3TJ8A

Crystal structure of helicobacter pylori uree bound to ni2+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 42
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tj8A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tj8A02
2HFVA 4J80A 1GMWD 3TJAA 3AGYA 1EB0A 3LA0A 3AGXA 1GMUA 1GMVA 1NLTA 3NY0A 2Q2GA 1XAOA 1GMWA 4L3KA 1EARA 2B26A 2QLDA 3I38A 1C3GA 3TJ8A 3L9ZA 3NXZA 3TJ9A 3LZ8A 3AGZA
chains in the Genus database with same CATH superfamily
3IXQA 2XC9A 3GMGA 2W9CB 2AQ4A 2F9DA 4DU8A 4IH6A 1Q82T 4CYUA 3NOCA 4EZ6A 5B0CA 2AGOA 1YLXA 1JLAB 4ECWA 3D7SB 1NH8A 4RW9B 2V4QA 3BH6B 4RNNA 1XNRF 1S7IA 4B3MJ 3L09A 3I56S 4DSFA 3H2VE 1PJ6A 3CDEA 5BYRA 4YR2A 1H0HB 2GHVC 2X1AA 4QIFA 4C98A 2FJXA 2NPFA 1L3KA 3J81Y 3G6YA 3MUTP 1UL3A 3KNGA 2DHXA 4ZVSB 4F4YA 2OMLA 3GYXB 2B5JA 5D3GA 2YNGA 2Y3YA 3KLEA 1SC1B 2XWXA 3KLIB 1C0TB 2CFXA 2HZVA 2IFXA 1URNA 3BN4A 4DQIA 1HR0F 2KFYA 3JSYA 1XK8A 2O1PA 3CNQP 4Y65A 1QDUB 5I3UB 2Y1IA 3KFWX 4DS4A 4FF1A 1YVFA 5KFGA 4PG7A 3HVAA 3N28A 2VQFJ 2ZC3A 3R9LA 2DPJA 4Y6IA 5J1EA 2YNIA 4HR2A 1HFEL 4NLDA 1JLAA 3L7PA 2NUUG 4LQ9A 1MMNA 3NKYA 4NLPA 4WXWA 4I6WA 1J5OB 5CCLA 3V6JA 5DQIA 5CQGA 4DV5F 4LF5F 1FWPA 1S1XB 1KKHA 2MKYA 5KT3A 3AQPA 3F56A 3POTA 4PUOB 4IRDA 3MM8A 4ED8A 1S10A 1S97A 1FFWB 1YJNS 3VGSA 1BUXA 3BKFA 3CJKA 2RUGA 3VWSA 1HARA 4M1KA 4B3TF 1RTDB 3DGVA 4DLEA 3N0VA 5HAOA 3CWJA 3K5PA 4I2QA 2ZJRQ 3BF4A 4ZN1A 4X62F 5EWGA 1QUPA 1XERA 4FP9A 1NLKL 1U0HA 5IT9Y 2MKIA 1C0TA 1RK8A 4ED0A 1R6YA 4DUTA 1M5VC 3DOMA 2M52A 1UWBB 2RDJA 4N8NA 1YJ9S 2W24A 2MKCA 3MPVA 3C3LA 1VQ9S 1H7WA 1K47A 3T5KA 3AFGA 3W7BA 2F4VF 4C2MA 3FZBA 4AL7A 2XS7A 2UXBJ 1NKEA 2PSZA 4CZCA 5HBMB 3DKDA 4NYZA 2N7CA 3CB4A 3AA9A 2W9BA 2OFHX 1FDAA 4WXOA 2JFDA 1GXUA 5L46A 4PUOA 2CNOB 2AZ1A 3D54A 2NZ4A 3V4IA 4MAKA 3UVJB 3G4SS 3GCWP 1FF2A 3U27A 2Y8WA 5K8NA 2LECA 1FTCA 3H7HB 2XYHB 1SJFA 4K4XA 4DR5F 2HSEB 4GKJF 1VQOS 4DS5A 1RWOB 1X5OA 2M3DA 2MQOA 5JVHQ 1GK8A 1VRTB 3R3TA 3SCKE 4LFBF 5LMNJ 3V2UC 2GQCA 3QIPB 3OSPA 3TZWA 2JFKA 1RXOB 4NOHA 3WIVA 1M1HA 4TVAB 1G3OA 5HBMA 2HGMA 3HM9A 4BHQA 3SV4A 5J1NA 3R6LB 2AYGA 4J9SA 4HKQA 2D3ZA 2ZBQA 4HVZA 2A2CA 2JLFA 2RQKA 4WZMA 3RU0A 3BEGB 2DKOB 4BWJA 2DRBA 5EN1A 1JJ4A 2UUAF 1IWGA 2A2DA 2VPYB 5DQGA 2VIHA 3PRBA 3IWXA 4IG3B 1RI7A 2YPYA 4YY3F 4LF8J 3C66A 3TZZA 1OS5A 3E51A 2DNMA 3ZNUA 5FIIA 4A8QA 3FCWA 2R2RA 3RR8A 2HZAA 2E5LJ 2BJ9A 1H98A 4P2SA 4RL1A 1KVIA 4WWSA 3FRYA 1SKSA 2IJNA 2HZCA 5LSRA 4QWAA 3PEHA 2WVEA 3ENAA 3IRXB 5DM6Q 1JWWA 4FN5A 1RADB 4OZ3A 2DBBA 1MNEA 2JEJA 2WTFA 4ZP9A 5IT4A 4DR7F 1F3VA 2UXCF 3PO4A 2E7WA 2VASA 3KLVA 2CAJA 4DZDA 3VAHA 5K9FA 2PT0A 5LL6d 2RH3A 2PE8A 1IBCB 1N36J 1RDRA 2H51B 3JQMA 1S9FA 1BD6A 3NEKA 3RUBL 3U02A 1A9NB 2IBKA 2FDNA 1RWPB 1V9OA 1Z2LA 3GILA 4IG3A 2E1CA 1KTVA 2E1MC 5GMKa 1VI7A 4RBUA 1F2HA 3OR2A 2QIFA 2B26A 4CP5A 4RPFA 3W8GA 1KHVA 1X9SA 1GXTA 3LP1A 5ETRA 4AXIA 1I51B 4UOCA 2EBEA 2AD9A 3TAPA 5CYMA 3AODA 2DISA 4LF7J 4P2FA 2CJXB 2R42A 3X3UA 1T11A 3KMQA 4FNIA 5KFIA 3VAKA 1TKDA 4CLSA 1PO6A 5KFQA 3B6BA 4B08A 1RHUB 1SB6A 3EYZA 3UD5A 1HNXF 1VYAA 7FD1A 2ZDPA 4ERDA 3CPWR 1SJ4P 4LRAA 2UP1A 4KR0B 2DYAA 4HTJA 4JV0A 2OEMA 2UUWA 3BBCA 4I64A 5B09A 1PYTA 1NZ8A 2ALYB 3THTA 1L3UA 3OHAA 5HMYA 5LMUJ 2XSJA 1AZSA 3AQOA 4Q5VA 3SDEB 5FLXU 3AD9C 5BXIA 2FJWA 4QWBA 2HQ3A 3M30A 5DG7A 2FC8A 3M6XA 4IFYB 1FEHA 2GCFA 1YG0A 2P9EA 2V9WA 1SH0A 3MECA 5KFJA 2OLWA 3WDOA 2YX1A 1DQ8A 2X1FA 1T7PA 2OJ3A 1X31C 1U1QA 1RWKB 3NBPB 2MPUA 4OX6A 2ASYA 2ZM6J 3GYNA 1JLFB 5L8RC 2VA3A 1T03A 1S1WB 4R0EA 2PI5A 5E3PA 1S9GB 4Q44A 3I31A 1ZA1B 4JI3J 3MD3A 3THVA 4YHHJ 4I6YA 3W9HA 3QWUA 2WB4A 3IAS9 4OJHA 3I32A 1SPBP 2HNDA 4IDKB 3MGJA 2UVUA 4ED4A 4Q8EA 3KUGA 2E9ZA 5KOXA 3DXBA 3Q22A 3M8QA 3CCUS 1M5SA 3AGYA 5LXRA 5IS2A 1FXRA 4PXEA 3PACA 2F7VA 1S4EA 1CULB 1Y11A 4OYOA 3OLAA 1LWXA 4ZVEA 1C1CB 3T5JA 2WZ1A 3OJSA 1SJ1A 2NSBA 1XR6A 5ETSA 4I7FB 4DZ6A 1RGVA 2IRYA 2AYMA 4USIA 3AXMA 1WEZA 1XEZA 2L3MA 3BPSP 3NBPA 3TW0A 5A8WB 5KFOA 1VRUA 1WJ9A 2ACYA 5LJ3Y 4O3SA 4K4VA 1S1WA 3MD1A 2NXJA 2F8HA 5DDPC 4I1TA 4C8MA 4H4MB 3T3FA 4LVNP 2OGUA 4UUWA 5AT1B 5J2PB 2RQ4A 1NDCA 1BHNA 4TU8A 1R8AA 4DR2J 2ZBIA 4L75A 3UDVA 3WBZA 2C3UA 3AAWB 4WYLA 4JI1J 2OIHA 3OD2A 2W01A 4ZPAA 2NSCA 3LWMA 1WG5A 5A8KA 2XGPA 1C1CA 1DJ0A 1QAYA 3CDBA 1BQMB 3BR8A 5J2MB 2QLBB 2V68A 3JTPA 4I7FA 1G1XA 4MYUA 4W4MA 4AQYJ 4PZVA 2EBGA 1SH3A 2J9DA 3JQJA 2XO7A 1SJ3P 4TU9A 2HG4A 4J9NA 2M8HA 5CH7B 4ELTA 5LM7E 2ZOGA 1W2IA 5D0EA 2DY9A 3KDNA 4DPTA 3KK1B 2HBRB 4C8KA 3GV7B 1TAQA 4H4MA 4F2RA 1VJQA 2RB7A 1TKTB 2LDYA 1WNEA 4EUVA 3NOGA 2HHPA 2B43A 3VAIA 4K4ZA 4F2SA 3O6QA 4UZCA 2BUNA 1ICEB 4X64F 4O3QA 3Q83A 3GFZA 3FSIA 3DFEA 4OFZA 1JNRB 4FVCA 6FDRA 2LEBA 3BQ1A 2G13A 1S4FA 1LEOA 1UA0A 2E9TA 3G82B 3NGKA 1WEXA 4DSLA 2CQ4A 2BXJA 5IWAF 1UWAA 4RJVA 3W2VA 3D0IE 4LF6J 2R7QA 2RU9A 3C14A 3CCTA 3RAMA 5C42A 2DXEA 1SCJB 5A8RB 4K4TA 4KSEB 3Q8RB 2HIYA 3HF5A 3H8YA 3PV8A 3I5BA 8AT1B 5A76A 3TUZC 1E6YB 4E2FB 4A48A 1WSRA 2JZ8A 4L72B 3KK1A 3RAXA 4DF4A 1B7FA 2VFUA 4ECRA 4KFBB 2PFDA 2I8EA 2D3UA 1KQGB 4WIIA 2DTJA 4D3HA 2R7SA 2QA2A 2U2FA 2CJ9A 4ELVA 4O3PA 2I1RA 4RUAA 4MIWA 3QGPA 4ZCMA 1R89A 4M5KA 4I2PB 4J9RA 2FVQA 1WDTA 1F2GA 5ETLA 1SKWA 2YWWA 1KFDA 3QJPA 2HHHF 3NGRA 4DSJA 5D4PA 1SQEA 2M0GB 5FLXY 3DMJB 3OTCA 3UD4P 1RAJA 3ELHA 2VPZB 5E3RA 2FJBB 4JI6F 2VD3A 4LF9F 3EMTA 4C8OA 4FXDA 2CPEA 2OPQA 1N52B 2RDDA 3ZZTA 4MFBB 3KXDA 4O4RA 2MTLA 4JI4F 1JJHA 3AGXA 3T9ZA 1K0VA 2DY1A 3D6TB 5EWFA 1G7CB 1FDBA 3I87A 4JYAJ 3OSNA 3TVZA 2KXNB 1N4LA 2VZ9A 2RKIA 2ZBPA 3GJTB 3KWMA 1F9EB 2VPXB 2XMJA 2HVZA 1I94F 2XS2A 2ZVSA 4ECTA 1NPKA 3OFFA 5H9FK 4K5RA 1K0TA 2ASJA 3UCUP 4Z2XA 3KHRA 1LW2B 5KT4A 4NLTA 1F5CA 4IKAA 1FK9B 4I0WA 1WKLA 2BZ2A 2AJ0A 3MEDB 4B3MF 4QWEA 3DMJA 1N0VC 2QL5B 2LEPA 2CDQA 2ZH1A 3HJVA 1AW0A 2XY7A 4C6AA 1DTQB 2DGTA 3E2EA 3BO4A 4ID5A 4ETXA 2BQ3A 2N3LA 1HA1A 3N6NA 2DVIA 1L3VA 1RUSA 5HROB 2V8PA 3M1VA 2CZ4A 4Y34A 4ZLNA 5ETVA 3MM9A 2RF2B 3GSIA 3SV3A 3QO9A 2QL7B 3G2XA 3M6VA 4NLXA 2KG1A 4DCOB 4QPXA 5HJXA 4X4PA 4RLEA 2MQNA 2GJIA 4ECQA 3NG8A 2I6WA 2W9AA 3MXHP 3C15A 1S0VA 2AJ4A 1U49A 2W4CA 1VQ6S 1QE1B 3J81j 1KQFB 2DIVA 4YDDB 5C25A 3LW5C 3D67A 1X5TA 4WCEQ 4ZVHA 5THWA 2H4YB 4NRUA 2OTJS 2E9RX 4HH1A 4RWWA 4ZDNA 3DLEB 3MPDA 4WK3A 2PMWA 4BCAA 5T7LB 5E3AA 3DCAA 2PA8D 3TI0A 4OV6A 2AMCB 1U1KA 3UNGC 5I42A 2KHCA 3MFIA 1KD1T 1IKYA 1TP7A 1X4CA 5AE2A 3DYAA 1WC0A 2B56A 2EXUA 4U7UK 1LWEA 3LPEA 2WBRA 5KT2A 3SQGA 3TJ9A 1EP4B 5HROA 2Z58B 3AD8C 2J6UA 3BSAA 1Q7LB 1EETA 4WP9A 5EHHA 4CTAA 2AIRB 2CUYA 4ZCIA 2LQ8A 3L7UA 4CO2A 2Y8YA 2KT2A 3RTVA 5L1IA 2EC0A 5CZVA 1VIOA 3R5DA 3GE9A 3CVKA 4NI2B 3MUMP 4C8YA 2R8JA 1XQIA 3GLJA 4CCHA 4RX6A 1FD8A 3T1HJ 2FB0A 1TMMA 1L3TA 1ZETA 1NEEA 1T3NA 3F44A 1C4CA 2UXBF 3DLLQ 2J0XA 2YKMA 1FJCA 3FFIB 3CJRA 4RBTA 1Y10A 3G8TA 1TL1A 3D9BA 1LV5A 3VAGA 2AU0A 4QOTA 2Z2LA 3J7AN 1W2BR 3QZ7A 4TY9A 3EM1A 3TVKA 1FFGB 1NJYA 3OVAA 4O3OA 3R1LA 1NK7A 4HACB 4TYAA 3CO9A 1HBOB 4ED6A 4J9LA 2CDRB 5A6PA 4DUZF 1RWNB 5BJRA 3D6FB 1HNVA 1Y3KA 2FHJA 3A1YG 3DM2B 5K5MA 3MWBA 2N7YA 1N32J 3T41A 4TY8B 5BR8J 1AFIA 3QBCA 1IJFB 3MM7B 2IAJB 4C8LA 2IY5B 3H2LA 4N47A 1EKSA 3IBWA 4RW4B 1S1UA 1MG7A 1IR1A 1RCOB 2GV1A 2RE1A 4OLOA 2CQHA 1YRUA 2YNHA 3UI3A 1CJUB 2P6SA 2VV5A 4OYZA 5LXYA 2I5JA 3N5BA 2BOAA 3H0PA 4A8WA 3I0RB 5M2UA 1W7WA 4PWUA 5KFUA 2HQFA 1RT3A 4IG0B 5G0RA 4LF8F 2JDJA 1GEHA 5CD4A 2UU9F 5HK4A 3VR1A 3N01A 3FNNA 1YITS 5GMDA 4Y2MA 1VQ7S 1HNWF 2CNNB 1SL0A 2LKZA 1FX4A 1C0UA 5GAGI 3PIOQ 2GO9A 3R8YA 4DFMA 3KLHB 2RDIA 4HDGA 1FJGJ 4NX9A 2KFNA 5I4MA 4H54A 1R8BA 2KJVA 4PCQA 2CG8A 3BPDA 1SQFA 1KVJA 4X84A 1U26A 4C11B 2BW7A 2OD4A 1CJKA 2WSFC 2K1RA 4UQGA 4FYVB 3V6HA 3TVYA 1OQ6A 4CO3A 2VG6B 1LOUA 1N36F 4ILLA 2VHGA 4USMA 1N33J 2XHWA 1N5YB 4TQRA 1XC9A 5L9NA 4A8KA 1U1PA 8ATCB 1WSVA 4I6AA 5IQQA 4R8UB 3R1HA 2MLZA 4B9LA 5KT5A 2VU5A 3NGDA 2MLYA 2XMTA 1JLQB 3T6JA 4U95A 2BJ7A 3PTWA 1LW0A 3AGZA 2ZBCA 4U7UD 1FJEB 5HQ8A 1S7HA 1WC6A 3TAQA 4V19X 3W9JA 4IFVB 2EFVA 4LF1A 2ASDA 5HVHA 5DLGA 3I55S 4H4OB 2PDAA 4LVOP 4WE1B 2NS1B 1YZ6A 5F8MA 1HBMB 1PCAA 3UFCX 2X7IA 3VHQA 3T1YJ 3CD6S 4NXMJ 4F25A 4GC6A 4FXVA 1UVIA 4C0BA 2PFFB 4ZJOA 2A0FB 3MR7A 3Q8YA 3TANA 4YDXA 1S9EB 2CQ2A 4K59A 1NKBA 1SUQA 3PW5A 1P8GA 1N6QA 1WDDA 1RAOA 4EYHB 4OI0A 3HHLA 2MEWA 3T5HA 3P5TL 2DR6A 4R8UA 4DPYA 5LMUF 3DOLA 2FHKA 2IM2A 1JLQA 3CXCR 4ZP6A 3EDRB 2ZZTA 2HFVA 3PYEA 1UZDA 1TKXB 4K0KF 1WHXA 1S6QB 1F1BB 2IDEA 4JP8A 3CDWA 4WE1A 4B9SA 2LQ9A 1HBMA 1HHSA 4LSNA 2OO4A 1X4HA 2ZFHA 3EUNA 5HATA 2A18A 2KFZA 1HWJA 2ZM6F 1NHUA 3ILOA 3GFYA 4L3KA 2DO0A 2ZC4A 1ITPA 3SSSA 3H2UB 2VJVA 5D0GA 3CJ0A 2FGOA 2CZ9A 4FF4A 1Q81T 4JI3F 2EC2A 4YHHF 2EFGA 1D1UA 2M7SA 5F0WA 3H5SA 1K1SA 4X4TA 2VKRA 1JNZB 3HHDA 3CF5Q 5ITHA 3KJNB 4YFUA 2YKNA 4EBCA 3TEHB 3FSXA 3VTIA 1NO8A 1TK8A 4PQAA 2GVZA 2O01C 1SBRA 4NE9C 2WONA 4C4WA 1DRZA 4EBDA 3M8PB 4MT1A 3MHYA 4R25A 3ET6A 1QAIA 2ZZMA 3BJYA 1VK3A 2E5GA 5AE1A 3NMAA 2DGQA 3W5YA 4P2MA 5DG9A 4DQPA 2CPFA 2B4UA 4OZ5A 1S48A 2AJ1A 2V9KA 4KHRA 4DV6J 4OHZA 4J80A 1OY8A 4DL3A 4KY3A 2DNQA 2J9EA 1BLUA 2HURA 3A8JA 4IUFA 1RABB 4NCGA 3C16A 4OJGA 5AJ3J 2W8LA 3G71S 1WHVA 3HLUA 4OX7A 1WOOA 2FY1A 1RE1B 3GU0A 4USJC 4KGZB 2Z57B 1FRJA 2JVMA 3SMZA 1H2VZ 3LP0A 1IBLJ 5M2RA 1FX2A 2P9GA 1J27A 1WD6A 3KNAA 2VG7B 2EW9A 1Q0NA 4DFJA 1RAEB 2Q1LA 4IOBA 1FVSA 1A7GE 5CCMA 1YTYA 3K2YA 3E01B 4C3KA 3LP2B 3TP2A 4PG4A 4JI1F 5CHCB 3W61A 4ER8A 3PW0A 3K0JA 3CTRA 2FLLA 4DV4F 3MM6A 2J9DE 3OVSA 4GVBA 2UVVA 5HP1A 2UUBJ 4RW8A 7FDRA 4OHYA 4AQYF 5IOLA 2FC9A 3RB0A 2Z8QA 4DQSA 2XNRA 2IYIA 2DNYA 1ZPVA 4B9VA 3I0SB 2J8AA 1RT7A 5L39A 1Q8BA 1RHMB 3U7JA 5GVQA 3LF0A 4CI0B 1FJ7A 3FVYA 3IS9B 2EWHA 3DHWC 5B0BA 2XI3A 3NLCA 3W2WB 5A0YA 6AT1B 4A8XA 5HN0A 2J76E 1KP6A 3C46A 1S76D 3D3BJ 2R2TA 2XMVA 3MMBA 4USUA 1HI8A 2PEHA 4WFZA 3BKTA 2DCLA 3Q8QB 4IR9A 3KJFB 2QLJB 4ZS6A 1Q4RA 4U8VA 3NNHA 4YS2A 4LF6F 3OTOF 2CPXA 2HMIB 4LFAJ 2AEFA 4MK8A 3FGVA 3GIKA 2GJFA 3I0SA 1F5BA 5EWEA 4HHHA 2HQGA 1FNMA 1UZHA 2J0QD 1UPPA 3NXZA 2DGUA 1UJ5A 2Q6BA 1XMOJ 3PX6A 5KG0A 3GIIA 2CNKB 2HK2A 3KJVA 2YWHA 2CQ1A 5IT0A 3AOBA 2RT3A 3MOZA 1FTRA 4X2BA 4FNHA 3MMCA 2HQCA 2B51A 5KG1A 1HNIA 