3TJ8A

Crystal structure of helicobacter pylori uree bound to ni2+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
total genus 42
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tj8A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tj8A02
3TJ9A 3NY0A 3TJAA 2HFVA 1GMVA 1EARA 3AGXA 2B26A 3L9ZA 3NXZA 3LA0A 3AGZA 1EB0A 1GMUA 4J80A 2QLDA 3TJ8A 1XAOA 3I38A 3AGYA 1GMWD 1C3GA 2Q2GA 3LZ8A 1GMWA 4L3KA 1NLTA
chains in the Genus database with same CATH superfamily
5D0EA 2FJAB 3EWGA 2B4PA 2FZKB 1YJ9S 2DD8S 1RTDB 5DO2A 2PT0A 3QMQA 2FZCB 3D5MA 5C24B 7FD1A 3B4DA 3MAAB 4XPCA 2FY1A 4B08A 3VAIA 2CQGA 4PQUB 1RAEB 2P6SA 4WFNQ 1S1VA 1T95A 2DGVA 2JDJA 4LFCJ 3IFEA 2PSZA 1XNQF 3GB0A 5D6GA 2J0WA 1WSRA 1F9HA 1RWOB 2ZDOA 4DX5A 4J9UE 3V6JA 2E5LJ 2NXJA 1J27A 2FDNA 2V2ZA 3FCWA 4NLUA 1RXOB 2KU7A 4M8LA 4JI2F 4TU7A 4F0KA 3BQ2A 2VFSA 2VJVA 1IVZA 1F2GA 2E1PA 2C2MB 4C3MA 5EHHA 2BM0A 2NXCA 1S1VB 4YQWA 2Y8WA 1R8AA 2V94A 3DLKA 5IM0A 2HAIA 3MPVA 3FFIA 4NZ0A 3PYEA 8RUCA 2FC9A 4FF3A 4PEOA 4N8OA 4OX7A 3BR8A 2MZRA 3MEDB 2AT1B 3G8QA 4LF8J 3G6YA 2HBZB 2ZKUA 3HM9A 3AFGA 2ROEA 1RT6A 2FJWA 2CQCA 4DX7A 1WC3A 2ROPA 4DL5A 2JEIA 4TU9A 3DI6B 2DCLA 3I0SA 3BH6B 2C2RA 2AYMA 3ZNJ1 3ISNC 3A13A 2NXNA 3PW5A 1QUVA 1TL7B 3BR9A 4R0JA 3MR2A 5DM7Q 4CWBA 4X62F 2MZSA 2A6MA 4DN9A 1IKXA 1MMNA 3VV2B 1QTMA 3CT9A 3I6PA 3RB6A 2FHKA 1F5CA 3VAMA 4KGXB 1ZPWX 3HJVA 3H5YA 2CQ3A 4PXBA 3I0RA 5GAEU 4FXWA 3AA9A 3DDNA 2UUWA 5IT4A 2H5IB 4DUZJ 1G1XA 4ZPWR 1M1KT 3AAWB 2I38A 3KXDA 2F4VJ 1VIOA 4Y6IA 3R1LA 3R2DJ 4MKAA 5L9XA 1YBUA 3BDEA 3PVXA 2ZOFA 3LPEA 1D0EA 1QLNA 2JFKA 1ELOA 2QV6A 4C97A 2B9YA 3CVKA 1FDAA 5DLGA 3DHXA 1FWPA 2HS3A 3OQ2A 4WCEQ 1YRXA 2HVZA 3TUZC 4IDKB 2HBQB 2Z58B 1S57A 1MWYA 1R7IA 4FYXB 4LR7A 1JQGA 4WIIA 3H25A 1DBDA 4DLGA 3R27A 5HATA 3HSZA 4CO3A 1ITPA 1JXEA 4NLTA 3U1NA 1XEZA 4WTYA 1RHQB 4RUAA 2PI4A 1QJHA 1N5TA 4EFAC 3CNQP 1AUDA 1VMBA 5KG5A 4UW2A 2V8PA 4DFPA 1H3DA 3P5BP 1S9EB 1UZDA 2XYPB 4FF1A 1U0HB 4B3RF 4L3NA 2NREA 4PXDA 1JNRB 5JUMA 2ZH2A 3QQCD 3CDAA 1SI9A 4MJKA 2XMAA 3VWSA 2HGNA 5KOWA 3NNHA 3DLJA 3C8YA 2GX8A 4HL9A 1CQNA 2KT3A 5ETKA 2P9EA 4DU7A 1NB7A 2QC3A 4F3OA 3FBBA 1H73A 2DGUA 2MQ8A 1JK9B 3C5XC 2MZ1A 2HRTA 4WU3A 2VOPA 3TR5A 1R0AB 1WC1A 2MY8A 2OPSB 1RBAA 1VS3A 2B5JB 2M88A 2ZUGA 2ZZTA 3AD7C 3O6QA 3TYTA 2CNOB 1OQ3A 2Z30B 2LYVA 3HLUA 3TARA 4PPZA 4QQBA 1SC3B 2IJRA 4YN3B 4YDDB 4F4ZA 3T1HF 1C0UB 1RACB 1S1UA 3NAHA 3A8EA 4Q8FA 1PKUA 4DPTA 1LKZA 2AJFE 3FCVA 1RZMA 1IBCB 1NU4A 1FKPB 1NAQA 1YTYA 2QYCA 4TXSA 4F0MA 3KLVA 4PXCA 3C6TA 3RB0A 5EDWA 1SJ4P 4WKRA 1HBNB 4I2QB 1NO8A 2WVEA 1S12A 4ZPCA 1N6QB 4NWBA 3N6NA 3KLEA 5L1JA 5JVHQ 4DSIA 1HW9A 1GXUA 1WEXA 3MDFA 4NYPA 4RBTA 4CIOA 2ZJQQ 1UFLA 2C42A 4FNIA 2PA8D 2C3OA 1RE1B 3EDRB 4CZCA 4JI1F 2IA6A 2XSFA 1M5OC 3CCUS 4HR2A 3ILJA 4LFAF 3CE8A 2QN6B 3H0PA 3AKOB 3CIMA 2HWIA 1K47A 1CG2A 1RU2A 2W2NP 1MMDA 2J9DE 1YIJS 3OL7A 1N6QA 1ZZFA 2C3MA 5K5MA 3CJ2A 4LQ9A 2R2SA 1FEHA 2CWXA 3JTOA 1R89A 3AJ1A 3CO9A 3R9LA 1BY9A 1B0PA 2YNIA 3D4JA 4CCHA 4WK3A 3KYLA 2W24A 4QIEA 3RAXA 3LAKA 5CA5A 4Q0BB 2DHSA 3OR2A 2YKQA 3W61A 1T05B 3FMBA 4WYLA 2AIRB 1MWZA 4JI8F 3UN2A 3FSXA 3GLJA 3FSIA 3U02A 1HQ2A 2ZJPQ 2GJ2A 1NK4A 2M0GB 2PE8A 2BVZA 5K8NA 5F8IA 2XY5A 4Q44A 5B09A 4LIRA 2YNIB 3DRYA 4DCOB 5D3GA 1U6BA 4AD6A 2UXDJ 4ZPBA 2J0SD 3DLEB 1TV6A 1P1TA 2AEMA 3OR2B 1M1GA 1D8ZA 1DTTB 2FHJD 2GJFA 4M5MA 1PAEX 4ALZA 1M5HA 1RHRB 4NRUA 5KFZA 4I6WA 2F9JA 3Q24A 4C8NA 4CLSA 4JI1J 2XG8A 2VD3A 2EXUA 3JQMA 1FRJA 4DV0F 2OEMA 4ZOSA 4ZLNA 4LVOP 4DV5F 1S4FA 3S01A 1G6BA 2JEGA 5T41A 1PCAA 4NLWA 1I5OB 4J90A 4M5NA 1M0SA 4O3OA 3TRGA 2DBBA 2DGOA 5HN0A 1L5UA 4O4RA 2HNZA 2LDIA 3KJVB 3MD3A 4YEAA 2FUG9 1B7YB 3HKWA 5L39A 3T5HA 4BHQA 4DR4J 1EHWA 3EYZA 1ZBTA 3R2CJ 1REGX 2HG4A 1O51A 2DT9A 3NOCA 1PAUB 4KB7A 1K0TA 3G82B 1Q95G 5CH7B 2M2BA 2HHHJ 4DV3J 3KJVA 2ZE2A 4TQSA 3KWMA 2Q1LA 1XR6A 4TVAB 2BM1A 4USMA 1ULRA 4ICLA 5DETA 2LQ8A 3R1HA 5IT0A 1TK0A 1ZAVA 4OJGA 2UXBJ 2F3JA 3RJMB 1FK9A 2NQPA 1U6ZA 1WKKA 3LP2B 4WBFA 5EWFA 2WONA 3JSMA 2AGOA 3OFGA 1N36F 2J6SA 4DZDA 3BREA 3M05A 1FFWB 4ZA1A 5KG6A 3H8YA 2DR6A 3BQ1A 1VQYA 3ITHA 2VPYB 4QR1A 2W25A 5CHCB 2C3YA 3F73A 1APSA 3M8ZA 4ECWA 5ADZA 4TYAA 2HQDA 5DM6Q 1D9DA 2AP6A 4OJ1A 2E29A 2OFHX 3UVJB 1CQMA 3RRKA 3VAHA 4NI2A 1RHKB 3ZZPA 2R7VA 4RO0A 1H74A 1NK8A 2GMHA 2KRRA 1HR0F 1NM2A 4F4YA 5B0AA 1NDLA 3SI8A 2ALZA 3D0HE 3I9ZA 5EX3A 2L41A 1UJ5A 1HNVB 2J9EA 3CCTA 1JLGB 4EGLA 1VGYA 3KLHA 5E5NA 2BQ3A 3W60A 1SC1B 4XTTA 1UJ4A 4GKJJ 5AXLA 2FLLA 1KWMA 5KTQA 3DLEA 3UD5A 1L3SA 5HLFA 3CJKA 4DV2J 2QSFA 3TNVA 4X4RA 3OL8A 2KFNA 3MR3A 3G8TA 3RBEA 1JLGA 1RT1A 2OHDA 3I96A 1S9FA 4NCGA 3CWJA 2UUTA 4RPFA 2C2EA 4DI6A 1FJ7A 4X4OA 1RCOB 3HZEA 4LRBA 5HK4A 1AZSA 1BGXT 4J91A 3UR3C 4F4AA 4U6PA 2UVWA 3BPSP 2AX1A 2DXDA 4CYUB 1U1MA 2FLNA 2YKMB 2HNZB 4IO1A 1PYTA 2W4CA 4KBIA 3CCLS 1XC9A 2DNMA 2VDIA 4ETZA 2XY6A 2GW8A 4GVLA 3G8SA 2CZ9A 4C8KA 1Y5LB 2JVOA 2J0XA 3M30B 2I6WA 4CO1A 4F02A 4O3PA 4RLEA 4A8MP 3Q8VA 4HLBA 3J7YI 1E6YA 1HMVB 3M7VA 1CJUA 1TKZB 2RD5C 3EZOA 4FKXA 3V4MA 2FJVA 2PDAA 3IG1B 3KUHA 4MKYA 5KFWA 1WHXA 1VOMA 2RQCA 1BQXA 2HQGA 4IG3A 1YBAA 4AE5A 2H1YA 2ASDA 3GU0A 3PW4A 4DFMA 4IO9Q 5KFBA 2ZH1A 3D66A 1HBUA 1RUSA 4IQMA 4C8MA 2Q2GA 1E6YB 1EETA 1HMVA 1NUEA 2O5DA 3CSKA 3D6TB 4HACA 1GMWA 5AE3A 3RR8A 2CJ9A 3DXSX 4MK7A 4ES3A 2M8HA 3HHDA 4UZCA 3WC2A 3HDSA 2HW3A 1NLTA 3ITHB 1CPZA 1KHVA 2NUHA 3GE9A 1O8BA 3B82A 1GAOA 3DU6A 2ZC4A 1TKTB 1RA7A 2BW7A 1HIYA 5I3UA 3ENQA 1HYSB 2VASA 1EETB 1X0PA 1P27B 2E7VA 3DOMB 1SQEA 4MH8A 1NK6A 3VGTA 5DG7A 3DLKB 2YNFA 1J5OA 2XULA 1AXQA 1SIZA 1BUXA 2BW2A 1HWKA 4HT7A 3ZZ0A 4YB1P 2AJ0A 1DARA 3OHAA 1V3RA 4W92B 1QVFR 1NSKL 2MEWA 3ISZA 1HPZB 1TFWA 3IA0A 1PYOB 4C2MA 1L3UA 3I38A 4K59A 2HMIA 1NPRA 1S10A 2AYGA 2RIJA 4EBCA 1LQ9A 4PG4A 1FCAA 2R7WA 2YTCA 3TX0A 5EWEA 1KNZA 2M7SA 4A48A 4J9KA 2RDDA 2D3OR 2CJAA 4LF9J 5F8HA 3K57A 1EKRA 5K14B 1N0VC 4O3QA 4YUDA 4DR2J 3V81B 1NKEA 4IRCA 1Y5IB 2DRDA 3VQSA 1SIWB 3TJAA 4CLYA 2DHHA 1NDKA 1TL4A 3MTKA 3NP5A 4USJC 2R2UA 1X9WA 3L9ZA 2WB1D 4I56A 5K20B 1KDNA 3W2WA 2RUGA 2WHOA 3RYLA 1T9VA 3LUYA 1HBOA 2B9WA 2ZFHA 3M8YA 2DHXA 4UUXA 2QA4S 4DF8A 1WOOA 3AB4B 2KM8C 5K14A 3V81A 3SSQA 3ENVA 3LWMA 1Q5VA 3TW0A 5ETOA 2Y3YA 1TU0B 3KJFB 1RT7B 2JZ8A 2IJFA 3CD6S 4OHXA 1NRKA 4AUKA 1V9OA 3W2WB 2R7SA 4ZN1A 1YKWA 4MAKA 2APOA 3UR0A 2Y1RI 1TKXA 2C2ZB 5DDRC 1KFSA 2B3TB 4NYOA 1TTHB 4DV6F 2ZH7A 3OSPA 3NS5A 3BGLA 3G2XA 3DNCA 3S1TA 2PGCA 1ZTWA 2HFOA 4LF4F 2OO4A 1P6TA 1RTJA 3NMRA 4FBUA 2P5VA 3C46A 4ECXA 5KFDA 4KFBB 5DGAA 1R8CA 1DHMA 5EWGA 3CUNA 2VJUA 2IM2A 3AGZA 1YRTA 3K17A 2UXCJ 4RNOA 2ZHAA 3CCRS 4AL6A 5J2PA 4LT6A 4B3MJ 3QT7A 3T5JA 2F40A 4USTA 1R6YA 5LL6d 4WFBQ 5HAOA 3TJ8A 4CDIA 4FXVA 4OYXA 2KZMA 5GMDA 3EE3A 3S7RA 4R5PA 4OZLA 1F2HA 3KDOA 3EX7B 5T7LB 3K5MA 2HK2A 4CT9A 1U0HA 3MAAA 4N47A 1U49A 2EG2A 4DV5J 4WZQA 4USVA 2YKNA 3A8IA 2ZWPA 3R7SB 1TVRB 1HHTP 2QYGA 1H72C 4BC9A 3VALA 3EPIA 4NLVA 2XS7A 2CG8A 2YNGB 4QBUA 4LRAA 2B43A 4AL7A 4ES1A 6AT1B 4NEYA 3WQPA 4ZCKA 1I6JA 2BKPA 3MEGA 2IBOA 3LGNA 1VBYA 1U1NA 4LJMA 4B3SJ 2CPDA 1S0VA 2FB0A 1WACA 1YLXA 2EK6A 1C0TA 2D41A 3J7YU 2W9CB 1KFDA 3R97A 4PPDA 4DG1B 1NH8A 3TAMB 4ED7A 1PJ5A 4RW6B 1CVJA 1MU2A 3FDSA 4PYDA 4UZBA 1GK8A 2Y1IA 1KR4A 2V4RA 2HHHF 1RYRA 4R25A 4S0MA 1Q1KA 3V4IA 3IR6B 5G0RB 4OYOA 2QMUB 2GGPA 2UXBF 2GQQA 1CJTA 1EQMA 3HHLA 3L7OA 2LXIA 2R3VA 4NL5A 1BQNB 2IYGA 1T3NA 1JLBA 1YWXA 4ZPAA 3W7BA 4RW8A 1JX4A 3LO3A 3A4TA 5C2CA 2EFVA 1X7VA 1HQEB 2HBYB 2BKOA 2AKWB 1JB0C 2BANB 4IFVA 2CPIA 2D9PA 3LQVA 2E5IA 1Y0HA 1F3FA 5G0RA 1QSSA 2EFPA 2RHQB 5D0HA 4C11A 2KFZA 4RW7A 3ZTOA 1NB2A 1YQHA 1FRKA 3W66A 4RU9A 1VLOA 4EBEA 1VQ9S 2D74B 2HHSA 1PG5B 2JVRA 2K7JA 3PYGA 3GQCA 4LF8F 1RWVB 3C14A 2ASLA 4LUBA 1JLAB 4WK1A 1ZA1B 4WWSA 3FC9A 1JXLA 3OTOF 3C3LA 4KGKA 4NLYA 3K8WA 4F36A 2ZH4A 3MM8B 2O01C 1RT2B 3NCQA 4H4OB 3EGZA 3HVWA 4DLEA 1U09A 2GMLA 2BQUA 4BDPA 4KFBA 3PXGa 4DEZA 2W4PA 1A6LA 3AA8A 5KT5A 4RW9A 1SXLA 1U25A 2LA6A 1WELA 2CQ0A 2BJEA 5IQ6A 3DMJB 4MKBA 5B08A 3KK1A 2C2DA 4IH5A 2C28A 1U7LA 3OW2R 3Q8YA 3R5GA 1Z2ZA 2ZHBA 3UDLA 1N32J 2XWYA 1WWHA 3HD1A 2EFNA 1IBLJ 2KFYA 3NGTA 3AGXA 3QRRA 4B3OA 4BWJA 3EUNA 3MURP 1IBMF 1YDLA 2J76E 4C0HA 4ZCLA 2N4DA 1UWBA 3ZTPA 4R8UA 1YJUA 2OPRA 3RW7A 4J80A 2VFUA 5H9EJ 3DLBA 1KN6A 1JMTA 2OPQB 5KG4A 3OJSA 4GKKJ 5DQHA 2MJUA 3FFIB 2VH7A 2DK2A 2NPFA 3BN7A 1VIXA 4QU6A 3O5TB 1UWBB 4OLOA 3J80U 1GXLA 1WI8A 4ID8A 2BX6A 1RISA 1UEVA 2XMTA 3CD7A 3J81U 3I32A 4MFBB 4V19J 2CQ1A 1KKHA 1S6UA 4DL3A 2D7SA 3MCNA 3THVA 4DR7J 3NWRA 1MU2B 3CO0P 2Z2YB 3A8KA 1BE4A 5ETVA 1T02A 2HZCA 2EWHA 2XMKA 3LP1A 1MLAA 5KFSA 2GC8A 1I94J 3UNYA 4NXNJ 1Q86T 4JI7J 2ZM6J 1VRTB 2OTLS 2ZZMA 1VJQA 4FKYA 4HDHA 4YHHF 2KKHA 4CTAA 1VCTA 1FNXH 1HQEA 3D1QA 4CQ1A 4ZCIA 1RYSA 5J2QB 2UVRA 4C8YA 3E01B 2V63A 4DBQA 2WBRA 3QJLA 1FXLA 4ELVA 3CJTA 1IBKF 1H6KX 4RW7B 2HIQA 2RKIA 2DB1A 4WP3A 4DXLA 4ECRA 3QLHB 1VK8A 4DCJB 2L9DA 4FXDA 1ICEB 1WI6A 2AW0A 3T41A 7AT1B 2R8KA 1RHJB 4JI0J 4JV2A 1IWAA 5FDLA 2F7VA 2OP5A 4KIAA 5CXTA 1Q78A 2CVIA 1KLNA 4F2SA 2AZ1A 3T1HJ 6FD1A 1HBMB 3EGWB 4WFYA 2V4QA 4M63A 4P71A 1YI2S 1RWMB 5BYQA 1FRMA 1OSDA 3U1MA 4KGZB 2FGOA 2QA2A 4ZIVA 3IWNC 3TZXA 3OXGA 4XK8C 1U1PA 2IYIA 3MPYA 4KT0C 2V9KA 4RW9B 1RWUA 1FXRA 2RF2A 3BKTA 1XWLA 2DGSA 3CULA 2OSQA 2EFGA 5A2QY 3CJKB 2KG1A 1F5BA 3D9BA 4YOEA 4L76A 4F4WA 1XQIA 2ZBQA 3MPDA 2FVSA 2C1EB 5L1KA 2HFNA 1SKRA 3MPUB 1VQ5S 1LW2B 4CT8A 1SVDA 3AD8C 3ET6A 3CDEA 3D68A 3TJ9A 1RI7A 1XJWB 3SCJE 2I2YA 3WX8A 1VQNS 1S7HA 5LJ5Y 2V34A 2Z57B 4RNNA 1DTTA 1T7PA 1JNZB 4C8LA 4H4KA 2V8VA 3MOZA 1N34J 1ZAWA 1I94F 3FKBA 1M5PC 1S9GA 1NHUA 3GG0A 4M5DA 2ZM6F 2KRBA 4HKQA 5AE2A 4RR5A 1Y5NB 3TUIC 3PW2A 4OYWA 3POTA 2P9CA 3NCPA 4DUYJ 2V2VA 5H9EK 3G9CA 2H3EB 4NLOA 2VG6A 3OL9A 4QU7A 1RP5A 5A6WA 1Q0NA 4FYDA 3B6BA 3N9UC 4OI1A 3SQOP 3Q22A 3C16B 3OVAA 2BOAA 3TA1A 4EBDA 1TFYA 1N56A 2DNRA 3OTCA 4LRDA 2R9LA 1HWLA 1NH7A 3DRRA 4JV0A 2ZEJA 5JXSA 3B4MA 1S77D 3P4UB 1VQ7S 4DV0J 3GCXP 1SUQA 1XNRF 4TYBA 1FFSB 1H2VZ 2JLGA 4HACB 