J 4LFAJ 2CQ0A 1FO1A 5LMNJ 2UUCJ 2HNZA 2XEXA 2J6UA 2YWWA 1HWUA 4C6AA 1KSPA 5AE1A 3QJJA 3CDUA 1X4EA 4P10A 1OPIA 1RP5A 4FKYA 1B4SA 1FJEB 1SJ1A 1GX5A 1O51A 4ECTA 1UTAA 2IMWP 1S79A 1RU1A 3R5DA 2MTLA 2XY7A 1VBXA 4NXMF 4RZRA 4HTJA 1JLFB 1U09A 2CJYB 4K2XA 2JX2A 2D3OR 5KFCA 4PWUA 1VRUA 1S1WB 4NLSA 3SCLE 1UETA 3JQJA 3MMAA 3U7JA 4Y6IA 3JB9k 4DQIA 3W9JA 2HVEA 3CJKA 4KGXB 5L9XA 4CNYA 2Y8WA 2W8KA 4O4RA 1OQ3A 1P9QC 2LA6A 3DI6A 3HDSA 2FGOA 2OEMA 2ROGA 2OD6A 3D0GE 4FDFA 1LWEA 4M5IA 4DL5A 3SV4A 2YPZA 3QNWB 4CWBA 3GYGA 4O3OA 2DEJA 1NDPA 2MKCA 1S1VA 4FYYB 1FRJA 3RG6A 3KLEA 5B0GA 3OV7A 2ZBQA 3P45B 3NBPB 1HHQA 2JC1A 1SH3A 2KU7A 3FVYA 3NS5A 2CQ1A 1P1LA 5C42A 1DQ8A 3GR1A 4I2PA 2KFNA 4CTAB 1WTFA 3Q8YA 3VAIA 4BWJA 5SUHA 1T7PA 2K7KA 1N8RT 2YKOA 3KJQB 2ZH2A 8AT1B 4U7UK 3DU5A 1C1CB 2IBKA 2HFOA 3DNCA 4X62F 3VWSA 4ILLA 2XQCA 2FYXA 3V6DA 2R7TA 4NLYA 2ZD1A 3IWXA 3QIPA 3NRBA 5J2QB 2MY7A 1H38A 1IWAA 2PE8A 1Y5NB 3NGRA 3D2WA 2GVDA 2BKOA 3EPIA 4KFBA 3KNAA 4O44A 4FZVA 5DQGA 1NEEA 3V5RA 2FHOB 4X2BA 1NBEB 2G1HA 1X8DA 1VQSA 4DV1F 1S97A 4OZLA 3BQ2A 1LFPA 4YB5A 1S76D 2E1MC 2BQ3A 3G82B 1T03A 3OL6A 4CO4A 4DPUA 1NM2A 2VASA 4DI6A 3MM5B 3M2UA 1CJKA 4ZP6A 3TJ9A 4OI2A 2GFFA 2Z2LA 4ES1A 3MM9B 3W66A 4EZ6A 5HQLA 1X5PA 1H3DA 5DZ6A 3EVOA 4DR2J 3I6PA 3CDEA 2GNKA 2CQ2A 3CCQS 3O2IA 1S6QA 4B3RF 3AGXA 1JLBA 2AGPA 2QV6A 4YDXA 4CLFA 3MPDA 3QO9B 1S77D 4DZDA 1HNVA 1VDHA 3P49B 1ZM2A 1T9WA 4LFBF 5LM7E 2ERRA 1REVA 2JRSA 2J7WA 2HKEA 4ALZA 1FA0A 1RK8A 2V34A 1KLMB 3CDAA 2FLOA 4LRAA 5AXLA 2LXFA 1U2FA 3K89A 3RBZA 3W8GA 3NL0A 3ISND 1GAOA 3DKDA 4M1KA 1FFGB 4ZN3A 4P9SA 2OP5A 5FIIA 1HBNB 1JNZB 3PO5A 1TL7A 2DNYA 3MR2A 4ETXA 5CYQB 1RLDA 4ZPBA 4M5KA 3FBBA 2BBEA 3MAAA 4DUZF 1RZMA 3I55S 5J2PA 5A8RB 2C2EA 5HMWA 3CVKA 3EM1A 2BR0A 5M2UA 1X9SA 2OGUA 3ZZYA 1S1XB 4EUVA 5B7WA 1CJTA 1S10A 3PR5B 1KLNA 4KY3A 2BXJA 2W01A 3I4PA 4KSEB 1VGYA 1X5SA 2LKZA 5LT5A 5LXRA 5KFFA 4H4OA 2HURA 2IM2A 3LAKA 3QMQA 2VKRA 4EBCA 1QLNA 1DTQB 4J9UE 1WSVA 4DFJA 4GO5X 4JI7F 1S49A 3JSYA 4NRTA 2H9ZA 1EKSA 3CE8A 1QE1A 1IR2A 3C6TA 1S1TA 4Y2CA 4JI2F 3MI7X 3P3DA 3E01A 4MK7A 1M5SA 4DL7A 4ILMA 4YR3A 1IXKA 1BWEA 4ER8A 4IQXA 1EP4A 1S0VA 4KPCA 2AEMA 3Q2TC 4O0IA 1XNRJ 2JWNA 1FK9B 1BWVA 1X60A 2CQGA 1S72S 3R5GA 1MLAA 2BOPA 3UW1A 2XY5A 4C11B 3LANA 4X4SA 2ZH1A 1IKXB 2DCLA 1SJ3P 1VQ5S 1VRTA 3BBBA 4D3HA 2UU9J 4KHRA 3W5ZA 1N6QA 3K2YA 2Z0GA 2XBPA 1N0VC 2XMKA 3PEJA 2W9BA 4IG0B 1KC8T 5T7LA 2GMLA 5KT2A 1N88A 2V4QA 2UXDJ 5HMYA 1WELA 1X31C 4NYZA 3ZZOA 4CO2A 3MR3A 3CCSS 4B3OB 2L08A 1WHVA 3PY8A 3W5XA 1M5HA 2QYCA 2LEBA 3D3CJ 1ROFA 4OHXA 1T9UA 1Y10A 3CPWR 2GO9A 1YDLA 2GVZA 2J9DE 1IUJA 2RIJA 3E01B 2MZJA 3SSQA 5DETA 3IN5A 1ZTWA 1WOOA 4OX8A 3IR7B 2LXIA 3R27A 1KTVA 2PT0A 4W98A 3J81U 4DPWA 2NCKL 3BN7A 3M8PB 4WCEQ 2DKOB 2F4VJ 4L75A 4G6VB 1E6YA 1HNZF 1QAXA 5A8KA 1SKWA 2MZTA 1WKJA 2EVZA 3LO3A 4H4OB 1EZZB 4IH5A 1MN9A 4B3SJ 5L38A 2OPPA 4USMA 2KXFA 3H2UB 4L72B 3FSXA 3TZYA 2CJBA 1H7XA 2KFYA 6FDRA 2DGUA 2MKHA 1SV5B 1C3GA 2W7PA 4ED1A 2M88A 3GYXB 2PN6A 4Q8EA 4BLGA 4QIEA 1KOOA 1HWJA 4S0MA 1V9OA 3AXMA 2J76E 4HH1A 5ITHA 1UKUA 2GAHC 2MLZA 3O44A 3MUVP 4JI3J 4DWIA 2POKA 3GJRB 3OR1A 4F4XA 1RT4A 3QRRA 4WYWA 1N33J 1WKLA 3HD1A 2F4VF 1A6LA 3HSJA 1I6JA 4CRJA 2Q1LA 2PMWA 4RUCA 5EUHA 3IWLA 2D3O1 1S6OA 4PPDA 3HZGA 3S8SA 1M5VC 1XNQF 3OXGA 2HVZA 3BSAA 5AXKA 4LVOP 2E9TA 4FYVB 1ZBTA 2PGCA 1N5SA 3FMWA 2MB0B 3BR9A 2DISA 2JLEA 1SQEA 3D4JA 2FJEB 4GVLA 4K8RA 4ZOSA 3TUJC 4WWSA 2W2OP 1S0OA 3KK1A 1JLBB 4URQU 3AA8A 2MMYA 5LSLA 1D8YA 2DTJA 3H7HB 1KR4A 3I31A 2IC3A 2DYAA 2RS8A 3DXSX 4I69A 1HHTP 3HMJG 2OPRB 2RF2A 3W5YA 4YHHF 4IO1A 2F5GA 4JV5J 2NZCA 5H9FK 1RAGB 4B9NA 2CQ4A 5KAKA 4LUBA 1CULA 3JSBA 2M3DA 4OYMA 3PXGa 3QZ8A 3MR5A 3MTKA 4CLZA 4YQWA 2JZ5A 1RAFB 3S1TA 5F9LA 2NPIA 3QLHA 3IR5B 1UCNA 3IC1A 1XIQA 3BYPA 4LSZB 3BKUA 1HPZA 4DDFA 2CPHA 4Q0BB 2ZZTA 4Q0BA 1FESA 2D1CA 1FWLA 2IAJA 4X84A 1OS5A 4RBUA 2XGPA 5GVQA 1TVRA 4HVZA 4DUYJ 2H5IB 2AX1A 2UUBF 3IBFB 4LF7F 2HW3A 1NK6A 3G6VA 3ILLA 3FK4A 2DNGA 2QLFB 3OPKA 1DTTB 2RD5C 2XMVA 3KUHA 4L74A 4MK9A 5CABA 1F3FA 2CDRB 1SXLA 4FVMA 1CULB 3TVYA 1ZAWA 2ATLA 3BN4A 3I9ZA 2E9RX 4FNIA 2KZMA 2O66A 5KFOA 3TX0A 2ALYB 3NGTA 2E1PA 2ROEA 2DD8S 2GIFA 4HHUA 4UOCA 4F4WA 3RB6A 3M8YA 1Y0HA 2YX1A 4B9SA 1K0TA 4G1QA 4K4TA 4BS2A 1WKKA 1RWNB 1TQLA 2O3DA 3SBMA 2KG0A 3MR7A 3TAPA 3J81j 5IOLA 3BGLA 1VFJA 1V3RA 1VK3A 4FNHA 3ISZA 4UY8T 2CPIA 2VIHA 2Y1JA 2R7RA 4MKVA 2WVDA 4WZMA 2WHOA 2A0FB 4RL1A 4LFAF 2HAIA 3D6TB 1X7VA 3RAQA 2AW0A 1Y5LB 4PR6A 3DRRB 1G6BA 2D3UA 1P8GA 3CJKB 4QBUA 5HVFA 2HWHA 5E3AA 4ZIVA 4ED2A 4WXWA 3TQ1A 1JB0C 1HW9A 3T5LA 4PQAA 4WK1A 4ZVRB 1QM9A 2MZ1A 3M7VA 1V5IB 2MXYA 4H4MA 2BM1A 4BHQA 1EQ0A 2XZWA 1IKVB 2YH0A 1HD0A 2YWGA 2VZ9A 3K0JA 4DV4J 1OY6A 3S7RA 2FVCA 4JI8F 4FP9A 4QIGA 2KT5A 3PHTA 3EUNA 4MK8A 1N5QA 3QJPA 1YZ6A 2NSBA 1J2VA 2CDQA 2M70A 3I9V9 3VGTA 5JVHQ 1HNXF 2AEJA 3U1LA 5L1JA 4CLKA 4OX6A 2PC6A 4DPYA 1WG4A 2PD1A 5J1PA 4ELVA 3TP2A 2HFNA 2CQCA 3QAUA 2WK4A 1FDNA 4Y2IA 3OBIA 1RT1B 4MJKA 5A8KB 5D6GA 3RBDA 4LFBJ 1FTRA 4L3KA 2DY9A 1QVFR 4TY8B 4TNOA 3R7BB 2DGWA 4TU7A 3D1QA 4OLPA 3T9ZA 4RBTA 1S9GB 3CTRA 5GADU 2XSJA 2ASDA 4CLTA 3CJ8A 4CO0A 4X4QA 3ILIA 2IJFA 5EHHA 1U02A 1QSYA 2DXFA 2ZNZA 4Y2AA 4B02A 2BKNA 3FMBA 3KHLA 4DS5A 3E2EA 2BE2A 1ZM9A 4TY9A 3GFXA 1KOHA 1M0SA 2UUTA 3DYAB 3R97A 3V4MA 4U8YA 5CA5A 2N82B 5MLCV 1DHMA 1RTZA 2MKSA 3GIIA 1B0VA 1XMQJ 3B6BA 1KTQA 5KFVA 1N32F 5HK4A 2YXLA 4Y2MA 3I32A 1VQ6S 5DZ7A 2BE7D 2M5YA 1RTHB 4XPCA 1M5OC 3GV8B 2NSCA 3CJQA 3PCOB 2C3OA 3LP1B 4ZVOB 4JI6F 4PYAA 1LW0B 2RSQA 4IFVA 4K7QA 4QYRA 3MCMA 5ETVA 3TYTA 3GFZA 5HO4A 3OL7A 2ZH9A 1RXOB 3PIOQ 3PW2A 5KFJA 4KE5A 2Y0BB 4CLSA 1YJWS 1TELA 3HSZA 3GTYX 4FPIA 4RPFA 1TZ0A 2CPZA 3Q83A 2Q66A 4C8ZA 4LRCA 2YNIA 3AOBA 4HI2A 4FBTA 1IN0A 4KPYA 2ZHOA 3C6TB 3K17A 4DX6A 4NYPA 4CO1A 4DR7J 3PRBA 3GJSB 3UR3C 3E51A 2OELA 1BGXT 2E5IA 3IMQJ 4OYWA 2MZQA 1R6YA 2DVIA 1PJ7A 2Z2YB 2GGPB 2WSEC 3J7YU 1WEZA 1TK0A 2W24A 2GV1A 1FRXA 1XR6A 1WDDA 3EWGA 3KLGA 2FJAB 5KTQA 1CJTB 2CQBA 3D66A 5KFKA 3ZFVA 5C25B 2MQOA 3VAHA 4B3RJ 2V4RA 1RTIA 3KK3B 4DV6F 2W25A 4FXWA 2VG5A 4JI5F 1KVKA 3TWZA 5BR8J 4B08A 2KT2A 3R2CJ 2A2CA 1U1OA 1OSDA 4F67A 5L46A 2DNNA 3KLIB 2FHMA 2J6SA 2OEJA 4Q2MA 1SPBP 2AGQA 5CYQA 2YKQA 3GFYA 4CDIA 1U47A 2XB2D 3UQSA 2MSTA 3H2LA 2DGXA 4OJ1A 4PPZA 4EI2A 2HMIA 3AY0A 3MCSA 1R43A 5HN0A 3BO2A 3VZIA 2I0XA 2C2ZB 2DIUA 3PYFA 4ZJQA 4GO7X 2VFTA 2QSFA 2NPFA 3ENVA 2YWFA 3W8PA 1DRZA 2AJ4A 3ITHB 1X0PA 3TA2A 3UO0A 2JEIA 1HNVB 2A2DA 2Z56B 1IBMF 3E3XA 4QWDA 1NKCA 4AUKA 2LQBA 4DR5J 3A3PB 2IA0A 3FZ2A 5M2RA 4CIOA 4LRDA 2YNHA 3WBZA 4GMKA 4N77A 1TFWA 2AGOA 4FF4A 4AXIA 4Q44A 4ZLNA 5K14B 2EXUA 1VQLS 1D8ZA 5KG0A 5DDPC 2W9CA 1RA6A 5DM7Q 3V6JA 2KT3A 4KTQA 1JLGB 1G3OA 1S6UA 2ASYA 1I5OB 5CH7B 5IM0A 2E5LF 4LF4F 1OJ4A 3BGUA 3MF5A 4QQBA 3TVZA 2DGTA 1FERA 1S7IA 4Y34A 1BQMB 1HQEB 2ATCB 4DEZA 3H42A 5LXYA 2MYFA 4KFBB 4EZ9A 1JK9B 3A8EA 3HD2A 3U27A 4DG1B 3SZ2A 4MH8A 1FX2A 2N4CA 4ZN1A 3R1HA 1T8EA 1S0MA 4K4UA 2KL8A 3DLBA 4WIIA 2QE5A 4IUFA 2CQHA 3OXLA 5ADZA 1CJVB 5D4OA 4K4VA 3UI3A 5KFBA 4B9LA 2E1RA 1YJVA 1HLWA 4DG1A 2FHJA 3OHAA 2R8IA 3CULA 2C3UA 2HZAA 3BM7A 1H0HB 2HBZB 4C2MA 4EYIB 1FRLA 1RT5A 2Z8QA 3IS9B 2DRAA 4DU7A 4LF7J 4RNNA 4EBEA 1U49A 3BSNA 1FT8A 1NDLA 3V81A 2K3IA 4EWTA 4YUDA 3CD0A 2XMJA 4BC7A 1LNQA 5IS2A 2DH8A 3Q23A 3HZEA 4W90B 4F0HA 3POTB 2B9XA 2BJ9A 2GQQA 5B0BA 4NEYA 3CEDA 3MCNA 3PRDA 3HVRA 1D0EA 4FYXB 4OX9F 1CQNA 4ED4A 1W2BR 1TTHB 2YNHB 3PJXA 2HGNA 1MWQA 4QJVA 4GVBB 3QRPA 2EBEA 2W7AA 2O67A 4DFKA 3HVAA 4CLYA 4X66F 2HHSA 3QFWA 2DH7A 3Q2SC 2PO4A 4OHYA 2W2QP 3EICA 4BDPA 2ZH4A 4PABA 4X4RA 1YJTA 5KFUA 3D54A 2Q2GA 4HLBA 2K7JA 4XTTA 2FVSA 3K59A 3TO8A 3FJ2A 4PXCA 1TV6B 3M9NB 3DRSB 2BW2A 1R31A 2ZUGA 4WBFA 2IYGA 2E7XA 3UCZP 4KGKA 5KT7A 3PVXA 2E1CA 5L39A 4NLWA 2Q43A 3MHYA 5JXSA 5J2MB 2HIYA 4QYZJ 2WW8A 2DXEA 4U6PA 3WX8A 4OZJA 3OLBA 4I64A 1BQXA 3IBCB 2BJEA 1SC3B 3I5BA 3N0VA 2LP4A 3HHLC 1V3SA 3CGIA 4GC6A 2OI2A 4KV8A 3PEHA 5DJBA 2HQIA 1VC5A 1NB7A 4CZCA 1F5AA 3DRPB 1NZAA 1IKYA 3IXQA 1RB0A 1D9AA 1C1BA 1OPZA 4ICLA 1NZ8A 1SQGA 1KDNA 3KLHB 4DS4A 1S9FA 4OL8A 2ASJA 4DOZA 1UMJA 4PEOA 1F1BB 1TAQA 5KT3A 4DHVA 1I51B 2CJQA 3CCTA 3PFEA 4UZBA 5KFMA 4IR9A 3H5XA 4ED8A 3EE3A 1T3OA 1WD6A 4I6AA 1ZZNA 2CNNB 2QMXA 4G1IA 1J5OB 4E8UA 2WSFC 2AHOB 1FRMA 1URRA 4HYKA 1M1KT 3I38A 4USUA 1NU4A 2ZE2B 4WXOA 3CC2S 2MKKA 4MIAA 3H4BA 4M5NA 2HS0A 1Q5VA 2MGZA 4J9SA 1VHIA 1UJ4A 4WU2A 5ETQA 3DMJB 2OTLS 1RABB 3KK2A 1D3WA 1B7YB 4RWWA 5A6WA 1KD1T 1DBDA 1RAOA 4OYOA 5C2CA 1NHVA 3CO9A 3N01A 4QU7A 3DYAA 1FEHA 1VOMA 2GO8A 1ZZFA 2NXEA 4DPXA 4ANEA 1FWKA 1B3TA 2CG8A 4LFCF 5IV4A 1FF2A 3PO4A 3OUYA 3C6UB 4DCPB 2XMWA 2G4BA 1SKSA 1NKEA 4DX7A 3OTDA 2ZFHA 4BBYA 3Q22A 1N4LA 5EWFA 2MZRA 1TL4A 3O3LA 3D3BJ 1RAEB 1RBOB 2XMMA 4MKAA 3TAMA 3UD5A 3T41A 