2DR9A 4AL6A 3TUIC 1RAHB 4CM2A 5C7PA 1BWEA 1HWIA 2OKQA 2Z2MA 3FKBA 3ZZZA 3T19A 2NREA 1QUVA 1IR0A 2R7WA 1FNXH 4FF2A 4CWBA 1RISA 1B3TA 1U8WA 3JSMA 1VQKS 4ED5A 3UW1A 2R7XA 3UN5A 3TUJC 3DLKA 3O1LA 1OWXA 1YDLA 3UO0A 2JLGA 2VPWB 2R7OA 4B17A 2HMIA 4NLWA 4L73A 1F0XA 2G2OA 1SV5B 2FYXA 3HSJA 4PXBA 5D6GA 2E29A 3MM5A 1RYRA 3NWGA 4DR3J 1GFWB 1TAUA 3AD7C 1SJRA 2VDIA 3PFEA 3D5MA 3FZ2A 2HLTA 3NCQA 4K4YA 1X5SA 1X0FA 2FVPA 1KN6A 2BYCA 1H2TZ 2ZH8A 2WVFA 4KRWA 1S77D 1QY7A 2FHMA 2GIFA 3KHHA 9ATCB 4Z7YA 2HHQA 2OUGA 3EE3A 1I1GA 2OTLS 3H4BA 1XMQJ 1VHFA 4QZVB 3IG1B 1RT6A 4PXDA 4ANCA 2CVIA 3DU6A 1VQLS 1YSJA 1NDPA 2GQQA 4NA1A 2EK1A 1GH8A 2RQCA 1G2EA 3FC9A 4QU6A 3NMRA 2WVDA 1M5PC 2K2PA 3TR5A 1TVRB 4PXCA 1FCAA 3RG6A 5KG3A 3CSKA 2IRUA 1PILA 1R8CA 4JI0J 1Y5IB 4UW2A 2W2QP 3QQCD 1WHYA 5K8OA 1SV5A 4OYXA 2KVIA 1HI0P 2AZ3A 1Y9OA 4TU7A 1WHWA 2QG9B 1I5OB 3CT9A 2AX0A 2ROGA 3DRRB 5E41A 2JSXA 4PABA 3UCGA 1HMVA 1MN7A 1U6ZA 4JI5J 1LWFB 2GZOA 4B9TA 2I38A 4KQZA 3V81B 2DH9A 4ZVFA 1GMWA 2B7CB 2H54B 3GR0A 2IC3B 4X4NA 5GADU 2XG8A 4WF9Q 2DGOA 1RBAA 1IKXA 1T05B 3VAJA 3D6HB 3SCJE 3WC0A 4CLFA 2CKWA 3BSCA 5EX0A 2H4WB 1S79A 1GTHA 2UXDJ 2V8DA 4U8YA 3G96A 2V6AA 1HWKA 1E6VB 5KFKA 1EQ0A 1OYEA 5AXKA 3TQ1A 3SIPB 5D15A 3X1LB 1R7IA 2XCAA 2MHNA 2HS4A 2E5HA 4Y0FA 5HI7A 1KS2A 3HVTA 3JYTA 1YBAA 1RT5A 1SQGA 4FBTA 5EUHA 2IJRA 1RHQB 1S59A 1UEUA 4CM0A 3G9CA 3SFUA 1IBKJ 2OELA 2FVCA 3WX4A 3V81A 2MXYA 3PYGA 2FPHX 5RUBA 3RYLA 1HBUA 3PX0A 3A13A 2O3DA 1IQTA 3TA1A 4XIUA 1VCTA 2QO3A 3AKOB 1NDLA 3BSOA 4ZJLA 4M5IA 4WFNQ 5CYQB 4KGVB 3M8SA 1QTMA 3DGPB 2RS8A 4K50A 3H5UA 4BDPA 1NB2A 3T1HF 3M32A 3EZ5A 5EX3A 3HD1A 2XLJA 2OH2A 5K14B 4YOEA 3OQ2A 1N5QA 1D9FA 1IBMJ 4DL5A 1RYSA 1TFWA 1FDDA 2L48A 1NHKL 5DS7A 2KYZA 4I4BA 3HSGA 2MKSA 1KOOA 2POKA 4WP8A 4RU9A 2QA4G 3M2UA 5J2NA 1KSPA 2VICA 3CMES 4ZLLA 3FEXB 3BBFA 1WKJA 1RAIB 2I9SA 1D9AA 4OX9J 2AWZA 4RKUC 3D28A 4QIVA 3MAQA 5HQLA 3SFGA 1YJUA 3BYPA 5F9LA 1RTIA 5BR8F 2L41A 4DUYJ 1UJ6A 3R5AA 2ZHAA 3H90A 2MHEA 5IM0A 4IRKA 2EK6A 4LRBA 1U1NA 2PA3A 1GT8A 3D66A 2HFOA 3CJ8A 3MR5A 5E3QA 4HT5A 4FZVA 1RT4A 3OT9A 2HNYB 3WIUA 1T9UA 2OPSB 4NZ6A 1B70B 3HZEA 3K8WA 2N4DA 1KWMA 3TA0A 4ES3A 2R8HA 3CJSA 1OJ4A 2CQDA 3ZTSA 2XMUA 1RT1A 1CS4B 3RRKA 3MOJB 1QAJA 2LMIA 3HJFA 4NYPA 3B4DA 1CLFA 2ZZNA 3VZIA 3CULA 3PRDA 1REVB 2OPRA 3EZUA 2V8GA 2F5GA 3MURP 1S6PA 1GQEA 1JLGA 2FIUA 1KQKA 1PBAA 2R7VA 1AYEA 4Q0BB 3RB4A 4IQXA 3AB4B 4Q7AA 2J7WA 1RT2A 2OSRA 4QYZK 2KI2A 3QT8A 3DC2A 2MB0B 3DRPB 2ILYA 4L74A 1TUGB 2AGQA 2MSTA 3CW2C 1TL3B 5DO2A 1GAOA 4C97A 1FJGF 4ICLA 3DXSX 2BJDA 2QJ3A 4DJBA 4KE5A 5B0GA 1VQ4S 1HQUA 3LTOA 3MEGB 1C2PA 1Z2ZA 4ILRA 3NRBA 1VOMA 3WZ0A 1TU0B 4U67Q 4BBYA 4NA2A 1RWVB 4GKKJ 2MKKA 1NJWA 3OL9A 2YXLA 4MK9A 3CC7S 2EFOA 3MDFA 4M5DB 4JOUA 3PDNA 4BLGA 1D3WA 4OJ1A 1BE4A 3K17A 1LWCA 4EEYA 3TRGA 2W7OA 3EX7B 2HFSA 2F8MA 4CYUB 1RAGB 3ZFVA 2CPHA 5JJBA 2VBWA 3W64A 2NXUA 4P9SA 2FUG9 3DLBA 3DRPA 2H48B 1VS3A 2GC8A 1SKRA 5DGBA 4DXLA 3T1YF 3MPWA 4NXMF 1W25A 4OQJA 1TL4A 2QGFB 1YHQS 1N5TA 4DV3J 4KV8B 1X4AA 3BSNA 3ZTOA 2CQPA 1XMBA 1ZH5A 1U2CA 2UV8G 3PW4A 4QBUA 4QW8A 5HLFA 4ITSA 5LOQA 2VG5A 2HVDA 4C9DA 3O3LA 2ADCA 2AJ2A 2Q43A 2QFIA 1EQMA 2APOA 4OYPA 3RJMB 4DL4A 3QJJA 2EI5A 4ZPWR 2R8KA 2B5JB 5D3GB 3CJ5A 3V6DB 1U7LA 2XZWA 1U02A 1HPZA 2ROPA 4DFKA 4KHPJ 2LQJA 3DNCA 3EXCX 4M5DA 2UZAA 2FVSA 3JS9A 3SI8A 4A8SA 5JUMA 4IH5A 1OQ3A 2ZH6A 4HLBA 2B7BB 3CJ3A 1RQ0A 2XO6A 3KK3A 2QV6A 4KO0A 3JQKA 4DPXA 1DURA 4WKYA 2V0NA 5J1EB 2YNIB 4CO1A 1RTZA 5E0OA 3QIDA 3CCZA 1YBTA 3UR0A 1NHVA 2UUCF 1D09B 2L9NA 1CJVA 3W5ZA 3IWNC 1HHTP 4D3GA 4B9MA 4ECZA 1N5VA 3POTB 2COLA 1VQYA 4KV8A 3MM8B 5BYSA 4DL0C 2DEIA 1LXNA 5B0FA 5ETTA 2DITA 4N56A 3CJKB 3PG9A 2L9WA 1VQSA 1QLNA 3ZZPA 4J37A 2XYGB 4I2QB 3QT6A 3V6DA 1U0HB 2JHEA 1CPZA 4I56A 3HPOA 1NNDA 2CG4A 2MQLA 1HR0J 5LT5A 4KIAA 3PO5A 3DOMB 1H38A 1H6KX 3FBCA 3DOKA 3CDUA 3UDLA 4DG1B 3U1NA 1P9YA 3P5BP 3ETOA 4J9PA 2E7VA 2XI2A 3KMSA 1NAQA 1NKCA 4WFYA 4ZJQA 1RTHA 2ZWOA 3Q86A 4B3OA 1S1TA 2BE9B 4LF5J 2W9BB 3NAHA 2XMAA 3MCNA 4DV6F 5F8NA 2VJUA 2PD1A 2NZCA 2PC6A 1DARA 3I4HX 3S8SA 3V4IB 2V8VA 5AJ3F 4B3TJ 2OMOA 3TJAA 3GTYX 4QIGA 3QT5A 4C3MA 2V34A 2J7KA 2YKAA 3TA2A 2CPDA 4FPRA 4NZ7A 5KG4A 4WTOB 2P2CB 1TZ0A 4PQUA 1UW4A 1V5VA 4Y2AA 2Q3PA 3RBDA 4LSZB 4KKOA 2YWEA 2E1PA 2JX2A 3BQ2A 5KFYA 4WJBA 3RB6A 4DG1A 5GAEU 2F4VJ 2MQMA 2GIRA 2QYCA 2BJ1A 3HX9A 2MZJA 1F9HA 4CDIA 4MKVA 3DLGA 2EKYA 4YMEA 3GONA 3G8SA 1OMSA 2C2EA 3JTOA 1UEKA 2Y1RI 5HANA 1I3OB 1WELA 3LO3A 4M8LA 3Q0AA 1NK9A 3S7RA 3PKYA 4A46A 4F50A 1B0TA 3E8OA 4JV1A 3UDEA 4GRSA 2NXEA 4I68A 2VKZG 1S5ZA 5CD4H 2BV3A 3FCVA 3CC4S 3MCSA 1V6HA 4DV2J 4BS2A 2F4FA 1D8ZA 1Y3JA 1O8BA 4QWCA 1ZM9A 3T9NA 1HBNB 2ZDOA 4GKJJ 1WC4A 3S01A 5GAHU 3EGNA 4C8ZA 4M5HA 2DO4A 1X4DA 3EVOA 4OZLA 5KG2A 4ETZA 2WOMA 4YB6A 4XO0A 1YGYA 1N34F 3Q24A 1HNZJ 5GADI 2M9KA 3QAEA 4UY85 3Q2TC 3EICA 2WBMA 3QSYB 3P4UB 5H9EJ 1PAUB 3G86A 1T3OA 1M5HA 4DDFA 2SXLA 1XR7A 3SXLA 3BGRA 3OXLA 3G6XA 1JLCA 1C3GA 1RWXB 4O3RA 1Y4ZB 3HFVA 1S99A 4LFAF 3AT1B 1MLAA 2YQ0A 1P1TA 1ULRA 2RHQB 2OPPA 1JIHA 1ZM2A 2BX6A 3M8YA 2RD5C 3I5CA 4L76A 2UUAJ 2BKOA 4DV1F 1KLMB 1ACMB 4JI2F 3PXGa 2FLPA 1MROB 1X4FA 5CZXA 4WTYA 4OL8A 3BREA 1X60A 1OSCA 4C0OC 1VIXA 4LSLA 1XMOF 4PWDA 2KXFA 3OR2B 2DGWA 1VR6A 2KZZA 3KYLA 1S6OA 2U1AA 1HBNA 1Q8IA 3DDNA 5SZTA 1AXQA 2AYEA 3IBCB 1IKWB 3HHEA 4G1IA 4P52A 1YJ7A 3LP1B 4OHVA 4XPCA 4HH0A 3ITHB 1DQAA 2AJQA 4URSA 1Q7YT 4YEAA 1HLWA 5CYMB 5IC6B 2VQEJ 3VAFA 3KKFA 2V4RA 4C3LA 1HD1A 3BZQA 3MZIA 3T6BA 1F3FA 2HW3A 4K4UA 1OIAA 5IC4B 2DNZA 4DR7J 4EBEA 4IO9Q 2RQMA 3FEZA 5C24A 4Q43A 2KT3A 3AA8A 1ZPWX 2GNKA 1RACB 1B0VA 4HDHA 1SVDA 3PX4A 2FJDB 4K2XA 1MSWD 4K5SA 5E2QA 1N5SA 1QD1A 1MWZA 2GHWA 1V3SA 1WF2A 2ZOMA 4OHWA 3TOQA 1FWKA 3R2CJ 2B9WA 2CVEA 3D0GE 3KHLA 2BMBA 1KLMA 1VC0A 2CQGA 3N79A 4DCJB 1MROA 2OP5A 2KJWA 4F67A 5BYQA 3UN3A 2XSJB 1AZSB 2JL9A 1YK9A 3IWLA 4CLLA 3GB0A 3KUEA 4LUBA 3M30B 3VQTA 2BEFA 4AUKA 1IKWA 3EVMA 3MECB 4OYBA 2C42A 1FXLA 4NYOA 2RUSA 4OYMA 4HEA9 1SC4B 1XMQF 2Z2YB 3ITHA 3B8HA 3AB2B 1FESA 1WF0A 3PEJA 3ISNC 1M1GA 3HULA 1T03B 4OZ2A 2JLEA 3MAHA 3M8WA 1VLOA 4K4SA 3JXOA 4DN0A 3UN2A 3H59A 9RUBA 3W5XA 5A2QU 4JI0F 3W66A 2HNDB 2HLUA 5CXTA 1UTAA 4CO4A 4NCBA 1FKOA 3OHBA 4Q2LA 3M8QB 3GJRB 4NXNJ 4R0JA 1XNQF 2JVOA 4WIQA 4JI5F 2MSSA 3OPKA 2QLDA 3I38A 3AY0A 2GJ2A 1VBYA 3TO8A 4YN3B 4DL2A 2YX4A 1X9WA 2MGZA 4CNYA 3BQ0A 3HHLC 3ONQA 3BYRA 5KFWA 2KO1A 4P2XA 4LBHA 1JJCB 4DR6J 1VRUB 1XWLA 2DJWA 4GVLA 1XN9A 1JXLA 1UETA 3KG1A 5E5NA 4ZKAA 2M4MA 4PEOA 4CLUA 1FRIA 1U48A 2CNLB 1RBOB 2Y9HA 3ZZ0A 5ETPA 3FUYA 4TNOA 4OYIA 2YPZA 5CYJA 1J5EJ 1CSJA 3OL8A 3CJ2A 1N0UA 3A3PB 4ZMMA 3NY0A 3IN5A 4A8YA 2BR0A 4H4KA 3ETMA 2IJFA 3H40A 3K5MA 2C2RA 2BE7D 5CAAA 3B78A 1ZS6A 2DGSA 2V69A 1P6TA 5A8KB 1T9XA 5HJYA 5ETMA 5FDLA 4A8OA 1NUEA 2HS0A 3D3CJ 1UVJA 4Q45A 1IKVA 3SCIE 4ZVUB 4CT8A 2ATLA 5KFDA 5H9EK 4AXJA 4HHJA 3R2DJ 4O4GB 4KH1B 2ZITA 2K06A 4KBIA 4Z7CA 3W3SA 3KLGA 5F8LA 1VK8A 3F0NA 1AA1B 3CCES 3DRSA 2ODXA 1CQNA 2FY8A 2G2YA 2HBYB 4KHMA 2IBOA 2OD6A 3CCQS 1U1LA 3F41A 4ES2A 2IA0A 3HSZA 4N5SA 5HL7Q 3BN7A 4KPYA 4OYAA 2VFRA 4CO5A 1U8SA 3J7Z5 1MMDA 4ZVRB 3TEGA 2FLOA 1JQGA 4CLZA 3FMWA 1F9FA 1LXJA 3BGUA 2EEYA 1TR0A 4DL6A 2J7UA 1ZYQA 3LOUA 2PN6A 2RJZA 4I67A 2DNNA 1GX5A 1Z4UA 4OX9F 3W2VB 4AE5A 4CQ1A 2GFFA 3C14B 4O4GA 2GGPB 1AUSL 5C42B 3MCOA 4F26A 3PJWA 2KB2A 4DUYF 5HVFA 2GW8A 3ENWA 1UFWA 2G0IA 5IT9U 2QLWA 2BW2A 1H3DA 3LGNA 2RHSB 4DX6A 3M05A 2VF3A 4YB1P 2QEXS 1LK5A 3H42A 4M63A 2CQ3A 3WHIA 3TX0A 2RAQA 1VQNS 2BJEA 2DHAA 5MLCV 4N77A 4WU3A 3LPYA 4X64J 2HNZA 1XAOA 3KUHA 2A6OA 4DBQA 1N48A 1CVJA 1IM4A 2KVQE 2HEKA 1B7YB 1BQNB 2IHR1 2MJNA 4DV0J 4WFAQ 3A3OB 4RW7A 2JRRA 4M5MA 2VBYA 4F4AA 2G2ZA 3FBEA 3DLJA 2BVZA 5DDRC 2HAIA 2AKWB 2C2ZB 2GGPA 2CPZA 1O5JA 4EGLA 4CH0S 1JB0C 3DU5A 5DM7Q 2IYGA 4B9UA 5KFNA 3LALA 1HQEB 1Y5LB 4ILMA 1FT8A 4WFBQ 2HWHA 1ZA2B 1JLEB 1O51A 1R8PA 3I82A 4DSEA 2OPQB 4FYYB 3C6EC 2JVRA 2WVBA 1RTJB 3MMAB 4X4QA 4Y2CA 1R0CB 1Y7PA 3KLFA 3K58A 4LRDA 4Z37A 5KG7A 4DL7A 3D1OA 1IVZA 3GIJA 2NYIA 4KH0B 5ETOA 2MLXA 2RKIB 3HP6A 4KPCA 2PMHA 2Z56B 1BQNA 3QATA 2QLXA 4EK2A 5A2QY 2VODA 3ILIA 3HVRA 5KFTA 1SC3B 4OZ0A 3H20A 3QGIA 2WVCA 5GAEI 3GV8B 2ZEJA 5KAKA 3H5XA 3P49B 5T14A 3ZO7A 1KC8T 2B4PA 4ZVGA 1LKZA 4TXSA 4JI6J 4XDDA 1Q16B 4ELUA 1HQEA 4DV3F 3ZZOA 2DPIA 1JLEA 5IV3A 1XIQA 3HKWA 3PYFA 4CLTA 3NS5A 1VDHA 4ID5B 3OUYB 4CLWA 3UE2A 1T95A 2DRAA 1TL5A 3K5LA 1ZZNA 1R27B 1RTJA 4DR1J 4MIAA 3MMAA 5DGAA 3I9ZA 3M2RA 5HSPA 3M1VB 1NM2A 4KYZA 1X4GA 3CIZA 2RRAA 3MM9B 4HI1A 4P10A 3BR9A 2LA4A 3QO9B 1VQ5S 2X1GA 2HHXA 5AXLA 3R5CA 4NASA 3WQPA 3AHPA 3QT7A 1PBUA 2MKHA 2BRLA 4JI7J 5GAHI 1SJQA 3VVTA 1HIYA 3HKZD 5L38A 2D74B 3OTBA 2W2NP 3C15B 1I94J 4U96A 3JTNA 4PAAA 3KOAA 1YZ7A 5C25B 2LVWA 4AFFA 4RWXA 3I9V9 2FJAB 4J9UE 2ZD1A 1CQMA 1MWQA 1WORA 3EPGA 1TKZA 2KHDA 3GFHA 4ZOSA 4QYRA 3IM9A 1FKPA 2XY6A 2BANA 4QR2A 2QC3A 2IVMA 3TUPA 1R43A 5I42B 3PM9A 2XS5A 2DD8S 4NEZA 3M9NB 1IKYB 2D69A 1LNQA 5KG5A 1WKKA 5HMWA 1HW9A 4TN2A 3DYAB 1S1VA 2PO4A 4JUZA 2C2MB 4ZK7M 1LWEB 2IIHA 3OUYA 2JNJA 3CGIA 1R0AA 1KTQA 2ACMA 1K73T 3SQGB 2EPIA 2VFSA 2DH8A 3SSRA 3I6PA 4HI2A 4JBCA 3NP5A 3BGOP 1YWXA 3AOAA 5H1SV 1UPMB 1EETB 2XTJP 3GPAA 4CTAB 4CIOA 1YJVA 2Y0SD 4USKA 1RWMB 2IPOB 2O67A 2R2SA 3K89A 2Y1LB 4K4WA 4HYKA 5D77A 2W9CA 2IM3A 5I3PA 1S6UA 4P7VA 1NB7A 2VQFF 2YH1A 2BRKA 6FD1A 2R9LA 1U2FA 5T41A 3G6ES 5D8HB 4K2JA 4F0HA 2YVSA 1NJIT 2YKMB 4RW9A 1TMJA 4AL5A 2XMKA 1KEKA 4LBIA 4NLUA 3N4WA 2CQBA 1TL1B 4G65A 5KFSA 2C3PA 4DFPA 4Y3CA 4DN9A 2H65B 2PEBA 4K7QA 2WB1D 4KGXB 3CEDA 4KAIA 1QSLA 3W63A 4NEYA 1WF1A 2DXFA 4ZVTB 4OIXA 1G6BA 1H74A 5L1JA 3PJ9A 1HNVB 1FRMA 3TX8A 1RU1A 2AT1B 2PGCA 2FD2A 2G9OA 3CCLS 1RBLA 4KGMA 3KLIA 4J90A 4LR7A 3G8QA 1JLBB 3M4XA 4AD6A 1YIJS 4C7QA 5LSOA 1I6JA 4TYBA 2BE2B 3PNIA 1RLDA 4E8UA 2ZE2B 4BC7A 2C1EB 4NMLA 5I3UA 3OW2R 3S6EA 4QR1A 2H9ZA 2M5YA 1ZAVA 1S1UB 2GMHA 1XBWA 2RVJA 4LF2A 3ENVA 2YNHB 1RP5A 1EJ7L 2IA6A 1Q78A 3P6YC 4USHA 2FGCA 1NSKL 2I5JB 3PW7A 1J5OA 4YP3A 4NMXA 1F60B 4J5OA 1S1XA 5IQ6A 4CLKA 4QPTA 2G1HA 3Q8UA 3L9ZA 4EZ9A 1XJWB 4OZ1A 2QSFA 2BKNA 