3RZAA 2MGZA 4XIUA 2LDYA 4Y0FA 4WP8A 4ECTA 2F4FA 2GQ2A 3F0NA 4RZRA 3HPOA 1M90T 3M8QA 1UVMA 1EP4A 2ZOMA 3L4BC 4I1TA 4DR3F 3NNAA 3EDQB 2JNJA 1Q7YT 2HFSA 1NSAA 3DRSB 1PBAA 3MGJA 4KGMA 4IRDA 1VRQC 5KFCA 3HK2A 1T9UA 2HVEA 1OY9A 2CWKA 4URQU 2HQCA 3M9MB 1X60A 2RVJA 3Q8SB 2HWTA 3KLIB 2DRBA 2V8GA 2QZ8A 3PFOA 3ETMA 4KKOB 3GV5B 4X62J 1VQMS 3W5XA 3J7Z5 3M6XA 1T05A 1TL5A 1AUSL 3IGNA 4DV3F 2WTFA 5LMNJ 1KQFB 1YRUA 2G13A 5KFFA 2XWXA 2GIQA 1FD8A 3J7A1 2ZUAA 3PZPA 3QFHA 1HHQA 3D28A 4NI2B 1DY3A 2XI3A 5D3GB 3CEDA 3L7PA 3MCSA 2OH2A 3QT8A 4B9MA 1HNXF 5LMNF 2HLTA 2JEJA 1B3TA 3OXFA 2X1AA 2CRLA 2HVIA 1FRLA 3MMAB 3NRBA 3AT1B 5FIIA 2IM1A 4DL7A 1VI7A 1U8WA 4PABA 1UJ6A 3DM2A 1RWWB 1XTZA 2Z2LA 4MIBA 2QLXA 2AGPA 2RMLA 2F8MA 2FHMA 3C66A 4NLPA 1IJEB 2E66A 2HURA 1RHUB 2UUAJ 3P3DA 2HVDA 1GX5A 3N5BA 4OFZA 1H38A 4KV8B 3W2VB 2ZOGA 3MMAA 5IOLA 3PW7A 4TNOA 4ILRA 1S9GB 1RT7A 4KPCA 3DCAA 4MT1A 4JI2J 5CZVA 3C19A 2CNLB 3EGNA 3DM2B 1CC8A 2BE9B 3RBXA 1XBWA 5A8WB 3EZ5A 1VQPS 1SH2A 3CD5A 1RAHB 2HNYA 1TK8A 1BWVA 1SJRA 3K5NA 4CLTA 4XDCA 3ZFVA 2A10A 4TQRA 2YKMA 4YB7A 5ETMA 4DQPA 3GIKA 3PIPQ 4YR2A 3PO5A 4KPYA 1X4HA 5KFQA 1HLWA 4OZ5A 1KLMA 4DV7F 4ICLB 3HSJA 5CAAA 5KFGA 3A1YG 2W7OA 3G87A 3TUJC 3MM5A 2OI2A 5KFLA 2VG5B 4ANEA 5ETQA 1UETA 2C2OB 2DGTA 2OKQA 4M5HA 1ACMB 2HZVA 4I6YA 3AJ2A 2MDAA 1FWKA 2EG1A 2MLYA 4OLPA 4CO4A 2UUBF 4WJBA 4ZP6A 1WORA 2IRUA 5SZTA 1CSJA 1ZAXA 3ISND 3TAPA 2XMWA 2AWZA 2N4CA 1IXKA 5GADI 3UNGC 1LWCB 2RJZA 1QAIA 4KHPF 3MM5B 4UOCA 2CQ2A 5D0RA 1NK9A 2CPHA 2RS8A 1WHYA 2A2DA 3CDUA 1F9EB 2ZH9A 2F65A 5HVFA 4B02A 1YZ7A 1Q8LA 2W4DA 3IM8A 4OMFG 1T0TV 2H5JB 2NXUA 4FN5A 2PC6A 1C1BB 1N5SA 3OJUA 4DR1J 3MEGB 4A46A 2JH3A 3TANA 4JBCA 3DLHA 3LP0A 4DOZA 4QCLA 1O5JA 2CDRB 5E3PA 2XO7A 1UVIA 1FEEA 3DDIA 3UDCA 1N33F 1CLFA 1U2FA 3DGPA 3RG6A 3VVTA 3KLHB 3UN3A 1VQOS 1A0OB 1NK0A 3NGDA 3MR7A 1NKBA 1F60B 3W9JA 4NCAA 1UVLA 4W98A 3H5UA 3ULHA 1TL1B 2WK4A 1FFGB 5CD4H 2V4JB 3K5PA 3LP0B 3SQGB 4KE5A 4RUHA 1N33J 4EZ6A 2YKPA 4ZITA 2OLWA 2B4UA 3EXYA 4DPOA 5J2NA 1KQKA 2FC8A 2R8JA 3PRVA 2VG7B 2G0IA 4OJHA 4CM0A 4WKYA 2DNZA 3V6DB 3EZUA 2YY3A 3MAHA 1EIYB 2KVIA 2V4JA 3SQGA 3GV8B 3IP0A 1WDTA 5HVGA 3PY8A 2GHVC 4MYTA 1UZHA 3PACA 4JI5F 4NA2A 4PXEA 1JLFB 2QLJB 1WC4A 3V6DA 4DSEA 1BMQB 2HBRB 4Y2KA 3SYZA 2YX4A 1UPPA 2Y1LB 1T9XA 3GWCA 1IKWA 1S6OA 2DIUA 1DZ5A 3CC4S 3X1LB 1CJUB 3T3FA 4HI1A 3RB4A 4FF2A 5D0GA 1RT2A 2FJBB 2FTRA 3KUGA 4H4OA 2E5JA 5J1NA 4P73A 4B3MF 4RUBA 2C3PA 4CLPA 4E98A 3TVYA 3W9IA 2KI2A 1KLMB 4AT1B 3M2UB 4DV4F 4B3TJ 1F6TA 1LW0B 2ILYA 2VC0A 2ZKTA 1RTIB 5HJXA 3TX8A 3MUVP 4A8WA 3OBIA 3HI9A 1FWLA 3W8PA 2POKA 4J9PA 2QL5B 2UXDF 3TZYA 3R6GB 3HO1A 4G1PA 4NLGA 4Y2CA 3U7JA 1VQKS 3DRPA 3UDVA 1QAXA 2CJBA 4NXMF 2G1HA 3K7RA 2R8GA 4DPYA 1HD0A 2WVFA 3TQ1A 3MD1A 1TKTA 3M8WA 3Q2SC 3DLLQ 2F5GA 1QE1B 2JRSA 3GSDA 4ZHRA 4U7UD 1ZYQA 2I5JA 3BGUA 3FMWA 3S8SA 1RA6A 1KOOA 3R5BA 5CZXA 5HP1B 1FRIA 2FD2A 4FBTA 1AFJA 2HFVA 3L7UA 5K9FA 1XMOJ 3QZ8A 4NLQA 4X4PA 1WEZA 2FPHX 3O44A 1KTVA 1RT4A 1RU1A 4DSJA 4MFBA 2L3MA 3WHIA 4KH1B 4O0IA 2WOMB 3SMZA 4LSZB 3UW1A 5A2QU 2IRXA 3Q86A 1VFJA 2LQ9A 2W1BA 5F3ZA 4YY3F 1XMOF 1HNXJ 4K4VA 1VQ4S 3BJYA 2PMWA 3OVBA 2FVCA 2AEJA 4Y28C 2KL8A 2WAQD 5J2MA 1TMMA 2PD1A 3MM6B 4TLRA 2E5LF 4ECQA 2O67A 1LWEB 3N28A 3OFHA 1UFKA 3NBPA 4F26A 2FZGB 1DQAA 4DR5F 1WNEA 1ZS6A 1FX4A 4R0EA 2Z2ZA 3I0SB 2W8KA 1AFIA 2D3ZA 2W2PP 5J1PA 4ELTA 2AYEA 4WFXA 3LGHA 4JI3J 2XS5A 1WHWA 2U2FA 2GGPB 3BYPA 2CNNB 1QTNB 2CPXA 1CJTB 5F0UA 3D2WA 1ZTTA 3DFEA 3IXQA 3KK2B 1R43A 2AU0A 3FUYA 2ZBIA 3KLGA 2YWFA 1SJ1A 4GO7X 2Y0BB 1AYEA 3NEKA 4K5RA 3ZZTA 4J9MA 2QG9B 3CC7S 2XMUA 2UV8A 3NCRA 2DEJA 2W9BB 4DFKA 3AH6A 5HQLA 5KFJA 1X4DA 4KY3A 2ZBPA 1D09B 1RBOB 1X4AA 3R7BB 2XY7A 4EYHB 1FNMA 2VV5A 2UU9F 2QO3A 5KT6A 1HR0J 2IHR1 4W4MA 1F0XA 3VCDA 2X3GA 3BF4A 3RGIA 2ADCA 1I3OB 2B9XA 3GSIA 5HANA 2L48A 1T8EA 2QX0A 5K8OA 1KVKA 1URRA 3AQOA 1CJVB 1X8DA 3MM9B 4Q5VA 2R7RA 2V68A 1W2BR 3MM8A 4ID5A 2UVVA 2KTQA 3DRPB 4ZMMA 2BJDA 2MXYA 2UUBJ 1D1UA 1J5EF 2QLWA 4L74A 4LIWA 1UP1A 4HH0A 1R8BA 4LF5J 2HHTA 1GMUA 2PI5A 4OI4A 3H4DA 5FD1A 4PUOB 2LQBA 4OYAA 2XZDB 2VZ9A 4EMDA 3PDNA 1F5AA 2G0JA 3M2RB 2CPYA 4ID5B 5KFPA 1FNOA 2YNGA 3F44A 4CH0S 2RU3A 2CQ4A 2B4OA 2DNNA 1LK7A 2OD4A 1KD1T 1B99A 1N52B 3ZO7A 4OI0A 1YJTA 3GMGA 2UZAA 3MFHA 1FDBA 4IH6A 2HQIA 3BSNA 4DR5J 4BS2A 1EZZB 4PQUA 4X64F 5H9FJ 2V9WA 4NOHA 3AD9C 2DCUB 2J0QD 4DR6J 1HNIB 2P9GA 1ZM3A 3JS9A 1PJ6A 4ECUA 1NJWA 2AJ2A 5ITHA 1OSCA 5JVGQ 4DV7J 3SXLA 2XB2D 4UOFA 5KFNA 4X84A 4JI6J 1N5YA 5E3AA 1MN7A 2D9OA 3TOQA 4ZCMA 3KG0A 4A8YA 4M5KA 4UUWA 1IN0A 4ZJLA 1R0CB 1IBKJ 1BQNA 3W8GA 4P72A 1HNZF 2E9RX 3GR1A 3NBPB 4QWDA 1C0UA 1WG5A 2N3LA 4IQXA 1B64A 1L3VA 2R7UA 4B9SA 4XPEA 3VQTA 1I1GA 2HWHA 5F8GA 1T9TA 4GKKF 3G6XA 3LP1B 4QIGA 1Q8BA 4KHPJ 1SL0A 1TELA 1FRXA 1RT6B 5HQMA 1X4GA 4ZPDA 3MAQA 2BE2B 4Z7YA 1MW7A 2CNKB 2CDQA 2DH8A 2EC2A 1LXJA 3PJ9A 3TP2A 3SSRA 3N5FA 2WVCA 1EARA 4UOHA 3E01A 1GXTA 1TL7A 2F9DA 2AZ3A 3MF5A 3UCGA 3Q2TC 3PV8A 3SCLE 2ZHOA 2QT7A 2PEBA 1X5OA 3K5OA 1RTHA 1Y4ZB 3DYAB 3KFWX 4QPTA 3BGOP 3QRPA 3H98A 1OIAA 3EXCX 4IDKA 2KVQE 3FEYB 2LMIA 3R7NB 4YFUA 5C5JA 4OHYA 2HAFA 1KQGB 1CJVA 1F3VA 2E9TA 1RGVA 1VQ8S 2E44A 1V3ZA 2YXLA 2LVWA 3M6UA 1T9YA 4CNZA 1FJCA 1IUJA 3MZIA 3I87A 4KQZA 4JI4F 4N41A 1RTHB 3DYAA 1Q53A 2ATCB 4F04B 2KT2A 1NLKL 3HVAA 4I6AA 2B0GA 2OD6A 2ZNYA 3BN4A 4CP5A 1W2IA 5B0BA 2XO6A 1U26A 4G1IA 3G6ES 4ILLA 5LOQA 1DTQB 1HNWJ 3BV8A 1RT5A 3WIUA 3HHEA 3CCMS 2B26A 4DV1J 3TVZA 2ZZNA 2DNPA 2DH9A 2MQPA 2CQHA 1RWNB 2XQCA 3H40A 5CYJA 2ZH6A 1X9MA 1S48A 3EVMA 3PRBA 4NPOA 4ECZA 2BDPA 1SH3A 4OX6A 1R0AA 2MZQA 1HNZJ 1X4FA 4K4XA 4LSNB 2NYIA 3P96A 4ZVHA 1EX8A 2PO4A 1WC0A 2V0NA 2CJYB 1DTQA 3FEXB 2XSJA 2IFXA 4GRSA 2RT3A 3VR1A 3WIVA 4J9OA 3KJQB 4CLUA 2AJ4A 5DGBA 4ZVEA 3PNIA 1JKHA 2E1MC 3JYTA 4P74A 3KMQA 3EVOA 3LF0A 1S9EA 3SV4A 2BR0A 3ILOA 3TA0A 4B3TF 3I82A 4DR3J 1M5VC 2AHOB 1Y3KA 3MOJB 2E7XA 2XHWA 1RWPB 3CJ0A 4FVMA 1UCNA 3M4XA 4JUZA 3CGIA 3TVKA 2X3DA 2VG6B 2VPWB 3I9V9 1MN9A 3MI7X 3ZZYA 2EEYA 4CO0A 2YKOA 4CTAB 3KLEB 1SJQA 2PFDA 3TUPA 1WC5A 3M6VA 2HHWA 1RABB 2MKCA 3QIPA 1S59A 5KG2A 2LFVA 3IS9A 1CJKB 1WF0A 2WVDA 3BKUA 1IM6A 4IG0A 2B8PA 1OJ4A 2VKZG 1T3OA 3N0VA 3LP2A 3JAMY 4ED3A 1FHTA 2WSEC 3E2EA 3R5CA 4UF4A 1LXNA 5DS7A 3JAMU 4GC6A 1HQUB 1XK8A 4AL5A 2VUGA 5F8NA 4DSFA 4A47A 4N77A 2KO1A 3QIPB 3QAEA 5BYSA 1FKPA 4DQRA 2BXJA 4IG0B 4RJVA 1BD6A 4USIA 4OV1A 4K0KJ 5DDQC 5L1IA 4F3MA 1C4AA 3OTEA 5M2UA 4JV5J 4V19X 3R5JB 1GH8A 1X9SA 3AJDA 2LXUA 5BJRA 2MKSA 4PKDB 5HBMB 3TAQA 2W8LA 3KHHA 3UE2A 4NCBA 1SB6A 4I69A 4U7UK 4RU2A 4ZVPB 5CD4A 4PR6A 4K2XA 1Q8KA 3GFXA 3VAGA 1J5EJ 1FF2A 3BKFA 4I7FA 1DAXA 1NJYA 1QVGR 2ZVIA 2X1FA 1T03B 5HLFB 1DFDA 4JI3F 1DLOB 1ZM4A 3X3UA 5GAHI 3QFWA 5HMWA 3B8HA 2OELA 4USHA 3ZXWA 3PKMA 4M5LA 4C6AA 3CPWR 3JTNA 1FE0A 3OV7A 5HO4A 1E6VA 4X4QA 3OT9A 2C22A 4DR4F 4ELUA 1QDUB 2VC1A 3OD2A 4ZPTR 4FYVB 4P10A 1DLOA 5D78A 3BM7A 3MCMA 1PSDA 2FJDB 1UA0A 2CZVC 4ANCA 2UU9J 4CH7A 2IM3A 1G3OA 1YK9A 5CABA 3G71S 2PA3A 2IPOB 4WXWA 1NJIT 3CDBA 5KT3A 3OL6A 3EJMA 3LAMA 4KJIA 4RL1A 2FIUA 3I5AA 3PYDA 3QPIA 1SUQB 1KQSR 2K1RB 3D3CJ 3H5XA 3TEHB 4IKAA 2O3DA 4KHRA 4IG3B 1KVIA 1LWXA 1KP6A 3OR1B 3GIJA 2M52A 4EZ9A 5KG0A 1NHKL 3UO0A 5KFUA 1PILA 1QE1A 1U24A 4ZHRB 1RAJA 3K58A 4C48A 1NKCA 5HVHA 4LF6F 2V67A 2CYYA 2IJNA 2OSRA 1WD6A 5JMNA 2DJWA 3C15A 3U27A 2ZE2B 3C6UA 2DNKA 4LBIA 5K8MA 1RQ0A 3CMQA 2DNLA 2WSCC 3KLIA 5GMEA 4DL4A 1U48A 1LFPA 2R7OA 2Z56B 4DUZF 4DL6A 1R3NA 3VZHA 3D0IE 1XAOA 3CD0A 4ZP8A 3UD3P 5IT9U 3ENAA 1VBKA 1IKYB 2Z4PA 1SC6A 3H2UB 1RHMB 1FK9B 4H4KC 2OMOA 4TKTA 4RNFA 4A8QA 1I51B 2MQNA 1K8AT 1K0VA 9ATCB 3T6BA 3RU0A 1OY6A 4OYPA 2YNFB 4GO5X 4NA3A 2LLZA 2QLFB 5GAHU 3NMAA 1HI8A 4QR2A 2WOMA 3E8OA 2ZDPA 3G6VA 1X4EA 1SKSA 3L95X 3O3LA 2CA9A 4LFBJ 3DC2A 3AXKA 2I0XA 2VQFF 4ZN3A 1ZM2A 1RTZA 2GFFA 2W2QP 3ZTSA 3M8SA 3LWLA 3K59A 4F50A 2CG4A 2K8GA 2E1AA 3OSNA 2RILA 1U45A 2HQ3A 2AX0A 3QBCA 2YWWA 3HVTA 2B6AA 4DQSA 1B0VA 3HHKA 3N01A 2BYCA 2DNYA 1RLDA 2HLUA 2B4VA 3IO1A 2R7TA 1SKUB 3TQEA 1K73T 3D6FB 3K2YA 4J9LA 2RAQA 3KLGB 1UVKA 1IBMJ 3G96A 1FI4A 3GYGA 1WG1A 2VFTA 5A8WA 3OUYB 3H4BA 2A1BA 1TUWA 1PO6A 5KFEA 3M30A 3VF0B 1HI1A 4PG6A 2FLPA 2HNYB 1HA1A 6FDRA 4DR7F 3CJ8A 4QZVB 2QA4G 1WSVA 4K2JA 3W64A 3PJWA 4J9QA 4WP9A 4OV6A 4YP3A 1ZOTA 2D1CA 3Q8QB 4NCGB 1HD1A 3IN5A 3D67A 2K3KA 2MKHA 4LF9F 9RUBA 2DR7A 1BQMA 3E3XA 4ZP9A 4ZVFA 2NYHA 2PN6A 1RAAB 2VG5A 3N79A 1IKVA 4DR1F 3W5YA 4CRJA 3GJTB 5I4MA 4AFFA 4DHVA 1VHIA 4P2XA 1V5VA 3GIRA 2V8DA 4LF7F 4O3RA 4ILMA 3OPKA 2NXEA 5A8RB 3BQ0A 1FJEB 5L8RC 3HJFA 2IY5B 4Z2XA 1H7WA 3VZIA 5BYRA 5FJ4A 3CCWA 5ETLA 1WTFA 3EMTA 4UOGA 3UDEA 1RTIA 5I42B 2J7UA 4LFCF 4YHHJ 3H90A 1TL3A 2CPZA 4AYBD 2LU1A 1X31C 3KK3A 4F2RA 1TKZA 4LF7J 2XC9A 3C6UB 2OEJA 4BC7A 4QWAA 1B4SA 1DQ8A 4XDDA 2K06A 2EPIA 4AXJA 5A8KB 4X4SA 4DS5A 1SKWA 1R27B 5F9NA 4X65F 4X66J 2J7WA 3DU5A 3CC2S 1VC0A 5IQQA 2QGFB 3NXZA 3SSSA 2M3DA 2JFDA 2MMYA 3IAM9 2MTLA 1WKJA 3MPWA 5JJBA 4K4WA 2CAJA 2DHAA 1WTBA 2WRMA 1Z4UA 2EFQA 1AT1B 3ONQA 2IVYA 4OZ2A 4WTOB 2KXNB 3GIMA 1OWXA 5I3UB 2MQQA 4P9SA 4F4XA 4U9RA 4UT4A 4CNYA 3DXBA 2K2PA 1S0NA 3H5SA 2UP1A 4X4UA 2XBPA 5A76A 1S4EA 5KT4A 5J2NB 3FQKA 4H4MB 3ZZZA 2VBZA 5CYQA 2XI2A 3KUEA 3NNCA 2XS2A 4QWBA 4QWCA 2XMJA 1BLUA 4WF9Q 1RLCL 3MMBA 4J9VA 3VTIA 1VHFA 3DDKA 2VA3A 3DOKB 5LM7E 3AOCA 4EO6A 1UEUA 2HNDA 3GFYA 1TAQA 4JYAF 2DHGA 1QUPA 4H4MA 4RW8B 2ADBA 2YNHA 3AB2B 1D3WA 3CCQS 4DS4A 5E3QA 5KG3A 1RWXB 4ZIWA 5IV4A 4JI4J 1LNQA 3GILA 2HRUA 3DOKA 3SFGA 3Q23A 2DY9A 4K4SA 1N34F 3B54A 2GIFA 3T1AA 4DPUA 3LH2S 5DG8A 2RDIA 4AQYJ 3Q83A 2HZAA 5C42B 4DJBA 1N36J 1ZH5A 4QYZK 1IR0A 4OZ0A 4G1QA 1HBOB 5I3PA 1FDDA 1JLEA 1YZ6A 4QW8A 5BXIA 3ADAC 2J7KA 3CW2C 4WFZA 1GTEA 4NX9A 3BS9A 4ITSA 1TK5A 2ZH5A 3FBFA 2GO8A 3LTOA 3W9HA 3D3BJ 1DURA 3DN9A 1NJZA 1HKAA 3QGPA 4I2PA 1NZAA 3CJRA 3KKFA 3CJ4A 5A0YB 5T7LA 5H9FK 1QSLA 1JLEB 3N6MA 3W62A 2RQKA 1BXNA 2NSBA 5KFMA 3T9ZA 4C98A 3M9NB 3WBZA 1CULB 2FLOA 2A3JA 2I5JB 3Q8UA 4YY3J 4PWDA 2LEPA 