3ZC4A 4CNZA 4AL6A 4ZVEA 3M6XA 3DC2A 4IH7A 2HHTA 3NOCA 1TL1A 1RQ0A 1S57A 1C4CA 1FD8A 3O1LA 4DU8A 4EYHB 1U0SA 1F5BA 1NXIA 3W7BA 2HVDA 3NCPA 2GS8A 2GW8A 3GONA 1VI7A 2D7SA 3HHLB 3DM2B 1ZETA 1UVLA 5D3GB 2VJVA 3J7AN 2ZWPA 1B99A 4JI1F 3IWNC 4OYZA 4DQQA 2EKNA 4E0DA 5KFDA 4LREA 2FD2A 3U1MA 5HQMA 1YRXA 4KKOB 5HI7A 3CDWA 4K5SA 1FVQA 3AFGA 4B3TF 4C8KA 2IIHA 4A8SA 4ILRA 3BV8A 4JI3F 1DLOA 1SUQA 5BJRA 1B64A 4DSKA 1JNRB 1RGVA 4OHVA 5F8NA 1ELOA 3DRRA 2B3TB 1DFDA 4USIA 2ABYA 5B0CA 1SVDA 1FRIA 3JQMA 5F0UA 3L3CA 1I94J 5A2QY 4DPTA 3BO4A 3KK2B 1UVJA 3DMJA 3QZ7A 1EHWA 2QT7A 3PG9A 4HACB 3SQGB 4ZPCA 2VC1A 1NK9A 1FTCA 5JVGQ 1VJWA 3DOMA 3KLVA 2VU5A 4IFYB 2D69A 4LJMA 5KG6A 2AD9A 1CPZA 4OIXA 3IBWA 2WVCA 3OFGA 2R2TA 3BDPA 3AQOA 5KG7A 3SMZA 5FD1A 4WFXA 3BH7B 4MIWA 1N5TA 3M6VA 5K9FA 4CLLA 2QL7B 3VCDA 1J5OA 2OSQA 3BJYA 2ZBRA 2DNOA 3HULA 3M6WA 2ZJQQ 3BS9A 2P2CB 2QLWA 5CXTA 1BXNA 3LQVA 4LF1A 1IBLJ 4UF4A 3NEKA 2AYBA 4MFBB 2V67A 2PA3A 4EK2A 2AX0A 4N41A 2UXBF 2IRUA 2QMWA 1YHQS 1TK8A 1FD2A 1Y3JA 3CIZA 4QWBA 3BSOA 4R8UB 1U1RA 2CWKA 2GQ2A 2VFRA 3PYDA 4I4BA 3ZXWA 3BQ0A 2RH3A 4NLPA 3IA0A 1IR0A 3RW6A 4IRCA 2XS7A 2VPXB 2CKWA 4J80A 2H3EB 2MJNA 3HT0A 3OLAA 4TLRA 2L9NA 3EPGA 2WONB 4ECYA 2C2RA 3OSPA 3HK2A 5LOQA 2ZOGA 1Q4RA 2QC3A 3F0NA 1JWWA 1KWMA 3PDNA 4OV1A 3IO1A 3VQTA 1U6ZA 3RB0A 2PI5A 1CJUA 1JJHA 1ZAXA 4IH6A 4JI1J 3MEKA 4PWWA 3IAM9 1BC6A 3AB4B 2DHXA 1UA1A 4IOCQ 3W62A 4X62J 3BR8A 4TU8A 3MURP 4QR1A 3AGZA 2FVQA 1FNMA 2YX4A 4GKKF 4WTYA 1R3NA 2F40A 3NG8A 4OZ1A 2J7UA 1F6TA 2YX7A 1UWBB 3D6FB 3GYNA 4OYIA 4ZVUB 4WF9Q 3MMJA 4FF1A 3NP5A 5DDRC 1TMJA 3HJFA 4ZPTR 1NKBA 1KN6A 3UN2A 3HPOA 5FLXU 2RQ4A 2ROPA 2OTJS 4C8MA 3OSNA 1U6BA 2O01C 3KDNA 2PEBA 3L7PA 5CCLA 2ZOMA 2YNGB 3CT9A 3EX7B 3ELHA 2NUUG 2HMIB 3G9CA 1FRHA 1TL3A 3CCLS 5BR8F 2H1YA 4ZVTB 4DR6F 2DH9A 2JEGA 1WI6A 3KLIA 4AE5A 3TANA 4QIVA 2VQEF 4PRFA 1CC7A 3F41A 3Q8UA 2KM8C 2OSRA 2VG5B 4N56A 5HROA 4NPOA 2FB0A 2HS4A 3QT6A 4ZCLA 1RAAB 1R0AA 1NK7A 1DAXA 3ZZRA 1RT7A 2IDLA 3Q8RB 3G96A 1YTYA 1Q8IA 2VBWA 2ZH6A 2ZHBA 1A0OB 3T5KA 3TVKA 3CCZA 4J9RA 3J7Z5 1UJ5A 1Q8KA 1IQTA 2AYMA 3KYLA 3CCES 5DS7A 4B9VA 2Y8YA 2D9OA 4R8UA 4TQRA 2ZM6J 5LMNF 1TAUA 1X4FA 2C3MA 3ZZPA 3KHGA 3UD3P 3QPIA 2YKNA 3M4XA 3SFUA 2APOA 2IYIA 2NXNA 4OZ2A 2FIUA 4F0KA 5J2QA 1VBKA 3ZNUA 4K4ZA 5J2NA 1R7IA 4ZP8A 2R7OA 1R27B 4ELUA 1S59A 4LF6F 5B0AA 2QA4S 2DHHA 3BYRA 3D5MA 2KXNB 3DXBA 4WE1A 3MFIA 1XNQJ 4IO9Q 3GIMA 1RHMB 1TKTA 2NXCA 3N5FA 5C7PA 1Q95G 3DGVA 4DR2F 4DV0F 3QATA 4IFVB 5CAAA 3MPUB 1UAWA 2NS1B 2RB7A 4NLXA 3ZZTA 7AT1B 1N6QB 3Q86A 2VG6A 1RWVB 2BANA 4IFYA 2FZCB 1JLGA 2JC0A 1D9DA 1TUWA 1IKXA 4FXDA 3KK3A 1C0TA 2RMLA 2XWXA 1MG7A 2OMOA 1NO8A 4L3NA 4CH0S 3CCRS 3KOAA 2B9EA 4JI5J 1MU2B 5G0RA 1UW9A 3UDVA 3IRWP 2DITA 3AODA 4XAKA 4CM2A 4DSLA 2CZ4A 4X64J 3R7SB 5HVGA 5DLGA 1GTEA 4USWA 2IVMA 1DLOB 2RUSA 2UV8A 2BOAA 5L9NA 3VAMA 1VQ4S 4I6YA 3C14A 1HNWF 4UQGA 1CS4A 1VQOS 2H54B 2UP1A 2NXUA 2XSJB 2HHUA 4X4VA 5D77A 3QT5A 4RW7A 4F25A 5D3GA 3GWCA 1HI0P 4TXSA 4OLOA 2ZNYA 3KKFA 2I6WA 2B0GA 4Q45A 3B4DA 4KB7A 4ED5A 1A9NB 2CQ3A 1RACB 3PIPQ 1IBMJ 1S9EA 1YRUA 2XWYA 4A47A 4CO5A 3J81Y 1TL1B 1HBMA 2MSSA 4RNFA 3NMAA 2UXDF 3A4TA 2EFVA 2UUAJ 2BABA 2ZH7A 2FDNA 1U7LA 1VHFA 1YJ7A 2QA2A 5CYMA 3TOQA 5J2PB 1SQFA 3LPYA 5LL6d 1HW8A 3I0SA 4YEAA 2HZVA 4ED0A 2VDHA 3KJNB 3FC9A 5ETTA 4B3TJ 2UXCJ 5EX3A 2NREA 1Q82T 1BE4A 4H4MB 2F9JA 1TP7A 2HK3A 3MGJA 4TYBA 4LBHA 4CYUA 3W64A 3RB4A 1I1GA 2YQ0A 3A3NB 3RTVA 3Q8QB 3MM6B 1Q78A 2HLTA 4FYWB 1HNZJ 3WX4A 1ZYQA 3JQKA 2IM3A 3BGOP 4FPRA 4LF8F 1LWCA 2R8GA 2YNIB 1MROB 2E7VA 2HAFA 2QFIA 3B4MA 2V2QA 3MEGA 4B9TA 3TR5A 2CRLA 1Q16B 4ATNA 2ZBIA 5ETSA 4DUYF 3CWJA 2DR7A 1S6QB 2MGZB 2ZVSA 1Q79A 3EMTA 4IQMA 4DV5J 4P52A 2BQRA 2QSWA 1W26A 4DCOB 1HARA 5LSOA 5FDLB 2ZE2A 2AV5A 2RDJA 5KFTA 1QSLA 2GHPA 3AHPA 5U47A 3DCAA 4C98A 3T5HA 4AXJA 1U26A 1N34J 3M2UB 3KMQA 3BGRB 1IBLF 2Q6CA 2V9KA 5D78A 4M8LA 2HQCA 1BLUA 1DTTA 4JI4F 3GLJA 2A6OA 1N5YB 2AJQA 2B5JB 1VRQC 3N6LA 4AFFA 3LUYA 4K4WA 3RBEA 4DMZA 4NLGA 3C46A 4DN0A 2DNPA 1UEVA 4KAIA 2R2SA 4LF2A 3D6MB 3S01A 4UY85 1R8AA 4DQSA 2BE2B 4U9RA 2FTRA 5D0EA 5ETPA 1EETA 7FDRA 4YY3F 3DRPA 4ZP7A 5DG9A 2G0CA 2V4JB 2WZ1A 7FD1A 3CNQP 4V19X 4QWEA 4WP3A 3T6BA 2V6AA 4I0WA 4LF5J 2K06A 1Q8BA 3DOKA 2VICA 1KNZA 4LSLB 2CUYA 2MKJA 1WUUA 5G4DA 2NQPA 1PYOB 1GH8A 2RKIB 4H4KA 1QAJA 2PIIA 4LF9J 2OPRA 4USHA 1LV5A 4F0MA 1IWGA 3A3OB 3NBPA 2MZSA 2CPFA 3TX8A 5F8MA 3T1HJ 1RLCL 2PA8D 9ATCB 2OHDA 2JLGA 1H2UX 1DZ5A 1FXLA 1AA1B 2ACYA 3LOUA 2V69A 3LTOA 2IVFB 4LMZA 4NZ7A 1TV6A 2YNFB 2DNRA 2L41A 4WIQA 2HNDA 3C19A 4ELTA 1FCAA 4NZ0A 4C48A 2B56A 4C8YA 2CPDA 1D09B 1BHNA 2PSZA 5IT4A 4K0KJ 3ZO7A 3UVJB 3KJFB 4I1TA 3UCUP 3MEDB 1WOSA 1U2CA 4ZVPB 1Q1KA 4KHPF 1QUPA 3C6EC 2H65B 2J8AA 1IR1A 1LEOA 3GIRA 4X65J 5L1KA 1UW4A 2JRRA 3G6YA 4YP3A 5K20B 1SV5A 2JFDA 2K2PA 2B8QA 2YNFA 2JEJA 2HVIA 3UDLA 3R2DJ 4DV3J 5DQHA 1RADB 3FSIA 5AJ3F 4KO0B 3ZTPA 1Z2LA 2G2ZA 2R7WA 2Y1IA 2LQ5A 3QQCD 2UVRA 4EEYA 2VFVA 1PCAA 2ZJRQ 5KOWA 5GMEA 1ZH5A 3LH2S 1KQFB 4PWDA 1UPMB 1REGX 3IS9A 2HBYB 1E6YB 4OHWA 4RX6A 4R5PB 3FBFA 2XMUA 4M94A 1T9TA 4PQUA 2OJ3A 2XYGB 4I7FA 1H73A 2JJ4D 2HS3A 1U1QA 1RWXB 2VOOA 3M8PA 4AL5A 1HA1A 4K0KF 4NLDA 1SH0A 5ETNA 2CJ9A 4C0HA 2V63A 4M5HA 4P72A 1WF1A 1FE4A 2DNLA 2V4JA 4PG7A 1TVRB 2HIQA 1YSJA 3L7OA 4IG3A 2U1AA 1UJ6A 4J9MA 1IBKJ 3TUIC 4DN9A 2BJDA 2CPXA 2AIRB 4DV0J 4NA2A 1HYSB 1PYTA 2AJFE 3WDOA 2QEXS 3HT3A 4J5OA 1T94A 2DT9A 3KG4A 2E5GA 1BQMA 1HQEA 3MD1A 3FEXB 3OD2A 4Y3CA 1M90T 4P2SA 3TEHB 1NSPA 3B82A 4DUTA 2ZDPA 3DGPA 3NY0A 5IM0B 4I67A 4C0OC 4JV5F 3RZAA 1KEKA 1FKAF 2P8IA 2HG4A 3LALA 5I3QA 2VBZA 4PZVA 2AEFA 2RQMA 2HYIB 3SYZA 2YKAA 3M05A 4WPAA 3THPA 2RF2B 1S48A 1S6PB 3MMBB 3UDCA 2JVRA 2B4VA 2V0NA 5DGAA 2J0QD 3BSCA 2IC3B 4C97A 3CJTA 3NCRA 3BKFA 3AGYA 1RWMB 2EEYA 5CHCB 4H54A 5H9EJ 3AD7C 2OKQA 3M2RB 4NMLA 1VISA 1HWKA 1FRKA 1S1TB 3ITHA 3K5PA 4TQSA 1NJXA 3M1VB 5JJBA 2VHGA 2WOMA 2LU1A 3EGWB 3EZUA 2LMIA 3EXCX 1RHUB 1DTQA 4OZ3A 4DV5F 4DR1F 4P75A 3IP0A 2VG7A 2G2OA 2MPUA 4RUHA 1AFIA 3LP0B 4W92B 3QSYB 1LOUA 2MKIA 3FEYB 2CQDA 1X4AA 3BH6B 3LGMA 1HQ2A 3ZTQA 3M9OB 2JSXA 2FVPA 3HO1A 2FY1A 2CVIA 2DGOA 1FNOA 3D1OA 2BYCA 1ZTTA 3NGSA 3QGGA 4P2XA 5CYMB 1LQ9A 2KYXA 1P1TA 4YN3B 2EW9A 2J6TA 2HHQA 2C2MB 3G87A 1HBMB 1FX4A 5JUMA 5IXUA 1RWWB 2GA7A 3ADAC 2H51B 4H4KC 4ZMMA 3KLGB 3NNAA 1NJYA 5THWA 4K2JA 4ID8A 4NLVA 1CBKA 4RWXA 2HZCA 1RT2B 3GFHA 4ZPAA 4ZCIA 4NXNF 2W1BA 1LFWA 4RBVA 2MQPA 1YX2A 2F7VA 3M8QB 4ZVHA 1TKZA 3M6UA 3VQSA 2WOMB 4PG6A 4HDGA 5IC4B 2OPSA 5HBMB 4ECSA 4F7VA 3VVTA 3TUPA 2E66A 2R4FA 2XI2A 5BYQA 1RKIA 5I42B 1WJ9A 3K5NA 3MM7A 2IRYA 3HHDA 1W2IA 4QPTA 2XLIA 3DLLQ 3CJSA 1GK8A 2CPJA 3O8WA 2X7IA 3DOLA 1RISA 3QSIA 2IBOA 5T7LB 1FJGJ 5F9NA 3IGVA 3NS6A 4C8LA 1NB2A 1PBAA 1DJ0A 1FVSA 5ETKA 2M0GB 3M30B 1U1KA 4USJC 4DV1J 4HDHA 1JKHA 2JZ8A 3VALA 1NLTA 1N0UA 3G82A 2BANB 3RJMB 1Y00A 1T03B 3H4DA 2FVRA 5H9FJ 4LSNB 4ECUA 2DNKA 1VLYA 2EFGA 2N3LA 3PW5A 3JSRA 1Q8LA 4OI6A 2DPJA 1ACMB 2F8MA 2MEWA 2QLJB 3K5MA 1DY3A 4RR5A 3EGVA 3M32B 3PYGA 3VGSA 3I0RA 3OFHA 3KFWX 1FWPA 2W7OA 3GSIA 1ZA2B 1RI7A 2AF6A 4Q2LA 4K4SA 3GP9A 1S9GA 3BBFA 5HANA 4ZVQB 3EYZA 2LQ8A 3JAMY 4Z7YA 1UFWA 4BCAA 2DRBA 2R7UA 2E9ZA 2YWEA 4ZKAA 4C0BA 4JI2J 1U2RA 4NYOA 1HI1A 1WC0A 4ECZA 4N5SA 2CNOB 3FSYA 3T1HF 2DGSA 4LF6J 2XZDB 3OHBA 5KFLA 3MOJB 1T9YA 3FZBA 4TN2A 3S6EA 1MN7A 1RA7A 2I1RA 4KGVB 6FD1A 3WZ0A 4J90A 2IHR1 2BZ2A 1RBLA 2E29A 2HRTA 4N8NA 5A8RA 4X66J 1QVGR 1NMEB 2R8HA 4B9MA 2PMHA 4UOHA 2VODA 1T3NA 3HHKA 2HBQB 1IM4A 4ZLLA 2A1BA 2V8DA 3TZZA 1PIEA 4GRSA 5IC6B 5DLFA 2BEFA 5HSPA 2ZDOA 3M8RA 4TYAA 3UVJA 4KYZA 2VH7A 1WI8A 2XULA 2PMZD 3B8HA 3FCVA 2CJAA 3CO0P 4Y28C 5KFAA 4ECQA 5KFEA 3G8TA 1WG5A 2CJXB 5K8NA 3JAMU 1QUVA 1Y5IB 3KUEA 3N4WA 1WC6A 5DQIA 1HBOB 1RT3A 1S1UB 5AE2A 5KFPA 2BQUA 2YY3A 2XS5A 4IOAQ 2L48A 2U2FA 2WSCC 3G86A 1A7GE 3MOZA 1RAIB 4PXEA 3HI9A 3T19A 4A8XA 2KJVA 3QO9A 4NOHA 3CUNA 1KFSA 2UUAF 2B6AA 4UUXA 3OQ2A 1MW7A 2ZH3A 2AU0A 3TI0A 4M5DB 4X4PA 2F63A 4FBUA 2HRYA 2AWZA 2C3YA 3MZIA 3W2VB 3W9HA 1NLKL 2RAQA 2ZH8A 3FQKA 4UZCA 2IDEA 2KN4A 4QIWD 5E3QA 3UN5A 2PI4A 2EG2A 4X4TA 2CIMA 4WJBA 2FJXA 2XYHB 2X1FA 4BWMA 4X4UA 1JXVA 3R5AA 4OQJA 5GAEU 1BQNA 1U24A 2VC0A 1VCTA 2Y1LB 1YVFA 3G6XA 3EZ5A 4DV7J 4DL6A 1EETB 4U67Q 4DV4F 3PX4A 2KTQA 1HD1A 1AT1B 4NZ6A 5E3PA 3BQ1A 3N79A 2I5JA 1FKPB 4NI2B 4DCJB 6AT1B 4RNHA 5DM6Q 2ACMA 2ZITA 3OTOJ 1HPZB 1L3VA 3DLHA 1YG0A 1EIYB 4RW8A 3RBXA 1NDKA 3ZNJ1 3QIPB 3UR0A 1CG2A 3V6DB 1YJUA 2B5JA 2Z2MA 2NYHA 2RHSB 2RRAA 2G1DA 1N5YA 3JXOA 3FRYA 4OJGA 1C1CA 2LCWA 3V4IA 2IVYA 1NJIT 1XBWA 4CLPA 1Y7PA 4FXVA 1YLXA 3CJ2A 3CD5A 1GEHA 3NOGA 4LIWA 4I2PB 1GT8A 4N76A 3QYYA 5IT9U 1T0TV 3DDNA 2CYYA 4USTA 3K5OA 1VR6A 2KHDA 2W4DA 3G71S 4DR3F 1PILA 3MM8A 4HI1A 1Q86T 4F3MA 2B9YA 3DLGA 3GG0A 2CPYA 1RWPB 1H6KX 