1TFYA 2LQ5A 2JC1A 3D0HE 3OXGA 1KDNA 1Y0HA 1V3RA 1RT3B 5DG8A 1FO1A 4LFCJ 4DUZJ 1RTDA 2XMWA 5G0RB 4J9KA 4DV2F 1NSPA 3P45B 1WC5A 1VHIA 3IR7B 1VGYA 1R31A 2LU2A 3EVWA 4EI2A 3R6GB 2D41A 1JLBA 1IWAA 2E5JA 4MKYA 2C2KB 3M2VB 1MMLA 3ADAC 2BE2A 1C0UB 2ZE2A 4U6PA 4S0MA 1UWBA 2DHHA 2IVFB 3LGMA 1DQ9A 1PYSB 1UFLA 1SL2A 2HVHA 1FFSB 1HNZF 5D4OA 5LMNF 4OLPA 3MEEB 2ZH9A 4P72A 4F3QA 3KK2B 4XK8C 4DU7A 1RWUA 1RKJA 1X9MA 3GIMA 2MQ8A 4X4UA 2YWFA 2K3KA 1SI9A 2UVWA 1W26A 1CJKB 3H4DA 1VC5A 3N5FA 2K1RB 2V8HA 4PG5A 4ID8A 1RAFB 2PI4A 3HT3A 3QWPA 2AF6A 2DIUA 1Q1KA 5F8IA 4LREA 2V4JB 1CEZA 3UVJA 1Q53A 1BMQB 2WHOA 5KFCA 3OL6A 5AXMA 5KT6A 2Y0BB 4OX8A 3W9IA 1P1LA 1VQMS 2UU9J 4F4KA 2HBZB 3G87A 5F8JA 2QL9B 2V2KA 1LW0B 2E1AA 3W62A 2MKJA 4DOZA 2DNGA 5D0RA 1QJHA 2E5LF 1S49A 1FVQA 1HNWJ 4MTPA 2D7SA 4DV7J 1WOSA 5L1KA 1EKRA 4XTTA 2KL8A 4W98A 3M2VA 2C3OA 3QAUA 1VRTA 2RRBA 5KFHA 5KTQA 1K44A 2VQEF 3BM7A 2GQ2A 3OFEA 2QMUB 2A1BA 3MEEA 1QVGR 1FXDA 3KK2A 3QIPA 4J9MA 5JXSA 1Y00A 4YUDA 4RO0A 2C2DA 1SUQB 4OI6A 3K8VA 1N6QB 4ES1A 1IM6A 2FHJD 3QRRA 2B0GA 5EDWA 3C2PA 1ZTWA 2J0SD 3HHLB 3KJQB 2OHDA 1VRQC 4UY8T 2DRDA 2V4JA 3R7SB 3VF0B 1GXLA 5K8MA 3DOLB 3CD0A 3HSDA 5F9NA 2VH7A 1C1BB 1L5UA 3MEKA 3VZHA 3JAMU 2NXCA 1YRXA 2ZH7A 3FBFA 4NLVA 1SL1A 4HHUA 2CXEA 4JI8J 2F9JA 5D0HA 1SH2A 4DF8A 2QA1A 1U24A 3IRXA 4GC7A 4LSNB 3QLHB 3T1AA 3PRVA 4YR3A 4LF7F 2WRMA 1NK5A 5KFMA 1WG4A 3TWZA 2X1BA 3IR5B 4PR6A 4IRCA 3MPYA 5DJBA 5F0UA 1KNZA 3W65A 2CWKA 4FPIA 3BO2A 2N4CA 3UQSA 1WG1A 2LXFA 2W7AA 2JC0A 2VOOA 2YTCA 2HFUA 4EMDA 5DLFA 2W2OP 3JSBA 2WSCC 2YKNB 4X66J 2RRNA 3IRWP 3TQEA 3C8YA 2GVZB 4NXNF 4FS1A 2GO8A 1N54B 2WONB 1X4BA 2LQBA 1C1BA 3QMQA 4J9QA 4K0KJ 1S0MA 3ET6B 2WK4A 2F8EX 3CO0P 4A47A 2VBXA 3PVXA 4V19J 1CC8A 2HRYA 3QLHA 4DR6F 3HO1A 1X0PA 3CJQA 3OL7A 4ED3A 3L7OA 2HRTA 4NCGB 3C16B 4KC5A 1OSDA 4O0IA 4F04B 1HHQA 3GWCA 2B8QA 1J5EF 3ISND 2QX0A 3LP0B 1KOHA 2KM8C 4DCPB 3PYDA 2C28A 3H5YA 4A4JA 4DPOA 1TV6B 1M0SA 4NLGA 4LIWA 1DTTB 3IAM9 4XDCA 3I5AA 3SDEA 2OFGX 4F0KA 1RU2A 4RZRA 3T5LA 1EARA 3CCSS 2H5IB 3AJ1A 1TL7B 1N8RT 5GAGU 2W4PA 4GMKA 4IFYA 4UUXA 3P3DA 5F3ZA 1SIWB 3MM6B 3J7YU 1DFDA 4GVBB 5HP1B 5DQHA 4MMOA 2ILZA 4RW8B 4USTA 1MW7A 4DSIA 5KFAA 4ZVPB 2ZJPQ 3KHGA 5H9FJ 5ETKA 4ANDA 2EFPA 3LQVA 1NXIA 1U25A 5B08A 4IOAQ 1JLFA 1KR4A 1OO0B 1RT7B 2MMYA 4MJKA 3HHLD 4U7CA 1S9GA 2UV8A 2ZWPA 1ELOA 5KFFA 1Q8KA 3CD7A 4CH1A 1TTHB 4M5NA 1NRKA 4B9NA 1S57A 5A0YB 4IDKA 1U45A 5D78A 3CJTA 3AJDA 1AT1B 1TV6A 4QIEA 1VBXA 3BGFA 2YKPA 4FYWB 1DTTA 4LBPA 4DR2F 4IYQA 4CT9A 2XB2D 3MMBB 2ZH5A 1CULA 3Q8VA 2F40A 4RNHA 3UR3C 3C19A 4B3SJ 4DV4J 3EGVA 3CCRS 1RKIA 1TL7A 3AH6A 3NS7B 3VALA 2MDAA 3BDEA 1NJXA 3UPFA 1WTFA 5FD1A 4M94A 2Z4PA 1S72S 3US5A 4YB5A 3SBMA 3HFKA 3BGLA 2GIQA 1NK6A 2EG2A 3H98A 2HK3A 3QJLA 5HQMA 1AUDA 2KU7A 5A8WA 2GVDB 3IBFB 5L1LA 5KFXA 3CCMS 2O66A 2ZNZA 2QSWA 1LFWA 2BJ3A 3PHEA 1TK5A 1NSQA 2Q66A 1IN0A 3EGWB 4F7VA 3EJMA 2CJQA 4MK7A 1RB0A 2XHCA 2AW0A 1B4SA 1H73A 4I69A 5J2PA 4NRTA 1M5KC 4OZJA 4ZVQB 3FSYA 2EVZA 3KJVB 1OYDA 2QYGA 2VB6A 4ZITA 1OPIA 3LUYA 1RJJA 2R4FA 2YWKA 2ZOFA 5ETNA 3MMCB 1K9MT 1BXNA 1HNIB 1RA6A 2OAUA 3C5XC 4YB7A 4NZ0A 3ULHA 1VQ8S 1U4BA 4DV0F 1IQZA 1BQMA 2D9PA 4ED1A 5J2MA 2HFZA 3JSMB 3GV5B 2MJUA 3ZC4A 3DLKB 3BB5A 3OTOJ 2V2VA 3OBIA 1T0TV 3J7ZT 2NPIA 1YBUA 2CJBA 4WPAA 3FMBA 3QRPA 2GVDA 2BQRA 4UOHA 4EWTA 1K8AT 1HKAA 7AT1B 3HI9A 1EB0A 3IM8A 2CIMA 3FRZA 3MM5B 3JAMY 3D6MB 2H5EA 4M5GA 2XEXA 5DZ6A 4ZLPA 2QRRA 2MQQA 5IV4A 2R8IA 2L9DA 2CJYB 3VQSA 1TKTA 4ZPTR 4RW6B 1ZM4A 2KDOA 4ZPCA 1A0OB 2QZ8A 1VQPS 4LF4J 2KKHA 4ECXA 2KXHA 1UJ4A 4OV1A 3HT0A 1RT6B 2QN6B 4ZPDA 1MWYA 5E33A 3DI6B 4F4XA 3G82A 5C5JA 4OI1A 2FTRA 3GSDA 2AEJA 4OI2A 4XPEA 3Q23A 3CCWA 5A8RA 1MN9A 2DK2A 2RIJA 3BBBA 2XLIA 3R97A 1E6YA 2NXNA 2V2ZA 2EG1A 2YKQA 4RUCA 2DR8A 3BDPA 2YWGA 2E1RA 2MZQA 4KB7A 5F3TA 1IUJA 4EFAC 1ZBTA 1S12A 4DR1F 2V63A 4KFBA 1HMVB 1Q86T 1UEVA 1O0PA 4RW6A 4B3RJ 2AGPA 4FKYA 4RNMA 3RAQA 4CLPA 4W90B 5IFMA 2KH9A 2UUTA 1HL6A 2CA9A 4JYAF 2X3GA 1IKXB 4IH7A 2YH0A 4KGKA 4JI7F 5LJ5Y 5IXUA 1IJEB 2FHOB 3AXKA 2HYIB 4NWBA 3UD3P 4PWWA 4I2PA 2KG0A 4PRFA 2DGVA 3DI6A 3PFOA 3ZXWA 4FXWA 3HMJG 2V94A 4DLGA 1X5PA 5KG6A 2GAGC 1U0SA 1A6LA 2VDHA 1XTZA 4J9OA 1NH7A 1V3ZA 5F8GA 4EO6A 4A8MP 4O0NA 2HVEA 1UKUA 3IC1A 3QPIA 4U9RA 1U1RA 3HXMA 2MZ1A 1PJ5A 3J80U 3HVTB 4MFBA 3ZZUA 3BH7B 3JYTB 4JV5J 4YR0A 1RT5B 2G4BA 2NCKL 4DPWA 2ZBRA 2BM1A 3MF5A 1PKUA 2CJAA 2P6TA 1HYSB 2E7XA 4R5PB 4DQQA 2ZHOA 2XLKA 2X51A 2PMZD 1QTNB 1T8EA 2HWIA 3R5GA 4E0DA 4AT1B 3M9OB 4X4OA 3SEOA 4O44B 3CJ4A 2M2BA 1HBUB 2JOQA 1RLCL 4FYDA 1X7VA 2HGLA 1T9WA 3AOCA 5J1PA 4KT0C 1WWHA 5HVGA 1VC6A 4TKTA 3MUVP 2FQQB 3RGIA 4FYXB 3PR4A 2DH7A 4PYAA 1QM9A 5D4LA 5CA5A 4ECSA 3M32B 3GP9A 2LA6A 1UVMA 4TQSA 1LW2A 1TUVA 3OXFA 4ZIVA 2FVRA 1FK9A 2VFTA 2J5AA 3LH2S 4M95A 2LDIA 4OI4A 3MEDA 3NGSA 3GYGA 4Y2KA 4ED2A 1P9QC 2CPIA 1WI8A 1DTQA 2V5HG 4LRFA 1YX2A 3IA0A 2KZMA 3K5NA 2DB1A 2HHSA 3FDSA 3R7NB 2RMLA 2P8IA 2DT9A 1UFKA 3RBEA 3M2UB 3W60A 5J2NB 1T9YA 1MU2B 2DR5A 2CWXA 3NAIA 1U6BA 1HYSA 4DQRA 2ATCB 4R5PA 1U1MA 2JEIA 2RF2A 2AP6A 2KT5A 3PJXA 4LQ3A 4NL5A 4O44A 1NDKA 1JJ2R 2HHWA 5C2GA 2F3JA 4ENOA 1RTIB 4H4KC 1HI1A 1SC6A 3LANA 3NWRA 4EO8A 1PAEX 2BJ8A 1NZAA 5IM0B 1QE1A 5J2QB 1NMEB 3OTEA 3GIRA 3U1MA 3IGVA 2HIQA 1RT4B 1F6TA 3DLEA 4ALZA 2M88A 1UVLA 5T7LA 4F36A 1QAXA 2VBZA 2MQPA 4P74A 2K3IA 3KDOA 3VAMA 3IFEA 1RT1B 1GMWD 4J7CA 2HQIA 3OFGA 2XULA 3RR7A 3IMQJ 2YX7A 1BWVA 3DDKA 2OPRB 1O6XA 5LSLA 1YRTA 5C2CA 4X65J 1S6PB 4LFCF 2VC1A 3RW6A 1EP4A 1MU2A 1JLGB 5HO4A 4FBUA 4PPZA 3NS6A 1N88A 1CG2A 2CQIA 1WOPA 1RT2B 5DRKA 3BV8A 4OHXA 4DR4J 2LU1A 1QVFR 1N32F 1FRXA 2W2PP 4NI2A 3RZAA 4WKRA 5JVGQ 5E3CA 2LYVA 2Q79A 2B4VA 1EIYB 1M1KT 5J2QA 1LQ9A 4ICLB 5M2PA 1UMJA 4ZLJA 3O2IA 4WBFA 3VV2B 2EKNA 2GAHC 3THPA 1HQUB 2VUGA 3GJSB 4ANEA 3FFIA 3QFHA 1WC3A 3RRGA 3ENQA 1U47A 2N3OA 4UQTA 3FCHA 2XZDB 2J0WA 3L95X 2ABYA 2IRXA 2BBEA 4N7TA 3JSRA 1SXLA 3OFHA 4E98A 3B4MA 4HACA 3CCVS 1HBOA 1HD0A 2BABA 4L6V3 2LLZA 5ADZA 2E44A 5B0AA 2ADBA 2QT7A 3ILJA 1LWCB 5K8PA 3M8ZA 3VGVA 5DZ7A 1UVKA 3PW2A 2EFQA 3DM2A 4DV7F 2HRUA 2QFJA 1R8HA 1VMBA 3J7YI 4TY8A 1OPZA 5AE3A 3I4PA 2VC0A 3DRXA 3MM7A 2IAJA 4PYDA 4J9VA 5L9XA 4RW4A 4L3NA 2D3O1 3DLHA 2J6SA 3DN9A 4MKAA 3K57A 1DZ5A 3HDSA 2G1DA 1VJWA 5HLFB 1CJUA 3IGNA 5KOWA 2VG5B 3AJ2A 3M7VA 4RU2A 1NU4A 4HT7A 2M70A 2HVIA 3I0RA 1L3SA 4RNOA 2H1YA 3K59A 3V6KA 1N33F 3A8EA 2HKEA 1HPZB 4HTIA 2DCUB 2XZTB 3R7BB 1B99A 2B6AB 5GMEA 3D68A 4FDFA 4Y2IA 4O23A 4IO1A 1TQLA 4IG0A 2KRRA 2DEJA 2RILA 3GFXA 2G0CA 4WU2A 1LFPA 1SIZA 1QSYA 1GMUA 2JH3A 2BQUA 2B8PA 3IO1A 3KK3B 3A12A 4KO0B 1R6VA 1X4EA 3J80Y 4GO7X 4JI8F 5DDOC 2KM8B 4RBVA 3QFWA 4G1QB 2DXDA 1HWLA 4ATNA 4MKBA 3KLHA 3NNAA 4AYBD 1CJVB 1UW9A 2RSQA 1FRHA 1U6FA 3QGGA 1DAXA 3HK2A 1YJRA 4BWMA 3HHKA 3OVBA 4C11A 2KTQA 2Y1JA 3Q8PB 3IR6B 1Q5VA 4UZBA 3RBXA 1OY9A 2VG6A 3QYYA 3N9UC 2XM3A 5HMZA 3MCMA 3N6MA 1N5YA 1T9VA 2IMOA 1UCNA 2XMMA 4PG8A 4FF3A 4X66F 4F02A 2B6AA 1Y5NB 4CRJA 4USVA 3DOKB 4RR5A 4QCLA 4PG6A 3LAMA 2DHGA 1PSDA 4WP3A 2V50A 1URRA 3ISZA 3R5BA 4PKDB 4LJMA 4IFVA 4OYWA 4B02A 3BS9A 4LT6A 4H4OA 2K8GA 5A6WA 2D9OA 1RTHB 4B3OB 4ECUA 2UUCJ 1XNRJ 4G1QA 1S1TB 2RS2A 2ZNYA 4RUHA 3CMAS 3HVWA 3J7A1 2W4DA 4HL9A 1AFJA 2HBQB 4O3NA 2VONA 4C48A 1ZZFA 3NNCA 4P73A 1S9EA 4CO0A 2XY5A 2R8GA 1B64A 2X3DA 1NPPA 3CIMA 4PQUB 1ROFA 3EZOA 4F3MA 3GR1A 1Q8LA 3RBZA 4ZVOB 1S0NA 4KKOB 1PIEA 2EFNA 4N41A 2Z2ZA 4P6QA 2XYPB 3MPUB 2HFNA 1FNOA 4JV2A 1TUWA 2XQCA 4WZQA 2QA4S 1LK7A 1TKXA 2DGXA 3A4TA 2VOPA 1RWWB 1AB8A 3DLGB 3HCXA 2QMXA 3OTDA 1S6QA 1FHTA 3K5OA 1C4AA 2FJEB 2VA2A 3NCRA 4F4WA 3Q2SC 4DV5J 1D8YA 1JXEA 3OLBA 4ZCLA 2O5DA 3C6UB 1GX6A 2ZH3A 3PY8A 2Z0GA 2L08A 1NSAA 2OEJA 2ALZA 1FRLA 3D2WA 2OEKA 2HHTA 1V5IB 4EU0A 4QU7A 3L3CA 1IBLF 3NCPA 4MIBA 4X62J 4A8FA 1DHMA 2CPJA 3B54A 3TNVA 3H25A 3R5JB 1FEEA 2OSQA 1ZAWA 3TZXA 4NLQA 5JMNA 5KFBA 5KFZA 1UVNA 3OJUA 2BKPA 2WOMB 1EHWA 4QIWD 2UVRA 1PJ7A 3F73A 3M8PA 4B3SF 1WTBA 1WACA 2CJKA 5DETA 3A8KA 5D4NA 1EZZB 1NK4A 2B9EA 3WX8A 4Y28C 3BGRB 4ZP8A 2Q2GA 2UUBF 1JLCB 4N8OA 3ZTPA 1FERA 3GZ7A 2W7PA 5I3QA 1N56A 2QLFB 2KN4A 2OPPB 3VCDA 3C6UA 3CE8A 5AXNA 1Q79A 2CYYA 4IQMA 2GS8A 5B0DA 3EPIA 2MY7A 4LSLB 2MZSA 4PWDB 2AHOB 4DPUA 4DR5J 2VG7A 3RRHA 3M9MB 2DNPA 1T02A 4NLOA 3WC2A 1FKAF 2A10A 3E01A 1N34J 3QNWB 3V5RA 3LP2A 5F41A 4TLQA 3DRYA 4LFBJ 4C8NA 3TZYA 1OY6A 5KFRA 2J6TA 3RB3A 1JMTA 2W2MP 4LRCA 3GG0A 2HAFA 2ZKUA 1REGX 5C24B 1BY9A 2F65A 2YQ1A 2QE5A 2Q6CA 2V2QA 1D9DA 1T94A 2R7RA 4XAKA 2CPYA 2R2UA 1J2VA 4WYWA 3MI7X 3W8PA 2YNFB 4DV1J 4NA3A 3FEYB 4JI2J 2ZUAA 2XGQA 3TARA 3MR2A 2A6MA 2F63A 3P8BB 1TK0A 2B4OA 2R3VA 5SUHA 3A8IA 4YY3J 3L4BC 3IS9A 3VGUA 1B0PA 4W92B 2W25A 1JK9B 4WK1A 3W2WA 2AYBA 1H7XA 3UDCA 4QW9A 4URQU 1HQ2A 2B3TB 4LIRA 2GX8A 4LF4F 4Y00A 3CDAA 2CQ0A 1JX4A 2AJFE 3M6UA 3LGHA 4FVMA 3C6TB 3TAMB 2VFVA 4NCAA 1RCXB 5G4DA 2HHUA 5MAOA 1S0OA 2GMLA 2UXCJ 3KG4A 2W8KA 4ZA1A 2IMWP 4IR1A 1YQHA 2YY3A 4N76A 2I0XA 3OV7A 2A3JA 4Q8FA 5EGYA 3TJ8A 4YQWA 2E66A 2DHSA 2HGNA 2BACA 1BC6A 1YJTA 2MZTA 1EX8A 3E3XA 4NLRA 1BGXT 2YNFA 3SSQA 2AX1A 4ZPVR 1NK0A 3JB9k 4DR3F 3D1QA 1FKOB 1BQXA 1CBKA 4ZN3A 4UOFA 4OZNA 1NLTA 1T9TA 3QGHA 3HFZB 2FJVA 4B3RF 1WUUA 4LMZA 5F8HA 1DLOB 1RHJB 1H2UX 1P27B 2MGZB 3LA0A 3ZZRA 2KRBA 1NCLA 2JRSA 2NLWA 2QMWA 2FZGB 1FE0A 3IP0A 3C6TA 1NBEB 2DR7A 3TAMA 4KJIA 4QYZJ 4OMFG 1X8DA 2AV5A 3HHNB 4ECYA 2ERRA 1HNXJ 2B9XA 2MY8A 4JB8B 2BDPA 2J9CA 4EYIB 4G6VB 5DDQC 1M5OC 4DX8H 4DSKA 2MYFA 3CC2S 1SKUB 4DMZA 2JJ4D 1ZAXA 2DNOA 2NR0A 1JKHB 3A3NB 3K7RA 4TLRA 4UF4A 4UT4A 1PC5A 1HW8A 2RNEA 2R7TA 4JV5F 4NLYA 1RZMA 1GTEA 1XNQJ 4QJVA 2J8SA 2GMJA 3BO3A 3PIPQ 3GQCA 2C2NA 1PG5B 2FZKB 4DX5A 1FE4A 5B7WA 2DNHA 5FDLB 3OR1B 2HPUA 4X4RA 1IKVB 2C2OB 3PZPA 1JXVA 1DLOA 1YI2S 1KBRA 4K8RA 4J91A 3MFHA 3W1YC 4MH8A 1EAYC 3IG1A 5E7OB 4CNZA 4F8RA 1Q95G 2KYXA 3KLGB 5CABA 2LP4A 2R7UA 3I96A 3M6WA 3SCLE 3DRSB 3ZTQA 4FS2A 1H72C 2UXDF 4OJ3A 1VBZA 2HHVA 2PIIA 1RHRB 1TVRA 3ZTRA 1FRKA 3SQOP 1KQSR 3UWTA 3EDQB 1R0BG 3EXYA 1F5AA 4C0HA 4GO5X 1JKHA 2ZH4A 3B82A 4URGA 1RHKB 3DDIA 3MAAB 2CADA 2M8DB 1KVKA 5HMXA 2ZHBA 1FDNA 3R27A 