1LWFB 1RTJB 5DZ7A 1H2TZ 4I2PB 5HP1A 3PJXA 4MIWA 5A8KA 1RB0A 5RUBA 3P45B 4LMZA 2IRYA 4ATNA 3JQJA 3HSDA 3IWXA 3QT6A 3G86A 3OTOJ 2DR8A 1PJ7A 3NGRA 5J2PB 1NCLA 1N54B 2DNGA 1FD2A 2KT5A 1T11A 4CLZA 2YQ0A 3CJ3A 2XNRA 2V69A 2D3UA 1NHVA 2Q6CA 1D8YA 4PZVA 4O44A 1YITS 4ED5A 2ZWOA 5F9LA 1IBLF 4KH0B 1AW0A 2RQ4A 3ZC4A 5M2RA 4YR0A 3SIPB 2DXEA 3MWBA 1RWKB 2KHCA 2UVUA 1N32F 2W2MP 2C3UA 2QFJA 3SCKE 4OJ3A 1JLBB 1OPZA 2ZBCA 3GJRB 3OFFA 2ERRA 4FF4A 3AOBA 4QR0A 4RX6A 5B0GA 1S6PB 4NZ7A 5E3RA 3ZZOA 2HSEB 4TY8A 4AXIA 3FZ2A 3IGVA 1FESA 3HD2A 3NAIA 1KS2A 1UEKA 4IUFA 1U1RA 5E3CA 4Q2LA 3GONA 4HI2A 2F8EX 1S49A 4Z37A 1H7XA 3R5AA 4DG1A 2D69A 3NOGA 2XGQA 4KO0A 4ED1A 3PHTA 5C25B 1U1OA 1GT8A 3NY0A 2ABYA 1VR6A 5J2QA 3LW5C 2B7BB 5IC6B 2BE7D 2ASYA 3HVRA 1L3TA 2ACYA 5F0WA 2R42A 5DG9A 5IWAJ 4DSKA 4PQAA 1VC6A 2BJ9A 4NYZA 2FJEB 4TLQA 4U8YA 1SL1A 4LF5F 4OZNA 1OY8A 2B56A 4IH7A 5AJ3J 1U2RA 3CMES 4JI6F 1S1UB 4NEZA 4G1QB 4ER8A 3W3SA 2MYFA 3H42A 3D6MB 3Q89A 2E1RA 2BANA 1IJFB 2EK1A 3DMJA 4IFVB 5FLXU 5K8PA 3HXMA 3QIDA 3QATA 5HBMA 1WDDA 4ZJQA 1VBXA 2MQOA 2JEFA 2BJ8A 4CLWA 2LCWA 5HI7A 2CADA 3RR7A 3VGVA 2HPUA 3DHWC 1JJCB 2AF6A 1SQGA 3ZNUA 4BLGA 1CC7A 1KRPA 2MQMA 5A0YA 4GVBA 3PW0A 4MMOA 1B70B 1R8PA 1XMQJ 1JLAA 2Q43A 3FEZA 2YKAA 1SCJB 4HTJA 1U02A 1KONA 2BRLA 4MIAA 2QRRA 2GMJA 3HX9A 2DRAA 1SV5A 1LWFA 3MEEB 1XNRJ 3BO2A 2I8EA 4DQIA 3R6LB 3P5TL 1S1XB 3GJQB 4DF4A 4DUTA 1NMEB 2VBWA 3O1LA 4ED4A 5H1SV 2FVQA 2QEXS 1VQ6S 1E6VB 4B9UA 2V5HG 5ETRA 1XIQA 3KK1B 5L1LA 3NL0A 2CPEA 3TO8A 4EWTA 2ODXA 1HWUA 3PR5B 2MHNA 1RT5B 2PEHA 4Q43A 4C3LA 1Z2LA 2WVBA 1SV5B 3DRXA 3MEEA 2HQFA 2QMWA 4LREA 3VHQA 4FS1A 2AMCB 3HFVA 3OFEA 2AJ1A 1X5TA 2LEBA 1IR2A 5F8MA 1Q81T 4M94A 4I67A 2ROGA 2X7IA 2F1FA 1N5YB 1S79A 1VK3A 2MPUA 4DFJA 1TV6B 1XR5A 2MQLA 4K50A 5KFVA 2I1RA 1MG7A 2H65B 1VRTA 2JLFA 2OPQA 2U1AA 3AY0A 4ENOA 2MKKA 2J8AA 4M5GA 2DR9A 4F0HA 4N76A 2WSFC 3BYRA 4MK9A 1H0HB 3JYTB 5J1EA 1JJ4A 4ZK7M 5CCLA 1HNWF 2YQ3A 2HYIB 3ICLA 5KG1A 4YB5A 4ZJOA 2BA9A 2B5JA 4LF1A 2ILZA 1JLQA 2F63A 3ZZUA 3FBEA 4DR2F 4X2BA 2MKJA 1WKLA 2JVMA 2LQJA 3Q8PB 2QA1A 4P2FA 2V6AA 2BE2A 3WDOA 3HMJG 1KC8T 2DGWA 2J6TA 2FGCA 2AJQA 4JB8B 1V5IB 2W7AA 4QYRA 2G4BA 4QWEA 3GR0A 1DQ9A 2GHPA 3F41A 3M8QB 3O8WA 3BSAA 4X65J 2CJXB 4TU8A 4N56A 2ASJA 1OPIA 2ACMA 2HK3A 4BWMA 2CQBA 3C6TB 1IKYA 1RBLA 3JTPA 3IS9B 1TZ0A 3AQPA 1WHVA 4Y00A 4KRWA 1M1HA 4B9TA 3JSBA 2QJ3A 4G6VB 2E9ZA 3OVSA 2FHJA 2QE5A 3UI3A 5EX0A 2R4FA 3MXHP 2J9DA 1AROP 2UV8G 4KSEB 4OYBA 3UPFA 1PBUA 2DR5A 4FZVA 3Q0AA 1K9MT 3ET6B 5DZ6A 2O66A 4N8NA 4KAIA 1SPBP 3HVTB 2O1PA 3MM7A 2VQEJ 3CCJS 1RCXB 2YVSA 1LFWA 2BJ3A 2HVHA 3PX6A 2GVDA 4RNMA 5DQGA 2ZNZA 1G2EA 3QGHA 1MMLA 1S1XA 2BJ7A 4PG7A 1JIHA 3MFIA 2VHGA 1D9AA 4I7FB 1SJFA 2VONA 5KFRA 3I4HX 3RB3A 3B78A 4JYAJ 1CEZA 3KG1A 2KDOA 4NLSA 4EI2A 3GPAA 4O3SA 2GHWA 3CF5Q 2K3IA 2MZJA 5AXMA 4Q8EA 4UY85 1X5SA 2CJKA 4O0NA 1A7GE 1VQLS 1JKHB 3SCIE 3I5BA 2G2YA 3M8PA 4A4JA 3M9OB 2XTJP 4MK8A 4OI3A 1LW2A 2QLDA 1MROB 5D15A 5LMUJ 1WC6A 3CTRA 4AQYF 4QJVA 1RADB 4K4ZA 3BZQA 4IOAQ 2MHEA 1TP7A 2Q3PA 5LSOA 3GP9A 1YSJA 4O4GB 5AXKA 4OX8A 5D8HB 1QY7A 1KEKA 3RRHA 5F8JA 1VRUA 3PTWA 3M8PB 1WJ9A 1HI0P 3EVWA 5J1EB 1RT1B 5LSRA 5A8RA 5L9NA 2JC0A 2KB2A 3IRXB 5E2QA 2DTJA 3KLFB 3RBZA 2H48B 1JLQB 1L3KA 1S99A 4NLXA 5I42A 1FJGJ 3DRSA 5EUHA 5LXYA 1CJKA 3N4WA 5E41A 2IA0A 5F8LA 4WFAQ 1S0OA 1KTQA 1Q7LB 1O6XA 3G82A 4WXOA 3QGGA 3HFZB 1QD1A 1VRUB 5GAGU 2LU2A 5D4PA 2M70A 5A6PA 2E5GA 5D77A 2KHDA 1V6HA 4IR9A 3C16A 4YMEA 1C1CA 3KLFA 3ZZRA 2QMXA 3U1LA 4YDXA 1W26A 3V2UC 2P6TA 3TI0A 4J7CA 4M5JA 2B9EA 3PEJA 4PG5A 3HF5A 5SUHA 2J9CA 3L09A 2GVZA 4HHHA 1RDRA 1WEYA 2R8IA 2X1BA 5C7PA 2N82B 2VPZB 2VIHA 5AE1A 3UWTA 4FS2A 2I9SA 2KN4A 4L75A 3P49B 4B3RJ 3JSYA 1DRZA 1VJWA 4L72B 5AT1B 2FVPA 2HHXA 4DV2F 1IQTA 1N88A 3L3CA 1N4LA 2KZZA 5IT9Y 1FE4A 2RE1A 1Z1ZA 2J5AA 2JSXA 2VL1A 3NKYA 3NS7B 3BBFA 4LR8A 2CKWA 4MTPA 4B3SF 3IMQJ 5CYQB 3HULA 1REVA 3M6WA 4RNHA 2HS4A 4N7TA 3MMBB 4PG8A 2ZH8A 1RJJA 1B0TA 1P9YA 1W7WA 2JX2A 2QL7B 2VB6A 2GVDB 5T14A 2KH9A 5BR8J 2EI5A 5HROA 2VPXB 1HYSA 2GS8A 4C3KA 2DKOB 4ZPVR 3FVYA 2CPJA 4LR9A 4KHMA 4A8SA 2AYBA 2YNHB 1YJVA 3VGSA 3HP6A 4W90B 1Y9OA 2DH7A 2SXLA 3HSGA 4M95A 5IWAF 1LOUA 1U0SA 2DISA 2ATLA 3CJ5A 3H2LA 5IS2A 2N7CA 4OZ1A 4WIQA 1J2VA 2RRAA 2HFUA 4ED2A 1PC5A 3IRWP 1ZPVA 2EVZA 2OJ3A 1Y00A 1MROA 4IOCQ 3QJPA 1JLFA 2N7YA 3BGRB 2Z0GA 4JP8A 4DV1F 4HTIA 3W5ZA 2DVIA 5AJ3F 2RS2A 2F4VF 2GV1A 5MLCV 2YWKA 5L38A 2DNQA 4DL2A 3PR4A 2J8SA 1KSPA 4CLLA 3J80Y 4YR3A 1WOPA 1NEEA 1ZM9A 4EUVA 3T1YF 3J7AN 2CVEA 3IRXA 1RAIB 1HWIA 4PWUA 2IVFB 1XMQF 2MLXA 3GCWP 1VLYA 3OR1A 1BQMB 3ILIA 5LSLA 1VBZA 2ZVSA 4UY8T 4C9DA 2BV3A 4RW4B 3NGUA 1ZETA 1IKVB 4JI7F 3CCZA 3D7SB 4FYYB 1UPMB 3GTYX 3IAS9 3G4SS 2M4MA 4OX9F 4B9VA 1N5QA 4HEA9 5DDOC 2FVRA 2KJVA 5F41A 3PG9A 1FRHA 2KYXA 5CYMA 3US5A 2X1GA 2MKIA 1NK5A 2DPJA 5DJBA 1XR7A 1OYEA 3NG8A 3JSRA 1TL3B 1H2UX 3EGVA 2CIMA 2LP4A 4OYZA 3KNAA 5EN1A 2RSQA 4ZVGA 3MCOA 1V3SA 1RAFB 4A8FA 3QWPA 2COLA 4B17A 2QL9B 1VQSA 2HHVA 2YWGA 2M5YA 2VOOA 3AGYA 3K89A 1CS4A 5D4NA 3OTBA 4CO5A 2JC1A 2JWNA 4E0DA 1B7FA 1C4CA 3BEGB 3T9NA 3MTJA 4NXMJ 4PYAA 3HHLD 1RT3B 4CM2A 1SC4B 1S7IA 2RUSA 2YBVA 5GMKa 2AQ4A 1J5OB 2LKZA 4J5OA 3BB5A 4O3NA 4CH1A 2HRYA 4RW6A 4R5PB 5ETPA 1C1BA 1VDHA 2DNOA 2WW8A 3MHYA 2D3O1 4QYZJ 5LJ3Y 2PFFB 4GC7A 2HMIB 3GIIA 4O23A 4X4TA 3M32A 1RT3A 4I64A 2V2KA 4Q7AA 3S6EA 5I3QA 3LA0A 3JB9k 3QT5A 1S5ZA 3IM9A 5HJYA 1OS5A 3BH7B 5KOXA 3KHGA 1JWWA 2DPIA 2JJ4D 4P7VA 2VFRA 5C25A 4WZMA 4BBYA 4JI8J 2NPIA 4P7TA 3VAKA 1U6FA 2W01A 2MSTA 3LOUA 1FKAF 2R2TA 2BEFA 2Y1JA 1GFWB 4IFYB 2V50A 5KFTA 4EYIB 2NLWA 3D54A 3M32B 2Y0SD 1C0TB 2ALYB 2R7QA 4FYWB 1M5SA 4PCQA 1SBRA 4ZKAA 3KK2A 4ECSA 4F7VA 4K0KF 4CLFA 3BGRA 4LF2A 2CUYA 4RUCA 3EM1A 3BBCA 3MECB 5KFYA 4Y2IA 1PIEA 2IAJA 3V4IB 4OYMA 3V5RA 4X66F 3MUTP 3HT0A 3KTQA 1BHNA 1FT8A 1SH0A 2L9WA 5DRKA 4HHJA 2J6UA 1IKXB 5DDPC 3OTDA 2UUCF 4ED6A 1U1LA 1EB0A 1XNQJ 1TKXB 4I4BA 2LEAA 2HHQA 4DX6A 2GAHC 3GFZA 2IAJB 4RW4A 4C8OA 3V6HA 3N6LA 4IR1A 3MR6A 1F9FA 1KOHA 2NUUG 2OAUA 4OQJA 1HW8A 2AV5A 3J81j 3QJJA 4NLDA 1TR0A 2HHUA 1G4CA 3BPDA 3C14B 5C24A 2HGMA 4LBPA 7FDRA 4UQGA 2G1DA 2GCFA 1YJ7A 2YX7A 1UWAA 4U8VA 2OPRB 5KFOA 4NMLA 3UN5A 4PWDB 2K7KA 1NZ8A 1U2CA 1PYSB 4LVNP 2PMZD 3MMJA 2IC3A 3DKDA 3D0GE 1LEOA 2CPFA 2W7PA 5LMUF 1CS4B 5GAEI 2VA2A 1VC5A 3QYYA 1LK5A 2HIYA 3T6JA 4HHUA 5AXNA 4C0BA 4V1Ak 3MEKA 1TVRA 2LECA 3EICA 3R3TA 2FY8A 3MM6A 3UCZP 2NZ4A 2G0CA 1YJNS 5IM0B 5HMYA 5C2GA 3CIZA 2B51A 1EKSA 4RWXA 3QGIA 2WBMA 1U1QA 1C3GA 1FERA 5IFMA 3I55S 3VVUA 1YJWS 2YPZA 4OL8A 4R8UB 3A3PB 3HT3A 2H54B 3QO9A 3T19A 5BR8F 2MB0B 3PX4A 1URNA 1DJ0A 2BABA 3T5KA 2L08A 5IV3A 3RRGA 3TAMA 1H98A 4K4YA 8AT1B 1UVJA 1S6PA 4ZVSB 2XLIA 1U1KA 2E7WA 3QSIA 2N3OA 1ROFA 2VQFJ 3SZ2A 4LSLB 1HFEL 4QOTA 3IBFB 4IFYA 2ZITA 3BBBA 4YS2A 3HHLB 4U95A 4URSA 3KDNA 5E0OA 3CB4A 1QAYA 2HEKA 4I0WA 5C42A 4EK2A 4ECVA 1S97A 3M1VA 2YWEA 2AEFA 3JQKA 3CCVS 3MECA 5FDLB 1UTAA 3LALA 3F56A 4L6V3 1Q8IA 3FK4A 4JOUA 1Y10A 4K8RA 2P8IA 4F3QA 3BDPA 4DSLA 1RAGB 3AOAA 1HBMA 3NS6A 3TWZA 3QRQA 2CQDA 5GVQA 1NPPA 4KC5A 5THWA 3KJNB 4C11B 1Y11A 2IIHA 1PGZA 2ZBRA 2OUGA 4NE9C 2GQCA 3FQLA 4ERDA 3AODA 3A3OB 1RK8A 4P52A 4DCPB 2QLBB 2G2OA 2RF2B 1FDNA 3IR5B 4A8KA 3PHEA 3MM7B 5ETNA 4PUOA 2BUNA 1CULA 3FNNA 4PWWA 4EEYA 2DIVA 2C2KB 4ECYA 4RKUC 1YVFA 1KHWA 3K8VA 3SDEB 4B9LA 1Y3JA 4GVBB 3NLCA 1MSWD 2BKNA 2DO0A 3RTVA 5KFXA 1YBTA 1ZA2B 2NSCA 3MM9A 4B3OB 5B0DA 1X0FA 4U67Q 2JL9A 3PCOB 1HNIA 4IOBA 1S6QB 2FJXA 3SDEA 4DR6F 4RBUA 2MSSA 3LZ8A 4CI0B 4RBVA 4O44B 2EW9A 2WZ1A 1Q4RA 1TKDA 3DGVA 5DLFA 2DITA 5E33A 3OXLA 4N5SA 4J37A 4QPXA 2Q6BA 1WG4A 4NXNF 3QNWB 1EJ7L 5KFAA 2KJWA 2QSWA 2R7XA 3GYXB 4Y2MA 1S6QA 1S1TA 2H9ZA 4NASA 2IDEA 2ZC3A 5KT7A 4DZ6A 1IM4A 3RAQA 3JXOA 4BCAA 1Q16B 1JLCA 4HVZA 1HWJA 4TY8B 5CQGA 2VFVA 3TEGA 5IZHA 3EPGA 4J9SA 4U96A 2G2ZA 1OMSA 2HHPA 1RKJA 1FTRA 4USKA 4OI2A 4UTGA 1N5VA 2GZOA 2QIFA 4F67A 2ZJRQ 1CBKA 4Z7CA 4IYQA 1EAYC 2W2OP 2BZ2A 3SBMA 1P8GA 1SQFA 4QIWD 1S1TB 1N0UA 4KO0B 5B0FA 1Q82T 2XHCA 3HKZD 1GX6A 4M5DB 1JLCB 4LBHA 3TZWA 2PMHA 3TA2A 1IWGA 1Y7PA 4D3GA 3AXMA 3ILLA 4ZLPA 5B0CA 3PEHA 1O0PA 2GA7A 1HBNA 3HZGA 4I2QA 3FZBA 2KG0A 1GNKA 2JRRA 5E7OB 4JI5J 4XAKA 1LV5A 1RAOA 5KFHA 4U7CA 4P6QA 3LPYA 3DI6A 1NDPA 2DO4A 4G65A 4NLRA 4ANDA 1AB8A 4KYZA 1MNEA 4DPXA 2A0FB 3NWGA 1W25A 4EO8A 3AHPA 4WYWA 1YHQS 3A12A 4ED0A 4YB6A 2VDHA 5GAGI 1Q79A 2KM8B 3GG1A 2LQ5A 3ENWA 3I31A 2RKIB 4H54A 2MZTA 4DDFA 4P75A 3QLHA 2F8HA 1WF2A 3H2VE 1WF1A 3VAJA 2HGLA 1N8RT 5KT2A 2MGZB 4DV4J 5KAKA 4CLKA 3RUBL 1REVB 3BGFA 4RWWA 1FTCA 3A8JA 4WE1B 3T5LA 1WOSA 4WU2A 2RRNA 1FX2A 5B0EA 3Q8RB 3ZTQA 4OI6A 2R2RA 2OIHA 4JV1A 3I0RB 3W65A 1N48A 3MMCA 3C2PA 2RNEA 3O2IA 1VISA 2FQQB 2EKYA 4L3KA 2VBYA 3FGVA 3FRZA 1NXIA 2OEKA 4P2SA 2LA4A 5IC4B 1FA0A 1R8HA 2GJIA 1NNDA 2AGQA 1UFWA 4P2MA 3GZ7A 1EQ0A 3VGUA 2BRKA 4LSNA 4EU0A 4KKOA 3FJ2A 2DXFA 2XSJB 3PKYA 4C8ZA 4DQQA 1KBRA 1D9FA 2IVMA 4KV8A 5F3TA 4FNHA 3W2VA 1C2PA 4OHZA 1U4BA 4ZVUB 2BACA 2VKRA 2Y9HA 2YH0A 5IXUA 4J9NA 2UXCF 3I56S 1K1SA 1TUVA 3IBCB 2GAGC 4IRKA 4XO0A 3FSYA 1FKOA 3CCSS 1S72S 2B8QA 2EBGA 2NS1B 2LXFA 3CJSA 3IC1A 2V2QA 3I5CA 2RRBA 8ATCB 5DQIA 1FJGF 2XCPA 5LT5A 1JJHA 2V8HA 4F4KA 1X4BA 1F1BB 3CXCR 4A8OA 3PRDA 3HFKA 3D1OA 1NPKA 2UUCJ 2FHOB 1HHSA 4USUA 1FKOB 2EBEA 1AZSB 5ETSA 4D3HA 3M8RA 1T94A 3GFHA 2H4YB 1U8SA 3POTB 4FVCA 4OHWA 4TY9A 4ZS6A 3W1YC 4O4GA 4ETXA 4CYUA 3THTA 1TQLA 1FVQA 2DGQA 1JXVA 2BMBA 3IR7B 1HQUA 4Q2MA 2NR0A 5HL7Q 1VYAA 5U47A 2C2NA 2L9NA 2YQ1A 3ETOA 1R31A 2RQMA 2OPSA 1X5PA 5MAOA 5CYMB 5FLXY 2MLZA 3GJSB 2H4WB 4ZVQB 4K7QA 1LWCA 2NCKL 3DRRB 5HMXA 4E8UA 4HYKA 1UA1A 2CFXA 1IQZA 2KXFA 4PRFA 3JSMB 4OZ3A 4UQTA 2Y8YA 3C15B 2DGXA 3IG1A 2W9AA 1UMJA 4Y2AA 2VICA 2OGUA 2RU9A 4M5IA 1SJ3P 2XZTB 1EP4B 1C1CB 5HSPA 2JHEA 3THPA 4HDGA 1GTHA 2XYHB 3P8BB 5CCMA 4C0OC 4TN2A 3PYFA 3MR5A 1UKUA 1A9NB 4DN0A 4NA1A 4URGA 1FO1A 2EFOA 3UVJA 3SFUA 3RBDA 4MYUA 2BJ1A 2Z8QA 3OHBA 2QTWA 1S76D 2RB7A 2GVZB 2XMMA 3IBWA 4GMKA 