3HSGA 4M5JA 5IWAJ 1K9MT 2P9CA 3MEGB 1FFWB 5MAOA 1NH7A 1MROA 3FQLA 3H5SA 4NRUA 1LWCB 5LSRA 1PO6A 1U4BA 3HJVA 1NK5A 2W4CA 3DRXA 3VAFA 5KG1A 2RS2A 2H4WB 3G8SA 1YI2S 2DPIA 3P6YC 1ZPWX 1SUQB 4K4YA 3LZ8A 1VRUB 1O8BA 2IFXA 2OMLA 4LQ9A 1ZM3A 2LFVA 2BRKA 2JHEA 3DLKA 1CEZA 4KKOA 2GHWA 3ISNC 1OWXA 2YBVA 4M63A 2XC9A 3W63A 1E6VB 4HEA9 4C3MA 1P9YA 4A8KA 1VQMS 3ETMA 4ES3A 3K8VA 1WWHA 2HQDA 2KYZA 4CCHA 1JMTA 4Y0FA 1Z4UA 4ZVSB 3RYLA 1YK9A 3VAKA 4KIAA 1JLQB 2L9WA 1AW0A 2A3JA 3PJWA 3RRKA 2KM8B 1XWLA 2OFHX 3G8QA 3H8YA 3MXHP 4C8NA 2MQQA 4KRWA 1U45A 1L3TA 2ZH5A 2R3VA 1RYRA 4HKQA 1X4GA 4NXMJ 2DNZA 3QAEA 4ZITA 3GZ7A 3OTOF 3FFIA 5F41A 1VBZA 2YQ3A 3SDEB 2CXEA 5IZHA 3JSMB 4XDCA 4ZJOA 4CLWA 3VHQA 3J7YI 1UZHA 3C6UA 3GPAA 2ALZA 2M52A 1R8PA 4Q8FA 2MKYA 4PWDB 2UXCF 4R0JA 1B0TA 1HQUB 2K8GA 2BW7A 2DGQA 2OO4A 4DZ6A 4RU9A 1UEKA 3Q8SB 4HHHA 3KLFA 2UVUA 4NXNJ 2ZZNA 4WU3A 3B54A 3PM9A 4ZVFA 3C8YA 3CC7S 1MU2A 3PNIA 3QT8A 5G0RB 3W2WA 5I4MA 5I3UA 4IG0A 3R8YA 1F9FA 2ZC3A 5F8IA 2W9BB 5B0EA 2BDPA 4JB8B 3RW7A 4YY3J 4X4NA 5HLFB 4ETZA 2VPWB 3CJ3A 5IQ6A 4DF8A 1O6XA 1YBAA 2RHQB 1VIOA 2CQPA 2I38A 3GCWP 3MCOA 5DDOC 3MECA 2M8HA 1IKWA 4NLTA 2WVEA 1FK9A 1CVJA 3SCIE 4KGZB 3UPFA 2B4PA 2RNEA 4J9VA 1EP4B 1Q53A 2ZOFA 3TAQA 3KG0A 4LFCJ 4YS2A 3V2UC 3HFKA 4WFBQ 2X3DA 1HHSA 2KXHA 4ZPWR 2X3GA 2CFXA 2YKNB 3FBEA 2QYGA 1QE1B 4QR0A 2EC0A 1KS2A 3SSSA 3R6LB 2OLWA 2HPUA 4P7VA 3RR7A 3JYTB 2QLBB 3KTQA 1JLEB 3IM9A 1URNA 5A76A 3GSDA 2FLNA 2IA6A 5D0RA 5EN1A 1P6TA 1SIWB 1VMBA 1T9VA 3D9BA 4IKAA 1H72C 3H40A 4MKYA 5KG5A 4PXDA 3L4BC 1X4HA 4PG5A 5F3ZA 4DFPA 1LWFA 4NLQA 2BJ1A 1NK8A 1MNEA 2XSFA 3X3UA 3AAWB 4OJHA 5D4LA 2J0SD 1UWAA 1WEYA 1DQAA 2BE9B 5E7OB 3AJ1A 4YB6A 5LMUF 4J9LA 3W1YC 1HBUA 1RSCA 5KFHA 1FDBA 1GXUA 2QTWA 1KQGB 3DU6A 5E33A 2K1RB 3KDOA 5L8RC 1MMDA 1TU0B 1SJ4P 3NWRA 1HL6A 4QU6A 2J7KA 4LRFA 1PBUA 2B6AB 3MEEA 3NS7B 2F65A 4CH1A 2KRRA 4HH0A 5A0YA 3SIPB 2IJNA 3MAHA 2M7SA 4JYAJ 2B4OA 5KT4A 1C0UA 2I9SA 1YITS 2VONA 3R7NB 5CZVA 3Q8VA 3AKOB 5ETLA 5HP1B 4OJ3A 2GC8A 4DX5A 3UE2A 2NZ4A 2CZ9A 1PJ5A 2KI2A 2ZKUA 4OZ5A 3J7A1 5JMNA 1UWBA 1YZ7A 2AT1B 2P6SA 4OI4A 4K59A 1PJ6A 1WC4A 4NWBA 1WORA 1M1HA 1X4DA 2Z2ZA 3NNCA 5FJ4A 5IWAF 3A8IA 4QIFA 5GAEI 5C24A 1CJKB 2YTCA 1L5UA 4AT1B 1YBUA 5E3CA 2EKYA 2W8LA 2EBGA 4QYZK 2DK2A 1VQYA 1XTZA 3F56A 3AJ2A 2GJIA 2P5VA 4HTIA 4OYBA 3J7ZT 3V81B 3H25A 3GMGA 5F0WA 1ZOTA 2DHAA 3H2VE 3ILJA 4Y00A 5A8WB 2YWHA 3HM9A 2VD3A 5ETOA 1XMBA 1UVIA 4NCGB 1LW2B 5B09A 1WDTA 2OIHA 1LXNA 3LP2A 2JH3A 1F2HA 3GU0A 2OUGA 4WP8A 1CC8A 2AZ3A 4O3PA 3HHEA 4B17A 3NMRA 1QAYA 2HBRB 4Z2XA 2X1AA 4MFBA 3DRYA 1SJFA 1WC3A 1R8CA 1JIHA 2N7YA 3D1HA 2JVOA 1J27A 2C42A 3I0RB 5A2QU 1PYSB 3CCWA 3K8WA 2JFKA 1SIZA 5KG2A 1CQMA 1U6FA 3CCVS 3NWGA 4B3SF 4U8VA 1IBKF 3MTJA 1AFJA 4FF2A 3N6NA 1YRTA 4NCBA 4ZS6A 4A8FA 4GKJJ 4LSNA 3C5XC 4LBIA 1RHQB 1IJEB 3MECB 1HMVA 3CD7A 2HQ3A 4MAKA 2R8KA 4ED7A 1B0PA 5CD4A 3DOMB 3KLEB 3GIJA 1LK7A 1PGZA 1JKHB 2CNLB 1NPPA 1S1VB 2O5DA 2XG8A 1CSJA 2GX8A 4Y65A 2GIQA 1RCXB 1R89A 2P6TA 4HACA 3CCMS 5HLFA 3QJLA 2J9DA 1LWEB 2VQEJ 3E8OA 1NAQA 1VS3A 3DI6B 3MUTP 3CMAS 2BACA 2KG1A 1SCJB 3HLUA 4WP9A 2KZZA 3NGUA 2XMAA 2R42A 2RU3A 1H2VZ 1WHXA 2B51A 2J9EA 3V6HA 1DARA 1BMQB 3BO3A 2I2YA 1J5EJ 3C16B 4V19J 3OL9A 1FJCA 2GJ2A 1BUXA 1NRKA 3DLEB 3IRXB 2HWTA 4HT7A 5C2GA 2HQGA 1OSCA 2UV8G 5EWGA 2G0IA 2A10A 2VJUA 1APSA 2C1EB 1KHVA 1PG5B 4USKA 3M2VA 2GHVC 4UTGA 3PW4A 3SDEA 3FCWA 2YKMA 4NE9C 2MLXA 1RT2A 4NEZA 5GAGU 2J0WA 2MQLA 4UW2A 2DB1A 4RW4B 2JDJA 2MQ8A 5D15A 2W9AA 3R3TA 4P7TA 3UCGA 4X65F 5J1NA 1JLQA 3GG1A 3BGFA 1F9EB 3NNHA 3NGDA 4PAAA 2ZBPA 4MMOA 4U96A 1IQZA 2Z4PA 5E41A 1OYDA 4F36A 1D1UA 1E6VA 1NCLA 1WACA 4KR0B 4LVNP 3SFGA 4F8RA 1N33F 2DCUB 3N28A 3T1AA 1F2GA 1NPKA 1RU2A 1TKDA 3MD3A 3OUYB 3DLKB 4WTOB 1GMWA 1TKXA 4P2MA 5L1LA 4IRDA 5K8PA 2UVWA 3OFFA 2YH1A 3LP0A 5BYSA 3PX0A 1U48A 2UUBJ 2XLJA 1M1GA 2XZTB 4ZCKA 3KHHA 2AYGA 2QX0A 1EAYC 3VAGA 4ED6A 4LF5F 4J9NA 3HVWA 1M5KC 2ZVIA 3SCKE 1FJ7A 3FUYA 4I56A 1K47A 2MQMA 1H98A 4NA3A 3PHEA 3LGHA 2VFUA 2F8EX 2LDYA 1N48A 2V68A 3MM8B 3EXYA 1HIYA 1N52B 1XEZA 3EZOA 3MMBA 4I2QA 2KFZA 5KT6A 1LW0A 3RAXA 1UZDA 4QW8A 2QG9B 4DR6J 4FF3A 5E0OA 3EGNA 5KG3A 1YQHA 5HMZA 8ATCB 2DR9A 1K1SA 1KONA 1M5PC 4RLEA 4JI0J
chains in the Genus database with same CATH topology
2Q2GA 1GMUA 4J80A 3LA0A 3TJ8A 3TJAA 3AGXA 1EARA 1XAOA 2QLDA 3AGYA 2HFVA 3L9ZA 4L3KA 1NLTA 1GMWD 3AGZA 3I38A 3NXZA 1C3GA 3NY0A 3LZ8A 1GMVA 1EB0A 3TJ9A 2B26A 1GMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2G A;  1GMU A;  4J80 A;  3LA0 A;  3TJ8 A;  3TJA A;  3AGX A;  1EAR A;  1XAO A;  2QLD A;  3AGY A;  2HFV A;  3L9Z A;  4L3K A;  1NLT A;  1GMW D;  3AGZ A;  3I38 A;  3NXZ A;  1C3G A;  3NY0 A;  3LZ8 A;  1GMV A;  1EB0 A;  3TJ9 A;  2B26 A;  1GMW A; 
#chains in the Genus database with same CATH topology
 2KVI A;  4TKT A;  4ERD A;  3HKZ D;  3SXL A;  3V4I B;  1U1M A;  2HHH J;  5GAG I;  1N36 F;  2VDI A;  2QFJ A;  2B7C B;  3DGP B;  4WKR A;  1AZS B;  1JLC A;  4DR7 F;  1AUD A;  1RT6 A;  1DUR A;  2QIF A;  2D9P A;  1C2P A;  1GFW B;  3QGH A;  1H2T Z;  3GE9 A;  5F8J A;  1UPP A;  3D6H B;  3KUG A;  4ANC A;  2F4F A;  3HFV A;  1VJQ A;  4ICL B;  2I5J B;  4NI2 A;  2RRN A;  4ES2 A;  2Z58 B;  1GXL A;  2PDA A;  1IKY B;  4R25 A;  2CG4 A;  2ZBC A;  4RW9 A;  4IG3 B;  5IV3 A;  5GAD I;  2XCA A;  3V6K A;  3IGN A;  2KB2 A;  3IG1 A;  3OT9 A;  4KGM A;  4M5G A;  4GKJ F;  1GMW D;  1RHK B;  1Z1Z A;  2W2N P;  3KG1 A;  2KDO A;  4KV8 B;  4ECR A;  1VC6 A;  2R7Q A;  3BF4 A;  1NK0 A;  3OW2 R;  2B9W A;  1G7C B;  5LJ5 Y;  4KC5 A;  3PW7 A;  3CC4 S;  4I7F B;  3FKB A;  3R6G B;  4UT4 A;  2UVV A;  3W2V A;  1RUS A;  4WFZ A;  5AXM A;  2EK1 A;  3KJV B;  4QCL A;  4PQU B;  2Q3P A;  2JEF A;  5F3T A;  1I94 F;  2JLF A;  3CJ4 A;  3FRZ A;  4M5D A;  2LEP A;  4QOT A;  1YJR A;  2LEC A;  1XC9 A;  4G1P A;  2OH2 A;  2E7W A;  1ICE B;  1S99 A;  4KO0 A;  3ULH A;  2FC8 A;  3VF0 B;  5M2P A;  2E5J A;  4OFZ A;  4B3M J;  4DR4 F;  2ZZM A;  3R5J B;  4C3K A;  1RHJ B;  3J80 U;  4LT6 A;  3P5T L;  4YOE A;  2R7X A;  2E44 A;  3BRE A;  3GR0 A;  2UUC F;  1PAE X;  3JTO A;  1SB6 A;  3M8S A;  1S4E A;  1IKV A;  3MED A;  2OD4 A;  1DQ9 A;  2B4U A;  4R0E A;  3KHR A;  3MMC B;  1KRP A;  5HJY A;  3QGI A;  2RT3 A;  3FDS A;  3I56 S;  2MQN A;  1F60 B;  1KBR A;  2MHE A;  2OPQ A;  1SC1 B;  4JI7 J;  4O3Q A;  1AB8 A;  4FS1 A;  1MMN A;  3PV8 A;  1XR5 A;  2UZA A;  1FKO A;  2B8P A;  1VQ8 S;  2DR6 A;  3EVW A;  4JI0 F;  2GJF A;  3POT A;  2R7V A;  3ENA A;  3AT1 B;  3JTP A;  4G3I A;  3CIM A;  3CW2 C;  2ZWO A;  1B7F A;  1FEE A;  1JLA B;  2EI5 A;  2ZKT A;  3MPW A;  4G1Q B;  1XQI A;  2V2Z A;  4HT5 A;  3R5B A;  4J9K A;  2BM0 A;  4DSE A;  2WBM A;  4AD6 A;  1J5E F;  2J0X A;  1NK4 A;  1QSS A;  2VA2 A;  3DDI A;  3AOA A;  2RKI A;  3HVT B;  4PUO B;  1TMM A;  1W25 A;  2FHJ D;  4OI0 A;  1VQN S;  3DOK B;  3M9M B;  5EWE A;  3VZH A;  4A4J A;  3DLJ A;  3A8J A;  4ECV A;  4NMX A;  1SC6 A;  2AMC B;  5KFN A;  2HNY A;  3SI8 A;  4JBC A;  2HHV A;  4NAS A;  2COL A;  1JX4 A;  1XJW B;  3C66 A;  4IDK B;  1PKU A;  1GMU A;  3TZW A;  2XGQ A;  5K5M A;  4WYL A;  1RT6 B;  1K73 T;  2GCF A;  1KFD A;  2QL5 B;  3QLH B;  4WFY A;  4WFA Q;  3VR1 A;  2FZG B;  3KMS A;  4LF8 J;  1KVJ A;  2DIV A;  1XAO A;  1N54 B;  2QGF B;  5CYJ A;  5KT5 A;  4RW6 A;  1OO0 B;  3ILO A;  3ET6 B;  3LF0 A;  3BGR A;  2JNJ A;  5H1S V;  3HHN B;  3M30 A;  1S12 A;  2W9C B;  3FNN A;  4TVA B;  1JQG A;  5GMD A;  3OTC A;  5K14 A;  5BXI A;  3Q24 A;  4ECX A;  5HQ8 A;  3A13 A;  4ID5 A;  1RWK B;  2C3P A;  3AJD A;  3RAM A;  3DOL B;  3HFZ B;  4CT8 A;  2WTF A;  2EWH A;  4DUZ J;  4Q7A A;  3K5L A;  2J5A A;  3HX9 A;  4EFA C;  3T1Y J;  1TL5 A;  4FN5 A;  3MM7 B;  3IR6 B;  3KK1 B;  5I42 A;  5KFX A;  4NX9 A;  5DGB A;  3BBC A;  3PYE A;  3J80 Y;  2AJ1 A;  1H7W A;  3Q0A A;  1T05 B;  3ZTR A;  1ULR A;  3ZZU A;  3NCQ A;  2OPS B;  3H98 A;  5HBM A;  3W65 A;  3OJU A;  2XHC A;  1L3U A;  3WHI A;  2FLP A;  4JI4 J;  4LR7 A;  4PCQ A;  3OVA A;  3VTI A;  1TKZ B;  4Z37 A;  3M8Q A;  4CYU B;  2FGC A;  4E98 A;  1Q7L B;  3CXC R;  3W3S A;  4HL9 A;  1RT4 B;  3M8Z A;  3MPY A;  2BJ3 A;  2W2M P;  2PFF B;  3QT7 A;  2ZC4 A;  1O0P A;  1LKZ A;  3KXD A;  2KRB A;  3L09 A;  1SL2 A;  3G6E S;  1UVN A;  3L9Z A;  4OZ0 A;  4O4G A;  4DX8 H;  4KJI A;  2RDI A;  1S5Z A;  3VAJ A;  4A46 A;  5GMK a;  5BYR A;  2KKH A;  2A6M A;  2NR0 A;  1XR7 A;  5F8G A;  3C2P A;  5C25 A;  1VYA A;  1UFK A;  3MWB A;  4CQ1 A;  5KFZ A;  1FJG F;  2V2K A;  2OPP B;  1S9E B;  3Q89 A;  1RTJ B;  1GMV A;  4OZN A;  3PKM A;  3T9N A;  2R7S A;  4EMD A;  1UFL A;  5AT1 B;  2BVZ A;  2GGP A;  3ONQ A;  4RW4 A;  2QA4 G;  1T9X A;  3FGV A;  1HNW J;  2DR8 A;  5T14 A;  2Y0S D;  4YR2 A;  1K8A T;  3BDE A;  2VG7 B;  2HHX A;  2UU9 