2BA9A 4CLYA 2JEFA 1FWLA 1GNKA 5KFVA 1APSA 3DRRA 2ROEA 3PHTA 2XWYA 1U09A 2YQ3A 1LWFA 2WW8A 1IBKF 4LR9A 2WW4A 3OR1A 2C3MA 5KFEA 3FQKA 2FLNA 1DBDA 2IC3A 2LEAA 1FA0A 3J81U 1T05A 2I2YA 3MR3A 1XR5A 3QRQA 2IDLA 5KFPA 5FJ4A 3NGTA 3KTQA 2C3YA 4F3OA 2ZVIA 1KHWA 2GHPA 1VLYA 2IM0A 2V67A 4MYTA 3CUNA 2JWNA 1E6VA 3EGZA 1WEYA 1IBMF 2DNRA 1FI4A 2NUHA 4IOCQ 4UOGA 3ZNJ1 4G3IA 2LFVA 3D1HA 2AEMA 1KONA 1ZTTA 3MAAA 2NYHA 2HNZB 3GJQB 5KT7A 2JEGA 5ETQA 1ZOTA 5K20B 3O8WA 2ZUGA 4X65F 3PR5B 1UA1A 3EWGA 2JZ5A 2H3EB 4ED7A 1KFSA 2HS3A 1G4CA 4RW7B 1KRPA 1IXKA 3G6VA 8RUCA 4WFXA 2BOPA 1VBKA 1K1QA 4ZIWA 2HWTA 1U2RA 2YKOA 3DHXA 3N6LA 4DR4F 2ZH2A 1RAAB 2XSFA 2Z30B 1YKWA 5CYQA 4F0MA 3LAKA 3DGPA 3O5TB 3CMQA 3UNYA 2K7KA 2WAQD 4DHVA 2GA7A 5IZHA 4PPDA 5K14A 2P5VA 4LR8A 1CC7A 2WSEC 1UAWA 4Q2MA 4ZHRB 3KLFB 4M5LA 3Q8SB 3GG1A 3HZGA 3NGUA 3BKUA 1ZM3A 2MZRA 2N82B 1KLNA 4ZCKA 3ILLA 3Q89A 2BM0A 2P9CA 3MTJA 2H5JB 1RSCA 4DI6A 4NLSA 3FBBA 1TELA 1QSSA 2NQPA 1NK8A 2LCWA 4RNFA 3M8RA 3ZZYA 3QZ8A 5IWAJ 2IM1A 2LXIA 1WC1A 2IVYA 1VFJA 4FKXA 4P75A 3KG0A 1PC4A 3D4JA 1HWUA 4X4SA 4CH7A 1U1OA 4P7TA 3SYZA 4M5JA 3PKMA 2D1CA 2ZJQQ 4G1PA 4KTQA 1RA7A 3PCOB 3LWLA 4ECVA 2F1FA 1M90T 2XCPA 2DNLA 4DX7A 3FQLA 3FJ2A 3P96A 4UTGA 2HNYA 4USWA 2XBPA 2OPSA 4ZHRA 3M2RB 3CD5A 2CRLA 1CS4A 3HD2A 3FK4A 1CJTB 4GKKF 1PGZA 3VVUA 3O44A 4QR0A 1DY3A 1VISA 4QWDA 1REVA 2HQDA 2W1BA 2K7JA 4QQBA 1UP1A 4P71A 3VGTA 3U1LA 3S1TA 4BC9A 1D0EA 4Q0BA 1Z1ZA 3RW7A 2DNKA 4X4VA 2ZD1B 3LZ8A 3CCJS 1TKZB 3MMJA 2HHHJ 3MTKA 3TYTA 1FKPB 2BANB 1NPRA 2OI2A 2XNQA 1GMVA 3ICLA 4RUBA 5B0EA 1PYOB 2FZCB 1TL3A 1Q5YA 1AROP 4F4ZA 2D3OR 4ZPBA 4LF9J 2C22A 1NJZA 1FD2A 1S1VB 2RU3A 3GCXP 4NPOA 3NL0A 2G0JA 2LXUA 3UCZP 1R0AB 3MEGA 2CZVC 4JI4J 5KFLA 2ASLA 1R3NA 1WI6A 4OI3A 4DEZA 2YNGB 2CQCA 2ZKTA 3QSIA 3KLEB 1YJWS 3V4MA 2VL1A 2YBVA 1IR2A 1CJTA 4DWIA 2E5IA 5U47A 4KHPF 2QTWA 4V1Ak 2B9YA 3SZ2A 2WCXA 3MR6A 4ZP7A
chains in the Genus database with same CATH topology
2HFVA 4J80A 1GMWD 3TJAA 3AGYA 1EB0A 3LA0A 3AGXA 1GMUA 1GMVA 1NLTA 3NY0A 2Q2GA 1XAOA 1GMWA 4L3KA 1EARA 2B26A 2QLDA 3I38A 1C3GA 3TJ8A 3L9ZA 3NXZA 3TJ9A 3LZ8A 3AGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFV A;  4J80 A;  1GMW D;  3TJA A;  3AGY A;  1EB0 A;  3LA0 A;  3AGX A;  1GMU A;  1GMV A;  1NLT A;  3NY0 A;  2Q2G A;  1XAO A;  1GMW A;  4L3K A;  1EAR A;  2B26 A;  2QLD A;  3I38 A;  1C3G A;  3TJ8 A;  3L9Z A;  3NXZ A;  3TJ9 A;  3LZ8 A;  3AGZ A; 
#chains in the Genus database with same CATH topology
 3IXQ A;  2XC9 A;  3GMG A;  2W9C B;  2AQ4 A;  2F9D A;  4DU8 A;  4IH6 A;  1Q82 T;  4CYU A;  3NOC A;  4EZ6 A;  5B0C A;  2AGO A;  1YLX A;  1JLA B;  4ECW A;  3D7S B;  1NH8 A;  4RW9 B;  2V4Q A;  3BH6 B;  4RNN A;  1XNR F;  1S7I A;  4B3M J;  3L09 A;  3I56 S;  4DSF A;  3H2V E;  1PJ6 A;  3CDE A;  5BYR A;  4YR2 A;  1H0H B;  2GHV C;  2X1A A;  4QIF A;  4C98 A;  2FJX A;  2NPF A;  1L3K A;  3J81 Y;  3G6Y A;  3MUT P;  1UL3 A;  3KNG A;  2DHX A;  4ZVS B;  4F4Y A;  2OML A;  3GYX B;  2B5J A;  5D3G A;  2YNG A;  2Y3Y A;  3KLE A;  1SC1 B;  2XWX A;  3KLI B;  1C0T B;  2CFX A;  2HZV A;  2IFX A;  1URN A;  3BN4 A;  4DQI A;  1HR0 F;  2KFY A;  3JSY A;  1XK8 A;  2O1P A;  3CNQ P;  4Y65 A;  1QDU B;  5I3U B;  2Y1I A;  3KFW X;  4DS4 A;  4FF1 A;  1YVF A;  5KFG A;  4PG7 A;  3HVA A;  3N28 A;  2VQF J;  2ZC3 A;  3R9L A;  2DPJ A;  4Y6I A;  5J1E A;  2YNI A;  4HR2 A;  1HFE L;  4NLD A;  1JLA A;  3L7P A;  2NUU G;  4LQ9 A;  1MMN A;  3NKY A;  4NLP A;  4WXW A;  4I6W A;  1J5O B;  5CCL A;  3V6J A;  5DQI A;  5CQG A;  4DV5 F;  4LF5 F;  1FWP A;  1S1X B;  1KKH A;  2MKY A;  5KT3 A;  3AQP A;  3F56 A;  3POT A;  4PUO B;  4IRD A;  3MM8 A;  4ED8 A;  1S10 A;  1S97 A;  1FFW B;  1YJN S;  3VGS A;  1BUX A;  3BKF A;  3CJK A;  2RUG A;  3VWS A;  1HAR A;  4M1K A;  4B3T F;  1RTD B;  3DGV A;  4DLE A;  3N0V A;  5HAO A;  3CWJ A;  3K5P A;  4I2Q A;  2ZJR Q;  3BF4 A;  4ZN1 A;  4X62 F;  5EWG A;  1QUP A;  1XER A;  4FP9 A;  1NLK L;  1U0H A;  5IT9 Y;  2MKI A;  1C0T A;  1RK8 A;  4ED0 A;  1R6Y A;  4DUT A;  1M5V C;  3DOM A;  2M52 A;  1UWB B;  2RDJ A;  4N8N A;  1YJ9 S;  2W24 A;  2MKC A;  3MPV A;  3C3L A;  1VQ9 S;  1H7W A;  1K47 A;  3T5K A;  3AFG A;  3W7B A;  2F4V F;  4C2M A;  3FZB A;  4AL7 A;  2XS7 A;  2UXB J;  1NKE A;  2PSZ A;  4CZC A;  5HBM B;  3DKD A;  4NYZ A;  2N7C A;  3CB4 A;  3AA9 A;  2W9B A;  2OFH X;  1FDA A;  4WXO A;  2JFD A;  1GXU A;  5L46 A;  4PUO A;  2CNO B;  2AZ1 A;  3D54 A;  2NZ4 A;  3V4I A;  4MAK A;  3UVJ B;  3G4S S;  3GCW P;  1FF2 A;  3U27 A;  2Y8W A;  5K8N A;  2LEC A;  1FTC A;  3H7H B;  2XYH B;  1SJF A;  4K4X A;  4DR5 F;  2HSE B;  4GKJ F;  1VQO S;  4DS5 A;  1RWO B;  1X5O A;  2M3D A;  2MQO A;  5JVH Q;  1GK8 A;  1VRT B;  3R3T A;  3SCK E;  4LFB F;  5LMN J;  3V2U C;  2GQC A;  3QIP B;  3OSP A;  3TZW A;  2JFK A;  1RXO B;  4NOH A;  3WIV A;  1M1H A;  4TVA B;  1G3O A;  5HBM A;  2HGM A;  3HM9 A;  4BHQ A;  3SV4 A;  5J1N A;  3R6L B;  2AYG A;  4J9S A;  4HKQ A;  2D3Z A;  2ZBQ A;  4HVZ A;  2A2C A;  2JLF A;  2RQK A;  4WZM A;  3RU0 A;  3BEG B;  2DKO B;  4BWJ A;  2DRB A;  5EN1 A;  1JJ4 A;  2UUA F;  1IWG A;  2A2D A;  2VPY B;  5DQG A;  2VIH A;  3PRB A;  3IWX A;  4IG3 B;  1RI7 A;  2YPY A;  4YY3 F;  4LF8 J;  3C66 A;  3TZZ A;  1OS5 A;  3E51 A;  2DNM A;  3ZNU A;  5FII A;  4A8Q A;  3FCW A;  2R2R A;  3RR8 A;  2HZA A;  2E5L J;  2BJ9 A;  1H98 A;  4P2S A;  4RL1 A;  1KVI A;  4WWS A;  3FRY A;  1SKS A;  2IJN A;  2HZC A;  5LSR A;  4QWA A;  3PEH A;  2WVE A;  3ENA A;  3IRX B;  5DM6 Q;  1JWW A;  4FN5 A;  1RAD B;  4OZ3 A;  2DBB A;  1MNE A;  2JEJ A;  2WTF A;  4ZP9 A;  5IT4 A;  4DR7 F;  1F3V A;  2UXC F;  3PO4 A;  2E7W A;  2VAS A;  3KLV A;  2CAJ A;  4DZD A;  3VAH A;  5K9F A;  2PT0 A;  5LL6 d;  2RH3 A;  2PE8 A;  1IBC B;  1N36 J;  1RDR A;  2H51 B;  3JQM A;  1S9F A;  1BD6 A;  3NEK A;  3RUB L;  3U02 A;  1A9N B;  2IBK A;  2FDN A;  1RWP B;  1V9O A;  1Z2L A;  3GIL A;  4IG3 A;  2E1C A;  1KTV A;  2E1M C;  5GMK a;  1VI7 A;  4RBU A;  1F2H A;  3OR2 A;  2QIF A;  2B26 A;  4CP5 A;  4RPF A;  3W8G A;  1KHV A;  1X9S A;  1GXT A;  3LP1 A;  5ETR A;  4AXI A;  1I51 B;  4UOC A;  2EBE A;  2AD9 A;  3TAP A;  5CYM A;  3AOD A;  2DIS A;  4LF7 J;  4P2F A;  2CJX B;  2R42 A;  3X3U A;  1T11 A;  3KMQ A;  4FNI A;  5KFI A;  3VAK A;  1TKD A;  4CLS A;  1PO6 A;  5KFQ A;  3B6B A;  4B08 A;  1RHU B;  1SB6 A;  3EYZ A;  3UD5 A;  1HNX F;  1VYA A;  7FD1 A;  2ZDP A;  4ERD A;  3CPW R;  1SJ4 P;  4LRA A;  2UP1 A;  4KR0 B;  2DYA A;  4HTJ A;  4JV0 A;  2OEM A;  2UUW A;  3BBC A;  4I64 A;  5B09 A;  1PYT A;  1NZ8 A;  2ALY B;  3THT A;  1L3U A;  3OHA A;  5HMY A;  5LMU J;  2XSJ A;  1AZS A;  3AQO A;  4Q5V A;  3SDE B;  5FLX U;  3AD9 C;  5BXI A;  2FJW A;  4QWB A;  2HQ3 A;  3M30 A;  5DG7 A;  2FC8 A;  3M6X A;  4IFY B;  1FEH A;  2GCF A;  1YG0 A;  2P9E A;  2V9W A;  1SH0 A;  3MEC A;  5KFJ A;  2OLW A;  3WDO A;  2YX1 A;  1DQ8 A;  2X1F A;  1T7P A;  2OJ3 A;  1X31 C;  1U1Q A;  1RWK B;  3NBP B;  2MPU A;  4OX6 A;  2ASY A;  2ZM6 J;  3GYN A;  1JLF B;  5L8R C;  2VA3 A;  1T03 A;  1S1W B;  4R0E A;  2PI5 A;  5E3P A;  1S9G B;  4Q44 A;  3I31 A;  1ZA1 B;  4JI3 J;  3MD3 A;  3THV A;  4YHH J;  4I6Y A;  3W9H A;  3QWU A;  2WB4 A;  3IAS 9;  4OJH A;  3I32 A;  1SPB P;  2HND A;  4IDK B;  3MGJ A;  2UVU A;  4ED4 A;  4Q8E A;  3KUG A;  2E9Z A;  5KOX A;  3DXB A;  3Q22 A;  3M8Q A;  3CCU S;  1M5S A;  3AGY A;  5LXR A;  5IS2 A;  1FXR A;  4PXE A;  3PAC A;  2F7V A;  1S4E A;  1CUL B;  1Y11 A;  4OYO A;  3OLA A;  1LWX A;  4ZVE A;  1C1C B;  3T5J A;  2WZ1 A;  3OJS A;  1SJ1 A;  2NSB A;  1XR6 A;  5ETS A;  4I7F B;  4DZ6 A;  1RGV A;  2IRY A;  2AYM A;  4USI A;  3AXM A;  1WEZ A;  1XEZ A;  2L3M A;  3BPS P;  3NBP A;  3TW0 A;  5A8W B;  5KFO A;  1VRU A;  1WJ9 A;  2ACY A;  5LJ3 Y;  4O3S A;  4K4V A;  1S1W A;  3MD1 A;  2NXJ A;  2F8H A;  5DDP C;  4I1T A;  4C8M A;  4H4M B;  3T3F A;  4LVN P;  2OGU A;  4UUW A;  5AT1 B;  5J2P B;  2RQ4 A;  1NDC A;  1BHN A;  4TU8 A;  1R8A A;  4DR2 J;  2ZBI A;  4L75 A;  3UDV A;  3WBZ A;  2C3U A;  3AAW B;  4WYL A;  4JI1 J;  2OIH A;  3OD2 A;  2W01 A;  4ZPA A;  2NSC A;  3LWM A;  1WG5 A;  5A8K A;  2XGP A;  1C1C A;  1DJ0 A;  1QAY A;  3CDB A;  1BQM B;  3BR8 A;  5J2M B;  2QLB B;  2V68 A;  3JTP A;  4I7F A;  1G1X A;  4MYU A;  4W4M A;  4AQY J;  4PZV A;  2EBG A;  1SH3 A;  2J9D A;  3JQJ A;  2XO7 A;  1SJ3 P;  4TU9 A;  2HG4 A;  4J9N A;  2M8H A;  5CH7 B;  4ELT A;  5LM7 E;  2ZOG A;  1W2I A;  5D0E A;  2DY9 A;  3KDN A;  4DPT A;  3KK1 B;  2HBR B;  4C8K A;  3GV7 B;  1TAQ A;  4H4M A;  4F2R A;  1VJQ A;  2RB7 A;  1TKT B;  2LDY A;  1WNE A;  4EUV A;  3NOG A;  2HHP A;  2B43 A;  3VAI A;  4K4Z A;  4F2S A;  3O6Q A;  4UZC A;  2BUN A;  1ICE B;  4X64 F;  4O3Q A;  3Q83 A;  3GFZ A;  3FSI A;  3DFE A;  4OFZ A;  1JNR B;  4FVC A;  6FDR A;  2LEB A;  3BQ1 A;  2G13 A;  1S4F A;  1LEO A;  1UA0 A;  2E9T A;  3G82 B;  3NGK A;  1WEX A;  4DSL A;  2CQ4 A;  2BXJ A;  5IWA F;  1UWA A;  4RJV A;  3W2V A;  3D0I E;  4LF6 J;  2R7Q A;  2RU9 A;  3C14 A;  3CCT A;  3RAM A;  5C42 A;  2DXE A;  1SCJ B;  5A8R B;  4K4T A;  4KSE B;  3Q8R B;  2HIY A;  3HF5 A;  3H8Y A;  3PV8 A;  3I5B A;  8AT1 B;  5A76 A;  3TUZ C;  1E6Y B;  4E2F B;  4A48 A;  1WSR A;  2JZ8 A;  4L72 B;  3KK1 A;  3RAX A;  4DF4 A;  1B7F A;  2VFU A;  4ECR A;  4KFB B;  2PFD A;  2I8E A;  2D3U A;  1KQG B;  4WII A;  2DTJ A;  4D3H A;  2R7S A;  2QA2 A;  2U2F A;  2CJ9 A;  4ELV A;  4O3P A;  2I1R A;  4RUA A;  4MIW A;  3QGP A;  4ZCM A;  1R89 A;  4M5K A;  4I2P B;  4J9R A;  2FVQ A;  1WDT A;  1F2G A;  5ETL A;  1SKW A;  2YWW A;  1KFD A;  3QJP A;  2HHH F;  3NGR A;  4DSJ A;  5D4P A;  1SQE A;  2M0G B;  5FLX Y;  3DMJ B;  3OTC A;  3UD4 P;  1RAJ A;  3ELH A;  2VPZ B;  5E3R A;  2FJB B;  4JI6 F;  2VD3 A;  4LF9 F;  3EMT A;  4C8O A;  4FXD A;  2CPE A;  2OPQ A;  1N52 B;  2RDD A;  3ZZT A;  4MFB B;  3KXD A;  4O4R A;  2MTL A;  4JI4 F;  1JJH A;  3AGX A;  3T9Z A;  1K0V A;  2DY1 A;  3D6T B;  5EWF A;  1G7C B;  1FDB A;  3I87 A;  4JYA J;  3OSN A;  3TVZ A;  2KXN B;  1N4L A;  2VZ9 A;  2RKI A;  2ZBP A;  3GJT B;  3KWM A;  1F9E B;  