1YX2A 4WE1A 3FCHA 4MKVA 2JLEA 5KFIA 5LXRA 1T03A 2KXHA 2OPPB 2FYXA 3GV7B 3MMCB 4ZLJA 1Q5YA 5L46A 1YJRA 2EC0A 2CQPA 3DOMA 3K5LA 3H20A 2X51A 1GMWD 4C4WA 4E2FB 3ELHA 1BC6A 4NRTA 2BBEA 1NJXA 2E1CA 4QIFA 2QFIA 3DLGA 1KVJA 1UAWA 2VG7A 4L73A 4QIVA 2IM0A 4C7QA 2KYZA 2B6AB 1GEHA 2XLJA 1QAJA 1NK7A 2IMWP 2OPPA 2CXEA 3BSCA 4DMZA 3UD4P 1TAUA 5HROB 4Y34A 2Q66A 3SV3A 2ZD1A 2IMOA 5KG7A 3P6YC 3W63A 3DGPB 2WCXA 4HT5A 4ZVOB 2YWHA 1S1WB 4OZJA 5GADU 3T1YJ 1ZZNA 4X4NA 3DLGB 1RKIA 1MWQA 4LFBF 2A6OA 4X64J 4LRCA 4LQ3A 2DEIA 1TL1A 1BWEA 2XMVA 1TUGB 3D6HB 2VBXA 3MUMP 4DU8A 1QSYA 3VAFA 2XEXA 2ZD1B 3NGKA 1XN9A 1K1QA 1UW4A 4GKJF 4USWA 1NBEB 3J81Y 4Y3CA 2XZWA 1IR1A 2XM3A 3OLAA 3KNGA 2HKEA 2OMLA 2BQRA 4DPWA 3PM9A 5D4OA 2DY1A 3V6KA 4G3IA 2WB4A 4FP9A 3HHNB 2MJNA 2ZH3A 2GIRA 3RW6A 3A3NB 3LGMA 3I4PA 3RAMA 3J7ZT 3PIOQ 2XCAA 4LF6J 4ZLLA 2CJQA 2M9KA 4F25A 1R6VA 4I68A 2XGPA 2YPYA 3BO4A 5D4LA 3C6EC 4K4TA 3PX0A 4FDFA 1S0MA 2CZ4A 1HBUB 1IKWB 3KK3B 3HHLC 2K1RA 4FPIA 3ZTRA 2H5EA 3DOLB 3H7HB 1QM9A 4K5SA 2JOQA 4QW9A 2IC3B 1RTDA 4CO2A 3CMAS 2DYAA 3M2VA 2GNKA 2VF3A 4ZDNA 3QZ7A 3KOAA 1LW0A 3UFCX 2XLKA 4OHVA 2P2CB 2GO9A 2Q79A 1XMBA 4OIXA 4ED8A 4ES2A 3KHLA 2Z2MA 4KR0B 2WONB 2DNHA 2R8HA 1HL6A 2PIIA 3DOLA 5HMZA 4K4UA 3HCXA 3FBCA 3KHRA 3TZZA 4F8RA 3PO4A 1HARA 3M2VB 5HQ8A 3OLBA 1HPZA 2A2CA 4LRFA 1K44A 1P1LA 4OYIA 2EKNA 4LFAJ 5M2PA 1WUUA 2RDJA 3IWLA 5KFKA 4J9RA 1RSCA 4OX9J 2YKNB 4JV5F 5J2MB 2H51B 3QO9B 4JI0F 1UW9A 3WC0A 2HFZA 4DX8H 4Q45A 1SL2A 3BSOA 2RH3A 2JZ5A 4ZVRB 5G4DA 3QWUA 4B9NA 1M5KC 1G7CB 4HH1A 4X4VA 2OTJS 1GQEA 4LSLA 3MEDA 1NSQA 4ZVTB 1OO0B 1T9WA 1JJ2R 1NSPA 1RT4B 1HNVA 1TMJA 1YG0A 1YGYA 2A18A 2HNDB 3CJQA 3CCES 1U47A 2W9CA 2RHSB 2HS0A 4DUYF 1S1WA 3BO3A 4DV6J 2YH1A 1AA1B 2UUAF 1OYDA 3M1VB 1X4CA 3UCUP 4WPAA 2IBKA 3QSYB 4LF4J 2W9BA 1R0BG 4FPRA 3NGSA 3SEOA 5ETTA 1NDCA 2E5HA 2B7CB 3E51A 3R5DA 4A8XA 1PC4A 1XERA 3CDWA 3QAUA 1GMVA 1FVSA 2NZCA 3GYNA 3WX4A 4DL0C 3LANA 2M8DB 1UVNA 2CQIA 1LWEA 3UQSA 4PAAA 3H59A 3D1HA 4Y65A 3OUYA 4KTQA 2OFGX 4DWIA 1P9QC 2VU5A 4NZ6A 1FXDA 3FRYA 2XNQA 3KG4A 2VODA 2VQEF 5B7WA 2IDLA 2G9OA 2YX1A 4NMXA 4ZP7A 1OQ6A 3WZ0A 5EGYA 3M2UA 3R8YA 2AD9A 2MKYA 2WW4A 4M1KA 4Q0BA 2XYGB 3K0JA 2BOPA 1UL3A 4KGVB 3PFEA 3KMSA 3M2RA 2MY7A
chains in the Genus database with same CATH topology
3TJ9A 3NY0A 3TJAA 2HFVA 1GMVA 1EARA 3AGXA 2B26A 3L9ZA 3NXZA 3LA0A 3AGZA 1EB0A 1GMUA 4J80A 2QLDA 3TJ8A 1XAOA 3I38A 3AGYA 1GMWD 1C3GA 2Q2GA 3LZ8A 1GMWA 4L3KA 1NLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ9 A;  3NY0 A;  3TJA A;  2HFV A;  1GMV A;  1EAR A;  3AGX A;  2B26 A;  3L9Z A;  3NXZ A;  3LA0 A;  3AGZ A;  1EB0 A;  1GMU A;  4J80 A;  2QLD A;  3TJ8 A;  1XAO A;  3I38 A;  3AGY A;  1GMW D;  1C3G A;  2Q2G A;  3LZ8 A;  1GMW A;  4L3K A;  1NLT A; 
#chains in the Genus database with same CATH topology
 5D0E A;  2FJA B;  3EWG A;  2B4P A;  2FZK B;  1YJ9 S;  2DD8 S;  1RTD B;  5DO2 A;  2PT0 A;  3QMQ A;  2FZC B;  3D5M A;  5C24 B;  7FD1 A;  3B4D A;  3MAA B;  4XPC A;  2FY1 A;  4B08 A;  3VAI A;  2CQG A;  4PQU B;  1RAE B;  2P6S A;  4WFN Q;  1S1V A;  1T95 A;  2DGV A;  2JDJ A;  4LFC J;  3IFE A;  2PSZ A;  1XNQ F;  3GB0 A;  5D6G A;  2J0W A;  1WSR A;  1F9H A;  1RWO B;  2ZDO A;  4DX5 A;  4J9U E;  3V6J A;  2E5L J;  2NXJ A;  1J27 A;  2FDN A;  2V2Z A;  3FCW A;  4NLU A;  1RXO B;  2KU7 A;  4M8L A;  4JI2 F;  4TU7 A;  4F0K A;  3BQ2 A;  2VFS A;  2VJV A;  1IVZ A;  1F2G A;  2E1P A;  2C2M B;  4C3M A;  5EHH A;  2BM0 A;  2NXC A;  1S1V B;  4YQW A;  2Y8W A;  1R8A A;  2V94 A;  3DLK A;  5IM0 A;  2HAI A;  3MPV A;  3FFI A;  4NZ0 A;  3PYE A;  8RUC A;  2FC9 A;  4FF3 A;  4PEO A;  4N8O A;  4OX7 A;  3BR8 A;  2MZR A;  3MED B;  2AT1 B;  3G8Q A;  4LF8 J;  3G6Y A;  2HBZ B;  2ZKU A;  3HM9 A;  3AFG A;  2ROE A;  1RT6 A;  2FJW A;  2CQC A;  4DX7 A;  1WC3 A;  2ROP A;  4DL5 A;  2JEI A;  4TU9 A;  3DI6 B;  2DCL A;  3I0S A;  3BH6 B;  2C2R A;  2AYM A;  3ZNJ 1;  3ISN C;  3A13 A;  2NXN A;  3PW5 A;  1QUV A;  1TL7 B;  3BR9 A;  4R0J A;  3MR2 A;  5DM7 Q;  4CWB A;  4X62 F;  2MZS A;  2A6M A;  4DN9 A;  1IKX A;  1MMN A;  3VV2 B;  1QTM A;  3CT9 A;  3I6P A;  3RB6 A;  2FHK A;  1F5C A;  3VAM A;  4KGX B;  1ZPW X;  3HJV A;  3H5Y A;  2CQ3 A;  4PXB A;  3I0R A;  5GAE U;  4FXW A;  3AA9 A;  3DDN A;  2UUW A;  5IT4 A;  2H5I B;  4DUZ J;  1G1X A;  4ZPW R;  1M1K T;  3AAW B;  2I38 A;  3KXD A;  2F4V J;  1VIO A;  4Y6I A;  3R1L A;  3R2D J;  4MKA A;  5L9X A;  1YBU A;  3BDE A;  3PVX A;  2ZOF A;  3LPE A;  1D0E A;  1QLN A;  2JFK A;  1ELO A;  2QV6 A;  4C97 A;  2B9Y A;  3CVK A;  1FDA A;  5DLG A;  3DHX A;  1FWP A;  2HS3 A;  3OQ2 A;  4WCE Q;  1YRX A;  2HVZ A;  3TUZ C;  4IDK B;  2HBQ B;  2Z58 B;  1S57 A;  1MWY A;  1R7I A;  4FYX B;  4LR7 A;  1JQG A;  4WII A;  3H25 A;  1DBD A;  4DLG A;  3R27 A;  5HAT A;  3HSZ A;  4CO3 A;  1ITP A;  1JXE A;  4NLT A;  3U1N A;  1XEZ A;  4WTY A;  1RHQ B;  4RUA A;  2PI4 A;  1QJH A;  1N5T A;  4EFA C;  3CNQ P;  1AUD A;  1VMB A;  5KG5 A;  4UW2 A;  2V8P A;  4DFP A;  1H3D A;  3P5B P;  1S9E B;  1UZD A;  2XYP B;  4FF1 A;  1U0H B;  4B3R F;  4L3N A;  2NRE A;  4PXD A;  1JNR B;  5JUM A;  2ZH2 A;  3QQC D;  3CDA A;  1SI9 A;  4MJK A;  2XMA A;  3VWS A;  2HGN A;  5KOW A;  3NNH A;  3DLJ A;  3C8Y A;  2GX8 A;  4HL9 A;  1CQN A;  2KT3 A;  5ETK A;  2P9E A;  4DU7 A;  1NB7 A;  2QC3 A;  4F3O A;  3FBB A;  1H73 A;  2DGU A;  2MQ8 A;  1JK9 B;  3C5X C;  2MZ1 A;  2HRT A;  4WU3 A;  2VOP A;  3TR5 A;  1R0A B;  1WC1 A;  2MY8 A;  2OPS B;  1RBA A;  1VS3 A;  2B5J B;  2M88 A;  2ZUG A;  2ZZT A;  3AD7 C;  3O6Q A;  3TYT A;  2CNO B;  1OQ3 A;  2Z30 B;  2LYV A;  3HLU A;  3TAR A;  4PPZ A;  4QQB A;  1SC3 B;  2IJR A;  4YN3 B;  4YDD B;  4F4Z A;  3T1H F;  1C0U B;  1RAC B;  1S1U A;  3NAH A;  3A8E A;  4Q8F A;  1PKU A;  4DPT A;  1LKZ A;  2AJF E;  3FCV A;  1RZM A;  1IBC B;  1NU4 A;  1FKP B;  1NAQ A;  1YTY A;  2QYC A;  4TXS A;  4F0M A;  3KLV A;  4PXC A;  3C6T A;  3RB0 A;  5EDW A;  1SJ4 P;  4WKR A;  1HBN B;  4I2Q B;  1NO8 A;  2WVE A;  1S12 A;  4ZPC A;  1N6Q B;  4NWB A;  3N6N A;  3KLE A;  5L1J A;  5JVH Q;  4DSI A;  1HW9 A;  1GXU A;  1WEX A;  3MDF A;  4NYP A;  4RBT A;  4CIO A;  2ZJQ Q;  1UFL A;  2C42 A;  4FNI A;  2PA8 D;  2C3O A;  1RE1 B;  3EDR B;  4CZC A;  4JI1 F;  2IA6 A;  2XSF A;  1M5O C;  3CCU S;  4HR2 A;  3ILJ A;  4LFA F;  3CE8 A;  2QN6 B;  3H0P A;  3AKO B;  3CIM A;  2HWI A;  1K47 A;  1CG2 A;  1RU2 A;  2W2N P;  1MMD A;  2J9D E;  1YIJ S;  3OL7 A;  1N6Q A;  1ZZF A;  2C3M A;  5K5M A;  3CJ2 A;  4LQ9 A;  2R2S A;  1FEH A;  2CWX A;  3JTO A;  1R89 A;  3AJ1 A;  3CO9 A;  3R9L A;  1BY9 A;  1B0P A;  2YNI A;  3D4J A;  4CCH A;  4WK3 A;  3KYL A;  2W24 A;  4QIE A;  3RAX A;  3LAK A;  5CA5 A;  4Q0B B;  2DHS A;  3OR2 A;  2YKQ A;  3W61 A;  1T05 B;  3FMB A;  4WYL A;  2AIR B;  1MWZ A;  4JI8 F;  3UN2 A;  3FSX A;  3GLJ A;  3FSI A;  3U02 A;  1HQ2 A;  2ZJP Q;  2GJ2 A;  1NK4 A;  2M0G B;  2PE8 A;  2BVZ A;  5K8N A;  5F8I A;  2XY5 A;  4Q44 A;  5B09 A;  4LIR A;  2YNI B;  3DRY A;  4DCO B;  5D3G A;  1U6B A;  4AD6 A;  2UXD J;  4ZPB A;  2J0S D;  3DLE B;  1TV6 A;  1P1T A;  2AEM A;  3OR2 B;  1M1G A;  1D8Z A;  1DTT B;  2FHJ D;  2GJF A;  4M5M A;  1PAE X;  4ALZ A;  1M5H A;  1RHR B;  4NRU A;  5KFZ A;  4I6W A;  2F9J A;  3Q24 A;  4C8N A;  4CLS A;  4JI1 J;  2XG8 A;  2VD3 A;  2EXU A;  3JQM A;  1FRJ A;  4DV0 F;  2OEM A;  4ZOS A;  4ZLN A;  4LVO P;  4DV5 F;  1S4F A;  3S01 A;  1G6B A;  2JEG A;  5T41 A;  1PCA A;  4NLW A;  1I5O B;  4J90 A;  4M5N A;  1M0S A;  4O3O A;  3TRG A;  2DBB A;  2DGO A;  5HN0 A;  1L5U A;  4O4R A;  2HNZ A;  2LDI A;  3KJV B;  3MD3 A;  4YEA A;  2FUG 9;  1B7Y B;  3HKW A;  5L39 A;  3T5H A;  4BHQ A;  4DR4 J;  1EHW A;  3EYZ A;  1ZBT A;  3R2C J;  1REG X;  2HG4 A;  1O51 A;  2DT9 A;  3NOC A;  1PAU B;  4KB7 A;  1K0T A;  3G82 B;  1Q95 G;  5CH7 B;  2M2B A;  2HHH J;  4DV3 J;  3KJV A;  2ZE2 A;  4TQS A;  3KWM A;  2Q1L A;  1XR6 A;  4TVA B;  2BM1 A;  4USM A;  1ULR A;  4ICL A;  5DET A;  2LQ8 A;  3R1H A;  5IT0 A;  1TK0 A;  1ZAV A;  4OJG A;  2UXB J;  2F3J A;  3RJM B;  1FK9 A;  2NQP A;  1U6Z A;  1WKK A;  3LP2 B;  4WBF A;  5EWF A;  2WON A;  3JSM A;  2AGO A;  3OFG A;  1N36 F;  2J6S A;  4DZD A;  3BRE A;  3M05 A;  1FFW B;  4ZA1 A;  5KG6 A;  3H8Y A;  2DR6 A;  3BQ1 A;  1VQY A;  3ITH A;  2VPY B;  4QR1 A;  2W25 A;  5CHC B;  2C3Y A;  3F73 A;  1APS A;  3M8Z A;  4ECW A;  5ADZ A;  4TYA A;  2HQD A;  5DM6 Q;  1D9D A;  2AP6 A;  4OJ1 A;  2E29 A;  2OFH X;  3UVJ B;  1CQM A;  3RRK A;  3VAH A;  4NI2 A;  1RHK B;  3ZZP A;  2R7V A;  4RO0 A;  1H74 A;  1NK8 A;  2GMH A;  2KRR A;  1HR0 F;  1NM2 A;  4F4Y A;  5B0A A;  1NDL A;  3SI8 A;  2ALZ A;  3D0H E;  3I9Z A;  5EX3 A;  2L41 A;  1UJ5 A;  1HNV B;  2J9E A;  3CCT A;  1JLG B;  4EGL A;  1VGY A;  3KLH A;  5E5N A;  2BQ3 A;  3W60 A;  1SC1 B;  4XTT A;  1UJ4 A;  4GKJ J;  5AXL A;  2FLL A;  1KWM A;  5KTQ A;  3DLE A;  3UD5 A;  1L3S A;  5HLF A;  3CJK A;  4DV2 J;  2QSF A;  3TNV A;  4X4R A;  3OL8 A;  2KFN A;  3MR3 A;  3G8T A;  3RBE A;  1JLG A;  1RT1 A;  2OHD A;  3I96 A;  1S9F A;  4NCG A;  3CWJ A;  2UUT A;  4RPF A;  2C2E A;  4DI6 A;  1FJ7 A;  4X4O A;  1RCO B;  3HZE A;  4LRB A;  5HK4 A;  1AZS A;  1BGX T;  4J91 A;  3UR3 C;  4F4A A;  4U6P A;  2UVW A;  3BPS P;  2AX1 A;  2DXD A;  4CYU B;  1U1M A;  2FLN A;  2YKM B;  2HNZ B;  4IO1 A;  1PYT A;  2W4C A;  4KBI A;  3CCL S;  1XC9 A;  2DNM A;  2VDI A;  4ETZ A;  2XY6 A;  2GW8 A;  4GVL A;  3G8S A;  2CZ9 A;  4C8K A;  1Y5L B;  2JVO A;  2J0X A;  3M30 B;  2I6W A;  4CO1 A;  4F02 A;  4O3P A;  4RLE A;  4A8M P;  3Q8V A;  4HLB A;  3J7Y I;  1E6Y A;  1HMV B;  3M7V A;  1CJU A;  1TKZ B;  2RD5 C;  3EZO A;  4FKX A;  3V4M A;  2FJV A;  2PDA A;  3IG1 B;  3KUH A;  4MKY A;  5KFW A;  1WHX A;  1VOM A;  2RQC A;  1BQX A;  2HQG A;  4IG3 A;  1YBA A;  4AE5 A;  2H1Y A;  2ASD A;  3GU0 A;  3PW4 A;  4DFM A;  4IO9 Q;  5KFB A;  2ZH1 A;  3D66 A;  1HBU A;  1RUS A;  4IQM A;  4C8M A;  2Q2G A;  1E6Y B;  1EET A;  1HMV A;  1NUE A;  2O5D