F;  2DNQ A;  3LA0 A;  4MT1 A;  2XO7 A;  3DN9 A;  1ZM4 A;  3EGZ A;  3D7S B;  4P74 A;  4RW7 B;  5ETR A;  4N47 A;  3UNG C;  3M1V A;  3M2V B;  2VPZ B;  2DEI A;  4K5R A;  2FHK A;  5K8M A;  1N32 J;  2QN6 B;  4ZPV R;  1CS4 B;  4P2F A;  3UN3 A;  1QD1 A;  3IRX A;  2RDD A;  2FQQ B;  3DLE A;  5DG8 A;  2BMB A;  1NH8 A;  2H48 B;  3C16 A;  3TEG A;  3CF5 Q;  2IM1 A;  4D3G A;  4F04 B;  4A8W A;  4DV6 J;  3C15 A;  2DJW A;  2K3K A;  2UXB J;  2EPI A;  1YJ9 S;  4ZHR A;  5HJX A;  4DFM A;  3CDB A;  2KJW A;  1BD6 A;  2YPY A;  1W7W A;  1YKW A;  3I5A A;  3N5B A;  3LP1 A;  4M5M A;  1X4C A;  1F5C A;  4CO3 A;  1C0T B;  1U8W A;  4C7Q A;  4FS2 A;  2QRR A;  3AB2 B;  1UL3 A;  1FXD A;  1VRT B;  3NAI A;  4J91 A;  5EGY A;  1YGY A;  3ET6 A;  5J1E A;  5FLX Y;  4DL2 A;  1KQS R;  2LU2 A;  4GKK J;  4ZCM A;  9RUB A;  4M95 A;  5F8H A;  2M8D B;  2VG6 B;  1EKR A;  3CJR A;  4RNO A;  1EQM A;  1HFE L;  3MPV A;  4LBP A;  3W9I A;  2WW4 A;  5CZX A;  5AJ3 J;  4OYA A;  2EFQ A;  3AD8 C;  2HFU A;  4IDK A;  3C15 B;  3GJT B;  5RUB A;  4J9Q A;  5HVH A;  5DDQ C;  1N34 F;  1HYS A;  4IOB A;  4XK8 C;  1U8S A;  2CAJ A;  3RU0 A;  2XNR A;  2EFP A;  3U1N A;  3ENQ A;  2F3J A;  2GZO A;  3TUZ C;  1K0V A;  3SSR A;  3OJS A;  3RRG A;  4UQT A;  4F02 A;  2I8E A;  4DV3 F;  3RB3 A;  4P71 A;  4TY8 A;  4O3N A;  2QA1 A;  2H5E A;  1HNI A;  1RAH B;  3UDE A;  3GIK A;  3P5B P;  4JV2 A;  1GQE A;  4WZQ A;  4ZDN A;  4AQY J;  5AE3 A;  4R5P A;  1MWZ A;  2G2Y A;  1TR0 A;  2W4P A;  3R5C A;  1RT1 A;  3CJ0 A;  1FFS B;  2RIL A;  4ITS A;  2YWK A;  4URS A;  2X1G A;  2D74 B;  3N9U C;  1OIA A;  1VQ7 S;  4NL5 A;  2DHS A;  3KWM A;  4QZV B;  1Q81 T;  1R0A B;  1HWI A;  4OX9 J;  5KFR A;  2XM3 A;  1X5T A;  1S1X A;  3TA1 A;  1SH2 A;  4YDD B;  1EAR A;  3CME S;  2G0J A;  1R0B G;  1Z2Z A;  4KT0 C;  4L73 A;  4OX7 A;  1UVK A;  2V5H G;  4J7C A;  5HRO B;  3DHX A;  3MAA B;  1GNK A;  1KKH A;  2R9L A;  4DV2 J;  5D4P A;  2HGM A;  2NUH A;  3AQP A;  3EDR B;  4MYU A;  4O4G B;  4LR9 A;  2AZ1 A;  2WB1 D;  1QY7 A;  4LF9 F;  2DO4 A;  3OXF A;  4RNM A;  2ADC A;  1RTD B;  4PYD A;  1TL7 B;  5D0G A;  5D0H A;  4JI6 J;  1Y9O A;  2VQF J;  2HFS A;  2H4Y B;  2P9G A;  4BC9 A;  4F26 A;  5GAH I;  1OY9 A;  3BKT A;  3MDF A;  2YNG A;  2B43 A;  2Y3Y A;  3QBC A;  4DSI A;  4CLU A;  2HSE B;  2VF3 A;  2WVF A;  1HI8 A;  3BB5 A;  1PSD A;  4XO0 A;  4AQY F;  1N56 A;  4ECW A;  4WFN Q;  3DFE A;  1REV B;  2HND B;  4N7T A;  2QO3 A;  3K58 A;  1T05 A;  4ZA1 A;  3I96 A;  4OYP A;  2F9D A;  5CQG A;  5A0Y B;  4F4K A;  4U7U D;  2LYV A;  4IRK A;  4J9O A;  3GB0 A;  1TUV A;  1UVM A;  2OEK A;  2M4M A;  4MIB A;  3OTE A;  4KHP J;  4CI0 B;  4XIU A;  2E5H A;  2FUG 9;  3P8B B;  4QR2 A;  4JI8 J;  2IM0 A;  3MM9 A;  3EDQ B;  2V94 A;  5I3P A;  3PAC A;  2L3M A;  4LSL A;  1U1N A;  4M5L A;  1IBC B;  3LPE A;  3O6Q A;  3RRH A;  3R9L A;  4DL3 A;  2HGL A;  2HRU A;  4UOF A;  1X9W A;  1T02 A;  2VL1 A;  4A8M P;  1CLF A;  1LXJ A;  3IG1 B;  2QMU B;  3GQC A;  1JJ2 R;  3D67 A;  4I6W A;  4GC7 A;  2VOP A;  3GIL A;  1JLE A;  2IAJ B;  2D41 A;  3WIV A;  3IM8 A;  2RRB A;  2GVD B;  3HF5 A;  3D0I E;  4NLR A;  5KFQ A;  1X5O A;  2CPE A;  2M9K A;  1N36 J;  1WG1 A;  3NGK A;  4U7C A;  4JYA F;  3THT A;  2WRM A;  2DRD A;  3DDK A;  4XPE A;  4ED3 A;  2LEA A;  1SKR A;  1ZS6 A;  1G4C A;  4URG A;  1S4F A;  1NDC A;  4DR3 J;  5KG4 A;  2BX6 A;  1VIX A;  2FPH X;  1HWL A;  4FKX A;  2J9C A;  5LMU J;  3QRQ A;  1V5V A;  1PC4 A;  5B0F A;  1WF0 A;  3H0P A;  4I2Q B;  5FDL A;  5C42 B;  1WOP A;  4OI3 A;  3QID A;  2NYI A;  3PFO A;  2ZEJ A;  2HWI A;  3NKY A;  1VQ9 S;  1GX6 A;  3KNG A;  4RUB A;  2BKP A;  3F73 A;  4DV7 F;  3SEO A;  3RGI A;  2CAD A;  3LAM A;  3VV2 B;  2ILZ A;  2FJD B;  2X51 A;  2EK6 A;  3SQG A;  4F4A A;  1NSK L;  2CWX A;  4U95 A;  3OVB A;  2VBX A;  2EFN A;  2VV5 A;  1Y4Z B;  4HHJ A;  3L95 X;  3VVU A;  5I3U B;  5E3R A;  4A8O A;  1NPR A;  2FZK B;  3F44 A;  3TJA A;  3MM6 A;  4USV A;  4DL0 C;  2SXL A;  5H9E K;  4JV1 A;  3KLF B;  3MMA B;  4PG8 A;  1UEU A;  1FDA A;  1F0X A;  1S1W A;  3TAR A;  2HFZ A;  3OR1 B;  3MMC A;  1PC5 A;  1RTD A;  3T3F A;  1FNX H;  4DQP A;  1RCO B;  4F2S A;  4YFU A;  3RR8 A;  3I0S B;  1K1Q A;  1RBA A;  3JSM A;  2V8P A;  2ZJP Q;  1KP6 A;  4EBD A;  4CT9 A;  3NXZ A;  3WC2 A;  1F9H A;  2AKW B;  3ENW A;  3NAH A;  2WVB A;  1R6V A;  4Q5V A;  4FYD A;  4ZVG A;  3K7R A;  3JS9 A;  1F3V A;  2PFD A;  3GCX P;  4AND A;  1WC5 A;  3GJQ B;  3M8W A;  4L76 A;  2QL9 B;  4KQZ A;  2FJV A;  2MLY A;  1V6H A;  4Q43 A;  3BZQ A;  3KJV A;  2VA3 A;  4EGL A;  4RO0 A;  2RQK A;  3TAM B;  4UUW A;  1X0F A;  3VGU A;  1HNI B;  3MAQ A;  3G2X A;  4DSJ A;  1MML A;  4XDD A;  1U1L A;  4KH0 B;  4C9D A;  1WSR A;  2MY8 A;  1P27 B;  3TNV A;  1Y3K A;  1WTB A;  2RE1 A;  2Z57 B;  3C14 B;  2QJ3 A;  3HSD A;  2GVZ B;  2R2R A;  2XY6 A;  1YIJ S;  2E1A A;  3B78 A;  2XNQ A;  1XMO F;  2W2P P;  3R1L A;  3OR2 A;  3A12 A;  1SL0 A;  2D3Z A;  4DPO A;  4B3O A;  1WHW A;  4L6V 3;  4P6Q A;  4P73 A;  5EX0 A;  5HAT A;  2XLK A;  4F4Z A;  4PG4 A;  2DNH A;  2MJU A;  4N8O A;  2GAG C;  1AXQ A;  2DBB A;  1AZS A;  1JLC B;  1SI9 A;  1H74 A;  1WF2 A;  3CSK A;  2WCX A;  1Y11 A;  3IAS 9;  1VC0 A;  1D9F A;  4DJB A;  1U0H B;  2IRX A;  2YVS A;  4DV2 F;  2O1P A;  1XER A;  2V2V A;  1WHY A;  3DLG B;  3LGN A;  2XHW A;  4C8O A;  2VBY A;  5IQQ A;  2C2K B;  1TUG B;  4C11 A;  5J1E B;  2N7C A;  5IT9 Y;  1QTN B;  3Q8P B;  3MUM P;  4RU2 A;  1SJR A;  4JP8 A;  5B0D A;  2C22 A;  3L7U A;  2ZM6 F;  1FXR A;  1T11 A;  4ZHR B;  5KOX A;  4LR8 A;  1TKT B;  2CQI A;  3FCH A;  2HQF A;  2KO1 A;  2LVW A;  4MYT A;  2A18 A;  4WE1 B;  4ZJL A;  3UWT A;  4F50 A;  1Q7Y T;  1FHT A;  2BV3 A;  2YQ1 A;  2YKP A;  5F8L A;  5J2N B;  4RKU C;  5ETM A;  5HMX A;  1XN9 A;  3MR6 A;  1YBT A;  2HHH F;  2MHN A;  3PRV A;  2WBR A;  1ZA1 B;  1NUE A;  3UD4 P;  3T1Y F;  1NSA A;  3HXM A;  2DGV A;  4MKB A;  1VK8 A;  2V50 A;  1SBR A;  1S7H A;  1C1B B;  1AUS L;  1SC4 B;  4NCG A;  2XYP B;  4OV6 A;  3UNY A;  1FDD A;  2WB4 A;  3HP6 A;  2CA9 A;  4DLE A;  1RDR A;  3X1L B;  5A8W A;  1TKX B;  2G9O A;  2VKZ G;  2AJ0 A;  1IM6 A;  3IFE A;  1LWX A;  5E2Q A;  3ZTO A;  4CP5 A;  1RT7 B;  2DXD A;  1RTJ A;  3T6J A;  1JJC B;  4YME A;  1TFY A;  2ADB A;  2GQC A;  1C4A A;  4YR0 A;  5C24 B;  3WQP A;  2HEK A;  1AYE A;  5HAO A;  4NLU A;  3OL8 A;  4C3L A;  1MSW D;  2AP6 A;  2ILY A;  4DXL A;  2NXJ A;  1Q0N A;  2VQF F;  1PAU B;  2UUW A;  3D68 A;  3H20 A;  3WC0 A;  3FEZ A;  3BEG B;  3O5T B;  4TU9 A;  3LWL A;  5J2M A;  1TL3 B;  1HBN A;  4YB7 A;  2CJK A;  2KHC A;  2V9W A;  4F3Q A;  1N5V A;  3DRS A;  2AQ4 A;  3LWM A;  2YKM B;  1ITP A;  3THV A;  1R0C B;  2LXU A;  1KLM A;  1B70 B;  1HBO A;  2EFO A;  1RHR B;  1RT3 B;  1S1U A;  3A8K A;  4HR2 A;  2JL9 A;  2B26 A;  4K4X A;  4F2R A;  3PX6 A;  1C0U B;  1RWO B;  2F8H A;  8RUC A;  3PKY A;  4ENO A;  1JXE A;  4KBI A;  5HL7 Q;  2OFG X;  3DHW C;  4AL7 A;  3AA9 A;  2RJZ A;  3QFH A;  3H90 A;  4W4M A;  4F4Y A;  1X4B A;  3MEE B;  2LA4 A;  2RQC A;  5D4N A;  2IY5 B;  3UFC X;  1SL1 A;  1UP1 A;  4GVB A;  4O3R A;  4ZPD A;  1NND A;  1IJF B;  3AD9 C;  4YHH J;  3CB4 A;  2FJW A;  1HBU B;  1L3K A;  1Q5Y A;  1QAI A;  2FLL A;  1EX8 A;  4DR5 F;  2GMH A;  4ID5 B;  1ARO P;  2ZUA A;  3T5J A;  2KH9 A;  1QJH A;  1R8H A;  1CJU B;  3VGV A;  1WEX A;  4TLQ A;  1YJN S;  3TW0 A;  1RKJ A;  5C5J A;  4IR1 A;  3HHL D;  2BJ7 A;  3MM5 A;  3PR4 A;  4LQ3 A;  2F1F A;  4RW6 B;  1NSQ A;  4KHM A;  2WON A;  1EJ7 L;  5LJ3 Y;  4DSF A;  2C28 A;  1HMV B;  4DBQ A;  1I3O B;  3OTB A;  4DLG A;  2WAQ D;  4ZIW A;  1RT5 B;  3D28 A;  2ZHA A;  5KFW A;  2HHP A;  2DY1 A;  2HK2 A;  1K44 A;  1WC1 A;  2GMJ A;  4G65 A;  3BPD A;  3ICL A;  4O44 B;  1RWU A;  3WIU A;  2XO6 A;  4DF4 A;  2L9D A;  2V8G A;  5EDW A;  2CVE A;  2FY8 A;  2V8V A;  4JV0 A;  1VQP S;  2HNY B;  2OAU A;  1CJV A;  5T41 A;  5SZT A;  2XTJ P;  2ZD1 B;  3K57 A;  4WK3 A;  4RUA A;  1QDU B;  2JOQ A;  1XNR F;  5GAH U;  4ZLJ A;  1VLO A;  3M32 A;  2HVH A;  1MWY A;  2P9E A;  1NJW A;  2G13 A;  3LP2 B;  4FVC A;  5E5N A;  2HFV A;  1LW2 A;  2IMO A;  2RVJ A;  4J37 A;  3HVT A;  2HLU A;  4NA1 A;  4OYX A;  4CTA A;  4QPX A;  3PZP A;  5KFS A;  2M2B A;  4PUO A;  1IVZ A;  1R8B A;  3FBC A;  1IKW B;  3W60 A;  5AXN A;  1OMS A;  1JXL A;  2GIR A;  3NLC A;  1JLA A;  2AJ2 A;  5L1I A;  3US5 A;  1RYS A;  1BY9 A;  4B9U A;  2IPO B;  1EB0 A;  3CMQ A;  3OVS A;  2PEH A;  3P96 A;  1YWX A;  2R2U A;  5KFI A;  4ZK7 M;  4QWA A;  4YB1 P;  4CH7 A;  2N3O A;  3EJM A;  2DO0 A;  4UOG A;  1FKO B;  4EO8 A;  2RUG A;  5CCM A;  3TQE A;  3SV3 A;  5DRK A;  5IT0 A;  3TZX A;  5CD4 H;  2R8J A;  5KFG A;  4LRB A;  4OI1 A;  2OPQ B;  2QLX A;  2V8H A;  2ODX A;  1HQU A;  2KVQ E;  