2VPX B;  2XMJ A;  2HVZ A;  1I94 F;  2XS2 A;  2ZVS A;  4ECT A;  1NPK A;  3OFF A;  5H9F K;  4K5R A;  1K0T A;  2ASJ A;  3UCU P;  4Z2X A;  3KHR A;  1LW2 B;  5KT4 A;  4NLT A;  1F5C A;  4IKA A;  1FK9 B;  4I0W A;  1WKL A;  2BZ2 A;  2AJ0 A;  3MED B;  4B3M F;  4QWE A;  3DMJ A;  1N0V C;  2QL5 B;  2LEP A;  2CDQ A;  2ZH1 A;  3HJV A;  1AW0 A;  2XY7 A;  4C6A A;  1DTQ B;  2DGT A;  3E2E A;  3BO4 A;  4ID5 A;  4ETX A;  2BQ3 A;  2N3L A;  1HA1 A;  3N6N A;  2DVI A;  1L3V A;  1RUS A;  5HRO B;  2V8P A;  3M1V A;  2CZ4 A;  4Y34 A;  4ZLN A;  5ETV A;  3MM9 A;  2RF2 B;  3GSI A;  3SV3 A;  3QO9 A;  2QL7 B;  3G2X A;  3M6V A;  4NLX A;  2KG1 A;  4DCO B;  4QPX A;  5HJX A;  4X4P A;  4RLE A;  2MQN A;  2GJI A;  4ECQ A;  3NG8 A;  2I6W A;  2W9A A;  3MXH P;  3C15 A;  1S0V A;  2AJ4 A;  1U49 A;  2W4C A;  1VQ6 S;  1QE1 B;  3J81 j;  1KQF B;  2DIV A;  4YDD B;  5C25 A;  3LW5 C;  3D67 A;  1X5T A;  4WCE Q;  4ZVH A;  5THW A;  2H4Y B;  4NRU A;  2OTJ S;  2E9R X;  4HH1 A;  4RWW A;  4ZDN A;  3DLE B;  3MPD A;  4WK3 A;  2PMW A;  4BCA A;  5T7L B;  5E3A A;  3DCA A;  2PA8 D;  3TI0 A;  4OV6 A;  2AMC B;  1U1K A;  3UNG C;  5I42 A;  2KHC A;  3MFI A;  1KD1 T;  1IKY A;  1TP7 A;  1X4C A;  5AE2 A;  3DYA A;  1WC0 A;  2B56 A;  2EXU A;  4U7U K;  1LWE A;  3LPE A;  2WBR A;  5KT2 A;  3SQG A;  3TJ9 A;  1EP4 B;  5HRO A;  2Z58 B;  3AD8 C;  2J6U A;  3BSA A;  1Q7L B;  1EET A;  4WP9 A;  5EHH A;  4CTA A;  2AIR B;  2CUY A;  4ZCI A;  2LQ8 A;  3L7U A;  4CO2 A;  2Y8Y A;  2KT2 A;  3RTV A;  5L1I A;  2EC0 A;  5CZV A;  1VIO A;  3R5D A;  3GE9 A;  3CVK A;  4NI2 B;  3MUM P;  4C8Y A;  2R8J A;  1XQI A;  3GLJ A;  4CCH A;  4RX6 A;  1FD8 A;  3T1H J;  2FB0 A;  1TMM A;  1L3T A;  1ZET A;  1NEE A;  1T3N A;  3F44 A;  1C4C A;  2UXB F;  3DLL Q;  2J0X A;  2YKM A;  1FJC A;  3FFI B;  3CJR A;  4RBT A;  1Y10 A;  3G8T A;  1TL1 A;  3D9B A;  1LV5 A;  3VAG A;  2AU0 A;  4QOT A;  2Z2L A;  3J7A N;  1W2B R;  3QZ7 A;  4TY9 A;  3EM1 A;  3TVK A;  1FFG B;  1NJY A;  3OVA A;  4O3O A;  3R1L A;  1NK7 A;  4HAC B;  4TYA A;  3CO9 A;  1HBO B;  4ED6 A;  4J9L A;  2CDR B;  5A6P A;  4DUZ F;  1RWN B;  5BJR A;  3D6F B;  1HNV A;  1Y3K A;  2FHJ A;  3A1Y G;  3DM2 B;  5K5M A;  3MWB A;  2N7Y A;  1N32 J;  3T41 A;  4TY8 B;  5BR8 J;  1AFI A;  3QBC A;  1IJF B;  3MM7 B;  2IAJ B;  4C8L A;  2IY5 B;  3H2L A;  4N47 A;  1EKS A;  3IBW A;  4RW4 B;  1S1U A;  1MG7 A;  1IR1 A;  1RCO B;  2GV1 A;  2RE1 A;  4OLO A;  2CQH A;  1YRU A;  2YNH A;  3UI3 A;  1CJU B;  2P6S A;  2VV5 A;  4OYZ A;  5LXY A;  2I5J A;  3N5B A;  2BOA A;  3H0P A;  4A8W A;  3I0R B;  5M2U A;  1W7W A;  4PWU A;  5KFU A;  2HQF A;  1RT3 A;  4IG0 B;  5G0R A;  4LF8 F;  2JDJ A;  1GEH A;  5CD4 A;  2UU9 F;  5HK4 A;  3VR1 A;  3N01 A;  3FNN A;  1YIT S;  5GMD A;  4Y2M A;  1VQ7 S;  1HNW F;  2CNN B;  1SL0 A;  2LKZ A;  1FX4 A;  1C0U A;  5GAG I;  3PIO Q;  2GO9 A;  3R8Y A;  4DFM A;  3KLH B;  2RDI A;  4HDG A;  1FJG J;  4NX9 A;  2KFN A;  5I4M A;  4H54 A;  1R8B A;  2KJV A;  4PCQ A;  2CG8 A;  3BPD A;  1SQF A;  1KVJ A;  4X84 A;  1U26 A;  4C11 B;  2BW7 A;  2OD4 A;  1CJK A;  2WSF C;  2K1R A;  4UQG A;  4FYV B;  3V6H A;  3TVY A;  1OQ6 A;  4CO3 A;  2VG6 B;  1LOU A;  1N36 F;  4ILL A;  2VHG A;  4USM A;  1N33 J;  2XHW A;  1N5Y B;  4TQR A;  1XC9 A;  5L9N A;  4A8K A;  1U1P A;  8ATC B;  1WSV A;  4I6A A;  5IQQ A;  4R8U B;  3R1H A;  2MLZ A;  4B9L A;  5KT5 A;  2VU5 A;  3NGD A;  2MLY A;  2XMT A;  1JLQ B;  3T6J A;  4U95 A;  2BJ7 A;  3PTW A;  1LW0 A;  3AGZ A;  2ZBC A;  4U7U D;  1FJE B;  5HQ8 A;  1S7H A;  1WC6 A;  3TAQ A;  4V19 X;  3W9J A;  4IFV B;  2EFV A;  4LF1 A;  2ASD A;  5HVH A;  5DLG A;  3I55 S;  4H4O B;  2PDA A;  4LVO P;  4WE1 B;  2NS1 B;  1YZ6 A;  5F8M A;  1HBM B;  1PCA A;  3UFC X;  2X7I A;  3VHQ A;  3T1Y J;  3CD6 S;  4NXM J;  4F25 A;  4GC6 A;  4FXV A;  1UVI A;  4C0B A;  2PFF B;  4ZJO A;  2A0F B;  3MR7 A;  3Q8Y A;  3TAN A;  4YDX A;  1S9E B;  2CQ2 A;  4K59 A;  1NKB A;  1SUQ A;  3PW5 A;  1P8G A;  1N6Q A;  1WDD A;  1RAO A;  4EYH B;  4OI0 A;  3HHL A;  2MEW A;  3T5H A;  3P5T L;  2DR6 A;  4R8U A;  4DPY A;  5LMU F;  3DOL A;  2FHK A;  2IM2 A;  1JLQ A;  3CXC R;  4ZP6 A;  3EDR B;  2ZZT A;  2HFV A;  3PYE A;  1UZD A;  1TKX B;  4K0K F;  1WHX A;  1S6Q B;  1F1B B;  2IDE A;  4JP8 A;  3CDW A;  4WE1 A;  4B9S A;  2LQ9 A;  1HBM A;  1HHS A;  4LSN A;  2OO4 A;  1X4H A;  2ZFH A;  3EUN A;  5HAT A;  2A18 A;  2KFZ A;  1HWJ A;  2ZM6 F;  1NHU A;  3ILO A;  3GFY A;  4L3K A;  2DO0 A;  2ZC4 A;  1ITP A;  3SSS A;  3H2U B;  2VJV A;  5D0G A;  3CJ0 A;  2FGO A;  2CZ9 A;  4FF4 A;  1Q81 T;  4JI3 F;  2EC2 A;  4YHH F;  2EFG A;  1D1U A;  2M7S A;  5F0W A;  3H5S A;  1K1S A;  4X4T A;  2VKR A;  1JNZ B;  3HHD A;  3CF5 Q;  5ITH A;  3KJN B;  4YFU A;  2YKN A;  4EBC A;  3TEH B;  3FSX A;  3VTI A;  1NO8 A;  1TK8 A;  4PQA A;  2GVZ A;  2O01 C;  1SBR A;  4NE9 C;  2WON A;  4C4W A;  1DRZ A;  4EBD A;  3M8P B;  4MT1 A;  3MHY A;  4R25 A;  3ET6 A;  1QAI A;  2ZZM A;  3BJY A;  1VK3 A;  2E5G A;  5AE1 A;  3NMA A;  2DGQ A;  3W5Y A;  4P2M A;  5DG9 A;  4DQP A;  2CPF A;  2B4U A;  4OZ5 A;  1S48 A;  2AJ1 A;  2V9K A;  4KHR A;  4DV6 J;  4OHZ A;  4J80 A;  1OY8 A;  4DL3 A;  4KY3 A;  2DNQ A;  2J9E A;  1BLU A;  2HUR A;  3A8J A;  4IUF A;  1RAB B;  4NCG A;  3C16 A;  4OJG A;  5AJ3 J;  2W8L A;  3G71 S;  1WHV A;  3HLU A;  4OX7 A;  1WOO A;  2FY1 A;  1RE1 B;  3GU0 A;  4USJ C;  4KGZ B;  2Z57 B;  1FRJ A;  2JVM A;  3SMZ A;  1H2V Z;  3LP0 A;  1IBL J;  5M2R A;  1FX2 A;  2P9G A;  1J27 A;  1WD6 A;  3KNA A;  2VG7 B;  2EW9 A;  1Q0N A;  4DFJ A;  1RAE B;  2Q1L A;  4IOB A;  1FVS A;  1A7G E;  5CCM A;  1YTY A;  3K2Y A;  3E01 B;  4C3K A;  3LP2 B;  3TP2 A;  4PG4 A;  4JI1 F;  5CHC B;  3W61 A;  4ER8 A;  3PW0 A;  3K0J A;  3CTR A;  2FLL A;  4DV4 F;  3MM6 A;  2J9D E;  3OVS A;  4GVB A;  2UVV A;  5HP1 A;  2UUB J;  4RW8 A;  7FDR A;  4OHY A;  4AQY F;  5IOL A;  2FC9 A;  3RB0 A;  2Z8Q A;  4DQS A;  2XNR A;  2IYI A;  2DNY A;  1ZPV A;  4B9V A;  3I0S B;  2J8A A;  1RT7 A;  5L39 A;  1Q8B A;  1RHM B;  3U7J A;  5GVQ A;  3LF0 A;  4CI0 B;  1FJ7 A;  3FVY A;  3IS9 B;  2EWH A;  3DHW C;  5B0B A;  2XI3 A;  3NLC A;  3W2W B;  5A0Y A;  6AT1 B;  4A8X A;  5HN0 A;  2J76 E;  1KP6 A;  3C46 A;  1S76 D;  3D3B J;  2R2T A;  2XMV A;  3MMB A;  4USU A;  1HI8 A;  2PEH A;  4WFZ A;  3BKT A;  2DCL A;  3Q8Q B;  4IR9 A;  3KJF B;  2QLJ B;  4ZS6 A;  1Q4R A;  4U8V A;  3NNH A;  4YS2 A;  4LF6 F;  3OTO F;  2CPX A;  2HMI B;  4LFA J;  2AEF A;  4MK8 A;  3FGV A;  3GIK A;  2GJF A;  3I0S A;  1F5B A;  5EWE A;  4HHH A;  2HQG A;  1FNM A;  1UZH A;  2J0Q D;  1UPP A;  3NXZ A;  2DGU A;  1UJ5 A;  2Q6B A;  1XMO J;  3PX6 A;  5KG0 A;  3GII A;  2CNK B;  2HK2 A;  3KJV A;  2YWH A;  2CQ1 A;  5IT0 A;  3AOB A;  2RT3 A;  3MOZ A;  1FTR A;  4X2B A;  4FNH A;  3MMC A;  2HQC A;  2B51 A;  5KG1 A;  1HNI A;  2DR9 A;  4AL6 A;  3TUI C;  1RAH B;  4CM2 A;  5C7P A;  1BWE A;  1HWI A;  2OKQ A;  2Z2M A;  3FKB A;  3ZZZ A;  3T19 A;  2NRE A;  1QUV A;  1IR0 A;  2R7W A;  1FNX H;  4FF2 A;  4CWB A;  1RIS A;  1B3T A;  1U8W A;  3JSM A;  1VQK S;  4ED5 A;  3UW1 A;  2R7X A;  3UN5 A;  3TUJ C;  3DLK A;  3O1L A;  1OWX A;  1YDL A;  3UO0 A;  2JLG A;  2VPW B;  2R7O A;  4B17 A;  2HMI A;  4NLW A;  4L73 A;  1F0X A;  2G2O A;  1SV5 B;  2FYX A;  3HSJ A;  4PXB A;  5D6G A;  2E29 A;  3MM5 A;  1RYR A;  3NWG A;  4DR3 J;  1GFW B;  1TAU A;  3AD7 C;  1SJR A;  2VDI A;  3PFE A;  3D5M A;  3FZ2 A;  2HLT A;  3NCQ A;  4K4Y A;  1X5S A;  1X0F A;  2FVP A;  1KN6 A;  2BYC A;  1H2T Z;  2ZH8 A;  2WVF A;  4KRW A;  1S77 D;  1QY7 A;  2FHM A;  2GIF A;  3KHH A;  9ATC B;  4Z7Y A;  2HHQ A;  2OUG A;  3EE3 A;  1I1G A;  2OTL S;  3H4B A;  1XMQ J;  1VHF A;  4QZV B;  3IG1 B;  1RT6 A;  4PXD A;  4ANC A;  2CVI A;  3DU6 A;  1VQL S;  1YSJ A;  1NDP A;  2GQQ A;  4NA1 A;  2EK1 A;  1GH8 A;  2RQC A;  1G2E A;  3FC9 A;  4QU6 A;  3NMR A;  2WVD A;  1M5P C;  2K2P A;  3TR5 A;  1TVR B;  4PXC A;  1FCA A;  3RG6 A;  5KG3 A;  3CSK A;  2IRU A;  1PIL A;  1R8C A;  4JI0 J;  1Y5I B;  4UW2 A;  2W2Q P;  3QQC D;  1WHY A;  5K8O A;  1SV5 A;  4OYX A;  2KVI A;  1HI0 P;  2AZ3 A;  1Y9O A;  4TU7 A;  1WHW A;  2QG9 B;  1I5O B;  3CT9 A;  2AX0 A;  2ROG A;  3DRR B;  5E41 A;  2JSX A;  4PAB A;  3UCG A;  1HMV A;  1MN7 A;  1U6Z A;  4JI5 J;  1LWF B;  2GZO A;  4B9T A;  2I38 A;  4KQZ A;  3V81 B;  2DH9 A;  4ZVF A;  1GMW A;  2B7C B;  2H54 B;  3GR0 A;  2IC3 B;  4X4N A;  5GAD U;  2XG8 A;  4WF9 Q;  2DGO A;  1RBA A;  1IKX A;  1T05 B;  3VAJ A;  3D6H B;  3SCJ E;  3WC0 A;  4CLF A;  2CKW A;  3BSC A;  5EX0 A;  2H4W B;  1S79 A;  1GTH A;  2UXD J;  2V8D A;  4U8Y A;  3G96 A;  2V6A A;  1HWK A;  1E6V B;  5KFK A;  1EQ0 A;  1OYE A;  5AXK A;  3TQ1 A;  3SIP B;  5D15 A;  3X1L B;  1R7I A;  2XCA A;  2MHN A;  2HS4 A;  2E5H A;  4Y0F A;  5HI7 A;  1KS2 A;  3HVT A;  3JYT A;  1YBA A;  1RT5 A;  1SQG A;  4FBT A;  5EUH A;  2IJR A;  1RHQ B;  1S59 A;  1UEU A;  4CM0 A;  3G9C A;  3SFU A;  1IBK J;  2OEL A;  2FVC A;  3WX4 A;  3V81 A;  2MXY A;  3PYG A;  2FPH X;  5RUB A;  3RYL A;  1HBU A;  3PX0 A;  3A13 A;  2O3D A;  1IQT A;  3TA1 A;  4XIU A;  1VCT A;  2QO3 A;  3AKO B;  1NDL A;  3BSO A;  4ZJL A;  4M5I A;  4WFN Q;  5CYQ B;  4KGV B;  3M8S A;  1QTM A;  3DGP B;  2RS8 A;  4K50 A;  3H5U A;  4BDP A;  1NB2 A;  3T1H F;  3M32 A;  3EZ5 A;  5EX3 A;  3HD1 A;  2XLJ A;  2OH2 A;  5K14 B;  4YOE A;  3OQ2 A;  1N5Q A;  1D9F A;  1IBM J;  4DL5 A;  1RYS A;  1TFW A;  1FDD A;  2L48 A;  1NHK L;  5DS7 A;  2KYZ A;  4I4B A;  3HSG A;  2MKS A;  1KOO A;  2POK A;  4WP8 A;  4RU9 A;  2QA4 G;  3M2U A;  5J2N A;  1KSP A;  2VIC A;  3CME S;  4ZLL A;  3FEX B;  3BBF A;  1WKJ A;  1RAI B;  2I9S A;  1D9A A;  4OX9 J;  2AWZ A;  4RKU C;  3D28 A;  4QIV A;  3MAQ A;  5HQL A;  3SFG A;  1YJU A;  3BYP A;  5F9L A;  1RTI A;  5BR8 F;  2L41 A;  4DUY J;  1UJ6 A;  3R5A A;  2ZHA A;  3H90 A;  2MHE A;  5IM0 A;  4IRK A;  2EK6 A;  4LRB A;  1U1N A;  2PA3 A;  1GT8 A;  3D66 A;  2HFO A;  3CJ8 A;  3MR5 A;  5E3Q A;  4HT5 A;  4FZV A;  1RT4 A;  3OT9 A;  2HNY B;  3WIU A;  1T9U A;  2OPS B;  4NZ6 A;  1B70 B;  3HZE A;  3K8W A;  2N4D A;  