A;  3CSK A;  3D6T B;  4HAC A;  1GMW A;  5AE3 A;  3RR8 A;  2CJ9 A;  3DXS X;  4MK7 A;  4ES3 A;  2M8H A;  3HHD A;  4UZC A;  3WC2 A;  3HDS A;  2HW3 A;  1NLT A;  3ITH B;  1CPZ A;  1KHV A;  2NUH A;  3GE9 A;  1O8B A;  3B82 A;  1GAO A;  3DU6 A;  2ZC4 A;  1TKT B;  1RA7 A;  2BW7 A;  1HIY A;  5I3U A;  3ENQ A;  1HYS B;  2VAS A;  1EET B;  1X0P A;  1P27 B;  2E7V A;  3DOM B;  1SQE A;  4MH8 A;  1NK6 A;  3VGT A;  5DG7 A;  3DLK B;  2YNF A;  1J5O A;  2XUL A;  1AXQ A;  1SIZ A;  1BUX A;  2BW2 A;  1HWK A;  4HT7 A;  3ZZ0 A;  4YB1 P;  2AJ0 A;  1DAR A;  3OHA A;  1V3R A;  4W92 B;  1QVF R;  1NSK L;  2MEW A;  3ISZ A;  1HPZ B;  1TFW A;  3IA0 A;  1PYO B;  4C2M A;  1L3U A;  3I38 A;  4K59 A;  2HMI A;  1NPR A;  1S10 A;  2AYG A;  2RIJ A;  4EBC A;  1LQ9 A;  4PG4 A;  1FCA A;  2R7W A;  2YTC A;  3TX0 A;  5EWE A;  1KNZ A;  2M7S A;  4A48 A;  4J9K A;  2RDD A;  2D3O R;  2CJA A;  4LF9 J;  5F8H A;  3K57 A;  1EKR A;  5K14 B;  1N0V C;  4O3Q A;  4YUD A;  4DR2 J;  3V81 B;  1NKE A;  4IRC A;  1Y5I B;  2DRD A;  3VQS A;  1SIW B;  3TJA A;  4CLY A;  2DHH A;  1NDK A;  1TL4 A;  3MTK A;  3NP5 A;  4USJ C;  2R2U A;  1X9W A;  3L9Z A;  2WB1 D;  4I56 A;  5K20 B;  1KDN A;  3W2W A;  2RUG A;  2WHO A;  3RYL A;  1T9V A;  3LUY A;  1HBO A;  2B9W A;  2ZFH A;  3M8Y A;  2DHX A;  4UUX A;  2QA4 S;  4DF8 A;  1WOO A;  3AB4 B;  2KM8 C;  5K14 A;  3V81 A;  3SSQ A;  3ENV A;  3LWM A;  1Q5V A;  3TW0 A;  5ETO A;  2Y3Y A;  1TU0 B;  3KJF B;  1RT7 B;  2JZ8 A;  2IJF A;  3CD6 S;  4OHX A;  1NRK A;  4AUK A;  1V9O A;  3W2W B;  2R7S A;  4ZN1 A;  1YKW A;  4MAK A;  2APO A;  3UR0 A;  2Y1R I;  1TKX A;  2C2Z B;  5DDR C;  1KFS A;  2B3T B;  4NYO A;  1TTH B;  4DV6 F;  2ZH7 A;  3OSP A;  3NS5 A;  3BGL A;  3G2X A;  3DNC A;  3S1T A;  2PGC A;  1ZTW A;  2HFO A;  4LF4 F;  2OO4 A;  1P6T A;  1RTJ A;  3NMR A;  4FBU A;  2P5V A;  3C46 A;  4ECX A;  5KFD A;  4KFB B;  5DGA A;  1R8C A;  1DHM A;  5EWG A;  3CUN A;  2VJU A;  2IM2 A;  3AGZ A;  1YRT A;  3K17 A;  2UXC J;  4RNO A;  2ZHA A;  3CCR S;  4AL6 A;  5J2P A;  4LT6 A;  4B3M J;  3QT7 A;  3T5J A;  2F40 A;  4UST A;  1R6Y A;  5LL6 d;  4WFB Q;  5HAO A;  3TJ8 A;  4CDI A;  4FXV A;  4OYX A;  2KZM A;  5GMD A;  3EE3 A;  3S7R A;  4R5P A;  4OZL A;  1F2H A;  3KDO A;  3EX7 B;  5T7L B;  3K5M A;  2HK2 A;  4CT9 A;  1U0H A;  3MAA A;  4N47 A;  1U49 A;  2EG2 A;  4DV5 J;  4WZQ A;  4USV A;  2YKN A;  3A8I A;  2ZWP A;  3R7S B;  1TVR B;  1HHT P;  2QYG A;  1H72 C;  4BC9 A;  3VAL A;  3EPI A;  4NLV A;  2XS7 A;  2CG8 A;  2YNG B;  4QBU A;  4LRA A;  2B43 A;  4AL7 A;  4ES1 A;  6AT1 B;  4NEY A;  3WQP A;  4ZCK A;  1I6J A;  2BKP A;  3MEG A;  2IBO A;  3LGN A;  1VBY A;  1U1N A;  4LJM A;  4B3S J;  2CPD A;  1S0V A;  2FB0 A;  1WAC A;  1YLX A;  2EK6 A;  1C0T A;  2D41 A;  3J7Y U;  2W9C B;  1KFD A;  3R97 A;  4PPD A;  4DG1 B;  1NH8 A;  3TAM B;  4ED7 A;  1PJ5 A;  4RW6 B;  1CVJ A;  1MU2 A;  3FDS A;  4PYD A;  4UZB A;  1GK8 A;  2Y1I A;  1KR4 A;  2V4R A;  2HHH F;  1RYR A;  4R25 A;  4S0M A;  1Q1K A;  3V4I A;  3IR6 B;  5G0R B;  4OYO A;  2QMU B;  2GGP A;  2UXB F;  2GQQ A;  1CJT A;  1EQM A;  3HHL A;  3L7O A;  2LXI A;  2R3V A;  4NL5 A;  1BQN B;  2IYG A;  1T3N A;  1JLB A;  1YWX A;  4ZPA A;  3W7B A;  4RW8 A;  1JX4 A;  3LO3 A;  3A4T A;  5C2C A;  2EFV A;  1X7V A;  1HQE B;  2HBY B;  2BKO A;  2AKW B;  1JB0 C;  2BAN B;  4IFV A;  2CPI A;  2D9P A;  3LQV A;  2E5I A;  1Y0H A;  1F3F A;  5G0R A;  1QSS A;  2EFP A;  2RHQ B;  5D0H A;  4C11 A;  2KFZ A;  4RW7 A;  3ZTO A;  1NB2 A;  1YQH A;  1FRK A;  3W66 A;  4RU9 A;  1VLO A;  4EBE A;  1VQ9 S;  2D74 B;  2HHS A;  1PG5 B;  2JVR A;  2K7J A;  3PYG A;  3GQC A;  4LF8 F;  1RWV B;  3C14 A;  2ASL A;  4LUB A;  1JLA B;  4WK1 A;  1ZA1 B;  4WWS A;  3FC9 A;  1JXL A;  3OTO F;  3C3L A;  4KGK A;  4NLY A;  3K8W A;  4F36 A;  2ZH4 A;  3MM8 B;  2O01 C;  1RT2 B;  3NCQ A;  4H4O B;  3EGZ A;  3HVW A;  4DLE A;  1U09 A;  2GML A;  2BQU A;  4BDP A;  4KFB A;  3PXG a;  4DEZ A;  2W4P A;  1A6L A;  3AA8 A;  5KT5 A;  4RW9 A;  1SXL A;  1U25 A;  2LA6 A;  1WEL A;  2CQ0 A;  2BJE A;  5IQ6 A;  3DMJ B;  4MKB A;  5B08 A;  3KK1 A;  2C2D A;  4IH5 A;  2C28 A;  1U7L A;  3OW2 R;  3Q8Y A;  3R5G A;  1Z2Z A;  2ZHB A;  3UDL A;  1N32 J;  2XWY A;  1WWH A;  3HD1 A;  2EFN A;  1IBL J;  2KFY A;  3NGT A;  3AGX A;  3QRR A;  4B3O A;  4BWJ A;  3EUN A;  3MUR P;  1IBM F;  1YDL A;  2J76 E;  4C0H A;  4ZCL A;  2N4D A;  1UWB A;  3ZTP A;  4R8U A;  1YJU A;  2OPR A;  3RW7 A;  4J80 A;  2VFU A;  5H9E J;  3DLB A;  1KN6 A;  1JMT A;  2OPQ B;  5KG4 A;  3OJS A;  4GKK J;  5DQH A;  2MJU A;  3FFI B;  2VH7 A;  2DK2 A;  2NPF A;  3BN7 A;  1VIX A;  4QU6 A;  3O5T B;  1UWB B;  4OLO A;  3J80 U;  1GXL A;  1WI8 A;  4ID8 A;  2BX6 A;  1RIS A;  1UEV A;  2XMT A;  3CD7 A;  3J81 U;  3I32 A;  4MFB B;  4V19 J;  2CQ1 A;  1KKH A;  1S6U A;  4DL3 A;  2D7S A;  3MCN A;  3THV A;  4DR7 J;  3NWR A;  1MU2 B;  3CO0 P;  2Z2Y B;  3A8K A;  1BE4 A;  5ETV A;  1T02 A;  2HZC A;  2EWH A;  2XMK A;  3LP1 A;  1MLA A;  5KFS A;  2GC8 A;  1I94 J;  3UNY A;  4NXN J;  1Q86 T;  4JI7 J;  2ZM6 J;  1VRT B;  2OTL S;  2ZZM A;  1VJQ A;  4FKY A;  4HDH A;  4YHH F;  2KKH A;  4CTA A;  1VCT A;  1FNX H;  1HQE A;  3D1Q A;  4CQ1 A;  4ZCI A;  1RYS A;  5J2Q B;  2UVR A;  4C8Y A;  3E01 B;  2V63 A;  4DBQ A;  2WBR A;  3QJL A;  1FXL A;  4ELV A;  3CJT A;  1IBK F;  1H6K X;  4RW7 B;  2HIQ A;  2RKI A;  2DB1 A;  4WP3 A;  4DXL A;  4ECR A;  3QLH B;  1VK8 A;  4DCJ B;  2L9D A;  4FXD A;  1ICE B;  1WI6 A;  2AW0 A;  3T41 A;  7AT1 B;  2R8K A;  1RHJ B;  4JI0 J;  4JV2 A;  1IWA A;  5FDL A;  2F7V A;  2OP5 A;  4KIA A;  5CXT A;  1Q78 A;  2CVI A;  1KLN A;  4F2S A;  2AZ1 A;  3T1H J;  6FD1 A;  1HBM B;  3EGW B;  4WFY A;  2V4Q A;  4M63 A;  4P71 A;  1YI2 S;  1RWM B;  5BYQ A;  1FRM A;  1OSD A;  3U1M A;  4KGZ B;  2FGO A;  2QA2 A;  4ZIV A;  3IWN C;  3TZX A;  3OXG A;  4XK8 C;  1U1P A;  2IYI A;  3MPY A;  4KT0 C;  2V9K A;  4RW9 B;  1RWU A;  1FXR A;  2RF2 A;  3BKT A;  1XWL A;  2DGS A;  3CUL A;  2OSQ A;  2EFG A;  5A2Q Y;  3CJK B;  2KG1 A;  1F5B A;  3D9B A;  4YOE A;  4L76 A;  4F4W A;  1XQI A;  2ZBQ A;  3MPD A;  2FVS A;  2C1E B;  5L1K A;  2HFN A;  1SKR A;  3MPU B;  1VQ5 S;  1LW2 B;  4CT8 A;  1SVD A;  3AD8 C;  3ET6 A;  3CDE A;  3D68 A;  3TJ9 A;  1RI7 A;  1XJW B;  3SCJ E;  2I2Y A;  3WX8 A;  1VQN S;  1S7H A;  5LJ5 Y;  2V34 A;  2Z57 B;  4RNN A;  1DTT A;  1T7P A;  1JNZ B;  4C8L A;  4H4K A;  2V8V A;  3MOZ A;  1N34 J;  1ZAW A;  1I94 F;  3FKB A;  1M5P C;  1S9G A;  1NHU A;  3GG0 A;  4M5D A;  2ZM6 F;  2KRB A;  4HKQ A;  5AE2 A;  4RR5 A;  1Y5N B;  3TUI C;  3PW2 A;  4OYW A;  3POT A;  2P9C A;  3NCP A;  4DUY J;  2V2V A;  5H9E K;  3G9C A;  2H3E B;  4NLO A;  2VG6 A;  3OL9 A;  4QU7 A;  1RP5 A;  5A6W A;  1Q0N A;  4FYD A;  3B6B A;  3N9U C;  4OI1 A;  3SQO P;  3Q22 A;  3C16 B;  3OVA A;  2BOA A;  3TA1 A;  4EBD A;  1TFY A;  1N56 A;  2DNR A;  3OTC A;  4LRD A;  2R9L A;  1HWL A;  1NH7 A;  3DRR A;  4JV0 A;  2ZEJ A;  5JXS A;  3B4M A;  1S77 D;  3P4U B;  1VQ7 S;  4DV0 J;  3GCX P;  1SUQ A;  1XNR F;  4TYB A;  1FFS B;  1H2V Z;  2JLG A;  4HAC B;  3RZA A;  2MGZ A;  4XIU A;  2LDY A;  4Y0F A;  4WP8 A;  4ECT A;  2F4F A;  2GQ2 A;  3F0N A;  4RZR A;  3HPO A;  1M90 T;  3M8Q A;  1UVM A;  1EP4 A;  2ZOM A;  3L4B C;  4I1T A;  4DR3 F;  3NNA A;  3EDQ B;  2JNJ A;  1Q7Y T;  2HFS A;  1NSA A;  3DRS B;  1PBA A;  3MGJ A;  4KGM A;  4IRD A;  1VRQ C;  5KFC A;  3HK2 A;  1T9U A;  2HVE A;  1OY9 A;  2CWK A;  4URQ U;  2HQC A;  3M9M B;  1X60 A;  2RVJ A;  3Q8S B;  2HWT A;  3KLI B;  2DRB A;  2V8G A;  2QZ8 A;  3PFO A;  3ETM A;  4KKO B;  3GV5 B;  4X62 J;  1VQM S;  3W5X A;  3J7Z 5;  3M6X A;  1T05 A;  1TL5 A;  1AUS L;  3IGN A;  4DV3 F;  2WTF A;  5LMN J;  1KQF B;  1YRU A;  2G13 A;  5KFF A;  2XWX A;  2GIQ A;  1FD8 A;  3J7A 1;  2ZUA A;  3PZP A;  3QFH A;  1HHQ A;  3D28 A;  4NI2 B;  1DY3 A;  2XI3 A;  5D3G B;  3CED A;  3L7P A;  3MCS A;  2OH2 A;  3QT8 A;  4B9M A;  1HNX F;  5LMN F;  2HLT A;  2JEJ A;  1B3T A;  3OXF A;  2X1A A;  2CRL A;  2HVI A;  1FRL A;  3MMA B;  3NRB A;  3AT1 B;  5FII A;  2IM1 A;  4DL7 A;  1VI7 A;  1U8W A;  4PAB A;  1UJ6 A;  3DM2 A;  1RWW B;  1XTZ A;  2Z2L A;  4MIB A;  2QLX A;  2AGP A;  2RML A;  2F8M A;  2FHM A;  3C66 A;  4NLP A;  1IJE B;  2E66 A;  2HUR A;  1RHU B;  2UUA J;  3P3D A;  2HVD A;  1GX5 A;  3N5B A;  4OFZ A;  1H38 A;  4KV8 B;  3W2V B;  2ZOG A;  3MMA A;  5IOL A;  3PW7 A;  4TNO A;  4ILR A;  1S9G B;  1RT7 A;  4KPC A;  3DCA A;  4MT1 A;  4JI2 J;  5CZV A;  3C19 A;  2CNL B;  3EGN A;  3DM2 B;  1CC8 A;  2BE9 B;  3RBX A;  1XBW A;  5A8W B;  3EZ5 A;  1VQP S;  1SH2 A;  3CD5 A;  1RAH B;  2HNY A;  1TK8 A;  1BWV A;  1SJR A;  3K5N A;  4CLT A;  4XDC A;  3ZFV A;  2A10 A;  4TQR A;  2YKM A;  4YB7 A;  5ETM A;  4DQP A;  3GIK A;  3PIP Q;  4YR2 A;  3PO5 A;  4KPY A;  1X4H A;  5KFQ A;  1HLW A;  4OZ5 A;  1KLM A;  4DV7 F;  4ICL B;  3HSJ A;  5CAA A;  5KFG A;  3A1Y G;  2W7O A;  3G87 A;  3TUJ C;  3MM5 A;  2OI2 A;  5KFL A;  2VG5 B;  4ANE A;  5ETQ A;  1UET A;  2C2O B;  2DGT A;  2OKQ A;  4M5H A;  1ACM B;  2HZV A;  4I6Y A;  3AJ2 A;  2MDA A;  1FWK A;  2EG1 A;  2MLY A;  4OLP A;  4CO4 A;  2UUB F;  4WJB A;  4ZP6 A;  1WOR A;  2IRU A;  5SZT A;  1CSJ A;  1ZAX A;  3ISN D;  3TAP A;  2XMW A;  2AWZ A;  2N4C A;  1IXK A;  5GAD I;  3UNG C;  1LWC B;  2RJZ A;  1QAI A;  4KHP F;  3MM5 B;  4UOC A;  2CQ2 A;  5D0R A;  1NK9 A;  2CPH A;  2RS8 A;  1WHY A;  2A2D A;  3CDU A;  1F9E B;  2ZH9 A;  2F65 A;  5HVF A;  4B02 A;  1YZ7 A;  1Q8L A;  2W4D A;  3IM8 A;  4OMF G;  1T0T V;  2H5J B;  2NXU A;  4FN5 A;  2PC6 A;  1C1B B;  1N5S A;  3OJU A;  4DR1 J;  3MEG B;  4A46 A;  2JH3 A;  3TAN A;  4JBC A;  3DLH A;  3LP0 A;  4DOZ A;  4QCL A;  1O5J A;  2CDR B;  5E3P A;  2XO7 A;  1UVI A;  1FEE A;  3DDI A;  3UDC A;  1N33 F;  1CLF A;  1U2F A;  3DGP A;  3RG6 A;  3VVT A;  3KLH B;  3UN3 A;  1VQO S;  1A0O B;  1NK0 A;  3NGD A;  3MR7 A;  1NKB A;  1F60 B;  3W9J A;  4NCA A;  1UVL A;  4W98 A;  3H5U A;  3ULH A;  1TL1 