3D0H E;  4ZP9 A;  4EO6 A;  1RJJ A;  1JLF A;  4IYQ A;  5DG7 A;  4A8Q A;  3H59 A;  3CD6 S;  3I82 A;  5HP1 A;  4MTP A;  1X9M A;  4OHZ A;  2LDI A;  3H5Y A;  2B7B B;  3GV7 B;  3HCX A;  2LQ9 A;  3GV5 B;  2BJ8 A;  3FFI B;  1ZAV A;  4JOU A;  2C2D A;  1HNX J;  3DM2 A;  3AOC A;  2BUN A;  2H5J B;  3AXK A;  3HHL A;  3JTN A;  3ZTS A;  4O3S A;  2HNZ B;  4NCA A;  1XK8 A;  2EG1 A;  2C2N A;  2FJB B;  2K1R A;  3PJ9 A;  3CCU S;  4NLO A;  3TRG A;  2VPY B;  4KH1 B;  1JJ4 A;  2DHG A;  5IFM A;  3BPS P;  3ZZZ A;  2XI3 A;  2N4D A;  4X64 F;  1RTI B;  1SKU B;  1KHW A;  4Z7C A;  2DNM A;  1NJZ A;  1LWF B;  1NHU A;  1S0N A;  1HR0 J;  4QWC A;  3MFH A;  1GXT A;  3EVM A;  1OY8 A;  3CJ5 A;  1NHK L;  3N6M A;  1TK5 A;  3ZZ0 A;  2XS2 A;  4PXB A;  4RW9 B;  3P4U B;  3JYT A;  3RUB L;  1XMQ F;  1VBY A;  4DL4 A;  1OYE A;  4O0N A;  4X4O A;  2EC2 A;  2C2O B;  3I4H X;  3SQO P;  3OFE A;  3M2R A;  4QW9 A;  2IJR A;  2CZV C;  2RU9 A;  2ASL A;  2XCP A;  1G1X A;  1G2E A;  1O5J A;  1U25 A;  1V3Z A;  2VB6 A;  1XMO J;  3C3L A;  2LLZ A;  3SCJ E;  1HKA A;  3TJ8 A;  3U02 A;  1KQK A;  2AYE A;  2XMT A;  3HKW A;  1S6P A;  4JUZ A;  3W61 A;  3PTW A;  3LW5 C;  2HHW A;  3AH6 A;  5K8O A;  1HR0 F;  1QTM A;  4K50 A;  2NLW A;  3I5C A;  2BRL A;  2JVM A;  1RTH A;  2FC9 A;  4RJV A;  4A48 A;  1L3S A;  4J9P A;  1U0H A;  1FE0 A;  3CCJ S;  1U1P A;  2VFS A;  1WNE A;  4I68 A;  2Y9H A;  1GTH A;  1SJQ A;  4F3O A;  1UA0 A;  2DR5 A;  5D8H B;  4Y2K A;  4RW8 B;  3W2W B;  1FI4 A;  4DR1 J;  2E5L J;  4LF4 J;  3KLH A;  3A1Y G;  2QZ8 A;  4A8Y A;  1KVI A;  1RAJ A;  2Y1R I;  1FKP A;  2CNK B;  3OR2 B;  1ZPV A;  2LQJ A;  2VUG A;  4DQR A;  2Q79 A;  3TA0 A;  1OQ6 A;  3ETO A;  5KFY A;  2BA9 A;  1BQN B;  4LIR A;  5B08 A;  2X1B A;  5A6P A;  4PKD B;  3QGP A;  2MDA A;  4AYB D;  3QWP A;  5DO2 A;  4EU0 A;  2J8S A;  1LK5 A;  1RE1 B;  3I87 A;  4WKY A;  4E2F B;  4O23 A;  3PW0 A;  4C4W A;  2QLD A;  4OMF G;  1T95 A;  1VQK S;  3QWU A;  2Q6B A;  4B3M F;  2Z30 B;  4CM0 A;  3H5U A;  4ZLP A;  3G4S S;  4V1A k;  4DR4 J;  4LFA J;  2CQ0 A;  1FO1 A;  5LMN J;  2UUC J;  2HNZ A;  2XEX A;  2J6U A;  2YWW A;  1HWU A;  4C6A A;  1KSP A;  5AE1 A;  3QJJ A;  3CDU A;  1X4E A;  4P10 A;  1OPI A;  1RP5 A;  4FKY A;  1B4S A;  1FJE B;  1SJ1 A;  1GX5 A;  1O51 A;  4ECT A;  1UTA A;  2IMW P;  1S79 A;  1RU1 A;  3R5D A;  2MTL A;  2XY7 A;  1VBX A;  4NXM F;  4RZR A;  4HTJ A;  1JLF B;  1U09 A;  2CJY B;  4K2X A;  2JX2 A;  2D3O R;  5KFC A;  4PWU A;  1VRU A;  1S1W B;  4NLS A;  3SCL E;  1UET A;  3JQJ A;  3MMA A;  3U7J A;  4Y6I A;  3JB9 k;  4DQI A;  3W9J A;  2HVE A;  3CJK A;  4KGX B;  5L9X A;  4CNY A;  2Y8W A;  2W8K A;  4O4R A;  1OQ3 A;  1P9Q C;  2LA6 A;  3DI6 A;  3HDS A;  2FGO A;  2OEM A;  2ROG A;  2OD6 A;  3D0G E;  4FDF A;  1LWE A;  4M5I A;  4DL5 A;  3SV4 A;  2YPZ A;  3QNW B;  4CWB A;  3GYG A;  4O3O A;  2DEJ A;  1NDP A;  2MKC A;  1S1V A;  4FYY B;  1FRJ A;  3RG6 A;  3KLE A;  5B0G A;  3OV7 A;  2ZBQ A;  3P45 B;  3NBP B;  1HHQ A;  2JC1 A;  1SH3 A;  2KU7 A;  3FVY A;  3NS5 A;  2CQ1 A;  1P1L A;  5C42 A;  1DQ8 A;  3GR1 A;  4I2P A;  2KFN A;  4CTA B;  1WTF A;  3Q8Y A;  3VAI A;  4BWJ A;  5SUH A;  1T7P A;  2K7K A;  1N8R T;  2YKO A;  3KJQ B;  2ZH2 A;  8AT1 B;  4U7U K;  3DU5 A;  1C1C B;  2IBK A;  2HFO A;  3DNC A;  4X62 F;  3VWS A;  4ILL A;  2XQC A;  2FYX A;  3V6D A;  2R7T A;  4NLY A;  2ZD1 A;  3IWX A;  3QIP A;  3NRB A;  5J2Q B;  2MY7 A;  1H38 A;  1IWA A;  2PE8 A;  1Y5N B;  3NGR A;  3D2W A;  2GVD A;  2BKO A;  3EPI A;  4KFB A;  3KNA A;  4O44 A;  4FZV A;  5DQG A;  1NEE A;  3V5R A;  2FHO B;  4X2B A;  1NBE B;  2G1H A;  1X8D A;  1VQS A;  4DV1 F;  1S97 A;  4OZL A;  3BQ2 A;  1LFP A;  4YB5 A;  1S76 D;  2E1M C;  2BQ3 A;  3G82 B;  1T03 A;  3OL6 A;  4CO4 A;  4DPU A;  1NM2 A;  2VAS A;  4DI6 A;  3MM5 B;  3M2U A;  1CJK A;  4ZP6 A;  3TJ9 A;  4OI2 A;  2GFF A;  2Z2L A;  4ES1 A;  3MM9 B;  3W66 A;  4EZ6 A;  5HQL A;  1X5P A;  1H3D A;  5DZ6 A;  3EVO A;  4DR2 J;  3I6P A;  3CDE A;  2GNK A;  2CQ2 A;  3CCQ S;  3O2I A;  1S6Q A;  4B3R F;  3AGX A;  1JLB A;  2AGP A;  2QV6 A;  4YDX A;  4CLF A;  3MPD A;  3QO9 B;  1S77 D;  4DZD A;  1HNV A;  1VDH A;  3P49 B;  1ZM2 A;  1T9W A;  4LFB F;  5LM7 E;  2ERR A;  1REV A;  2JRS A;  2J7W A;  2HKE A;  4ALZ A;  1FA0 A;  1RK8 A;  2V34 A;  1KLM B;  3CDA A;  2FLO A;  4LRA A;  5AXL A;  2LXF A;  1U2F A;  3K89 A;  3RBZ A;  3W8G A;  3NL0 A;  3ISN D;  1GAO A;  3DKD A;  4M1K A;  1FFG B;  4ZN3 A;  4P9S A;  2OP5 A;  5FII A;  1HBN B;  1JNZ B;  3PO5 A;  1TL7 A;  2DNY A;  3MR2 A;  4ETX A;  5CYQ B;  1RLD A;  4ZPB A;  4M5K A;  3FBB A;  2BBE A;  3MAA A;  4DUZ F;  1RZM A;  3I55 S;  5J2P A;  5A8R B;  2C2E A;  5HMW A;  3CVK A;  3EM1 A;  2BR0 A;  5M2U A;  1X9S A;  2OGU A;  3ZZY A;  1S1X B;  4EUV A;  5B7W A;  1CJT A;  1S10 A;  3PR5 B;  1KLN A;  4KY3 A;  2BXJ A;  2W01 A;  3I4P A;  4KSE B;  1VGY A;  1X5S A;  2LKZ A;  5LT5 A;  5LXR A;  5KFF A;  4H4O A;  2HUR A;  2IM2 A;  3LAK A;  3QMQ A;  2VKR A;  4EBC A;  1QLN A;  1DTQ B;  4J9U E;  1WSV A;  4DFJ A;  4GO5 X;  4JI7 F;  1S49 A;  3JSY A;  4NRT A;  2H9Z A;  1EKS A;  3CE8 A;  1QE1 A;  1IR2 A;  3C6T A;  1S1T A;  4Y2C A;  4JI2 F;  3MI7 X;  3P3D A;  3E01 A;  4MK7 A;  1M5S A;  4DL7 A;  4ILM A;  4YR3 A;  1IXK A;  1BWE A;  4ER8 A;  4IQX A;  1EP4 A;  1S0V A;  4KPC A;  2AEM A;  3Q2T C;  4O0I A;  1XNR J;  2JWN A;  1FK9 B;  1BWV A;  1X60 A;  2CQG A;  1S72 S;  3R5G A;  1MLA A;  2BOP A;  3UW1 A;  2XY5 A;  4C11 B;  3LAN A;  4X4S A;  2ZH1 A;  1IKX B;  2DCL A;  1SJ3 P;  1VQ5 S;  1VRT A;  3BBB A;  4D3H A;  2UU9 J;  4KHR A;  3W5Z A;  1N6Q A;  3K2Y A;  2Z0G A;  2XBP A;  1N0V C;  2XMK A;  3PEJ A;  2W9B A;  4IG0 B;  1KC8 T;  5T7L A;  2GML A;  5KT2 A;  1N88 A;  2V4Q A;  2UXD J;  5HMY A;  1WEL A;  1X31 C;  4NYZ A;  3ZZO A;  4CO2 A;  3MR3 A;  3CCS S;  4B3O B;  2L08 A;  1WHV A;  3PY8 A;  3W5X A;  1M5H A;  2QYC A;  2LEB A;  3D3C J;  1ROF A;  4OHX A;  1T9U A;  1Y10 A;  3CPW R;  2GO9 A;  1YDL A;  2GVZ A;  2J9D E;  1IUJ A;  2RIJ A;  3E01 B;  2MZJ A;  3SSQ A;  5DET A;  3IN5 A;  1ZTW A;  1WOO A;  4OX8 A;  3IR7 B;  2LXI A;  3R27 A;  1KTV A;  2PT0 A;  4W98 A;  3J81 U;  4DPW A;  2NCK L;  3BN7 A;  3M8P B;  4WCE Q;  2DKO B;  2F4V J;  4L75 A;  4G6V B;  1E6Y A;  1HNZ F;  1QAX A;  5A8K A;  1SKW A;  2MZT A;  1WKJ A;  2EVZ A;  3LO3 A;  4H4O B;  1EZZ B;  4IH5 A;  1MN9 A;  4B3S J;  5L38 A;  2OPP A;  4USM A;  2KXF A;  3H2U B;  4L72 B;  3FSX A;  3TZY A;  2CJB A;  1H7X A;  2KFY A;  6FDR A;  2DGU A;  2MKH A;  1SV5 B;  1C3G A;  2W7P A;  4ED1 A;  2M88 A;  3GYX B;  2PN6 A;  4Q8E A;  4BLG A;  4QIE A;  1KOO A;  1HWJ A;  4S0M A;  1V9O A;  3AXM A;  2J76 E;  4HH1 A;  5ITH A;  1UKU A;  2GAH C;  2MLZ A;  3O44 A;  3MUV P;  4JI3 J;  4DWI A;  2POK A;  3GJR B;  3OR1 A;  4F4X A;  1RT4 A;  3QRR A;  4WYW A;  1N33 J;  1WKL A;  3HD1 A;  2F4V F;  1A6L A;  3HSJ A;  1I6J A;  4CRJ A;  2Q1L A;  2PMW A;  4RUC A;  5EUH A;  3IWL A;  2D3O 1;  1S6O A;  4PPD A;  3HZG A;  3S8S A;  1M5V C;  1XNQ F;  3OXG A;  2HVZ A;  3BSA A;  5AXK A;  4LVO P;  2E9T A;  4FYV B;  1ZBT A;  2PGC A;  1N5S A;  3FMW A;  2MB0 B;  3BR9 A;  2DIS A;  2JLE A;  1SQE A;  3D4J A;  2FJE B;  4GVL A;  4K8R A;  4ZOS A;  3TUJ C;  4WWS A;  2W2O P;  1S0O A;  3KK1 A;  1JLB B;  4URQ U;  3AA8 A;  2MMY A;  5LSL A;  1D8Y A;  2DTJ A;  3H7H B;  1KR4 A;  3I31 A;  2IC3 A;  2DYA A;  2RS8 A;  3DXS X;  4I69 A;  1HHT P;  3HMJ G;  2OPR B;  2RF2 A;  3W5Y A;  4YHH F;  4IO1 A;  2F5G A;  4JV5 J;  2NZC A;  5H9F K;  1RAG B;  4B9N A;  2CQ4 A;  5KAK A;  4LUB A;  1CUL A;  3JSB A;  2M3D A;  4OYM A;  3PXG a;  3QZ8 A;  3MR5 A;  3MTK A;  4CLZ A;  4YQW A;  2JZ5 A;  1RAF B;  3S1T A;  5F9L A;  2NPI A;  3QLH A;  3IR5 B;  1UCN A;  3IC1 A;  1XIQ A;  3BYP A;  4LSZ B;  3BKU A;  1HPZ A;  4DDF A;  2CPH A;  4Q0B B;  2ZZT A;  4Q0B A;  1FES A;  2D1C A;  1FWL A;  2IAJ A;  4X84 A;  1OS5 A;  4RBU A;  2XGP A;  5GVQ A;  1TVR A;  4HVZ A;  4DUY J;  2H5I B;  2AX1 A;  2UUB F;  3IBF B;  4LF7 F;  2HW3 A;  1NK6 A;  3G6V A;  3ILL A;  3FK4 A;  2DNG A;  2QLF B;  3OPK A;  1DTT B;  2RD5 C;  2XMV A;  3KUH A;  4L74 A;  4MK9 A;  5CAB A;  1F3F A;  2CDR B;  1SXL A;  4FVM A;  1CUL B;  3TVY A;  1ZAW A;  2ATL A;  3BN4 A;  3I9Z A;  2E9R X;  4FNI A;  2KZM A;  2O66 A;  5KFO A;  3TX0 A;  2ALY B;  3NGT A;  2E1P A;  2ROE A;  2DD8 S;  2GIF A;  4HHU A;  4UOC A;  4F4W A;  3RB6 A;  3M8Y A;  1Y0H A;  2YX1 A;  4B9S A;  1K0T A;  4G1Q A;  4K4T A;  4BS2 A;  1WKK A;  1RWN B;  1TQL A;  2O3D A;  3SBM A;  2KG0 A;  3MR7 A;  3TAP A;  3J81 j;  5IOL A;  3BGL A;  1VFJ A;  1V3R A;  1VK3 A;  4FNH A;  3ISZ A;  4UY8 T;  2CPI A;  2VIH A;  2Y1J A;  2R7R A;  4MKV A;  2WVD A;  4WZM A;  2WHO A;  2A0F B;  4RL1 A;  4LFA F;  2HAI A;  3D6T B;  1X7V A;  3RAQ A;  