1KWM A;  3TA0 A;  4ES3 A;  2R8H A;  3CJS A;  1OJ4 A;  2CQD A;  3ZTS A;  2XMU A;  1RT1 A;  1CS4 B;  3RRK A;  3MOJ B;  1QAJ A;  2LMI A;  3HJF A;  4NYP A;  3B4D A;  1CLF A;  2ZZN A;  3VZI A;  3CUL A;  3PRD A;  1REV B;  2OPR A;  3EZU A;  2V8G A;  2F5G A;  3MUR P;  1S6P A;  1GQE A;  1JLG A;  2FIU A;  1KQK A;  1PBA A;  2R7V A;  1AYE A;  4Q0B B;  3RB4 A;  4IQX A;  3AB4 B;  4Q7A A;  2J7W A;  1RT2 A;  2OSR A;  4QYZ K;  2KI2 A;  3QT8 A;  3DC2 A;  2MB0 B;  3DRP B;  2ILY A;  4L74 A;  1TUG B;  2AGQ A;  2MST A;  3CW2 C;  1TL3 B;  5DO2 A;  1GAO A;  4C97 A;  1FJG F;  4ICL A;  3DXS X;  2BJD A;  2QJ3 A;  4DJB A;  4KE5 A;  5B0G A;  1VQ4 S;  1HQU A;  3LTO A;  3MEG B;  1C2P A;  1Z2Z A;  4ILR A;  3NRB A;  1VOM A;  3WZ0 A;  1TU0 B;  4U67 Q;  4BBY A;  4NA2 A;  1RWV B;  4GKK J;  2MKK A;  1NJW A;  3OL9 A;  2YXL A;  4MK9 A;  3CC7 S;  2EFO A;  3MDF A;  4M5D B;  4JOU A;  3PDN A;  4BLG A;  1D3W A;  4OJ1 A;  1BE4 A;  3K17 A;  1LWC A;  4EEY A;  3TRG A;  2W7O A;  3EX7 B;  2HFS A;  2F8M A;  4CYU B;  1RAG B;  3ZFV A;  2CPH A;  5JJB A;  2VBW A;  3W64 A;  2NXU A;  4P9S A;  2FUG 9;  3DLB A;  3DRP A;  2H48 B;  1VS3 A;  2GC8 A;  1SKR A;  5DGB A;  4DXL A;  3T1Y F;  3MPW A;  4NXM F;  1W25 A;  4OQJ A;  1TL4 A;  2QGF B;  1YHQ S;  1N5T A;  4DV3 J;  4KV8 B;  1X4A A;  3BSN A;  3ZTO A;  2CQP A;  1XMB A;  1ZH5 A;  1U2C A;  2UV8 G;  3PW4 A;  4QBU A;  4QW8 A;  5HLF A;  4ITS A;  5LOQ A;  2VG5 A;  2HVD A;  4C9D A;  3O3L A;  2ADC A;  2AJ2 A;  2Q43 A;  2QFI A;  1EQM A;  2APO A;  4OYP A;  3RJM B;  4DL4 A;  3QJJ A;  2EI5 A;  4ZPW R;  2R8K A;  2B5J B;  5D3G B;  3CJ5 A;  3V6D B;  1U7L A;  2XZW A;  1U02 A;  1HPZ A;  2ROP A;  4DFK A;  4KHP J;  2LQJ A;  3DNC A;  3EXC X;  4M5D A;  2UZA A;  2FVS A;  3JS9 A;  3SI8 A;  4A8S A;  5JUM A;  4IH5 A;  1OQ3 A;  2ZH6 A;  4HLB A;  2B7B B;  3CJ3 A;  1RQ0 A;  2XO6 A;  3KK3 A;  2QV6 A;  4KO0 A;  3JQK A;  4DPX A;  1DUR A;  4WKY A;  2V0N A;  5J1E B;  2YNI B;  4CO1 A;  1RTZ A;  5E0O A;  3QID A;  3CCZ A;  1YBT A;  3UR0 A;  1NHV A;  2UUC F;  1D09 B;  2L9N A;  1CJV A;  3W5Z A;  3IWN C;  1HHT P;  4D3G A;  4B9M A;  4ECZ A;  1N5V A;  3POT B;  2COL A;  1VQY A;  4KV8 A;  3MM8 B;  5BYS A;  4DL0 C;  2DEI A;  1LXN A;  5B0F A;  5ETT A;  2DIT A;  4N56 A;  3CJK B;  3PG9 A;  2L9W A;  1VQS A;  1QLN A;  3ZZP A;  4J37 A;  2XYG B;  4I2Q B;  3QT6 A;  3V6D A;  1U0H B;  2JHE A;  1CPZ A;  4I56 A;  3HPO A;  1NND A;  2CG4 A;  2MQL A;  1HR0 J;  5LT5 A;  4KIA A;  3PO5 A;  3DOM B;  1H38 A;  1H6K X;  3FBC A;  3DOK A;  3CDU A;  3UDL A;  4DG1 B;  3U1N A;  1P9Y A;  3P5B P;  3ETO A;  4J9P A;  2E7V A;  2XI2 A;  3KMS A;  1NAQ A;  1NKC A;  4WFY A;  4ZJQ A;  1RTH A;  2ZWO A;  3Q86 A;  4B3O A;  1S1T A;  2BE9 B;  4LF5 J;  2W9B B;  3NAH A;  2XMA A;  3MCN A;  4DV6 F;  5F8N A;  2VJU A;  2PD1 A;  2NZC A;  2PC6 A;  1DAR A;  3I4H X;  3S8S A;  3V4I B;  2V8V A;  5AJ3 F;  4B3T J;  2OMO A;  3TJA A;  3GTY X;  4QIG A;  3QT5 A;  4C3M A;  2V34 A;  2J7K A;  2YKA A;  3TA2 A;  2CPD A;  4FPR A;  4NZ7 A;  5KG4 A;  4WTO B;  2P2C B;  1TZ0 A;  4PQU A;  1UW4 A;  1V5V A;  4Y2A A;  2Q3P A;  3RBD A;  4LSZ B;  4KKO A;  2YWE A;  2E1P A;  2JX2 A;  3BQ2 A;  5KFY A;  4WJB A;  3RB6 A;  4DG1 A;  5GAE U;  2F4V J;  2MQM A;  2GIR A;  2QYC A;  2BJ1 A;  3HX9 A;  2MZJ A;  1F9H A;  4CDI A;  4MKV A;  3DLG A;  2EKY A;  4YME A;  3GON A;  3G8S A;  1OMS A;  2C2E A;  3JTO A;  1UEK A;  2Y1R I;  5HAN A;  1I3O B;  1WEL A;  3LO3 A;  4M8L A;  3Q0A A;  1NK9 A;  3S7R A;  3PKY A;  4A46 A;  4F50 A;  1B0T A;  3E8O A;  4JV1 A;  3UDE A;  4GRS A;  2NXE A;  4I68 A;  2VKZ G;  1S5Z A;  5CD4 H;  2BV3 A;  3FCV A;  3CC4 S;  3MCS A;  1V6H A;  4DV2 J;  4BS2 A;  2F4F A;  1D8Z A;  1Y3J A;  1O8B A;  4QWC A;  1ZM9 A;  3T9N A;  1HBN B;  2ZDO A;  4GKJ J;  1WC4 A;  3S01 A;  5GAH U;  3EGN A;  4C8Z A;  4M5H A;  2DO4 A;  1X4D A;  3EVO A;  4OZL A;  5KG2 A;  4ETZ A;  2WOM A;  4YB6 A;  4XO0 A;  1YGY A;  1N34 F;  3Q24 A;  1HNZ J;  5GAD I;  2M9K A;  3QAE A;  4UY8 5;  3Q2T C;  3EIC A;  2WBM A;  3QSY B;  3P4U B;  5H9E J;  1PAU B;  3G86 A;  1T3O A;  1M5H A;  4DDF A;  2SXL A;  1XR7 A;  3SXL A;  3BGR A;  3OXL A;  3G6X A;  1JLC A;  1C3G A;  1RWX B;  4O3R A;  1Y4Z B;  3HFV A;  1S99 A;  4LFA F;  3AT1 B;  1MLA A;  2YQ0 A;  1P1T A;  1ULR A;  2RHQ B;  2OPP A;  1JIH A;  1ZM2 A;  2BX6 A;  3M8Y A;  2RD5 C;  3I5C A;  4L76 A;  2UUA J;  2BKO A;  4DV1 F;  1KLM B;  1ACM B;  4JI2 F;  3PXG a;  2FLP A;  1MRO B;  1X4F A;  5CZX A;  4WTY A;  4OL8 A;  3BRE A;  1X60 A;  1OSC A;  4C0O C;  1VIX A;  4LSL A;  1XMO F;  4PWD A;  2KXF A;  3OR2 B;  2DGW A;  1VR6 A;  2KZZ A;  3KYL A;  1S6O A;  2U1A A;  1HBN A;  1Q8I A;  3DDN A;  5SZT A;  1AXQ A;  2AYE A;  3IBC B;  1IKW B;  3HHE A;  4G1I A;  4P52 A;  1YJ7 A;  3LP1 B;  4OHV A;  4XPC A;  4HH0 A;  3ITH B;  1DQA A;  2AJQ A;  4URS A;  1Q7Y T;  4YEA A;  1HLW A;  5CYM B;  5IC6 B;  2VQE J;  3VAF A;  3KKF A;  2V4R A;  4C3L A;  1HD1 A;  3BZQ A;  3MZI A;  3T6B A;  1F3F A;  2HW3 A;  4K4U A;  1OIA A;  5IC4 B;  2DNZ A;  4DR7 J;  4EBE A;  4IO9 Q;  2RQM A;  3FEZ A;  5C24 A;  4Q43 A;  2KT3 A;  3AA8 A;  1ZPW X;  2GNK A;  1RAC B;  1B0V A;  4HDH A;  1SVD A;  3PX4 A;  2FJD B;  4K2X A;  1MSW D;  4K5S A;  5E2Q A;  1N5S A;  1QD1 A;  1MWZ A;  2GHW A;  1V3S A;  1WF2 A;  2ZOM A;  4OHW A;  3TOQ A;  1FWK A;  3R2C J;  2B9W A;  2CVE A;  3D0G E;  3KHL A;  2BMB A;  1KLM A;  1VC0 A;  2CQG A;  3N79 A;  4DCJ B;  1MRO A;  2OP5 A;  2KJW A;  4F67 A;  5BYQ A;  3UN3 A;  2XSJ B;  1AZS B;  2JL9 A;  1YK9 A;  3IWL A;  4CLL A;  3GB0 A;  3KUE A;  4LUB A;  3M30 B;  3VQT A;  2BEF A;  4AUK A;  1IKW A;  3EVM A;  3MEC B;  4OYB A;  2C42 A;  1FXL A;  4NYO A;  2RUS A;  4OYM A;  4HEA 9;  1SC4 B;  1XMQ F;  2Z2Y B;  3ITH A;  3B8H A;  3AB2 B;  1FES A;  1WF0 A;  3PEJ A;  3ISN C;  1M1G A;  3HUL A;  1T03 B;  4OZ2 A;  2JLE A;  3MAH A;  3M8W A;  1VLO A;  4K4S A;  3JXO A;  4DN0 A;  3UN2 A;  3H59 A;  9RUB A;  3W5X A;  5A2Q U;  4JI0 F;  3W66 A;  2HND B;  2HLU A;  5CXT A;  1UTA A;  4CO4 A;  4NCB A;  1FKO A;  3OHB A;  4Q2L A;  3M8Q B;  3GJR B;  4NXN J;  4R0J A;  1XNQ F;  2JVO A;  4WIQ A;  4JI5 F;  2MSS A;  3OPK A;  2QLD A;  3I38 A;  3AY0 A;  2GJ2 A;  1VBY A;  3TO8 A;  4YN3 B;  4DL2 A;  2YX4 A;  1X9W A;  2MGZ A;  4CNY A;  3BQ0 A;  3HHL C;  3ONQ A;  3BYR A;  5KFW A;  2KO1 A;  4P2X A;  4LBH A;  1JJC B;  4DR6 J;  1VRU B;  1XWL A;  2DJW A;  4GVL A;  1XN9 A;  1JXL A;  1UET A;  3KG1 A;  5E5N A;  4ZKA A;  2M4M A;  4PEO A;  4CLU A;  1FRI A;  1U48 A;  2CNL B;  1RBO B;  2Y9H A;  3ZZ0 A;  5ETP A;  3FUY A;  4TNO A;  4OYI A;  2YPZ A;  5CYJ A;  1J5E J;  1CSJ A;  3OL8 A;  3CJ2 A;  1N0U A;  3A3P B;  4ZMM A;  3NY0 A;  3IN5 A;  4A8Y A;  2BR0 A;  4H4K A;  3ETM A;  2IJF A;  3H40 A;  3K5M A;  2C2R A;  2BE7 D;  5CAA A;  3B78 A;  1ZS6 A;  2DGS A;  2V69 A;  1P6T A;  5A8K B;  1T9X A;  5HJY A;  5ETM A;  5FDL A;  4A8O A;  1NUE A;  2HS0 A;  3D3C J;  1UVJ A;  4Q45 A;  1IKV A;  3SCI E;  4ZVU B;  4CT8 A;  2ATL A;  5KFD A;  5H9E K;  4AXJ A;  4HHJ A;  3R2D J;  4O4G B;  4KH1 B;  2ZIT A;  2K06 A;  4KBI A;  4Z7C A;  3W3S A;  3KLG A;  5F8L A;  1VK8 A;  3F0N A;  1AA1 B;  3CCE S;  3DRS A;  2ODX A;  1CQN A;  2FY8 A;  2G2Y A;  2HBY B;  4KHM A;  2IBO A;  2OD6 A;  3CCQ S;  1U1L A;  3F41 A;  4ES2 A;  2IA0 A;  3HSZ A;  4N5S A;  5HL7 Q;  3BN7 A;  4KPY A;  4OYA A;  2VFR A;  4CO5 A;  1U8S A;  3J7Z 5;  1MMD A;  4ZVR B;  3TEG A;  2FLO A;  1JQG A;  4CLZ A;  3FMW A;  1F9F A;  1LXJ A;  3BGU A;  2EEY A;  1TR0 A;  4DL6 A;  2J7U A;  1ZYQ A;  3LOU A;  2PN6 A;  2RJZ A;  4I67 A;  2DNN A;  1GX5 A;  1Z4U A;  4OX9 F;  3W2V B;  4AE5 A;  4CQ1 A;  2GFF A;  3C14 B;  4O4G A;  2GGP B;  1AUS L;  5C42 B;  3MCO A;  4F26 A;  3PJW A;  2KB2 A;  4DUY F;  5HVF A;  2GW8 A;  3ENW A;  1UFW A;  2G0I A;  5IT9 U;  2QLW A;  2BW2 A;  1H3D A;  3LGN A;  2RHS B;  4DX6 A;  3M05 A;  2VF3 A;  4YB1 P;  2QEX S;  1LK5 A;  3H42 A;  4M63 A;  2CQ3 A;  3WHI A;  3TX0 A;  2RAQ A;  1VQN S;  2BJE A;  2DHA A;  5MLC V;  4N77 A;  4WU3 A;  3LPY A;  4X64 J;  2HNZ A;  1XAO A;  3KUH A;  2A6O A;  4DBQ A;  1N48 A;  1CVJ A;  1IM4 A;  2KVQ E;  2HEK A;  1B7Y B;  1BQN B;  2IHR 1;  2MJN A;  4DV0 J;  4WFA Q;  3A3O B;  4RW7 A;  2JRR A;  4M5M A;  2VBY A;  4F4A A;  2G2Z A;  3FBE A;  3DLJ A;  2BVZ A;  5DDR C;  2HAI A;  2AKW B;  2C2Z B;  2GGP A;  2CPZ A;  1O5J A;  4EGL A;  4CH0 S;  1JB0 C;  3DU5 A;  5DM7 Q;  2IYG A;  4B9U A;  5KFN A;  3LAL A;  1HQE B;  1Y5L B;  4ILM A;  1FT8 A;  4WFB Q;  2HWH A;  1ZA2 B;  1JLE B;  1O51 A;  1R8P A;  3I82 A;  4DSE A;  2OPQ B;  4FYY B;  3C6E C;  2JVR A;  2WVB A;  1RTJ B;  3MMA B;  4X4Q A;  4Y2C A;  1R0C B;  1Y7P A;  3KLF A;  3K58 A;  4LRD A;  4Z37 A;  5KG7 A;  4DL7 A;  3D1O A;  1IVZ A;  3GIJ A;  2NYI A;  4KH0 B;  5ETO A;  2MLX A;  2RKI B;  3HP6 A;  4KPC A;  2PMH A;  2Z56 B;  1BQN A;  3QAT A;  2QLX A;  4EK2 A;  5A2Q Y;  2VOD A;  3ILI A;  3HVR A;  5KFT A;  1SC3 B;  4OZ0 A;  3H20 A;  3QGI A;  2WVC A;  5GAE I;  3GV8 B;  2ZEJ A;  5KAK A;  3H5X A;  3P49 B;  5T14 A;  3ZO7 A;  1KC8 T;  2B4P A;  4ZVG A;  1LKZ A;  4TXS A;  4JI6 J;  4XDD A;  1Q16 B;  4ELU A;  1HQE A;  4DV3 F;  3ZZO A;  2DPI A;  1JLE A;  5IV3 A;  1XIQ A;  3HKW A;  3PYF A;  4CLT A;  3NS5 A;  1VDH A;  4ID5 B;  3OUY B;  4CLW A;  3UE2 A;  1T95 A;  2DRA A;  1TL5 A;  3K5L A;  1ZZN A;  1R27 B;  1RTJ A;  4DR1 J;  4MIA A;  3MMA A;  5DGA A;  3I9Z A;  3M2R A;  5HSP A;  3M1V B;  1NM2 A;  4KYZ A;  1X4G A;  3CIZ A;  2RRA A;  3MM9 B;  4HI1 A;  4P10 A;  3BR9 A;  2LA4 A;  3QO9 B;  1VQ5 S;  2X1G A;  2HHX A;  5AXL A;  3R5C A;  4NAS A;  3WQP A;  3AHP A;  3QT7 A;  1PBU A;  2MKH A;  2BRL A;  4JI7 J;  5GAH I;  1SJQ A;  3VVT A;  1HIY A;  3HKZ D;  5L38 A;  2D74 B;  3OTB A;  2W2N P;  3C15 B;  1I94 J;  4U96 A;  3JTN A;  4PAA A;  3KOA A;  1YZ7 A;  5C25 B;  2LVW A;  4AFF A;  4RWX A;  3I9V 9;  2FJA B;  4J9U E;  2ZD1 A;  1CQM A;  1MWQ A;  1WOR A;  3EPG A;  1TKZ A;  2KHD A;  3GFH A;  4ZOS A;  4QYR A;  3IM9 A;  1FKP A;  2XY6 A;  2BAN A;  4QR2 A;  2QC3 A;  2IVM A;  3TUP A;  