B;  2WK4 A;  1FFG B;  5CD4 H;  2V4J B;  3K5P A;  3LP0 B;  3SQG B;  4KE5 A;  4RUH A;  1N33 J;  4EZ6 A;  2YKP A;  4ZIT A;  2OLW A;  2B4U A;  3EXY A;  4DPO A;  5J2N A;  1KQK A;  2FC8 A;  2R8J A;  3PRV A;  2VG7 B;  2G0I A;  4OJH A;  4CM0 A;  4WKY A;  2DNZ A;  3V6D B;  3EZU A;  2YY3 A;  3MAH A;  1EIY B;  2KVI A;  2V4J A;  3SQG A;  3GV8 B;  3IP0 A;  1WDT A;  5HVG A;  3PY8 A;  2GHV C;  4MYT A;  1UZH A;  3PAC A;  4JI5 F;  4NA2 A;  4PXE A;  1JLF B;  2QLJ B;  1WC4 A;  3V6D A;  4DSE A;  1BMQ B;  2HBR B;  4Y2K A;  3SYZ A;  2YX4 A;  1UPP A;  2Y1L B;  1T9X A;  3GWC A;  1IKW A;  1S6O A;  2DIU A;  1DZ5 A;  3CC4 S;  3X1L B;  1CJU B;  3T3F A;  4HI1 A;  3RB4 A;  4FF2 A;  5D0G A;  1RT2 A;  2FJB B;  2FTR A;  3KUG A;  4H4O A;  2E5J A;  5J1N A;  4P73 A;  4B3M F;  4RUB A;  2C3P A;  4CLP A;  4E98 A;  3TVY A;  3W9I A;  2KI2 A;  1KLM B;  4AT1 B;  3M2U B;  4DV4 F;  4B3T J;  1F6T A;  1LW0 B;  2ILY A;  2VC0 A;  2ZKT A;  1RTI B;  5HJX A;  3TX8 A;  3MUV P;  4A8W A;  3OBI A;  3HI9 A;  1FWL A;  3W8P A;  2POK A;  4J9P A;  2QL5 B;  2UXD F;  3TZY A;  3R6G B;  3HO1 A;  4G1P A;  4NLG A;  4Y2C A;  3U7J A;  1VQK S;  3DRP A;  3UDV A;  1QAX A;  2CJB A;  4NXM F;  2G1H A;  3K7R A;  2R8G A;  4DPY A;  1HD0 A;  2WVF A;  3TQ1 A;  3MD1 A;  1TKT A;  3M8W A;  3Q2S C;  3DLL Q;  2F5G A;  1QE1 B;  2JRS A;  3GSD A;  4ZHR A;  4U7U D;  1ZYQ A;  2I5J A;  3BGU A;  3FMW A;  3S8S A;  1RA6 A;  1KOO A;  3R5B A;  5CZX A;  5HP1 B;  1FRI A;  2FD2 A;  4FBT A;  1AFJ A;  2HFV A;  3L7U A;  5K9F A;  1XMO J;  3QZ8 A;  4NLQ A;  4X4P A;  1WEZ A;  2FPH X;  3O44 A;  1KTV A;  1RT4 A;  1RU1 A;  4DSJ A;  4MFB A;  2L3M A;  3WHI A;  4KH1 B;  4O0I A;  2WOM B;  3SMZ A;  4LSZ B;  3UW1 A;  5A2Q U;  2IRX A;  3Q86 A;  1VFJ A;  2LQ9 A;  2W1B A;  5F3Z A;  4YY3 F;  1XMO F;  1HNX J;  4K4V A;  1VQ4 S;  3BJY A;  2PMW A;  3OVB A;  2FVC A;  2AEJ A;  4Y28 C;  2KL8 A;  2WAQ D;  5J2M A;  1TMM A;  2PD1 A;  3MM6 B;  4TLR A;  2E5L F;  4ECQ A;  2O67 A;  1LWE B;  3N28 A;  3OFH A;  1UFK A;  3NBP A;  4F26 A;  2FZG B;  1DQA A;  4DR5 F;  1WNE A;  1ZS6 A;  1FX4 A;  4R0E A;  2Z2Z A;  3I0S B;  2W8K A;  1AFI A;  2D3Z A;  2W2P P;  5J1P A;  4ELT A;  2AYE A;  4WFX A;  3LGH A;  4JI3 J;  2XS5 A;  1WHW A;  2U2F A;  2GGP B;  3BYP A;  2CNN B;  1QTN B;  2CPX A;  1CJT B;  5F0U A;  3D2W A;  1ZTT A;  3DFE A;  3IXQ A;  3KK2 B;  1R43 A;  2AU0 A;  3FUY A;  2ZBI A;  3KLG A;  2YWF A;  1SJ1 A;  4GO7 X;  2Y0B B;  1AYE A;  3NEK A;  4K5R A;  3ZZT A;  4J9M A;  2QG9 B;  3CC7 S;  2XMU A;  2UV8 A;  3NCR A;  2DEJ A;  2W9B B;  4DFK A;  3AH6 A;  5HQL A;  5KFJ A;  1X4D A;  4KY3 A;  2ZBP A;  1D09 B;  1RBO B;  1X4A A;  3R7B B;  2XY7 A;  4EYH B;  1FNM A;  2VV5 A;  2UU9 F;  2QO3 A;  5KT6 A;  1HR0 J;  2IHR 1;  4W4M A;  1F0X A;  3VCD A;  2X3G A;  3BF4 A;  3RGI A;  2ADC A;  1I3O B;  2B9X A;  3GSI A;  5HAN A;  2L48 A;  1T8E A;  2QX0 A;  5K8O A;  1KVK A;  1URR A;  3AQO A;  1CJV B;  1X8D A;  3MM9 B;  4Q5V A;  2R7R A;  2V68 A;  1W2B R;  3MM8 A;  4ID5 A;  2UVV A;  2KTQ A;  3DRP B;  4ZMM A;  2BJD A;  2MXY A;  2UUB J;  1D1U A;  1J5E F;  2QLW A;  4L74 A;  4LIW A;  1UP1 A;  4HH0 A;  1R8B A;  4LF5 J;  2HHT A;  1GMU A;  2PI5 A;  4OI4 A;  3H4D A;  5FD1 A;  4PUO B;  2LQB A;  4OYA A;  2XZD B;  2VZ9 A;  4EMD A;  3PDN A;  1F5A A;  2G0J A;  3M2R B;  2CPY A;  4ID5 B;  5KFP A;  1FNO A;  2YNG A;  3F44 A;  4CH0 S;  2RU3 A;  2CQ4 A;  2B4O A;  2DNN A;  1LK7 A;  2OD4 A;  1KD1 T;  1B99 A;  1N52 B;  3ZO7 A;  4OI0 A;  1YJT A;  3GMG A;  2UZA A;  3MFH A;  1FDB A;  4IH6 A;  2HQI A;  3BSN A;  4DR5 J;  4BS2 A;  1EZZ B;  4PQU A;  4X64 F;  5H9F J;  2V9W A;  4NOH A;  3AD9 C;  2DCU B;  2J0Q D;  4DR6 J;  1HNI B;  2P9G A;  1ZM3 A;  3JS9 A;  1PJ6 A;  4ECU A;  1NJW A;  2AJ2 A;  5ITH A;  1OSC A;  5JVG Q;  4DV7 J;  3SXL A;  2XB2 D;  4UOF A;  5KFN A;  4X84 A;  4JI6 J;  1N5Y A;  5E3A A;  1MN7 A;  2D9O A;  3TOQ A;  4ZCM A;  3KG0 A;  4A8Y A;  4M5K A;  4UUW A;  1IN0 A;  4ZJL A;  1R0C B;  1IBK J;  1BQN A;  3W8G A;  4P72 A;  1HNZ F;  2E9R X;  3GR1 A;  3NBP B;  4QWD A;  1C0U A;  1WG5 A;  2N3L A;  4IQX A;  1B64 A;  1L3V A;  2R7U A;  4B9S A;  4XPE A;  3VQT A;  1I1G A;  2HWH A;  5F8G A;  1T9T A;  4GKK F;  3G6X A;  3LP1 B;  4QIG A;  1Q8B A;  4KHP J;  1SL0 A;  1TEL A;  1FRX A;  1RT6 B;  5HQM A;  1X4G A;  4ZPD A;  3MAQ A;  2BE2 B;  4Z7Y A;  1MW7 A;  2CNK B;  2CDQ A;  2DH8 A;  2EC2 A;  1LXJ A;  3PJ9 A;  3TP2 A;  3SSR A;  3N5F A;  2WVC A;  1EAR A;  4UOH A;  3E01 A;  1GXT A;  1TL7 A;  2F9D A;  2AZ3 A;  3MF5 A;  3UCG A;  3Q2T C;  3PV8 A;  3SCL E;  2ZHO A;  2QT7 A;  2PEB A;  1X5O A;  3K5O A;  1RTH A;  1Y4Z B;  3DYA B;  3KFW X;  4QPT A;  3BGO P;  3QRP A;  3H98 A;  1OIA A;  3EXC X;  4IDK A;  2KVQ E;  3FEY B;  2LMI A;  3R7N B;  4YFU A;  5C5J A;  4OHY A;  2HAF A;  1KQG B;  1CJV A;  1F3V A;  2E9T A;  1RGV A;  1VQ8 S;  2E44 A;  1V3Z A;  2YXL A;  2LVW A;  3M6U A;  1T9Y A;  4CNZ A;  1FJC A;  1IUJ A;  3MZI A;  3I87 A;  4KQZ A;  4JI4 F;  4N41 A;  1RTH B;  3DYA A;  1Q53 A;  2ATC B;  4F04 B;  2KT2 A;  1NLK L;  3HVA A;  4I6A A;  2B0G A;  2OD6 A;  2ZNY A;  3BN4 A;  4CP5 A;  1W2I A;  5B0B A;  2XO6 A;  1U26 A;  4G1I A;  3G6E S;  4ILL A;  5LOQ A;  1DTQ B;  1HNW J;  3BV8 A;  1RT5 A;  3WIU A;  3HHE A;  3CCM S;  2B26 A;  4DV1 J;  3TVZ A;  2ZZN A;  2DNP A;  2DH9 A;  2MQP A;  2CQH A;  1RWN B;  2XQC A;  3H40 A;  5CYJ A;  2ZH6 A;  1X9M A;  1S48 A;  3EVM A;  3PRB A;  4NPO A;  4ECZ A;  2BDP A;  1SH3 A;  4OX6 A;  1R0A A;  2MZQ A;  1HNZ J;  1X4F A;  4K4X A;  4LSN B;  2NYI A;  3P96 A;  4ZVH A;  1EX8 A;  2PO4 A;  1WC0 A;  2V0N A;  2CJY B;  1DTQ A;  3FEX B;  2XSJ A;  2IFX A;  4GRS A;  2RT3 A;  3VR1 A;  3WIV A;  4J9O A;  3KJQ B;  4CLU A;  2AJ4 A;  5DGB A;  4ZVE A;  3PNI A;  1JKH A;  2E1M C;  3JYT A;  4P74 A;  3KMQ A;  3EVO A;  3LF0 A;  1S9E A;  3SV4 A;  2BR0 A;  3ILO A;  3TA0 A;  4B3T F;  3I82 A;  4DR3 J;  1M5V C;  2AHO B;  1Y3K A;  3MOJ B;  2E7X A;  2XHW A;  1RWP B;  3CJ0 A;  4FVM A;  1UCN A;  3M4X A;  4JUZ A;  3CGI A;  3TVK A;  2X3D A;  2VG6 B;  2VPW B;  3I9V 9;  1MN9 A;  3MI7 X;  3ZZY A;  2EEY A;  4CO0 A;  2YKO A;  4CTA B;  3KLE B;  1SJQ A;  2PFD A;  3TUP A;  1WC5 A;  3M6V A;  2HHW A;  1RAB B;  2MKC A;  3QIP A;  1S59 A;  5KG2 A;  2LFV A;  3IS9 A;  1CJK B;  1WF0 A;  2WVD A;  3BKU A;  1IM6 A;  4IG0 A;  2B8P A;  1OJ4 A;  2VKZ G;  1T3O A;  3N0V A;  3LP2 A;  3JAM Y;  4ED3 A;  1FHT A;  2WSE C;  3E2E A;  3R5C A;  4UF4 A;  1LXN A;  5DS7 A;  3JAM U;  4GC6 A;  1HQU B;  1XK8 A;  4AL5 A;  2VUG A;  5F8N A;  4DSF A;  4A47 A;  4N77 A;  2KO1 A;  3QIP B;  3QAE A;  5BYS A;  1FKP A;  4DQR A;  2BXJ A;  4IG0 B;  4RJV A;  1BD6 A;  4USI A;  4OV1 A;  4K0K J;  5DDQ C;  5L1I A;  4F3M A;  1C4A A;  3OTE A;  5M2U A;  4JV5 J;  4V19 X;  3R5J B;  1GH8 A;  1X9S A;  3AJD A;  2LXU A;  5BJR A;  2MKS A;  4PKD B;  5HBM B;  3TAQ A;  2W8L A;  3KHH A;  3UE2 A;  4NCB A;  1SB6 A;  4I69 A;  4U7U K;  4RU2 A;  4ZVP B;  5CD4 A;  4PR6 A;  4K2X A;  1Q8K A;  3GFX A;  3VAG A;  1J5E J;  1FF2 A;  3BKF A;  4I7F A;  1DAX A;  1NJY A;  1QVG R;  2ZVI A;  2X1F A;  1T03 B;  5HLF B;  1DFD A;  4JI3 F;  1DLO B;  1ZM4 A;  3X3U A;  5GAH I;  3QFW A;  5HMW A;  3B8H A;  2OEL A;  4USH A;  3ZXW A;  3PKM A;  4M5L A;  4C6A A;  3CPW R;  3JTN A;  1FE0 A;  3OV7 A;  5HO4 A;  1E6V A;  4X4Q A;  3OT9 A;  2C22 A;  4DR4 F;  4ELU A;  1QDU B;  2VC1 A;  3OD2 A;  4ZPT R;  4FYV B;  4P10 A;  1DLO A;  5D78 A;  3BM7 A;  3MCM A;  1PSD A;  2FJD B;  1UA0 A;  2CZV C;  4ANC A;  2UU9 J;  4CH7 A;  2IM3 A;  1G3O A;  1YK9 A;  5CAB A;  3G71 S;  2PA3 A;  2IPO B;  4WXW A;  1NJI T;  3CDB A;  5KT3 A;  3OL6 A;  3EJM A;  3LAM A;  4KJI A;  4RL1 A;  2FIU A;  3I5A A;  3PYD A;  3QPI A;  1SUQ B;  1KQS R;  2K1R B;  3D3C J;  3H5X A;  3TEH B;  4IKA A;  2O3D A;  4KHR A;  4IG3 B;  1KVI A;  1LWX A;  1KP6 A;  3OR1 B;  3GIJ A;  2M52 A;  4EZ9 A;  5KG0 A;  1NHK L;  3UO0 A;  5KFU A;  1PIL A;  1QE1 A;  1U24 A;  4ZHR B;  1RAJ A;  3K58 A;  4C48 A;  1NKC A;  5HVH A;  4LF6 F;  2V67 A;  2CYY A;  2IJN A;  2OSR A;  1WD6 A;  5JMN A;  2DJW A;  3C15 A;  3U27 A;  2ZE2 B;  3C6U A;  2DNK A;  4LBI A;  5K8M A;  1RQ0 A;  3CMQ A;  2DNL A;  2WSC C;  3KLI A;  5GME A;  4DL4 A;  1U48 A;  1LFP A;  2R7O A;  2Z56 B;  4DUZ F;  4DL6 A;  1R3N A;  3VZH A;  3D0I E;  1XAO A;  3CD0 A;  4ZP8 A;  3UD3 P;  5IT9 U;  3ENA A;  1VBK A;  1IKY B;  2Z4P A;  1SC6 A;  3H2U B;  1RHM B;  1FK9 B;  4H4K C;  2OMO A;  4TKT A;  4RNF A;  4A8Q A;  1I51 B;  2MQN A;  1K8A T;  1K0V A;  9ATC B;  3T6B A;  3RU0 A;  1OY6 A;  4OYP A;  2YNF B;  4GO5 X;  4NA3 A;  2LLZ A;  2QLF B;  5GAH U;  3NMA A;  1HI8 A;  4QR2 A;  2WOM A;  3E8O A;  2ZDP A;  3G6V A;  1X4E A;  1SKS A;  3L95 X;  3O3L A;  2CA9 A;  4LFB J;  3DC2 A;  3AXK A;  2I0X A;  2VQF F;  4ZN3 A;  1ZM2 A;  1RTZ A;  2GFF A;  2W2Q P;  3ZTS A;  3M8S A;  3LWL A;  3K59 A;  4F50 A;  2CG4 A;  2K8G A;  2E1A A;  3OSN A;  2RIL A;  1U45 A;  2HQ3 A;  2AX0 A;  3QBC A;  2YWW A;  3HVT A;  2B6A A;  4DQS A;  1B0V A;  3HHK A;  3N01 A;  2BYC A;  2DNY A;  1RLD A;  2HLU A;  2B4V A;  3IO1 A;  2R7T A;  1SKU B;  3TQE A;  1K73 T;  3D6F B;  3K2Y A;  4J9L A;  2RAQ A;  3KLG B;  1UVK A;  1IBM J;  3G96 A;  1FI4 A;  3GYG A;  1WG1 A;  2VFT A;  5A8W A;  3OUY B;  3H4B A;  2A1B A;  1TUW A;  1PO6 A;  5KFE A;  3M30 A;  3VF0 B;  1HI1 A;  4PG6 A;  2FLP A;  2HNY B;  1HA1 A;  6FDR A;  4DR7 F;  3CJ8 A;  4QZV B;  2QA4 G;  1WSV A;  4K2J A;  3W64 A;  3PJW A;  4J9Q A;  4WP9 A;  4OV6 A;  4YP3 A;  1ZOT A;  2D1C A;  3Q8Q B;  4NCG B;  1HD1 A;  3IN5 A;  3D67 A;  2K3K A;  2MKH A;  4LF9 F;  9RUB A;  2DR7 A;  1BQM A;  3E3X A;  4ZP9 A;  4ZVF A;  2NYH A;  2PN6 A;  1RAA B;  2VG5 A;  3N79 A;  1IKV A;  4DR1 F;  3W5Y A;  4CRJ A;  3GJT B;  5I4M A;  4AFF A;  4DHV A;  1VHI A;  4P2X A;  1V5V A;  3GIR A;  2V8D A;  4LF7 F;  4O3R A;  4ILM A;  3OPK A;  2NXE A;  5A8R B;  3BQ0 A;  1FJE B;  5L8R C;  3HJF A;  2IY5 B;  4Z2X A;  1H7W A;  3VZI