2AW0 A;  1Y5L B;  4PR6 A;  3DRR B;  1G6B A;  2D3U A;  1P8G A;  3CJK B;  4QBU A;  5HVF A;  2HWH A;  5E3A A;  4ZIV A;  4ED2 A;  4WXW A;  3TQ1 A;  1JB0 C;  1HW9 A;  3T5L A;  4PQA A;  4WK1 A;  4ZVR B;  1QM9 A;  2MZ1 A;  3M7V A;  1V5I B;  2MXY A;  4H4M A;  2BM1 A;  4BHQ A;  1EQ0 A;  2XZW A;  1IKV B;  2YH0 A;  1HD0 A;  2YWG A;  2VZ9 A;  3K0J A;  4DV4 J;  1OY6 A;  3S7R A;  2FVC A;  4JI8 F;  4FP9 A;  4QIG A;  2KT5 A;  3PHT A;  3EUN A;  4MK8 A;  1N5Q A;  3QJP A;  1YZ6 A;  2NSB A;  1J2V A;  2CDQ A;  2M70 A;  3I9V 9;  3VGT A;  5JVH Q;  1HNX F;  2AEJ A;  3U1L A;  5L1J A;  4CLK A;  4OX6 A;  2PC6 A;  4DPY A;  1WG4 A;  2PD1 A;  5J1P A;  4ELV A;  3TP2 A;  2HFN A;  2CQC A;  3QAU A;  2WK4 A;  1FDN A;  4Y2I A;  3OBI A;  1RT1 B;  4MJK A;  5A8K B;  5D6G A;  3RBD A;  4LFB J;  1FTR A;  4L3K A;  2DY9 A;  1QVF R;  4TY8 B;  4TNO A;  3R7B B;  2DGW A;  4TU7 A;  3D1Q A;  4OLP A;  3T9Z A;  4RBT A;  1S9G B;  3CTR A;  5GAD U;  2XSJ A;  2ASD A;  4CLT A;  3CJ8 A;  4CO0 A;  4X4Q A;  3ILI A;  2IJF A;  5EHH A;  1U02 A;  1QSY A;  2DXF A;  2ZNZ A;  4Y2A A;  4B02 A;  2BKN A;  3FMB A;  3KHL A;  4DS5 A;  3E2E A;  2BE2 A;  1ZM9 A;  4TY9 A;  3GFX A;  1KOH A;  1M0S A;  2UUT A;  3DYA B;  3R97 A;  3V4M A;  4U8Y A;  5CA5 A;  2N82 B;  5MLC V;  1DHM A;  1RTZ A;  2MKS A;  3GII A;  1B0V A;  1XMQ J;  3B6B A;  1KTQ A;  5KFV A;  1N32 F;  5HK4 A;  2YXL A;  4Y2M A;  3I32 A;  1VQ6 S;  5DZ7 A;  2BE7 D;  2M5Y A;  1RTH B;  4XPC A;  1M5O C;  3GV8 B;  2NSC A;  3CJQ A;  3PCO B;  2C3O A;  3LP1 B;  4ZVO B;  4JI6 F;  4PYA A;  1LW0 B;  2RSQ A;  4IFV A;  4K7Q A;  4QYR A;  3MCM A;  5ETV A;  3TYT A;  3GFZ A;  5HO4 A;  3OL7 A;  2ZH9 A;  1RXO B;  3PIO Q;  3PW2 A;  5KFJ A;  4KE5 A;  2Y0B B;  4CLS A;  1YJW S;  1TEL A;  3HSZ A;  3GTY X;  4FPI A;  4RPF A;  1TZ0 A;  2CPZ A;  3Q83 A;  2Q66 A;  4C8Z A;  4LRC A;  2YNI A;  3AOB A;  4HI2 A;  4FBT A;  1IN0 A;  4KPY A;  2ZHO A;  3C6T B;  3K17 A;  4DX6 A;  4NYP A;  4CO1 A;  4DR7 J;  3PRB A;  3GJS B;  3UR3 C;  3E51 A;  2OEL A;  1BGX T;  2E5I A;  3IMQ J;  4OYW A;  2MZQ A;  1R6Y A;  2DVI A;  1PJ7 A;  2Z2Y B;  2GGP B;  2WSE C;  3J7Y U;  1WEZ A;  1TK0 A;  2W24 A;  2GV1 A;  1FRX A;  1XR6 A;  1WDD A;  3EWG A;  3KLG A;  2FJA B;  5KTQ A;  1CJT B;  2CQB A;  3D66 A;  5KFK A;  3ZFV A;  5C25 B;  2MQO A;  3VAH A;  4B3R J;  2V4R A;  1RTI A;  3KK3 B;  4DV6 F;  2W25 A;  4FXW A;  2VG5 A;  4JI5 F;  1KVK A;  3TWZ A;  5BR8 J;  4B08 A;  2KT2 A;  3R2C J;  2A2C A;  1U1O A;  1OSD A;  4F67 A;  5L46 A;  2DNN A;  3KLI B;  2FHM A;  2J6S A;  2OEJ A;  4Q2M A;  1SPB P;  2AGQ A;  5CYQ A;  2YKQ A;  3GFY A;  4CDI A;  1U47 A;  2XB2 D;  3UQS A;  2MST A;  3H2L A;  2DGX A;  4OJ1 A;  4PPZ A;  4EI2 A;  2HMI A;  3AY0 A;  3MCS A;  1R43 A;  5HN0 A;  3BO2 A;  3VZI A;  2I0X A;  2C2Z B;  2DIU A;  3PYF A;  4ZJQ A;  4GO7 X;  2VFT A;  2QSF A;  2NPF A;  3ENV A;  2YWF A;  3W8P A;  1DRZ A;  2AJ4 A;  3ITH B;  1X0P A;  3TA2 A;  3UO0 A;  2JEI A;  1HNV B;  2A2D A;  2Z56 B;  1IBM F;  3E3X A;  4QWD A;  1NKC A;  4AUK A;  2LQB A;  4DR5 J;  3A3P B;  2IA0 A;  3FZ2 A;  5M2R A;  4CIO A;  4LRD A;  2YNH A;  3WBZ A;  4GMK A;  4N77 A;  1TFW A;  2AGO A;  4FF4 A;  4AXI A;  4Q44 A;  4ZLN A;  5K14 B;  2EXU A;  1VQL S;  1D8Z A;  5KG0 A;  5DDP C;  2W9C A;  1RA6 A;  5DM7 Q;  3V6J A;  2KT3 A;  4KTQ A;  1JLG B;  1G3O A;  1S6U A;  2ASY A;  1I5O B;  5CH7 B;  5IM0 A;  2E5L F;  4LF4 F;  1OJ4 A;  3BGU A;  3MF5 A;  4QQB A;  3TVZ A;  2DGT A;  1FER A;  1S7I A;  4Y34 A;  1BQM B;  1HQE B;  2ATC B;  4DEZ A;  3H42 A;  5LXY A;  2MYF A;  4KFB B;  4EZ9 A;  1JK9 B;  3A8E A;  3HD2 A;  3U27 A;  4DG1 B;  3SZ2 A;  4MH8 A;  1FX2 A;  2N4C A;  4ZN1 A;  3R1H A;  1T8E A;  1S0M A;  4K4U A;  2KL8 A;  3DLB A;  4WII A;  2QE5 A;  4IUF A;  2CQH A;  3OXL A;  5ADZ A;  1CJV B;  5D4O A;  4K4V A;  3UI3 A;  5KFB A;  4B9L A;  2E1R A;  1YJV A;  1HLW A;  4DG1 A;  2FHJ A;  3OHA A;  2R8I A;  3CUL A;  2C3U A;  2HZA A;  3BM7 A;  1H0H B;  2HBZ B;  4C2M A;  4EYI B;  1FRL A;  1RT5 A;  2Z8Q A;  3IS9 B;  2DRA A;  4DU7 A;  4LF7 J;  4RNN A;  4EBE A;  1U49 A;  3BSN A;  1FT8 A;  1NDL A;  3V81 A;  2K3I A;  4EWT A;  4YUD A;  3CD0 A;  2XMJ A;  4BC7 A;  1LNQ A;  5IS2 A;  2DH8 A;  3Q23 A;  3HZE A;  4W90 B;  4F0H A;  3POT B;  2B9X A;  2BJ9 A;  2GQQ A;  5B0B A;  4NEY A;  3CED A;  3MCN A;  3PRD A;  3HVR A;  1D0E A;  4FYX B;  4OX9 F;  1CQN A;  4ED4 A;  1W2B R;  1TTH B;  2YNH B;  3PJX A;  2HGN A;  1MWQ A;  4QJV A;  4GVB B;  3QRP A;  2EBE A;  2W7A A;  2O67 A;  4DFK A;  3HVA A;  4CLY A;  4X66 F;  2HHS A;  3QFW A;  2DH7 A;  3Q2S C;  2PO4 A;  4OHY A;  2W2Q P;  3EIC A;  4BDP A;  2ZH4 A;  4PAB A;  4X4R A;  1YJT A;  5KFU A;  3D54 A;  2Q2G A;  4HLB A;  2K7J A;  4XTT A;  2FVS A;  3K59 A;  3TO8 A;  3FJ2 A;  4PXC A;  1TV6 B;  3M9N B;  3DRS B;  2BW2 A;  1R31 A;  2ZUG A;  4WBF A;  2IYG A;  2E7X A;  3UCZ P;  4KGK A;  5KT7 A;  3PVX A;  2E1C A;  5L39 A;  4NLW A;  2Q43 A;  3MHY A;  5JXS A;  5J2M B;  2HIY A;  4QYZ J;  2WW8 A;  2DXE A;  4U6P A;  3WX8 A;  4OZJ A;  3OLB A;  4I64 A;  1BQX A;  3IBC B;  2BJE A;  1SC3 B;  3I5B A;  3N0V A;  2LP4 A;  3HHL C;  1V3S A;  3CGI A;  4GC6 A;  2OI2 A;  4KV8 A;  3PEH A;  5DJB A;  2HQI A;  1VC5 A;  1NB7 A;  4CZC A;  1F5A A;  3DRP B;  1NZA A;  1IKY A;  3IXQ A;  1RB0 A;  1D9A A;  1C1B A;  1OPZ A;  4ICL A;  1NZ8 A;  1SQG A;  1KDN A;  3KLH B;  4DS4 A;  1S9F A;  4OL8 A;  2ASJ A;  4DOZ A;  1UMJ A;  4PEO A;  1F1B B;  1TAQ A;  5KT3 A;  4DHV A;  1I51 B;  2CJQ A;  3CCT A;  3PFE A;  4UZB A;  5KFM A;  4IR9 A;  3H5X A;  4ED8 A;  3EE3 A;  1T3O A;  1WD6 A;  4I6A A;  1ZZN A;  2CNN B;  2QMX A;  4G1I A;  1J5O B;  4E8U A;  2WSF C;  2AHO B;  1FRM A;  1URR A;  4HYK A;  1M1K T;  3I38 A;  4USU A;  1NU4 A;  2ZE2 B;  4WXO A;  3CC2 S;  2MKK A;  4MIA A;  3H4B A;  4M5N A;  2HS0 A;  1Q5V A;  2MGZ A;  4J9S A;  1VHI A;  1UJ4 A;  4WU2 A;  5ETQ A;  3DMJ B;  2OTL S;  1RAB B;  3KK2 A;  1D3W A;  1B7Y B;  4RWW A;  5A6W A;  1KD1 T;  1DBD A;  1RAO A;  4OYO A;  5C2C A;  1NHV A;  3CO9 A;  3N01 A;  4QU7 A;  3DYA A;  1FEH A;  1VOM A;  2GO8 A;  1ZZF A;  2NXE A;  4DPX A;  4ANE A;  1FWK A;  1B3T A;  2CG8 A;  4LFC F;  5IV4 A;  1FF2 A;  3PO4 A;  3OUY A;  3C6U B;  4DCP B;  2XMW A;  2G4B A;  1SKS A;  1NKE A;  4DX7 A;  3OTD A;  2ZFH A;  4BBY A;  3Q22 A;  1N4L A;  5EWF A;  2MZR A;  1TL4 A;  3O3L A;  3D3B J;  1RAE B;  1RBO B;  2XMM A;  4MKA A;  3TAM A;  3UD5 A;  3T41 A;  3ZC4 A;  4CNZ A;  4AL6 A;  4ZVE A;  3M6X A;  3DC2 A;  4IH7 A;  2HHT A;  3NOC A;  1TL1 A;  1RQ0 A;  1S57 A;  1C4C A;  1FD8 A;  3O1L A;  4DU8 A;  4EYH B;  1U0S A;  1F5B A;  1NXI A;  3W7B A;  2HVD A;  3NCP A;  2GS8 A;  2GW8 A;  3GON A;  1VI7 A;  2D7S A;  3HHL B;  3DM2 B;  1ZET A;  1UVL A;  5D3G B;  2VJV A;  3J7A N;  2ZWP A;  1B99 A;  4JI1 F;  3IWN C;  4OYZ A;  4DQQ A;  2EKN A;  4E0D A;  5KFD A;  4LRE A;  2FD2 A;  3U1M A;  5HQM A;  1YRX A;  4KKO B;  5HI7 A;  3CDW A;  4K5S A;  1FVQ A;  3AFG A;  4B3T F;  4C8K A;  2IIH A;  4A8S A;  4ILR A;  3BV8 A;  4JI3 F;  1DLO A;  1SUQ A;  5BJR A;  1B64 A;  4DSK A;  1JNR B;  1RGV A;  4OHV A;  5F8N A;  1ELO A;  3DRR A;  2B3T B;  1DFD A;  4USI A;  2ABY A;  5B0C A;  1SVD A;  1FRI A;  3JQM A;  5F0U A;  3L3C A;  1I94 J;  5A2Q Y;  4DPT A;  3BO4 A;  3KK2 B;  1UVJ A;  3DMJ A;  3QZ7 A;  1EHW A;  2QT7 A;  3PG9 A;  4HAC B;  3SQG B;  4ZPC A;  2VC1 A;  1NK9 A;  1FTC A;  5JVG Q;  1VJW A;  3DOM A;  3KLV A;  2VU5 A;  4IFY B;  2D69 A;  4LJM A;  5KG6 A;  2AD9 A;  1CPZ A;  4OIX A;  3IBW A;  2WVC A;  3OFG A;  2R2T A;  3BDP A;  3AQO A;  5KG7 A;  3SMZ A;  5FD1 A;  4WFX A;  3BH7 B;  4MIW A;  1N5T A;  3M6V A;  5K9F A;  4CLL A;  2QL7 B;  3VCD A;  1J5O A;  2OSQ A;  3BJY A;  2ZBR A;  2DNO A;  3HUL A;  3M6W A;  2ZJQ Q;  3BS9 A;  2P2C B;  2QLW A;  5CXT A;  1BXN A;  3LQV A;  4LF1 A;  1IBL J;  4UF4 A;  3NEK A;  2AYB A;  4MFB B;  2V67 A;  2PA3 A;  4EK2 A;  2AX0 A;  4N41 A;  2UXB F;  2IRU A;  2QMW A;  1YHQ S;  1TK8 A;  1FD2 A;  1Y3J A;  3CIZ A;  4QWB A;  3BSO A;  4R8U B;  1U1R A;  2CWK A;  2GQ2 A;  2VFR A;  3PYD A;  4I4B A;  3ZXW A;  3BQ0 A;  2RH3 A;  4NLP A;  3IA0 A;  1IR0 A;  3RW6 A;  4IRC A;  2XS7 A;  2VPX B;  2CKW A;  4J80 A;  2H3E B;  2MJN A;  3HT0 A;  3OLA A;  4TLR A;  2L9N A;  3EPG A;  2WON B;  4ECY A;  2C2R A;  3OSP A;  3HK2 A;  5LOQ A;  2ZOG A;  1Q4R A;  2QC3 A;  3F0N A;  1JWW A;  1KWM A;  3PDN A;  4OV1 A;  3IO1 A;  3VQT A;  1U6Z A;  3RB0 A;  2PI5 A;  1CJU A;  1JJH A;  1ZAX A;  4IH6 A;  4JI1 J;  3MEK A;  4PWW A;  3IAM 9;  1BC6 A;  3AB4 B;  2DHX A;  1UA1 A;  4IOC Q;  3W62 A;  4X62 J;  3BR8 A;  4TU8 A;  3MUR P;  4QR1 A;  3AGZ A;  2FVQ A;  1FNM A;  2YX4 A;  4GKK F;  4WTY A;  1R3N A;  2F40 A;  3NG8 A;  4OZ1 A;  2J7U A;  1F6T A;  2YX7 A;  1UWB B;  3D6F B;  