1R43 A;  5I42 B;  3PM9 A;  2XS5 A;  2DD8 S;  4NEZ A;  3M9N B;  1IKY B;  2D69 A;  1LNQ A;  5KG5 A;  1WKK A;  5HMW A;  1HW9 A;  4TN2 A;  3DYA B;  1S1V A;  2PO4 A;  4JUZ A;  2C2M B;  4ZK7 M;  1LWE B;  2IIH A;  3OUY A;  2JNJ A;  3CGI A;  1R0A A;  1KTQ A;  2ACM A;  1K73 T;  3SQG B;  2EPI A;  2VFS A;  2DH8 A;  3SSR A;  3I6P A;  4HI2 A;  4JBC A;  3NP5 A;  3BGO P;  1YWX A;  3AOA A;  5H1S V;  1UPM B;  1EET B;  2XTJ P;  3GPA A;  4CTA B;  4CIO A;  1YJV A;  2Y0S D;  4USK A;  1RWM B;  2IPO B;  2O67 A;  2R2S A;  3K89 A;  2Y1L B;  4K4W A;  4HYK A;  5D77 A;  2W9C A;  2IM3 A;  5I3P A;  1S6U A;  4P7V A;  1NB7 A;  2VQF F;  2YH1 A;  2BRK A;  6FD1 A;  2R9L A;  1U2F A;  5T41 A;  3G6E S;  5D8H B;  4K2J A;  4F0H A;  2YVS A;  1NJI T;  2YKM B;  4RW9 A;  1TMJ A;  4AL5 A;  2XMK A;  1KEK A;  4LBI A;  4NLU A;  3N4W A;  2CQB A;  1TL1 B;  4G65 A;  5KFS A;  2C3P A;  4DFP A;  4Y3C A;  4DN9 A;  2H65 B;  2PEB A;  4K7Q A;  2WB1 D;  4KGX B;  3CED A;  4KAI A;  1QSL A;  3W63 A;  4NEY A;  1WF1 A;  2DXF A;  4ZVT B;  4OIX A;  1G6B A;  1H74 A;  5L1J A;  3PJ9 A;  1HNV B;  1FRM A;  3TX8 A;  1RU1 A;  2AT1 B;  2PGC A;  2FD2 A;  2G9O A;  3CCL S;  1RBL A;  4KGM A;  3KLI A;  4J90 A;  4LR7 A;  3G8Q A;  1JLB B;  3M4X A;  4AD6 A;  1YIJ S;  4C7Q A;  5LSO A;  1I6J A;  4TYB A;  2BE2 B;  3PNI A;  1RLD A;  4E8U A;  2ZE2 B;  4BC7 A;  2C1E B;  4NML A;  5I3U A;  3OW2 R;  3S6E A;  4QR1 A;  2H9Z A;  2M5Y A;  1ZAV A;  1S1U B;  2GMH A;  1XBW A;  2RVJ A;  4LF2 A;  3ENV A;  2YNH B;  1RP5 A;  1EJ7 L;  2IA6 A;  1Q78 A;  3P6Y C;  4USH A;  2FGC A;  1NSK L;  2I5J B;  3PW7 A;  1J5O A;  4YP3 A;  4NMX A;  1F60 B;  4J5O A;  1S1X A;  5IQ6 A;  4CLK A;  4QPT A;  2G1H A;  3Q8U A;  3L9Z A;  4EZ9 A;  1XJW B;  4OZ1 A;  2QSF A;  2BKN A;  1TFY A;  2LQ5 A;  2JC1 A;  3D0H E;  3OXG A;  1KDN A;  1Y0H A;  1V3R A;  1RT3 B;  5DG8 A;  1FO1 A;  4LFC J;  4DUZ J;  1RTD A;  2XMW A;  5G0R B;  4J9K A;  4DV2 F;  1NSP A;  3P45 B;  1WC5 A;  1VHI A;  3IR7 B;  1VGY A;  1R31 A;  2LU2 A;  3EVW A;  4EI2 A;  3R6G B;  2D41 A;  1JLB A;  1IWA A;  2E5J A;  4MKY A;  2C2K B;  3M2V B;  1MML A;  3ADA C;  2BE2 A;  1C0U B;  2ZE2 A;  4U6P A;  4S0M A;  1UWB A;  2DHH A;  2IVF B;  3LGM A;  1DQ9 A;  1PYS B;  1UFL A;  1SL2 A;  2HVH A;  1FFS B;  1HNZ F;  5D4O A;  5LMN F;  4OLP A;  3MEE B;  2ZH9 A;  4P72 A;  4F3Q A;  3KK2 B;  4XK8 C;  4DU7 A;  1RWU A;  1RKJ A;  1X9M A;  3GIM A;  2MQ8 A;  4X4U A;  2YWF A;  2K3K A;  1SI9 A;  2UVW A;  1W26 A;  1CJK B;  3H4D A;  1VC5 A;  3N5F A;  2K1R B;  2V8H A;  4PG5 A;  4ID8 A;  1RAF B;  2PI4 A;  3HT3 A;  3QWP A;  2AF6 A;  2DIU A;  1Q1K A;  5F8I A;  4LRE A;  2V4J B;  1CEZ A;  3UVJ A;  1Q53 A;  1BMQ B;  2WHO A;  5KFC A;  3OL6 A;  5AXM A;  5KT6 A;  2Y0B B;  4OX8 A;  3W9I A;  1P1L A;  1VQM S;  2UU9 J;  4F4K A;  2HBZ B;  3G87 A;  5F8J A;  2QL9 B;  2V2K A;  1LW0 B;  2E1A A;  3W62 A;  2MKJ A;  4DOZ A;  2DNG A;  5D0R A;  1QJH A;  2E5L F;  1S49 A;  1FVQ A;  1HNW J;  4MTP A;  2D7S A;  4DV7 J;  1WOS A;  5L1K A;  1EKR A;  4XTT A;  2KL8 A;  4W98 A;  3M2V A;  2C3O A;  3QAU A;  1VRT A;  2RRB A;  5KFH A;  5KTQ A;  1K44 A;  2VQE F;  3BM7 A;  2GQ2 A;  3OFE A;  2QMU B;  2A1B A;  3MEE A;  1QVG R;  1FXD A;  3KK2 A;  3QIP A;  4J9M A;  5JXS A;  1Y00 A;  4YUD A;  4RO0 A;  2C2D A;  1SUQ B;  4OI6 A;  3K8V A;  1N6Q B;  4ES1 A;  1IM6 A;  2FHJ D;  3QRR A;  2B0G A;  5EDW A;  3C2P A;  1ZTW A;  2J0S D;  3HHL B;  3KJQ B;  2OHD A;  1VRQ C;  4UY8 T;  2DRD A;  2V4J A;  3R7S B;  3VF0 B;  1GXL A;  5K8M A;  3DOL B;  3CD0 A;  3HSD A;  5F9N A;  2VH7 A;  1C1B B;  1L5U A;  3MEK A;  3VZH A;  3JAM U;  2NXC A;  1YRX A;  2ZH7 A;  3FBF A;  4NLV A;  1SL1 A;  4HHU A;  2CXE A;  4JI8 J;  2F9J A;  5D0H A;  1SH2 A;  4DF8 A;  2QA1 A;  1U24 A;  3IRX A;  4GC7 A;  4LSN B;  3QLH B;  3T1A A;  3PRV A;  4YR3 A;  4LF7 F;  2WRM A;  1NK5 A;  5KFM A;  1WG4 A;  3TWZ A;  2X1B A;  3IR5 B;  4PR6 A;  4IRC A;  3MPY A;  5DJB A;  5F0U A;  1KNZ A;  3W65 A;  2CWK A;  4FPI A;  3BO2 A;  2N4C A;  3UQS A;  1WG1 A;  2LXF A;  2W7A A;  2JC0 A;  2VOO A;  2YTC A;  2HFU A;  4EMD A;  5DLF A;  2W2O P;  3JSB A;  2WSC C;  2YKN B;  4X66 J;  2RRN A;  3IRW P;  3TQE A;  3C8Y A;  2GVZ B;  4NXN F;  4FS1 A;  2GO8 A;  1N54 B;  2WON B;  1X4B A;  2LQB A;  1C1B A;  3QMQ A;  4J9Q A;  4K0K J;  1S0M A;  3ET6 B;  2WK4 A;  2F8E X;  3CO0 P;  4A47 A;  2VBX A;  3PVX A;  4V19 J;  1CC8 A;  2HRY A;  3QLH A;  4DR6 F;  3HO1 A;  1X0P A;  3CJQ A;  3OL7 A;  4ED3 A;  3L7O A;  2HRT A;  4NCG B;  3C16 B;  4KC5 A;  1OSD A;  4O0I A;  4F04 B;  1HHQ A;  3GWC A;  2B8Q A;  1J5E F;  3ISN D;  2QX0 A;  3LP0 B;  1KOH A;  2KM8 C;  4DCP B;  3PYD A;  2C28 A;  3H5Y A;  4A4J A;  4DPO A;  1TV6 B;  1M0S A;  4NLG A;  4LIW A;  1DTT B;  3IAM 9;  4XDC A;  3I5A A;  3SDE A;  2OFG X;  4F0K A;  1RU2 A;  4RZR A;  3T5L A;  1EAR A;  3CCS S;  2H5I B;  3AJ1 A;  1TL7 B;  1N8R T;  5GAG U;  2W4P A;  4GMK A;  4IFY A;  4UUX A;  3P3D A;  5F3Z A;  1SIW B;  3MM6 B;  3J7Y U;  1DFD A;  4GVB B;  5HP1 B;  5DQH A;  4MMO A;  2ILZ A;  4RW8 B;  4UST A;  1MW7 A;  4DSI A;  5KFA A;  4ZVP B;  2ZJP Q;  3KHG A;  5H9F J;  5ETK A;  4AND A;  2EFP A;  3LQV A;  1NXI A;  1U25 A;  5B08 A;  4IOA Q;  1JLF A;  1KR4 A;  1OO0 B;  1RT7 B;  2MMY A;  4MJK A;  3HHL D;  4U7C A;  1S9G A;  2UV8 A;  2ZWP A;  1ELO A;  5KFF A;  1Q8K A;  3CD7 A;  4CH1 A;  1TTH B;  4M5N A;  1NRK A;  4B9N A;  1S57 A;  5A0Y B;  4IDK A;  1U45 A;  5D78 A;  3CJT A;  3AJD A;  1AT1 B;  1TV6 A;  4QIE A;  1VBX A;  3BGF A;  2YKP A;  4FYW B;  1DTT A;  4LBP A;  4DR2 F;  4IYQ A;  4CT9 A;  2XB2 D;  3MMB B;  2ZH5 A;  1CUL A;  3Q8V A;  2F40 A;  4RNH A;  3UR3 C;  3C19 A;  4B3S J;  4DV4 J;  3EGV A;  3CCR S;  1RKI A;  1TL7 A;  3AH6 A;  3NS7 B;  3VAL A;  2MDA A;  3BDE A;  1NJX A;  3UPF A;  1WTF A;  5FD1 A;  4M94 A;  2Z4P A;  1S72 S;  3US5 A;  4YB5 A;  3SBM A;  3HFK A;  3BGL A;  2GIQ A;  1NK6 A;  2EG2 A;  3H98 A;  2HK3 A;  3QJL A;  5HQM A;  1AUD A;  2KU7 A;  5A8W A;  2GVD B;  3IBF B;  5L1L A;  5KFX A;  3CCM S;  2O66 A;  2ZNZ A;  2QSW A;  1LFW A;  2BJ3 A;  3PHE A;  1TK5 A;  1NSQ A;  2Q66 A;  1IN0 A;  3EGW B;  4F7V A;  3EJM A;  2CJQ A;  4MK7 A;  1RB0 A;  2XHC A;  2AW0 A;  1B4S A;  1H73 A;  4I69 A;  5J2P A;  4NRT A;  1M5K C;  4OZJ A;  4ZVQ B;  3FSY A;  2EVZ A;  3KJV B;  1OYD A;  2QYG A;  2VB6 A;  4ZIT A;  1OPI A;  3LUY A;  1RJJ A;  2R4F A;  2YWK A;  2ZOF A;  5ETN A;  3MMC B;  1K9M T;  1BXN A;  1HNI B;  1RA6 A;  2OAU A;  3C5X C;  4YB7 A;  4NZ0 A;  3ULH A;  1VQ8 S;  1U4B A;  4DV0 F;  1IQZ A;  1BQM A;  2D9P A;  4ED1 A;  5J2M A;  2HFZ A;  3JSM B;  3GV5 B;  2MJU A;  3ZC4 A;  3DLK B;  3BB5 A;  3OTO J;  2V2V A;  3OBI A;  1T0T V;  3J7Z T;  2NPI A;  1YBU A;  2CJB A;  4WPA A;  3FMB A;  3QRP A;  2GVD A;  2BQR A;  4UOH A;  4EWT A;  1K8A T;  1HKA A;  7AT1 B;  3HI9 A;  1EB0 A;  3IM8 A;  2CIM A;  3FRZ A;  3MM5 B;  3JAM Y;  3D6M B;  2H5E A;  4M5G A;  2XEX A;  5DZ6 A;  4ZLP A;  2QRR A;  2MQQ A;  5IV4 A;  2R8I A;  2L9D A;  2CJY B;  3VQS A;  1TKT A;  4ZPT R;  4RW6 B;  1ZM4 A;  2KDO A;  4ZPC A;  1A0O B;  2QZ8 A;  1VQP S;  4LF4 J;  2KKH A;  4ECX A;  2KXH A;  1UJ4 A;  4OV1 A;  3HT0 A;  1RT6 B;  2QN6 B;  4ZPD A;  1MWY A;  5E33 A;  3DI6 B;  4F4X A;  3G82 A;  5C5J A;  4OI1 A;  2FTR A;  3GSD A;  2AEJ A;  4OI2 A;  4XPE A;  3Q23 A;  3CCW A;  5A8R A;  1MN9 A;  2DK2 A;  2RIJ A;  3BBB A;  2XLI A;  3R97 A;  1E6Y A;  2NXN A;  2V2Z A;  2EG1 A;  2YKQ A;  4RUC A;  2DR8 A;  3BDP A;  2YWG A;  2E1R A;  2MZQ A;  4KB7 A;  5F3T A;  1IUJ A;  4EFA C;  1ZBT A;  1S12 A;  4DR1 F;  2V63 A;  4KFB A;  1HMV B;  1Q86 T;  1UEV A;  1O0P A;  4RW6 A;  4B3R J;  2AGP A;  4FKY A;  4RNM A;  3RAQ A;  4CLP A;  4W90 B;  5IFM A;  2KH9 A;  2UUT A;  1HL6 A;  2CA9 A;  4JYA F;  2X3G A;  1IKX B;  4IH7 A;  2YH0 A;  4KGK A;  4JI7 F;  5LJ5 Y;  5IXU A;  1IJE B;  2FHO B;  3AXK A;  2HYI B;  4NWB A;  3UD3 P;  4PWW A;  4I2P A;  2KG0 A;  4PRF A;  2DGV A;  3DI6 A;  3PFO A;  3ZXW A;  4FXW A;  3HMJ G;  2V94 A;  4DLG A;  1X5P A;  5KG6 A;  2GAG C;  1U0S A;  1A6L A;  2VDH A;  1XTZ A;  4J9O A;  1NH7 A;  1V3Z A;  5F8G A;  4EO6 A;  4A8M P;  4O0N A;  2HVE A;  1UKU A;  3IC1 A;  3QPI A;  4U9R A;  1U1R A;  3HXM A;  2MZ1 A;  1PJ5 A;  3J80 U;  3HVT B;  4MFB A;  3ZZU A;  3BH7 B;  3JYT B;  4JV5 J;  4YR0 A;  1RT5 B;  2G4B A;  2NCK L;  4DPW A;  2ZBR A;  2BM1 A;  3MF5 A;  1PKU A;  2CJA A;  2P6T A;  1HYS B;  2E7X A;  4R5P B;  4DQQ A;  2ZHO A;  2XLK A;  2X51 A;  2PMZ D;  1QTN B;  1T8E A;  2HWI A;  3R5G A;  4E0D A;  4AT1 B;  3M9O B;  4X4O A;  3SEO A;  4O44 B;  3CJ4 A;  2M2B A;  1HBU B;  2JOQ A;  1RLC L;  4FYD A;  1X7V A;  2HGL A;  1T9W A;  3AOC A;  5J1P A;  4KT0 C;  1WWH A;  5HVG A;  1VC6 A;  4TKT A;  3MUV P;  2FQQ B;  3RGI A;  4FYX B;  3PR4 A;  2DH7 A;  4PYA A;  1QM9 A;  5D4L A;  5CA5 A;  4ECS A;  3M32 B;  3GP9 A;  2LA6 A;  1UVM A;  4TQS A;  1LW2 A;  1TUV A;  3OXF A;  4ZIV A;  2FVR A;  1FK9 A;  2VFT A;  2J5A A;  3LH2 S;  4M95 A;  2LDI A;  4OI4 A;  3MED A;  3NGS A;  3GYG A;  4Y2K A;  4ED2 A;  1P9Q C;  2CPI A;  1WI8 A;  1DTQ A;  2V5H G;  4LRF A;  1YX2 A;  3IA0 A;  2KZM A;  3K5N A;  2DB1 A;  2HHS A;  3FDS A;  3R7N B;  2RML A;  2P8I A;  2DT9 A;  1UFK A;  3RBE A;  3M2U B;  3W60 A;  5J2N B;  1T9Y A;  1MU2 B;  2DR5 A;  2CWX A;  3NAI A;  1U6B A;  1HYS A;  4DQR A;  2ATC B;  4R5P A;  1U1M A;  2JEI A;  2RF2 A;  2AP6 A;  2KT5 A;  3PJX A;  4LQ3 A;  4NL5 A;  4O44 A;  1NDK A;  1JJ2 R;  2HHW A;  5C2G A;  2F3J A;  4ENO A;  1RTI B;  4H4K C;  1HI1 A;  1SC6 A;  3LAN A;  3NWR A;  4EO8 A;  1PAE X;  2BJ8 A;  1NZA A;  5IM0 B;  1QE1 A;  5J2Q B;  1NME B;  3OTE A;  3GIR A;  3U1M A;  3IGV A;  2HIQ A;  1RT4 B;  1F6T A;  3DLE A;  4ALZ A;  2M88 A;  1UVL A;  5T7L A;  4F36 A;  1QAX A;  2VBZ A;  2MQP A;  4P74 A;  2K3I A;  3KDO A;  3VAM A;  3IFE A;  1RT1 B;  1GMW D;  4J7C A;  2HQI A;  3OFG A;  2XUL A;  3RR7 A;  3IMQ J;  2YX7 A;  1BWV A;  3DDK A;  2OPR B;  1O6X A;  5LSL A;  1YRT A;  5C2C A;  4X65 J;  1S6P B;  4LFC F;  2VC1 A;  3RW6 A;  1EP4 A;  1MU2 A;  1JLG B;  5HO4 