A;  5BYR A;  5FJ4 A;  3CCW A;  5ETL A;  1WTF A;  3EMT A;  4UOG A;  3UDE A;  1RTI A;  5I42 B;  2J7U A;  4LFC F;  4YHH J;  3H90 A;  1TL3 A;  2CPZ A;  4AYB D;  2LU1 A;  1X31 C;  3KK3 A;  4F2R A;  1TKZ A;  4LF7 J;  2XC9 A;  3C6U B;  2OEJ A;  4BC7 A;  4QWA A;  1B4S A;  1DQ8 A;  4XDD A;  2K06 A;  2EPI A;  4AXJ A;  5A8K B;  4X4S A;  4DS5 A;  1SKW A;  1R27 B;  5F9N A;  4X65 F;  4X66 J;  2J7W A;  3DU5 A;  3CC2 S;  1VC0 A;  5IQQ A;  2QGF B;  3NXZ A;  3SSS A;  2M3D A;  2JFD A;  2MMY A;  3IAM 9;  2MTL A;  1WKJ A;  3MPW A;  5JJB A;  4K4W A;  2CAJ A;  2DHA A;  1WTB A;  2WRM A;  1Z4U A;  2EFQ A;  1AT1 B;  3ONQ A;  2IVY A;  4OZ2 A;  4WTO B;  2KXN B;  3GIM A;  1OWX A;  5I3U B;  2MQQ A;  4P9S A;  4F4X A;  4U9R A;  4UT4 A;  4CNY A;  3DXB A;  2K2P A;  1S0N A;  3H5S A;  2UP1 A;  4X4U A;  2XBP A;  5A76 A;  1S4E A;  5KT4 A;  5J2N B;  3FQK A;  4H4M B;  3ZZZ A;  2VBZ A;  5CYQ A;  2XI2 A;  3KUE A;  3NNC A;  2XS2 A;  4QWB A;  4QWC A;  2XMJ A;  1BLU A;  4WF9 Q;  1RLC L;  3MMB A;  4J9V A;  3VTI A;  1VHF A;  3DDK A;  2VA3 A;  3DOK B;  5LM7 E;  3AOC A;  4EO6 A;  1UEU A;  2HND A;  3GFY A;  1TAQ A;  4JYA F;  2DHG A;  1QUP A;  4H4M A;  4RW8 B;  2ADB A;  2YNH A;  3AB2 B;  1D3W A;  3CCQ S;  4DS4 A;  5E3Q A;  5KG3 A;  1RWX B;  4ZIW A;  5IV4 A;  4JI4 J;  1LNQ A;  3GIL A;  2HRU A;  3DOK A;  3SFG A;  3Q23 A;  2DY9 A;  4K4S A;  1N34 F;  3B54 A;  2GIF A;  3T1A A;  4DPU A;  3LH2 S;  5DG8 A;  2RDI A;  4AQY J;  3Q83 A;  2HZA A;  5C42 B;  4DJB A;  1N36 J;  1ZH5 A;  4QYZ K;  1IR0 A;  4OZ0 A;  4G1Q A;  1HBO B;  5I3P A;  1FDD A;  1JLE A;  1YZ6 A;  4QW8 A;  5BXI A;  3ADA C;  2J7K A;  3CW2 C;  4WFZ A;  1GTE A;  4NX9 A;  3BS9 A;  4ITS A;  1TK5 A;  2ZH5 A;  3FBF A;  2GO8 A;  3LTO A;  3W9H A;  3D3B J;  1DUR A;  3DN9 A;  1NJZ A;  1HKA A;  3QGP A;  4I2P A;  1NZA A;  3CJR A;  3KKF A;  3CJ4 A;  5A0Y B;  5T7L A;  5H9F K;  1QSL A;  1JLE B;  3N6M A;  3W62 A;  2RQK A;  1BXN A;  2NSB A;  5KFM A;  3T9Z A;  4C98 A;  3M9N B;  3WBZ A;  1CUL B;  2FLO A;  2A3J A;  2I5J B;  3Q8U A;  4YY3 J;  4PWD A;  2LEP A;  1LWF B;  1RTJ B;  5DZ7 A;  1H2T Z;  4I2P B;  5HP1 A;  3PJX A;  4MIW A;  5A8K A;  1RB0 A;  5RUB A;  3P45 B;  4LMZ A;  2IRY A;  4ATN A;  3JQJ A;  3HSD A;  3IWX A;  3QT6 A;  3G86 A;  3OTO J;  2DR8 A;  1PJ7 A;  3NGR A;  5J2P B;  1NCL A;  1N54 B;  2DNG A;  1FD2 A;  2KT5 A;  1T11 A;  4CLZ A;  2YQ0 A;  3CJ3 A;  2XNR A;  2V69 A;  2D3U A;  1NHV A;  2Q6C A;  1D8Y A;  4PZV A;  4O44 A;  1YIT S;  4ED5 A;  2ZWO A;  5F9L A;  1IBL F;  4KH0 B;  1AW0 A;  2RQ4 A;  3ZC4 A;  5M2R A;  4YR0 A;  3SIP B;  2DXE A;  3MWB A;  1RWK B;  2KHC A;  2UVU A;  1N32 F;  2W2M P;  2C3U A;  2QFJ A;  3SCK E;  4OJ3 A;  1JLB B;  1OPZ A;  2ZBC A;  3GJR B;  3OFF A;  2ERR A;  4FF4 A;  3AOB A;  4QR0 A;  4RX6 A;  5B0G A;  1S6P B;  4NZ7 A;  5E3R A;  3ZZO A;  2HSE B;  4TY8 A;  4AXI A;  3FZ2 A;  3IGV A;  1FES A;  3HD2 A;  3NAI A;  1KS2 A;  1UEK A;  4IUF A;  1U1R A;  5E3C A;  4Q2L A;  3GON A;  4HI2 A;  2F8E X;  1S49 A;  4Z37 A;  1H7X A;  3R5A A;  4DG1 A;  2D69 A;  3NOG A;  2XGQ A;  4KO0 A;  4ED1 A;  3PHT A;  5C25 B;  1U1O A;  1GT8 A;  3NY0 A;  2ABY A;  1VR6 A;  5J2Q A;  3LW5 C;  2B7B B;  5IC6 B;  2BE7 D;  2ASY A;  3HVR A;  1L3T A;  2ACY A;  5F0W A;  2R42 A;  5DG9 A;  5IWA J;  4DSK A;  4PQA A;  1VC6 A;  2BJ9 A;  4NYZ A;  2FJE B;  4TLQ A;  4U8Y A;  1SL1 A;  4LF5 F;  4OZN A;  1OY8 A;  2B56 A;  4IH7 A;  5AJ3 J;  1U2R A;  3CME S;  4JI6 F;  1S1U B;  4NEZ A;  4G1Q B;  4ER8 A;  3W3S A;  2MYF A;  3H42 A;  3D6M B;  3Q89 A;  2E1R A;  2BAN A;  1IJF B;  2EK1 A;  3DMJ A;  4IFV B;  5FLX U;  5K8P A;  3HXM A;  3QID A;  3QAT A;  5HBM A;  1WDD A;  4ZJQ A;  1VBX A;  2MQO A;  2JEF A;  2BJ8 A;  4CLW A;  2LCW A;  5HI7 A;  2CAD A;  3RR7 A;  3VGV A;  2HPU A;  3DHW C;  1JJC B;  2AF6 A;  1SQG A;  3ZNU A;  4BLG A;  1CC7 A;  1KRP A;  2MQM A;  5A0Y A;  4GVB A;  3PW0 A;  4MMO A;  1B70 B;  1R8P A;  1XMQ J;  1JLA A;  2Q43 A;  3FEZ A;  2YKA A;  1SCJ B;  4HTJ A;  1U02 A;  1KON A;  2BRL A;  4MIA A;  2QRR A;  2GMJ A;  3HX9 A;  2DRA A;  1SV5 A;  1LWF A;  3MEE B;  1XNR J;  3BO2 A;  2I8E A;  4DQI A;  3R6L B;  3P5T L;  1S1X B;  3GJQ B;  4DF4 A;  4DUT A;  1NME B;  2VBW A;  3O1L A;  4ED4 A;  5H1S V;  2FVQ A;  2QEX S;  1VQ6 S;  1E6V B;  4B9U A;  2V5H G;  5ETR A;  1XIQ A;  3KK1 B;  5L1L A;  3NL0 A;  2CPE A;  3TO8 A;  4EWT A;  2ODX A;  1HWU A;  3PR5 B;  2MHN A;  1RT5 B;  2PEH A;  4Q43 A;  4C3L A;  1Z2L A;  2WVB A;  1SV5 B;  3DRX A;  3MEE A;  2HQF A;  2QMW A;  4LRE A;  3VHQ A;  4FS1 A;  2AMC B;  3HFV A;  3OFE A;  2AJ1 A;  1X5T A;  2LEB A;  1IR2 A;  5F8M A;  1Q81 T;  4M94 A;  4I67 A;  2ROG A;  2X7I A;  2F1F A;  1N5Y B;  1S79 A;  1VK3 A;  2MPU A;  4DFJ A;  1TV6 B;  1XR5 A;  2MQL A;  4K50 A;  5KFV A;  2I1R A;  1MG7 A;  2H65 B;  1VRT A;  2JLF A;  2OPQ A;  2U1A A;  3AY0 A;  4ENO A;  2MKK A;  2J8A A;  4M5G A;  2DR9 A;  4F0H A;  4N76 A;  2WSF C;  3BYR A;  4MK9 A;  1H0H B;  3JYT B;  5J1E A;  1JJ4 A;  4ZK7 M;  5CCL A;  1HNW F;  2YQ3 A;  2HYI B;  3ICL A;  5KG1 A;  4YB5 A;  4ZJO A;  2BA9 A;  2B5J A;  4LF1 A;  2ILZ A;  1JLQ A;  2F63 A;  3ZZU A;  3FBE A;  4DR2 F;  4X2B A;  2MKJ A;  1WKL A;  2JVM A;  2LQJ A;  3Q8P B;  2QA1 A;  4P2F A;  2V6A A;  2BE2 A;  3WDO A;  3HMJ G;  1KC8 T;  2DGW A;  2J6T A;  2FGC A;  2AJQ A;  4JB8 B;  1V5I B;  2W7A A;  4QYR A;  2G4B A;  4QWE A;  3GR0 A;  1DQ9 A;  2GHP A;  3F41 A;  3M8Q B;  3O8W A;  3BSA A;  4X65 J;  2CJX B;  4TU8 A;  4N56 A;  2ASJ A;  1OPI A;  2ACM A;  2HK3 A;  4BWM A;  2CQB A;  3C6T B;  1IKY A;  1RBL A;  3JTP A;  3IS9 B;  1TZ0 A;  3AQP A;  1WHV A;  4Y00 A;  4KRW A;  1M1H A;  4B9T A;  3JSB A;  2QJ3 A;  4G6V B;  2E9Z A;  3OVS A;  2FHJ A;  2QE5 A;  3UI3 A;  5EX0 A;  2R4F A;  3MXH P;  2J9D A;  1ARO P;  2UV8 G;  4KSE B;  4OYB A;  3UPF A;  1PBU A;  2DR5 A;  4FZV A;  3Q0A A;  1K9M T;  3ET6 B;  5DZ6 A;  2O66 A;  4N8N A;  4KAI A;  1SPB P;  3HVT B;  2O1P A;  3MM7 A;  2VQE J;  3CCJ S;  1RCX B;  2YVS A;  1LFW A;  2BJ3 A;  2HVH A;  3PX6 A;  2GVD A;  4RNM A;  5DQG A;  2ZNZ A;  1G2E A;  3QGH A;  1MML A;  1S1X A;  2BJ7 A;  4PG7 A;  1JIH A;  3MFI A;  2VHG A;  1D9A A;  4I7F B;  1SJF A;  2VON A;  5KFR A;  3I4H X;  3RB3 A;  3B78 A;  4JYA J;  1CEZ A;  3KG1 A;  2KDO A;  4NLS A;  4EI2 A;  3GPA A;  4O3S A;  2GHW A;  3CF5 Q;  2K3I A;  2MZJ A;  5AXM A;  4Q8E A;  4UY8 5;  1X5S A;  2CJK A;  4O0N A;  1A7G E;  1VQL S;  1JKH B;  3SCI E;  3I5B A;  2G2Y A;  3M8P A;  4A4J A;  3M9O B;  2XTJ P;  4MK8 A;  4OI3 A;  1LW2 A;  2QLD A;  1MRO B;  5D15 A;  5LMU J;  1WC6 A;  3CTR A;  4AQY F;  4QJV A;  1RAD B;  4K4Z A;  3BZQ A;  4IOA Q;  2MHE A;  1TP7 A;  2Q3P A;  5LSO A;  3GP9 A;  1YSJ A;  4O4G B;  5AXK A;  4OX8 A;  5D8H B;  1QY7 A;  1KEK A;  3RRH A;  5F8J A;  1VRU A;  3PTW A;  3M8P B;  1WJ9 A;  1HI0 P;  3EVW A;  5J1E B;  1RT1 B;  5LSR A;  5A8R A;  5L9N A;  2JC0 A;  2KB2 A;  3IRX B;  5E2Q A;  2DTJ A;  3KLF B;  3RBZ A;  2H48 B;  1JLQ B;  1L3K A;  1S99 A;  4NLX A;  5I42 A;  1FJG J;  3DRS A;  5EUH A;  5LXY A;  1CJK A;  3N4W A;  5E41 A;  2IA0 A;  5F8L A;  4WFA Q;  1S0O A;  1KTQ A;  1Q7L B;  1O6X A;  3G82 A;  4WXO A;  3QGG A;  3HFZ B;  1QD1 A;  1VRU B;  5GAG U;  2LU2 A;  5D4P A;  2M70 A;  5A6P A;  2E5G A;  5D77 A;  2KHD A;  1V6H A;  4IR9 A;  3C16 A;  4YME A;  1C1C A;  3KLF A;  3ZZR A;  2QMX A;  3U1L A;  4YDX A;  1W26 A;  3V2U C;  2P6T A;  3TI0 A;  4J7C A;  4M5J A;  2B9E A;  3PEJ A;  4PG5 A;  3HF5 A;  5SUH A;  2J9C A;  3L09 A;  2GVZ A;  4HHH A;  1RDR A;  1WEY A;  2R8I A;  2X1B A;  5C7P A;  2N82 B;  2VPZ B;  2VIH A;  5AE1 A;  3UWT A;  4FS2 A;  2I9S A;  2KN4 A;  4L75 A;  3P49 B;  4B3R J;  3JSY A;  1DRZ A;  1VJW A;  4L72 B;  5AT1 B;  2FVP A;  2HHX A;  4DV2 F;  1IQT A;  1N88 A;  3L3C A;  1N4L A;  2KZZ A;  5IT9 Y;  1FE4 A;  2RE1 A;  1Z1Z A;  2J5A A;  2JSX A;  2VL1 A;  3NKY A;  3NS7 B;  3BBF A;  4LR8 A;  2CKW A;  4MTP A;  4B3S F;  3IMQ J;  5CYQ B;  3HUL A;  1REV A;  3M6W A;  4RNH A;  2HS4 A;  4N7T A;  3MMB B;  4PG8 A;  2ZH8 A;  1RJJ A;  1B0T A;  1P9Y A;  1W7W A;  2JX2 A;  2QL7 B;  2VB6 A;  2GVD B;  5T14 A;  2KH9 A;  5BR8 J;  2EI5 A;  5HRO A;  2VPX B;  1HYS A;  2GS8 A;  4C3K A;  2DKO B;  4ZPV R;  3FVY A;  2CPJ A;  4LR9 A;  4KHM A;  4A8S A;  2AYB A;  2YNH B;  1YJV A;  3VGS A;  3HP6 A;  4W90 B;  1Y9O A;  2DH7 A;  2SXL A;  3HSG A;  4M95 A;  5IWA F;  1LOU A;  1U0S A;  2DIS A;  2ATL A;  3CJ5 A;  3H2L A;  5IS2 A;  2N7C A;  4OZ1 A;  4WIQ A;  1J2V A;  2RRA A;  2HFU A;  4ED2 A;  1PC5 A;  3IRW P;  1ZPV A;  2EVZ A;  2OJ3 A;  1Y00 A;  1MRO A;  4IOC Q;  3QJP A;  1JLF A;  2N7Y A;  3BGR B;  2Z0G A;  4JP8 A;  4DV1 F;  4HTI A;  3W5Z A;  2DVI A;  5AJ3 F;  2RS2 A;  2F4V F;  2GV1 A;  5MLC V;  2YWK A;  5L38 A;  2DNQ A;  4DL2 A;  3PR4 A;  2J8S A;  1KSP A;  4CLL A;  3J80 Y;  4YR3 A;  1WOP A;  1NEE A;  1ZM9 A;  4EUV A;  3T1Y F;  3J7A N;  2CVE A;  3IRX A;  1RAI B;  1HWI A;  4PWU A;  2IVF B;  1XMQ F;  2MLX A;  3GCW P;  1VLY A;  3OR1 A;  1BQM B;  3ILI A;  5LSL A;  1VBZ A;  2ZVS A;  4UY8 T;  4C9D A;  2BV3 A;  4RW4 B;  3NGU A;  1ZET A;  1IKV B;  4JI7 F;  3CCZ A;  3D7S B;  4FYY B;  1UPM B;  3GTY X;  3IAS 9;  3G4S S;  2M4M A;  4OX9 F;  4B9V A;  1N5Q A;  4HEA 9;  5DDO C;  2FVR A;  2KJV A;  5F41 A;  3PG9 A;  1FRH A;  2KYX A;  5CYM A;  3US5 A;  2X1G A;  2MKI A;  1NK5 A;  2DPJ A;  5DJB A;  1XR7 A;  1OYE A;  3NG8 A;  3JSR A;  1TL3 B;  1H2U X;  3EGV A;  2CIM A;  2LP4 A;  4OYZ A;  3KNA A;  5EN1 A;  2RSQ A;  4ZVG A;  3MCO A;  1V3S A;  1RAF B;  4A8F A;  3QWP A;  2COL A;  4B17 A;  2QL9 B;  1VQS A;  2HHV A;  2YWG A;  2M5Y A;  2VOO A;  3AGY A;  3K89 A;  1CS4 A;  5D4N A;  3OTB A;  4CO5 A;  2JC1 A;  2JWN A;  4E0D A;  1B7F A;  1C4C A;  3BEG B;  3T9N A;  3MTJ A;  4NXM J;  4PYA A;  3HHL D;  1RT3 B;  4CM2 A;  1SC4 B;  1S7I A;  2RUS A;  2YBV A;  5GMK a;  2AQ4 A;  1J5O B;  2LKZ A;  4J5O A;  3BB5 A;  4O3N A;  4CH1 A;  2HRY A;  4RW6 A;  4R5P B;  5ETP