3GYN A;  4OYI A;  4ZVU B;  4WF9 Q;  3MMJ A;  4FF1 A;  3NP5 A;  5DDR C;  1TMJ A;  3HJF A;  4ZPT R;  1NKB A;  1KN6 A;  3UN2 A;  3HPO A;  5FLX U;  2RQ4 A;  2ROP A;  2OTJ S;  4C8M A;  3OSN A;  1U6B A;  2O01 C;  3KDN A;  2PEB A;  3L7P A;  5CCL A;  2ZOM A;  2YNG B;  3CT9 A;  3EX7 B;  3ELH A;  2NUU G;  2HMI B;  3G9C A;  1FRH A;  1TL3 A;  3CCL S;  5BR8 F;  2H1Y A;  4ZVT B;  4DR6 F;  2DH9 A;  2JEG A;  1WI6 A;  3KLI A;  4AE5 A;  3TAN A;  4QIV A;  2VQE F;  4PRF A;  1CC7 A;  3F41 A;  3Q8U A;  2KM8 C;  2OSR A;  2VG5 B;  4N56 A;  5HRO A;  4NPO A;  2FB0 A;  2HS4 A;  3QT6 A;  4ZCL A;  1RAA B;  1R0A A;  1NK7 A;  1DAX A;  3ZZR A;  1RT7 A;  2IDL A;  3Q8R B;  3G96 A;  1YTY A;  1Q8I A;  2VBW A;  2ZH6 A;  2ZHB A;  1A0O B;  3T5K A;  3TVK A;  3CCZ A;  4J9R A;  3J7Z 5;  1UJ5 A;  1Q8K A;  1IQT A;  2AYM A;  3KYL A;  3CCE S;  5DS7 A;  4B9V A;  2Y8Y A;  2D9O A;  4R8U A;  4TQR A;  2ZM6 J;  5LMN F;  1TAU A;  1X4F A;  2C3M A;  3ZZP A;  3KHG A;  3UD3 P;  3QPI A;  2YKN A;  3M4X A;  3SFU A;  2APO A;  2IYI A;  2NXN A;  4OZ2 A;  2FIU A;  4F0K A;  5J2Q A;  1VBK A;  3ZNU A;  4K4Z A;  5J2N A;  1R7I A;  4ZP8 A;  2R7O A;  1R27 B;  4ELU A;  1S59 A;  4LF6 F;  5B0A A;  2QA4 S;  2DHH A;  3BYR A;  3D5M A;  2KXN B;  3DXB A;  4WE1 A;  3MFI A;  1XNQ J;  4IO9 Q;  3GIM A;  1RHM B;  1TKT A;  2NXC A;  3N5F A;  5C7P A;  1Q95 G;  3DGV A;  4DR2 F;  4DV0 F;  3QAT A;  4IFV B;  5CAA A;  3MPU B;  1UAW A;  2NS1 B;  2RB7 A;  4NLX A;  3ZZT A;  7AT1 B;  1N6Q B;  3Q86 A;  2VG6 A;  1RWV B;  2BAN A;  4IFY A;  2FZC B;  1JLG A;  2JC0 A;  1D9D A;  1TUW A;  1IKX A;  4FXD A;  3KK3 A;  1C0T A;  2RML A;  2XWX A;  1MG7 A;  2OMO A;  1NO8 A;  4L3N A;  4CH0 S;  3CCR S;  3KOA A;  2B9E A;  4JI5 J;  1MU2 B;  5G0R A;  1UW9 A;  3UDV A;  3IRW P;  2DIT A;  3AOD A;  4XAK A;  4CM2 A;  4DSL A;  2CZ4 A;  4X64 J;  3R7S B;  5HVG A;  5DLG A;  1GTE A;  4USW A;  2IVM A;  1DLO B;  2RUS A;  2UV8 A;  2BOA A;  5L9N A;  3VAM A;  1VQ4 S;  4I6Y A;  3C14 A;  1HNW F;  4UQG A;  1CS4 A;  1VQO S;  2H54 B;  2UP1 A;  2NXU A;  2XSJ B;  2HHU A;  4X4V A;  5D77 A;  3QT5 A;  4RW7 A;  4F25 A;  5D3G A;  3GWC A;  1HI0 P;  4TXS A;  4OLO A;  2ZNY A;  3KKF A;  2I6W A;  2B0G A;  4Q45 A;  3B4D A;  4KB7 A;  4ED5 A;  1A9N B;  2CQ3 A;  1RAC B;  3PIP Q;  1IBM J;  1S9E A;  1YRU A;  2XWY A;  4A47 A;  4CO5 A;  3J81 Y;  1TL1 B;  1HBM A;  2MSS A;  4RNF A;  3NMA A;  2UXD F;  3A4T A;  2EFV A;  2UUA J;  2BAB A;  2ZH7 A;  2FDN A;  1U7L A;  1VHF A;  1YJ7 A;  2QA2 A;  5CYM A;  3TOQ A;  5J2P B;  1SQF A;  3LPY A;  5LL6 d;  1HW8 A;  3I0S A;  4YEA A;  2HZV A;  4ED0 A;  2VDH A;  3KJN B;  3FC9 A;  5ETT A;  4B3T J;  2UXC J;  5EX3 A;  2NRE A;  1Q82 T;  1BE4 A;  4H4M B;  2F9J A;  1TP7 A;  2HK3 A;  3MGJ A;  4TYB A;  4LBH A;  4CYU A;  3W64 A;  3RB4 A;  1I1G A;  2YQ0 A;  3A3N B;  3RTV A;  3Q8Q B;  3MM6 B;  1Q78 A;  2HLT A;  4FYW B;  1HNZ J;  3WX4 A;  1ZYQ A;  3JQK A;  2IM3 A;  3BGO P;  4FPR A;  4LF8 F;  1LWC A;  2R8G A;  2YNI B;  1MRO B;  2E7V A;  2HAF A;  2QFI A;  3B4M A;  2V2Q A;  3MEG A;  4B9T A;  3TR5 A;  2CRL A;  1Q16 B;  4ATN A;  2ZBI A;  5ETS A;  4DUY F;  3CWJ A;  2DR7 A;  1S6Q B;  2MGZ B;  2ZVS A;  1Q79 A;  3EMT A;  4IQM A;  4DV5 J;  4P52 A;  2BQR A;  2QSW A;  1W26 A;  4DCO B;  1HAR A;  5LSO A;  5FDL B;  2ZE2 A;  2AV5 A;  2RDJ A;  5KFT A;  1QSL A;  2GHP A;  3AHP A;  5U47 A;  3DCA A;  4C98 A;  3T5H A;  4AXJ A;  1U26 A;  1N34 J;  3M2U B;  3KMQ A;  3BGR B;  1IBL F;  2Q6C A;  2V9K A;  5D78 A;  4M8L A;  2HQC A;  1BLU A;  1DTT A;  4JI4 F;  3GLJ A;  2A6O A;  1N5Y B;  2AJQ A;  2B5J B;  1VRQ C;  3N6L A;  4AFF A;  3LUY A;  4K4W A;  3RBE A;  4DMZ A;  4NLG A;  3C46 A;  4DN0 A;  2DNP A;  1UEV A;  4KAI A;  2R2S A;  4LF2 A;  3D6M B;  3S01 A;  4UY8 5;  1R8A A;  4DQS A;  2BE2 B;  4U9R A;  2FTR A;  5D0E A;  5ETP A;  1EET A;  7FDR A;  4YY3 F;  3DRP A;  4ZP7 A;  5DG9 A;  2G0C A;  2V4J B;  2WZ1 A;  7FD1 A;  3CNQ P;  4V19 X;  4QWE A;  4WP3 A;  3T6B A;  2V6A A;  4I0W A;  4LF5 J;  2K06 A;  1Q8B A;  3DOK A;  2VIC A;  1KNZ A;  4LSL B;  2CUY A;  2MKJ A;  1WUU A;  5G4D A;  2NQP A;  1PYO B;  1GH8 A;  2RKI B;  4H4K A;  1QAJ A;  2PII A;  4LF9 J;  2OPR A;  4USH A;  1LV5 A;  4F0M A;  1IWG A;  3A3O B;  3NBP A;  2MZS A;  2CPF A;  3TX8 A;  5F8M A;  3T1H J;  1RLC L;  2PA8 D;  9ATC B;  2OHD A;  2JLG A;  1H2U X;  1DZ5 A;  1FXL A;  1AA1 B;  2ACY A;  3LOU A;  2V69 A;  3LTO A;  2IVF B;  4LMZ A;  4NZ7 A;  1TV6 A;  2YNF B;  2DNR A;  2L41 A;  4WIQ A;  2HND A;  3C19 A;  4ELT A;  1FCA A;  4NZ0 A;  4C48 A;  2B56 A;  4C8Y A;  2CPD A;  1D09 B;  1BHN A;  2PSZ A;  5IT4 A;  4K0K J;  3ZO7 A;  3UVJ B;  3KJF B;  4I1T A;  3UCU P;  3MED B;  1WOS A;  1U2C A;  4ZVP B;  1Q1K A;  4KHP F;  1QUP A;  3C6E C;  2H65 B;  2J8A A;  1IR1 A;  1LEO A;  3GIR A;  4X65 J;  5L1K A;  1UW4 A;  2JRR A;  3G6Y A;  4YP3 A;  5K20 B;  1SV5 A;  2JFD A;  2K2P A;  2B8Q A;  2YNF A;  2JEJ A;  2HVI A;  3UDL A;  3R2D J;  4DV3 J;  5DQH A;  1RAD B;  3FSI A;  5AJ3 F;  4KO0 B;  3ZTP A;  1Z2L A;  2G2Z A;  2R7W A;  2Y1I A;  2LQ5 A;  3QQC D;  2UVR A;  4EEY A;  2VFV A;  1PCA A;  2ZJR Q;  5KOW A;  5GME A;  1ZH5 A;  3LH2 S;  1KQF B;  4PWD A;  1UPM B;  1REG X;  3IS9 A;  2HBY B;  1E6Y B;  4OHW A;  4RX6 A;  4R5P B;  3FBF A;  2XMU A;  4M94 A;  1T9T A;  4PQU A;  2OJ3 A;  2XYG B;  4I7F A;  1H73 A;  2JJ4 D;  2HS3 A;  1U1Q A;  1RWX B;  2VOO A;  3M8P A;  4AL5 A;  1HA1 A;  4K0K F;  4NLD A;  1SH0 A;  5ETN A;  2CJ9 A;  4C0H A;  2V63 A;  4M5H A;  4P72 A;  1WF1 A;  1FE4 A;  2DNL A;  2V4J A;  4PG7 A;  1TVR B;  2HIQ A;  1YSJ A;  3L7O A;  4IG3 A;  2U1A A;  1UJ6 A;  4J9M A;  1IBK J;  3TUI C;  4DN9 A;  2BJD A;  2CPX A;  2AIR B;  4DV0 J;  4NA2 A;  1HYS B;  1PYT A;  2AJF E;  3WDO A;  2QEX S;  3HT3 A;  4J5O A;  1T94 A;  2DT9 A;  3KG4 A;  2E5G A;  1BQM A;  1HQE A;  3MD1 A;  3FEX B;  3OD2 A;  4Y3C A;  1M90 T;  4P2S A;  3TEH B;  1NSP A;  3B82 A;  4DUT A;  2ZDP A;  3DGP A;  3NY0 A;  5IM0 B;  4I67 A;  4C0O C;  4JV5 F;  3RZA A;  1KEK A;  1FKA F;  2P8I A;  2HG4 A;  3LAL A;  5I3Q A;  2VBZ A;  4PZV A;  2AEF A;  2RQM A;  2HYI B;  3SYZ A;  2YKA A;  3M05 A;  4WPA A;  3THP A;  2RF2 B;  1S48 A;  1S6P B;  3MMB B;  3UDC A;  2JVR A;  2B4V A;  2V0N A;  5DGA A;  2J0Q D;  3BSC A;  2IC3 B;  4C97 A;  3CJT A;  3NCR A;  3BKF A;  3AGY A;  1RWM B;  2EEY A;  5CHC B;  4H54 A;  5H9E J;  3AD7 C;  2OKQ A;  3M2R B;  4NML A;  1VIS A;  1HWK A;  1FRK A;  1S1T B;  3ITH A;  3K5P A;  4TQS A;  1NJX A;  3M1V B;  5JJB A;  2VHG A;  2WOM A;  2LU1 A;  3EGW B;  3EZU A;  2LMI A;  3EXC X;  1RHU B;  1DTQ A;  4OZ3 A;  4DV5 F;  4DR1 F;  4P75 A;  3IP0 A;  2VG7 A;  2G2O A;  2MPU A;  4RUH A;  1AFI A;  3LP0 B;  4W92 B;  3QSY B;  1LOU A;  2MKI A;  3FEY B;  2CQD A;  1X4A A;  3BH6 B;  3LGM A;  1HQ2 A;  3ZTQ A;  3M9O B;  2JSX A;  2FVP A;  3HO1 A;  2FY1 A;  2CVI A;  2DGO A;  1FNO A;  3D1O A;  2BYC A;  1ZTT A;  3NGS A;  3QGG A;  4P2X A;  5CYM B;  1LQ9 A;  2KYX A;  1P1T A;  4YN3 B;  2EW9 A;  2J6T A;  2HHQ A;  2C2M B;  3G87 A;  1HBM B;  1FX4 A;  5JUM A;  5IXU A;  1RWW B;  2GA7 A;  3ADA C;  2H51 B;  4H4K C;  4ZMM A;  3KLG B;  3NNA A;  1NJY A;  5THW A;  4K2J A;  4ID8 A;  4NLV A;  1CBK A;  4RWX A;  2HZC A;  1RT2 B;  3GFH A;  4ZPA A;  4ZCI A;  4NXN F;  2W1B A;  1LFW A;  4RBV A;  2MQP A;  1YX2 A;  2F7V A;  3M8Q B;  4ZVH A;  1TKZ A;  3M6U A;  3VQS A;  2WOM B;  4PG6 A;  4HDG A;  5IC4 B;  2OPS A;  5HBM B;  4ECS A;  4F7V A;  3VVT A;  3TUP A;  2E66 A;  2R4F A;  2XI2 A;  5BYQ A;  1RKI A;  5I42 B;  1WJ9 A;  3K5N A;  3MM7 A;  2IRY A;  3HHD A;  1W2I A;  4QPT A;  2XLI A;  3DLL Q;  3CJS A;  1GK8 A;  2CPJ A;  3O8W A;  2X7I A;  3DOL A;  1RIS A;  3QSI A;  2IBO A;  5T7L B;  1FJG J;  5F9N A;  3IGV A;  3NS6 A;  4C8L A;  1NB2 A;  1PBA A;  1DJ0 A;  1FVS A;  5ETK A;  2M0G B;  3M30 B;  1U1K A;  4USJ C;  4DV1 J;  4HDH A;  1JKH A;  2JZ8 A;  3VAL A;  1NLT A;  1N0U A;  3G82 A;  2BAN B;  3RJM B;  1Y00 A;  1T03 B;  3H4D A;  2FVR A;  5H9F J;  4LSN B;  4ECU A;  2DNK A;  1VLY A;  2EFG A;  2N3L A;  3PW5 A;  3JSR A;  1Q8L A;  4OI6 A;  2DPJ A;  1ACM B;  2F8M A;  2MEW A;  2QLJ B;  3K5M A;  1DY3 A;  4RR5 A;  3EGV A;  3M32 B;  3PYG A;  3VGS A;  3I0R A;  3OFH A;  3KFW X;  1FWP A;  2W7O A;  3GSI A;  1ZA2 B;  1RI7 A;  2AF6 A;  4Q2L A;  4K4S A;  3GP9 A;  1S9G A;  3BBF A;  5HAN A;  4ZVQ B;  3EYZ A;  2LQ8 A;  3JAM Y;  4Z7Y A;  1UFW A;  4BCA A;  2DRB A;  2R7U A;  2E9Z A;  2YWE A;  4ZKA A;  4C0B A;  4JI2 J;  1U2R A;  4NYO A;  1HI1 A;  1WC0 A;  4ECZ A;  4N5S A;  2CNO B;  3FSY A;  3T1H F;  2DGS A;  4LF6 J;  2XZD B;  3OHB A;  5KFL A;  3MOJ B;  1T9Y A;  3FZB A;  4TN2 A;  3S6E A;  1MN7 A;  1RA7 A;  2I1R A;  4KGV B;  6FD1 A;  3WZ0 A;  4J90 A;  2IHR 1;  2BZ2 A;  1RBL A;  2E29 A;  2HRT A;  