A;  4FBU A;  4PPZ A;  3NS6 A;  1N88 A;  1CG2 A;  2CQI A;  1WOP A;  1RT2 B;  5DRK A;  3BV8 A;  4OHX A;  4DR4 J;  2LU1 A;  1QVF R;  1N32 F;  1FRX A;  2W2P P;  4NI2 A;  3RZA A;  4WKR A;  5JVG Q;  5E3C A;  2LYV A;  2Q79 A;  2B4V A;  1EIY B;  1M1K T;  5J2Q A;  1LQ9 A;  4ICL B;  5M2P A;  1UMJ A;  4ZLJ A;  3O2I A;  4WBF A;  3VV2 B;  2EKN A;  2GAH C;  3THP A;  1HQU B;  2VUG A;  3GJS B;  4ANE A;  3FFI A;  3QFH A;  1WC3 A;  3RRG A;  3ENQ A;  1U47 A;  2N3O A;  4UQT A;  3FCH A;  2XZD B;  2J0W A;  3L95 X;  2ABY A;  2IRX A;  2BBE A;  4N7T A;  3JSR A;  1SXL A;  3OFH A;  4E98 A;  3B4M A;  4HAC A;  3CCV S;  1HBO A;  1HD0 A;  2BAB A;  4L6V 3;  2LLZ A;  5ADZ A;  2E44 A;  5B0A A;  2ADB A;  2QT7 A;  3ILJ A;  1LWC B;  5K8P A;  3M8Z A;  3VGV A;  5DZ7 A;  1UVK A;  3PW2 A;  2EFQ A;  3DM2 A;  4DV7 F;  2HRU A;  2QFJ A;  1R8H A;  1VMB A;  3J7Y I;  4TY8 A;  1OPZ A;  5AE3 A;  3I4P A;  2VC0 A;  3DRX A;  3MM7 A;  2IAJ A;  4PYD A;  4J9V A;  5L9X A;  4RW4 A;  4L3N A;  2D3O 1;  3DLH A;  2J6S A;  3DN9 A;  4MKA A;  3K57 A;  1DZ5 A;  3HDS A;  2G1D A;  1VJW A;  5HLF B;  1CJU A;  3IGN A;  5KOW A;  2VG5 B;  3AJ2 A;  3M7V A;  4RU2 A;  1NU4 A;  4HT7 A;  2M70 A;  2HVI A;  3I0R A;  1L3S A;  4RNO A;  2H1Y A;  3K59 A;  3V6K A;  1N33 F;  3A8E A;  2HKE A;  1HPZ B;  4HTI A;  2DCU B;  2XZT B;  3R7B B;  1B99 A;  2B6A B;  5GME A;  3D68 A;  4FDF A;  4Y2I A;  4O23 A;  4IO1 A;  1TQL A;  4IG0 A;  2KRR A;  2DEJ A;  2RIL A;  3GFX A;  2G0C A;  4WU2 A;  1LFP A;  1SIZ A;  1QSY A;  1GMU A;  2JH3 A;  2BQU A;  2B8P A;  3IO1 A;  3KK3 B;  3A12 A;  4KO0 B;  1R6V A;  1X4E A;  3J80 Y;  4GO7 X;  4JI8 F;  5DDO C;  2KM8 B;  4RBV A;  3QFW A;  4G1Q B;  2DXD A;  1HWL A;  4ATN A;  4MKB A;  3KLH A;  3NNA A;  4AYB D;  1CJV B;  1UW9 A;  2RSQ A;  1FRH A;  1U6F A;  3QGG A;  1DAX A;  3HK2 A;  1YJR A;  4BWM A;  3HHK A;  3OVB A;  4C11 A;  2KTQ A;  2Y1J A;  3Q8P B;  3IR6 B;  1Q5V A;  4UZB A;  3RBX A;  1OY9 A;  2VG6 A;  3QYY A;  3N9U C;  2XM3 A;  5HMZ A;  3MCM A;  3N6M A;  1N5Y A;  1T9V A;  2IMO A;  1UCN A;  2XMM A;  4PG8 A;  4FF3 A;  4X66 F;  4F02 A;  2B6A A;  1Y5N B;  4CRJ A;  4USV A;  3DOK B;  4RR5 A;  4QCL A;  4PG6 A;  3LAM A;  2DHG A;  1PSD A;  4WP3 A;  2V50 A;  1URR A;  3ISZ A;  3R5B A;  4PKD B;  4LJM A;  4IFV A;  4OYW A;  4B02 A;  3BS9 A;  4LT6 A;  4H4O A;  2K8G A;  5A6W A;  2D9O A;  1RTH B;  4B3O B;  4ECU A;  2UUC J;  1XNR J;  4G1Q A;  1S1T B;  2RS2 A;  2ZNY A;  4RUH A;  3CMA S;  3HVW A;  3J7A 1;  2W4D A;  4HL9 A;  1AFJ A;  2HBQ B;  4O3N A;  2VON A;  4C48 A;  1ZZF A;  3NNC A;  4P73 A;  1S9E A;  4CO0 A;  2XY5 A;  2R8G A;  1B64 A;  2X3D A;  1NPP A;  3CIM A;  4PQU B;  1ROF A;  3EZO A;  4F3M A;  3GR1 A;  1Q8L A;  3RBZ A;  4ZVO B;  1S0N A;  4KKO B;  1PIE A;  2EFN A;  4N41 A;  2Z2Z A;  4P6Q A;  2XYP B;  3MPU B;  2HFN A;  1FNO A;  4JV2 A;  1TUW A;  2XQC A;  4WZQ A;  2QA4 S;  1LK7 A;  1TKX A;  2DGX A;  3A4T A;  2VOP A;  1RWW B;  1AB8 A;  3DLG B;  3HCX A;  2QMX A;  3OTD A;  1S6Q A;  1FHT A;  3K5O A;  1C4A A;  2FJE B;  2VA2 A;  3NCR A;  4F4W A;  3Q2S C;  4DV5 J;  1D8Y A;  1JXE A;  3OLB A;  4ZCL A;  2O5D A;  3C6U B;  1GX6 A;  2ZH3 A;  3PY8 A;  2Z0G A;  2L08 A;  1NSA A;  2OEJ A;  2ALZ A;  1FRL A;  3D2W A;  2OEK A;  2HHT A;  1V5I B;  4EU0 A;  4QU7 A;  3L3C A;  1IBL F;  3NCP A;  4MIB A;  4X62 J;  4A8F A;  1DHM A;  2CPJ A;  3B54 A;  3TNV A;  3H25 A;  3R5J B;  1FEE A;  2OSQ A;  1ZAW A;  3TZX A;  4NLQ A;  5JMN A;  5KFB A;  5KFZ A;  1UVN A;  3OJU A;  2BKP A;  2WOM B;  1EHW A;  4QIW D;  2UVR A;  1PJ7 A;  3F73 A;  3M8P A;  4B3S F;  1WTB A;  1WAC A;  2CJK A;  5DET A;  3A8K A;  5D4N A;  1EZZ B;  1NK4 A;  2B9E A;  3WX8 A;  4Y28 C;  3BGR B;  4ZP8 A;  2Q2G A;  2UUB F;  1JLC B;  4N8O A;  3ZTP A;  1FER A;  3GZ7 A;  2W7P A;  5I3Q A;  1N56 A;  2QLF B;  2KN4 A;  2OPP B;  3VCD A;  3C6U A;  3CE8 A;  5AXN A;  1Q79 A;  2CYY A;  4IQM A;  2GS8 A;  5B0D A;  3EPI A;  2MY7 A;  4LSL B;  2MZS A;  4PWD B;  2AHO B;  4DPU A;  4DR5 J;  2VG7 A;  3RRH A;  3M9M B;  2DNP A;  1T02 A;  4NLO A;  3WC2 A;  1FKA F;  2A10 A;  3E01 A;  1N34 J;  3QNW B;  3V5R A;  3LP2 A;  5F41 A;  4TLQ A;  3DRY A;  4LFB J;  4C8N A;  3TZY A;  1OY6 A;  5KFR A;  2J6T A;  3RB3 A;  1JMT A;  2W2M P;  4LRC A;  3GG0 A;  2HAF A;  2ZKU A;  1REG X;  5C24 B;  1BY9 A;  2F65 A;  2YQ1 A;  2QE5 A;  2Q6C A;  2V2Q A;  1D9D A;  1T94 A;  2R7R A;  4XAK A;  2CPY A;  2R2U A;  1J2V A;  4WYW A;  3MI7 X;  3W8P A;  2YNF B;  4DV1 J;  4NA3 A;  3FEY B;  4JI2 J;  2ZUA A;  2XGQ A;  3TAR A;  3MR2 A;  2A6M A;  2F63 A;  3P8B B;  1TK0 A;  2B4O A;  2R3V A;  5SUH A;  3A8I A;  4YY3 J;  3L4B C;  3IS9 A;  3VGU A;  1B0P A;  4W92 B;  2W25 A;  1JK9 B;  4WK1 A;  3W2W A;  2AYB A;  1H7X A;  3UDC A;  4QW9 A;  4URQ U;  1HQ2 A;  2B3T B;  4LIR A;  2GX8 A;  4LF4 F;  4Y00 A;  3CDA A;  2CQ0 A;  1JX4 A;  2AJF E;  3M6U A;  3LGH A;  4FVM A;  3C6T B;  3TAM B;  2VFV A;  4NCA A;  1RCX B;  5G4D A;  2HHU A;  5MAO A;  1S0O A;  2GML A;  2UXC J;  3KG4 A;  2W8K A;  4ZA1 A;  2IMW P;  4IR1 A;  1YQH A;  2YY3 A;  4N76 A;  2I0X A;  3OV7 A;  2A3J A;  4Q8F A;  5EGY A;  3TJ8 A;  4YQW A;  2E66 A;  2DHS A;  2HGN A;  2BAC A;  1BC6 A;  1YJT A;  2MZT A;  1EX8 A;  3E3X A;  4NLR A;  1BGX T;  2YNF A;  3SSQ A;  2AX1 A;  4ZPV R;  1NK0 A;  3JB9 k;  4DR3 F;  3D1Q A;  1FKO B;  1BQX A;  1CBK A;  4ZN3 A;  4UOF A;  4OZN A;  1NLT A;  1T9T A;  3QGH A;  3HFZ B;  2FJV A;  4B3R F;  1WUU A;  4LMZ A;  5F8H A;  1DLO B;  1RHJ B;  1H2U X;  1P27 B;  2MGZ B;  3LA0 A;  3ZZR A;  2KRB A;  1NCL A;  2JRS A;  2NLW A;  2QMW A;  2FZG B;  1FE0 A;  3IP0 A;  3C6T A;  1NBE B;  2DR7 A;  3TAM A;  4KJI A;  4QYZ J;  4OMF G;  1X8D A;  2AV5 A;  3HHN B;  4ECY A;  2ERR A;  1HNX J;  2B9X A;  2MY8 A;  4JB8 B;  2BDP A;  2J9C A;  4EYI B;  4G6V B;  5DDQ C;  1M5O C;  4DX8 H;  4DSK A;  2MYF A;  3CC2 S;  1SKU B;  4DMZ A;  2JJ4 D;  1ZAX A;  2DNO A;  2NR0 A;  1JKH B;  3A3N B;  3K7R A;  4TLR A;  4UF4 A;  4UT4 A;  1PC5 A;  1HW8 A;  2RNE A;  2R7T A;  4JV5 F;  4NLY A;  1RZM A;  1GTE A;  1XNQ J;  4QJV A;  2J8S A;  2GMJ A;  3BO3 A;  3PIP Q;  3GQC A;  2C2N A;  1PG5 B;  2FZK B;  4DX5 A;  1FE4 A;  5B7W A;  2DNH A;  5FDL B;  3OR1 B;  2HPU A;  4X4R A;  1IKV B;  2C2O B;  3PZP A;  1JXV A;  1DLO A;  1YI2 S;  1KBR A;  4K8R A;  4J91 A;  3MFH A;  3W1Y C;  4MH8 A;  1EAY C;  3IG1 A;  5E7O B;  4CNZ A;  4F8R A;  1Q95 G;  2KYX A;  3KLG B;  5CAB A;  2LP4 A;  2R7U A;  3I96 A;  3M6W A;  3SCL E;  3DRS B;  3ZTQ A;  4FS2 A;  1H72 C;  2UXD F;  4OJ3 A;  1VBZ A;  2HHV A;  2PII A;  1RHR B;  1TVR A;  3ZTR A;  1FRK A;  3SQO P;  1KQS R;  3UWT A;  3EDQ B;  1R0B G;  3EXY A;  1F5A A;  4C0H A;  4GO5 X;  1JKH A;  2ZH4 A;  3B82 A;  4URG A;  1RHK B;  3DDI A;  3MAA B;  2CAD A;  2M8D B;  1KVK A;  5HMX A;  2ZHB A;  1FDN A;  3R27 A;  2BA9 A;  4CLY A;  2JEF A;  1FWL A;  1GNK A;  5KFV A;  1APS A;  3DRR A;  2ROE A;  3PHT A;  2XWY A;  1U09 A;  2YQ3 A;  1LWF A;  2WW8 A;  1IBK F;  4LR9 A;  2WW4 A;  3OR1 A;  2C3M A;  5KFE A;  3FQK A;  2FLN A;  1DBD A;  2IC3 A;  2LEA A;  1FA0 A;  3J81 U;  1T05 A;  2I2Y A;  3MR3 A;  1XR5 A;  3QRQ A;  2IDL A;  5KFP A;  5FJ4 A;  3NGT A;  3KTQ A;  2C3Y A;  4F3O A;  2ZVI A;  1KHW A;  2GHP A;  1VLY A;  2IM0 A;  2V67 A;  4MYT A;  3CUN A;  2JWN A;  1E6V A;  3EGZ A;  1WEY A;  1IBM F;  2DNR A;  1FI4 A;  2NUH A;  4IOC Q;  4UOG A;  3ZNJ 1;  4G3I A;  2LFV A;  3D1H A;  2AEM A;  1KON A;  1ZTT A;  3MAA A;  2NYH A;  2HNZ B;  3GJQ B;  5KT7 A;  2JEG A;  5ETQ A;  1ZOT A;  5K20 B;  3O8W A;  2ZUG A;  4X65 F;  3PR5 B;  1UA1 A;  3EWG A;  2JZ5 A;  2H3E B;  4ED7 A;  1KFS A;  2HS3 A;  1G4C A;  4RW7 B;  1KRP A;  1IXK A;  3G6V A;  8RUC A;  4WFX A;  2BOP A;  1VBK A;  1K1Q A;  4ZIW A;  2HWT A;  1U2R A;  2YKO A;  3DHX A;  3N6L A;  4DR4 F;  2ZH2 A;  1RAA B;  2XSF A;  2Z30 B;  1YKW A;  5CYQ A;  4F0M A;  3LAK A;  3DGP A;  3O5T B;  3CMQ A;  3UNY A;  2K7K A;  2WAQ D;  4DHV A;  2GA7 A;  5IZH A;  4PPD A;  5K14 A;  2P5V A;  4LR8 A;  1CC7 A;  2WSE C;  1UAW A;  4Q2M A;  4ZHR B;  3KLF B;  4M5L A;  3Q8S B;  3GG1 A;  3HZG A;  3NGU A;  3BKU A;  1ZM3 A;  2MZR A;  2N82 B;  1KLN A;  4ZCK A;  3ILL A;  3Q89 A;  2BM0 A;  2P9C A;  3MTJ A;  2H5J B;  1RSC A;  4DI6 A;  4NLS A;  3FBB A;  1TEL A;  1QSS A;  2NQP A;  1NK8 A;  2LCW A;  4RNF A;  3M8R A;  3ZZY A;  3QZ8 A;  5IWA J;  2IM1 A;  2LXI A;  1WC1 A;  2IVY A;  1VFJ A;  4FKX A;  4P75 A;  3KG0 A;  1PC4 A;  3D4J A;  1HWU A;  4X4S A;  4CH7 A;  1U1O A;  4P7T A;  3SYZ A;  4M5J A;  3PKM A;  2D1C A;  2ZJQ Q;  4G1P A;  4KTQ A;  1RA7 A;  3PCO B;  3LWL A;  4ECV A;  2F1F A;  1M90 T;  2XCP A;  2DNL A;  4DX7 A;  3FQL A;  3FJ2 A;  3P96 A;  4UTG A;  2HNY A;  4USW A;  2XBP A;  2OPS A;  4ZHR A;  3M2R B;  3CD5 A;  2CRL A;  1CS4 A;  3HD2 A;  3FK4 A;  1CJT B;  4GKK F;  1PGZ A;  3VVU A;  3O44 A;  4QR0 A;  1DY3 A;  1VIS A;  4QWD A;  1REV A;  2HQD A;  2W1B A;  2K7J A;  4QQB A;  1UP1 A;  4P71 A;  3VGT A;  3U1L A;  3S1T A;  4BC9 A;  1D0E A;  4Q0B A;  1Z1Z A;  3RW7 A;  2DNK A;  4X4V A;  2ZD1 B;  3LZ8 A;  3CCJ S;  1TKZ B;  3MMJ A;  2HHH J;  3MTK A;  3TYT A;  1FKP B;  2BAN B;  1NPR A;  2OI2 A;  2XNQ A;  1GMV A;  3ICL A;  4RUB A;  5B0E A;  1PYO B;  2FZC B;  1TL3 A;  1Q5Y A;  1ARO P;  4F4Z A;  2D3O R;  4ZPB A;  4LF9 J;  2C22 A;  1NJZ A;  1FD2 A;  1S1V B;  2RU3 A;  3GCX P;  4NPO A;  3NL0 A;  2G0J A;  2LXU A;  3UCZ P;  1R0A B;  3MEG A;  2CZV C;  4JI4 J;  5KFL A;  2ASL A;  1R3N A;  1WI6 A;  4OI3 A;  4DEZ A;  2YNG B;  2CQC A;  2ZKT A;  3QSI A;  3KLE B;  1YJW S;  3V4M A;  2VL1 A;  2YBV A;  1IR2 A;  1CJT A;  4DWI A;  2E5I A;  5U47 A;  4KHP F;  2QTW A;  4V1A k;  2B9Y A;  3SZ2 A;  2WCX A;  3MR6 A;  4ZP7 A; 
#chains in the Genus database with same CATH homology
 2HFV A;  4J80 A;  1GMW D;  3TJA A;  3AGY A;  1EB0 A;  3LA0 A;  3AGX A;  1GMU A;  1GMV A;  1NLT A;  3NY0 A;  2Q2G A;  1XAO A;  1GMW A;  4L3K A;  1EAR A;  2B26 A;  2QLD A;  3I38 A;  1C3G A;  3TJ8 A;  3L9Z A;  3NXZ A;  3TJ9 A;  3LZ8 A;  3AGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...