4N8N A;  5A8R A;  4X66 J;  1QVG R;  1NME B;  2R8H A;  4B9M A;  2PMH A;  4UOH A;  2VOD A;  1T3N A;  3HHK A;  2HBQ B;  1IM4 A;  4ZLL A;  2A1B A;  2V8D A;  3TZZ A;  1PIE A;  4GRS A;  5IC6 B;  5DLF A;  2BEF A;  5HSP A;  2ZDO A;  3M8R A;  4TYA A;  3UVJ A;  4KYZ A;  2VH7 A;  1WI8 A;  2XUL A;  2PMZ D;  3B8H A;  3FCV A;  2CJA A;  3CO0 P;  4Y28 C;  5KFA A;  4ECQ A;  5KFE A;  3G8T A;  1WG5 A;  2CJX B;  5K8N A;  3JAM U;  1QUV A;  1Y5I B;  3KUE A;  3N4W A;  1WC6 A;  5DQI A;  1HBO B;  1RT3 A;  1S1U B;  5AE2 A;  5KFP A;  2BQU A;  2YY3 A;  2XS5 A;  4IOA Q;  2L48 A;  2U2F A;  2WSC C;  3G86 A;  1A7G E;  3MOZ A;  1RAI B;  4PXE A;  3HI9 A;  3T19 A;  4A8X A;  2KJV A;  3QO9 A;  4NOH A;  3CUN A;  1KFS A;  2UUA F;  2B6A A;  4UUX A;  3OQ2 A;  1MW7 A;  2ZH3 A;  2AU0 A;  3TI0 A;  4M5D B;  4X4P A;  2F63 A;  4FBU A;  2HRY A;  2AWZ A;  2C3Y A;  3MZI A;  3W2V B;  3W9H A;  1NLK L;  2RAQ A;  2ZH8 A;  3FQK A;  4UZC A;  2IDE A;  2KN4 A;  4QIW D;  5E3Q A;  3UN5 A;  2PI4 A;  2EG2 A;  4X4T A;  2CIM A;  4WJB A;  2FJX A;  2XYH B;  2X1F A;  4BWM A;  4X4U A;  1JXV A;  3R5A A;  4OQJ A;  5GAE U;  1BQN A;  1U24 A;  2VC0 A;  1VCT A;  2Y1L B;  1YVF A;  3G6X A;  3EZ5 A;  4DV7 J;  4DL6 A;  1EET B;  4U67 Q;  4DV4 F;  3PX4 A;  2KTQ A;  1HD1 A;  1AT1 B;  4NZ6 A;  5E3P A;  3BQ1 A;  3N79 A;  2I5J A;  1FKP B;  4NI2 B;  4DCJ B;  6AT1 B;  4RNH A;  5DM6 Q;  2ACM A;  2ZIT A;  3OTO J;  1HPZ B;  1L3V A;  3DLH A;  1YG0 A;  1EIY B;  4RW8 A;  3RBX A;  1NDK A;  3ZNJ 1;  3QIP B;  3UR0 A;  1CG2 A;  3V6D B;  1YJU A;  2B5J A;  2Z2M A;  2NYH A;  2RHS B;  2RRA A;  2G1D A;  1N5Y A;  3JXO A;  3FRY A;  4OJG A;  1C1C A;  2LCW A;  3V4I A;  2IVY A;  1NJI T;  1XBW A;  4CLP A;  1Y7P A;  4FXV A;  1YLX A;  3CJ2 A;  3CD5 A;  1GEH A;  3NOG A;  4LIW A;  4I2P B;  1GT8 A;  4N76 A;  3QYY A;  5IT9 U;  1T0T V;  3DDN A;  2CYY A;  4UST A;  3K5O A;  1VR6 A;  2KHD A;  2W4D A;  3G71 S;  4DR3 F;  1PIL A;  3MM8 A;  4HI1 A;  1Q86 T;  4F3M A;  2B9Y A;  3DLG A;  3GG0 A;  2CPY A;  1RWP B;  1H6K X;  3HSG A;  4M5J A;  5IWA J;  1K9M T;  2P9C A;  3MEG B;  1FFW B;  5MAO A;  1NH7 A;  1MRO A;  3FQL A;  3H5S A;  4NRU A;  1LWC B;  5LSR A;  1PO6 A;  1U4B A;  3HJV A;  1NK5 A;  2W4C A;  3DRX A;  3VAF A;  5KG1 A;  2RS2 A;  2H4W B;  3G8S A;  1YI2 S;  2DPI A;  3P6Y C;  1ZPW X;  1SUQ B;  4K4Y A;  3LZ8 A;  1VRU B;  1O8B A;  2IFX A;  2OML A;  4LQ9 A;  1ZM3 A;  2LFV A;  2BRK A;  2JHE A;  3DLK A;  1CEZ A;  4KKO A;  2GHW A;  3ISN C;  1OWX A;  2YBV A;  4M63 A;  2XC9 A;  3W63 A;  1E6V B;  4HEA 9;  4C3M A;  1P9Y A;  4A8K A;  1VQM S;  3ETM A;  4ES3 A;  3K8V A;  1WWH A;  2HQD A;  2KYZ A;  4CCH A;  1JMT A;  4Y0F A;  1Z4U A;  4ZVS B;  3RYL A;  1YK9 A;  3VAK A;  4KIA A;  1JLQ B;  2L9W A;  1AW0 A;  2A3J A;  3PJW A;  3RRK A;  2KM8 B;  1XWL A;  2OFH X;  3G8Q A;  3H8Y A;  3MXH P;  4C8N A;  2MQQ A;  4KRW A;  1U45 A;  1L3T A;  2ZH5 A;  2R3V A;  1RYR A;  4HKQ A;  1X4G A;  4NXM J;  2DNZ A;  3QAE A;  4ZIT A;  3GZ7 A;  3OTO F;  3FFI A;  5F41 A;  1VBZ A;  2YQ3 A;  3SDE B;  2CXE A;  5IZH A;  3JSM B;  4XDC A;  4ZJO A;  4CLW A;  3VHQ A;  3J7Y I;  1UZH A;  3C6U A;  3GPA A;  2ALZ A;  2M52 A;  1R8P A;  4Q8F A;  2MKY A;  4PWD B;  2UXC F;  4R0J A;  1B0T A;  1HQU B;  2K8G A;  2BW7 A;  2DGQ A;  2OO4 A;  4DZ6 A;  4RU9 A;  1UEK A;  3Q8S B;  4HHH A;  3KLF A;  2UVU A;  4NXN J;  2ZZN A;  4WU3 A;  3B54 A;  3PM9 A;  4ZVF A;  3C8Y A;  3CC7 S;  1MU2 A;  3PNI A;  3QT8 A;  5G0R B;  3W2W A;  5I4M A;  5I3U A;  4IG0 A;  3R8Y A;  1F9F A;  2ZC3 A;  5F8I A;  2W9B B;  5B0E A;  2BDP A;  4JB8 B;  3RW7 A;  4YY3 J;  4X4N A;  5HLF B;  4ETZ A;  2VPW B;  3CJ3 A;  5IQ6 A;  4DF8 A;  1O6X A;  1YBA A;  2RHQ B;  1VIO A;  2CQP A;  2I38 A;  3GCW P;  3MCO A;  5DDO C;  3MEC A;  2M8H A;  1IKW A;  4NLT A;  2WVE A;  1FK9 A;  1CVJ A;  3SCI E;  4KGZ B;  3UPF A;  2B4P A;  2RNE A;  4J9V A;  1EP4 B;  1Q53 A;  2ZOF A;  3TAQ A;  3KG0 A;  4LFC J;  4YS2 A;  3V2U C;  3HFK A;  4WFB Q;  2X3D A;  1HHS A;  2KXH A;  4ZPW R;  2X3G A;  2CFX A;  2YKN B;  3FBE A;  2QYG A;  1QE1 B;  4QR0 A;  2EC0 A;  1KS2 A;  3SSS A;  3R6L B;  2OLW A;  2HPU A;  4P7V A;  3RR7 A;  3JYT B;  2QLB B;  3KTQ A;  1JLE B;  3IM9 A;  1URN A;  5A76 A;  3GSD A;  2FLN A;  2IA6 A;  5D0R A;  5EN1 A;  1P6T A;  1SIW B;  1VMB A;  1T9V A;  3D9B A;  4IKA A;  1H72 C;  3H40 A;  4MKY A;  5KG5 A;  4PXD A;  3L4B C;  1X4H A;  4PG5 A;  5F3Z A;  4DFP A;  1LWF A;  4NLQ A;  2BJ1 A;  1NK8 A;  1MNE A;  2XSF A;  3X3U A;  3AAW B;  4OJH A;  5D4L A;  2J0S D;  1UWA A;  1WEY A;  1DQA A;  2BE9 B;  5E7O B;  3AJ1 A;  4YB6 A;  5LMU F;  4J9L A;  3W1Y C;  1HBU A;  1RSC A;  5KFH A;  1FDB A;  1GXU A;  2QTW A;  1KQG B;  3DU6 A;  5E33 A;  2K1R B;  3KDO A;  5L8R C;  1MMD A;  1TU0 B;  1SJ4 P;  3NWR A;  1HL6 A;  4QU6 A;  2J7K A;  4LRF A;  1PBU A;  2B6A B;  3MEE A;  3NS7 B;  2F65 A;  4CH1 A;  2KRR A;  4HH0 A;  5A0Y A;  3SIP B;  2IJN A;  3MAH A;  2M7S A;  4JYA J;  2B4O A;  5KT4 A;  1C0U A;  2I9S A;  1YIT S;  2VON A;  3R7N B;  5CZV A;  3Q8V A;  3AKO B;  5ETL A;  5HP1 B;  4OJ3 A;  2GC8 A;  4DX5 A;  3UE2 A;  2NZ4 A;  2CZ9 A;  1PJ5 A;  2KI2 A;  2ZKU A;  4OZ5 A;  3J7A 1;  5JMN A;  1UWB A;  1YZ7 A;  2AT1 B;  2P6S A;  4OI4 A;  4K59 A;  1PJ6 A;  1WC4 A;  4NWB A;  1WOR A;  1M1H A;  1X4D A;  2Z2Z A;  3NNC A;  5FJ4 A;  5IWA F;  3A8I A;  4QIF A;  5GAE I;  5C24 A;  1CJK B;  2YTC A;  1L5U A;  4AT1 B;  1YBU A;  5E3C A;  2EKY A;  2W8L A;  2EBG A;  4QYZ K;  2DK2 A;  1VQY A;  1XTZ A;  3F56 A;  3AJ2 A;  2GJI A;  2P5V A;  4HTI A;  4OYB A;  3J7Z T;  3V81 B;  3H25 A;  3GMG A;  5F0W A;  1ZOT A;  2DHA A;  3H2V E;  3ILJ A;  4Y00 A;  5A8W B;  2YWH A;  3HM9 A;  2VD3 A;  5ETO A;  1XMB A;  1UVI A;  4NCG B;  1LW2 B;  5B09 A;  1WDT A;  2OIH A;  1LXN A;  3LP2 A;  2JH3 A;  1F2H A;  3GU0 A;  2OUG A;  4WP8 A;  1CC8 A;  2AZ3 A;  4O3P A;  3HHE A;  4B17 A;  3NMR A;  1QAY A;  2HBR B;  4Z2X A;  2X1A A;  4MFB A;  3DRY A;  1SJF A;  1WC3 A;  1R8C A;  1JIH A;  2N7Y A;  3D1H A;  2JVO A;  1J27 A;  2C42 A;  3I0R B;  5A2Q U;  1PYS B;  3CCW A;  3K8W A;  2JFK A;  1SIZ A;  5KG2 A;  1CQM A;  1U6F A;  3CCV S;  3NWG A;  4B3S F;  4U8V A;  1IBK F;  3MTJ A;  1AFJ A;  4FF2 A;  3N6N A;  1YRT A;  4NCB A;  4ZS6 A;  4A8F A;  4GKJ J;  4LSN A;  3C5X C;  4LBI A;  1RHQ B;  1IJE B;  3MEC B;  1HMV A;  3CD7 A;  2HQ3 A;  4MAK A;  2R8K A;  4ED7 A;  1B0P A;  5CD4 A;  3DOM B;  3KLE B;  3GIJ A;  1LK7 A;  1PGZ A;  1JKH B;  2CNL B;  1NPP A;  1S1V B;  2O5D A;  2XG8 A;  1CSJ A;  2GX8 A;  4Y65 A;  2GIQ A;  1RCX B;  1R89 A;  2P6T A;  4HAC A;  3CCM S;  5HLF A;  3QJL A;  2J9D A;  1LWE B;  2VQE J;  3E8O A;  1NAQ A;  1VS3 A;  3DI6 B;  3MUT P;  3CMA S;  2BAC A;  2KG1 A;  1SCJ B;  3HLU A;  4WP9 A;  2KZZ A;  3NGU A;  2XMA A;  2R42 A;  2RU3 A;  1H2V Z;  1WHX A;  2B51 A;  2J9E A;  3V6H A;  1DAR A;  1BMQ B;  3BO3 A;  2I2Y A;  1J5E J;  3C16 B;  4V19 J;  3OL9 A;  1FJC A;  2GJ2 A;  1BUX A;  1NRK A;  3DLE B;  3IRX B;  2HWT A;  4HT7 A;  5C2G A;  2HQG A;  1OSC A;  2UV8 G;  5EWG A;  2G0I A;  2A10 A;  2VJU A;  1APS A;  2C1E B;  1KHV A;  1PG5 B;  4USK A;  3M2V A;  2GHV C;  4UTG A;  3PW4 A;  3SDE A;  3FCW A;  2YKM A;  4NE9 C;  2MLX A;  1RT2 A;  4NEZ A;  5GAG U;  2J0W A;  2MQL A;  4UW2 A;  2DB1 A;  4RW4 B;  2JDJ A;  2MQ8 A;  5D15 A;  2W9A A;  3R3T A;  4P7T A;  3UCG A;  4X65 F;  5J1N A;  1JLQ A;  3GG1 A;  3BGF A;  1F9E B;  3NNH A;  3NGD A;  4PAA A;  2ZBP A;  4MMO A;  4U96 A;  1IQZ A;  2Z4P A;  5E41 A;  1OYD A;  4F36 A;  1D1U A;  1E6V A;  1NCL A;  1WAC A;  4KR0 B;  4LVN P;  3SFG A;  4F8R A;  1N33 F;  2DCU B;  3N28 A;  3T1A A;  1F2G A;  1NPK A;  1RU2 A;  1TKD A;  3MD3 A;  3OUY B;  3DLK B;  4WTO B;  1GMW A;  1TKX A;  4P2M A;  5L1L A;  4IRD A;  5K8P A;  2UVW A;  3OFF A;  2YH1 A;  3LP0 A;  5BYS A;  3PX0 A;  1U48 A;  2UUB J;  2XLJ A;  1M1G A;  2XZT B;  4ZCK A;  3KHH A;  2AYG A;  2QX0 A;  1EAY C;  3VAG A;  4ED6 A;  4LF5 F;  4J9N A;  3HVW A;  1M5K C;  2ZVI A;  3SCK E;  1FJ7 A;  3FUY A;  4I56 A;  1K47 A;  2MQM A;  1H98 A;  4NA3 A;  3PHE A;  3LGH A;  2VFU A;  2F8E X;  2LDY A;  1N48 A;  2V68 A;  3MM8 B;  3EXY A;  1HIY A;  1N52 B;  1XEZ A;  3EZO A;  3MMB A;  4I2Q A;  2KFZ A;  5KT6 A;  1LW0 A;  3RAX A;  1UZD A;  4QW8 A;  2QG9 B;  4DR6 J;  4FF3 A;  5E0O A;  3EGN A;  5KG3 A;  1YQH A;  5HMZ A;  8ATC B;  2DR9 A;  1K1S A;  1KON A;  1M5P C;  4RLE A;  4JI0 J; 
#chains in the Genus database with same CATH homology
 2Q2G A;  1GMU A;  4J80 A;  3LA0 A;  3TJ8 A;  3TJA A;  3AGX A;  1EAR A;  1XAO A;  2QLD A;  3AGY A;  2HFV A;  3L9Z A;  4L3K A;  1NLT A;  1GMW D;  3AGZ A;  3I38 A;  3NXZ A;  1C3G A;  3NY0 A;  3LZ8 A;  1GMV A;  1EB0 A;  3TJ9 A;  2B26 A;  1GMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...