A;  1C1B A;  1VDH A;  2DNO A;  2WW8 A;  3MHY A;  2D3O 1;  4QYZ J;  5LJ3 Y;  2PFF B;  4GC7 A;  2HMI B;  3GII A;  4O23 A;  4X4T A;  3M32 A;  1RT3 A;  4I64 A;  2V2K A;  4Q7A A;  3S6E A;  5I3Q A;  3LA0 A;  3JB9 k;  3QT5 A;  1S5Z A;  3IM9 A;  5HJY A;  1OS5 A;  3BH7 B;  5KOX A;  3KHG A;  1JWW A;  2DPI A;  2JJ4 D;  4P7V A;  2VFR A;  5C25 A;  4WZM A;  4BBY A;  4JI8 J;  2NPI A;  4P7T A;  3VAK A;  1U6F A;  2W01 A;  2MST A;  3LOU A;  1FKA F;  2R2T A;  2BEF A;  2Y1J A;  1GFW B;  4IFY B;  2V50 A;  5KFT A;  4EYI B;  2NLW A;  3D54 A;  3M32 B;  2Y0S D;  1C0T B;  2ALY B;  2R7Q A;  4FYW B;  1M5S A;  4PCQ A;  1SBR A;  4ZKA A;  3KK2 A;  4ECS A;  4F7V A;  4K0K F;  4CLF A;  3BGR A;  4LF2 A;  2CUY A;  4RUC A;  3EM1 A;  3BBC A;  3MEC B;  5KFY A;  4Y2I A;  1PIE A;  2IAJ A;  3V4I B;  4OYM A;  3V5R A;  4X66 F;  3MUT P;  3HT0 A;  3KTQ A;  1BHN A;  1FT8 A;  1SH0 A;  2L9W A;  5DRK A;  4HHJ A;  2J6U A;  1IKX B;  5DDP C;  3OTD A;  2UUC F;  4ED6 A;  1U1L A;  1EB0 A;  1XNQ J;  1TKX B;  4I4B A;  2LEA A;  2HHQ A;  4DX6 A;  2GAH C;  3GFZ A;  2IAJ B;  4RW4 A;  4C8O A;  3V6H A;  3N6L A;  4IR1 A;  3MR6 A;  1F9F A;  1KOH A;  2NUU G;  2OAU A;  4OQJ A;  1HW8 A;  2AV5 A;  3J81 j;  3QJJ A;  4NLD A;  1TR0 A;  2HHU A;  1G4C A;  3BPD A;  3C14 B;  5C24 A;  2HGM A;  4LBP A;  7FDR A;  4UQG A;  2G1D A;  2GCF A;  1YJ7 A;  2YX7 A;  1UWA A;  4U8V A;  2OPR B;  5KFO A;  4NML A;  3UN5 A;  4PWD B;  2K7K A;  1NZ8 A;  1U2C A;  1PYS B;  4LVN P;  2PMZ D;  3MMJ A;  2IC3 A;  3DKD A;  3D0G E;  1LEO A;  2CPF A;  2W7P A;  5LMU F;  1CS4 B;  5GAE I;  2VA2 A;  1VC5 A;  3QYY A;  1LK5 A;  2HIY A;  3T6J A;  4HHU A;  5AXN A;  4C0B A;  4V1A k;  3MEK A;  1TVR A;  2LEC A;  3EIC A;  3R3T A;  2FY8 A;  3MM6 A;  3UCZ P;  2NZ4 A;  2G0C A;  1YJN S;  5IM0 B;  5HMY A;  5C2G A;  3CIZ A;  2B51 A;  1EKS A;  4RWX A;  3QGI A;  2WBM A;  1U1Q A;  1C3G A;  1FER A;  5IFM A;  3I55 S;  3VVU A;  1YJW S;  2YPZ A;  4OL8 A;  4R8U B;  3A3P B;  3HT3 A;  2H54 B;  3QO9 A;  3T19 A;  5BR8 F;  2MB0 B;  3PX4 A;  1URN A;  1DJ0 A;  2BAB A;  3T5K A;  2L08 A;  5IV3 A;  3RRG A;  3TAM A;  1H98 A;  4K4Y A;  8AT1 B;  1UVJ A;  1S6P A;  4ZVS B;  2XLI A;  1U1K A;  2E7W A;  3QSI A;  2N3O A;  1ROF A;  2VQF J;  3SZ2 A;  4LSL B;  1HFE L;  4QOT A;  3IBF B;  4IFY A;  2ZIT A;  3BBB A;  4YS2 A;  3HHL B;  4U95 A;  4URS A;  3KDN A;  5E0O A;  3CB4 A;  1QAY A;  2HEK A;  4I0W A;  5C42 A;  4EK2 A;  4ECV A;  1S97 A;  3M1V A;  2YWE A;  2AEF A;  3JQK A;  3CCV S;  3MEC A;  5FDL B;  1UTA A;  3LAL A;  3F56 A;  4L6V 3;  1Q8I A;  3FK4 A;  4JOU A;  1Y10 A;  4K8R A;  2P8I A;  4F3Q A;  3BDP A;  4DSL A;  1RAG B;  3AOA A;  1HBM A;  3NS6 A;  3TWZ A;  3QRQ A;  2CQD A;  5GVQ A;  1NPP A;  4KC5 A;  5THW A;  3KJN B;  4C11 B;  1Y11 A;  2IIH A;  1PGZ A;  2ZBR A;  2OUG A;  4NE9 C;  2GQC A;  3FQL A;  4ERD A;  3AOD A;  3A3O B;  1RK8 A;  4P52 A;  4DCP B;  2QLB B;  2G2O A;  2RF2 B;  1FDN A;  3IR5 B;  4A8K A;  3PHE A;  3MM7 B;  5ETN A;  4PUO A;  2BUN A;  1CUL A;  3FNN A;  4PWW A;  4EEY A;  2DIV A;  2C2K B;  4ECY A;  4RKU C;  1YVF A;  1KHW A;  3K8V A;  3SDE B;  4B9L A;  1Y3J A;  4GVB B;  3NLC A;  1MSW D;  2BKN A;  2DO0 A;  3RTV A;  5KFX A;  1YBT A;  1ZA2 B;  2NSC A;  3MM9 A;  4B3O B;  5B0D A;  1X0F A;  4U67 Q;  2JL9 A;  3PCO B;  1HNI A;  4IOB A;  1S6Q B;  2FJX A;  3SDE A;  4DR6 F;  4RBU A;  2MSS A;  3LZ8 A;  4CI0 B;  4RBV A;  4O44 B;  2EW9 A;  2WZ1 A;  1Q4R A;  1TKD A;  3DGV A;  5DLF A;  2DIT A;  5E33 A;  3OXL A;  4N5S A;  4J37 A;  4QPX A;  2Q6B A;  1WG4 A;  4NXN F;  3QNW B;  1EJ7 L;  5KFA A;  2KJW A;  2QSW A;  2R7X A;  3GYX B;  4Y2M A;  1S6Q A;  1S1T A;  2H9Z A;  4NAS A;  2IDE A;  2ZC3 A;  5KT7 A;  4DZ6 A;  1IM4 A;  3RAQ A;  3JXO A;  4BCA A;  1Q16 B;  1JLC A;  4HVZ A;  1HWJ A;  4TY8 B;  5CQG A;  2VFV A;  3TEG A;  5IZH A;  3EPG A;  4J9S A;  4U96 A;  2G2Z A;  1OMS A;  2HHP A;  1RKJ A;  1FTR A;  4USK A;  4OI2 A;  4UTG A;  1N5V A;  2GZO A;  2QIF A;  4F67 A;  2ZJR Q;  1CBK A;  4Z7C A;  4IYQ A;  1EAY C;  2W2O P;  2BZ2 A;  3SBM A;  1P8G A;  1SQF A;  4QIW D;  1S1T B;  1N0U A;  4KO0 B;  5B0F A;  1Q82 T;  2XHC A;  3HKZ D;  1GX6 A;  4M5D B;  1JLC B;  4LBH A;  3TZW A;  2PMH A;  3TA2 A;  1IWG A;  1Y7P A;  4D3G A;  3AXM A;  3ILL A;  4ZLP A;  5B0C A;  3PEH A;  1O0P A;  2GA7 A;  1HBN A;  3HZG A;  4I2Q A;  3FZB A;  2KG0 A;  1GNK A;  2JRR A;  5E7O B;  4JI5 J;  4XAK A;  1LV5 A;  1RAO A;  5KFH A;  4U7C A;  4P6Q A;  3LPY A;  3DI6 A;  1NDP A;  2DO4 A;  4G65 A;  4NLR A;  4AND A;  1AB8 A;  4KYZ A;  1MNE A;  4DPX A;  2A0F B;  3NWG A;  1W25 A;  4EO8 A;  3AHP A;  4WYW A;  1YHQ S;  3A12 A;  4ED0 A;  4YB6 A;  2VDH A;  5GAG I;  1Q79 A;  2KM8 B;  3GG1 A;  2LQ5 A;  3ENW A;  3I31 A;  2RKI B;  4H54 A;  2MZT A;  4DDF A;  4P75 A;  3QLH A;  2F8H A;  1WF2 A;  3H2V E;  1WF1 A;  3VAJ A;  2HGL A;  1N8R T;  5KT2 A;  2MGZ B;  4DV4 J;  5KAK A;  4CLK A;  3RUB L;  1REV B;  3BGF A;  4RWW A;  1FTC A;  3A8J A;  4WE1 B;  3T5L A;  1WOS A;  4WU2 A;  2RRN A;  1FX2 A;  5B0E A;  3Q8R B;  3ZTQ A;  4OI6 A;  2R2R A;  2OIH A;  4JV1 A;  3I0R B;  3W65 A;  1N48 A;  3MMC A;  3C2P A;  2RNE A;  3O2I A;  1VIS A;  2FQQ B;  2EKY A;  4L3K A;  2VBY A;  3FGV A;  3FRZ A;  1NXI A;  2OEK A;  4P2S A;  2LA4 A;  5IC4 B;  1FA0 A;  1R8H A;  2GJI A;  1NND A;  2AGQ A;  1UFW A;  4P2M A;  3GZ7 A;  1EQ0 A;  3VGU A;  2BRK A;  4LSN A;  4EU0 A;  4KKO A;  3FJ2 A;  2DXF A;  2XSJ B;  3PKY A;  4C8Z A;  4DQQ A;  1KBR A;  1D9F A;  2IVM A;  4KV8 A;  5F3T A;  4FNH A;  3W2V A;  1C2P A;  4OHZ A;  1U4B A;  4ZVU B;  2BAC A;  2VKR A;  2Y9H A;  2YH0 A;  5IXU A;  4J9N A;  2UXC F;  3I56 S;  1K1S A;  1TUV A;  3IBC B;  2GAG C;  4IRK A;  4XO0 A;  3FSY A;  1FKO A;  3CCS S;  1S72 S;  2B8Q A;  2EBG A;  2NS1 B;  2LXF A;  3CJS A;  3IC1 A;  2V2Q A;  3I5C A;  2RRB A;  8ATC B;  5DQI A;  1FJG F;  2XCP A;  5LT5 A;  1JJH A;  2V8H A;  4F4K A;  1X4B A;  1F1B B;  3CXC R;  4A8O A;  3PRD A;  3HFK A;  3D1O A;  1NPK A;  2UUC J;  2FHO B;  1HHS A;  4USU A;  1FKO B;  2EBE A;  1AZS B;  5ETS A;  4D3H A;  3M8R A;  1T94 A;  3GFH A;  2H4Y B;  1U8S A;  3POT B;  4FVC A;  4OHW A;  4TY9 A;  4ZS6 A;  3W1Y C;  4O4G A;  4ETX A;  4CYU A;  3THT A;  1TQL A;  1FVQ A;  2DGQ A;  1JXV A;  2BMB A;  3IR7 B;  1HQU A;  4Q2M A;  2NR0 A;  5HL7 Q;  1VYA A;  5U47 A;  2C2N A;  2L9N A;  2YQ1 A;  3ETO A;  1R31 A;  2RQM A;  2OPS A;  1X5P A;  5MAO A;  5CYM B;  5FLX Y;  2MLZ A;  3GJS B;  2H4W B;  4ZVQ B;  4K7Q A;  1LWC A;  2NCK L;  3DRR B;  5HMX A;  4E8U A;  4HYK A;  1UA1 A;  2CFX A;  1IQZ A;  2KXF A;  4PRF A;  3JSM B;  4OZ3 A;  4UQT A;  2Y8Y A;  3C15 B;  2DGX A;  3IG1 A;  2W9A A;  1UMJ A;  4Y2A A;  2VIC A;  2OGU A;  2RU9 A;  4M5I A;  1SJ3 P;  2XZT B;  1EP4 B;  1C1C B;  5HSP A;  2JHE A;  3THP A;  4HDG A;  1GTH A;  2XYH B;  3P8B B;  5CCM A;  4C0O C;  4TN2 A;  3PYF A;  3MR5 A;  1UKU A;  1A9N B;  4DN0 A;  4NA1 A;  4URG A;  1FO1 A;  2EFO A;  3UVJ A;  3SFU A;  3RBD A;  4MYU A;  2BJ1 A;  2Z8Q A;  3OHB A;  2QTW A;  1S76 D;  2RB7 A;  2GVZ B;  2XMM A;  3IBW A;  4GMK A;  1YX2 A;  4WE1 A;  3FCH A;  4MKV A;  2JLE A;  5KFI A;  5LXR A;  1T03 A;  2KXH A;  2OPP B;  2FYX A;  3GV7 B;  3MMC B;  4ZLJ A;  1Q5Y A;  5L46 A;  1YJR A;  2EC0 A;  2CQP A;  3DOM A;  3K5L A;  3H20 A;  2X51 A;  1GMW D;  4C4W A;  4E2F B;  3ELH A;  1BC6 A;  4NRT A;  2BBE A;  1NJX A;  2E1C A;  4QIF A;  2QFI A;  3DLG A;  1KVJ A;  1UAW A;  2VG7 A;  4L73 A;  4QIV A;  2IM0 A;  4C7Q A;  2KYZ A;  2B6A B;  1GEH A;  2XLJ A;  1QAJ A;  1NK7 A;  2IMW P;  2OPP A;  2CXE A;  3BSC A;  4DMZ A;  3UD4 P;  1TAU A;  5HRO B;  4Y34 A;  2Q66 A;  3SV3 A;  2ZD1 A;  2IMO A;  5KG7 A;  3P6Y C;  3W63 A;  3DGP B;  2WCX A;  4HT5 A;  4ZVO B;  2YWH A;  1S1W B;  4OZJ A;  5GAD U;  3T1Y J;  1ZZN A;  4X4N A;  3DLG B;  1RKI A;  1MWQ A;  4LFB F;  2A6O A;  4X64 J;  4LRC A;  4LQ3 A;  2DEI A;  1TL1 A;  1BWE A;  2XMV A;  1TUG B;  3D6H B;  2VBX A;  3MUM P;  4DU8 A;  1QSY A;  3VAF A;  2XEX A;  2ZD1 B;  3NGK A;  1XN9 A;  1K1Q A;  1UW4 A;  4GKJ F;  4USW A;  1NBE B;  3J81 Y;  4Y3C A;  2XZW A;  1IR1 A;  2XM3 A;  3OLA A;  3KNG A;  2HKE A;  2OML A;  2BQR A;  4DPW A;  3PM9 A;  5D4O A;  2DY1 A;  3V6K A;  4G3I A;  2WB4 A;  4FP9 A;  3HHN B;  2MJN A;  2ZH3 A;  2GIR A;  3RW6 A;  3A3N B;  3LGM A;  3I4P A;  3RAM A;  3J7Z T;  3PIO Q;  2XCA A;  4LF6 J;  4ZLL A;  2CJQ A;  2M9K A;  4F25 A;  1R6V A;  4I68 A;  2XGP A;  2YPY A;  3BO4 A;  5D4L A;  3C6E C;  4K4T A;  3PX0 A;  4FDF A;  1S0M A;  2CZ4 A;  1HBU B;  1IKW B;  3KK3 B;  3HHL C;  2K1R A;  4FPI A;  3ZTR A;  2H5E A;  3DOL B;  3H7H B;  1QM9 A;  4K5S A;  2JOQ A;  4QW9 A;  2IC3 B;  1RTD A;  4CO2 A;  3CMA S;  2DYA A;  3M2V A;  2GNK A;  2VF3 A;  4ZDN A;  3QZ7 A;  3KOA A;  1LW0 A;  3UFC X;  2XLK A;  4OHV A;  2P2C B;  2GO9 A;  2Q79 A;  1XMB A;  4OIX A;  4ED8 A;  4ES2 A;  3KHL A;  2Z2M A;  4KR0 B;  2WON B;  2DNH A;  2R8H A;  1HL6 A;  2PII A;  3DOL A;  5HMZ A;  4K4U A;  3HCX A;  3FBC A;  3KHR A;  3TZZ A;  4F8R A;  3PO4 A;  1HAR A;  3M2V B;  5HQ8 A;  3OLB A;  1HPZ A;  2A2C A;  4LRF A;  1K44 A;  1P1L A;  4OYI A;  2EKN A;  4LFA J;  5M2P A;  1WUU A;  2RDJ A;  3IWL A;  5KFK A;  4J9R A;  1RSC A;  4OX9 J;  2YKN B;  4JV5 F;  5J2M B;  2H51 B;  3QO9 B;  4JI0 F;  1UW9 A;  3WC0 A;  2HFZ A;  4DX8 H;  4Q45 A;  1SL2 A;  3BSO A;  2RH3 A;  2JZ5 A;  4ZVR B;  5G4D A;  3QWU A;  4B9N A;  1M5K C;  1G7C B;  4HH1 A;  4X4V A;  2OTJ S;  1GQE A;  4LSL A;  3MED A;  1NSQ A;  4ZVT B;  1OO0 B;  1T9W A;  1JJ2 R;  1NSP A;  1RT4 B;  1HNV A;  1TMJ A;  1YG0 A;  1YGY A;  2A18 A;  2HND B;  3CJQ A;  3CCE S;  1U47 A;  2W9C A;  2RHS B;  2HS0 A;  4DUY F;  1S1W A;  3BO3 A;  4DV6 J;  2YH1 A;  1AA1 B;  2UUA F;  1OYD A;  3M1V B;  1X4C A;  3UCU P;  4WPA A;  2IBK A;  3QSY B;  4LF4 J;  2W9B A;  1R0B G;  4FPR A;  3NGS A;  3SEO A;  5ETT A;  1NDC A;  2E5H A;  2B7C B;  3E51 A;  3R5D A;  4A8X A;  1PC4 A;  1XER A;  3CDW A;  3QAU A;  1GMV A;  1FVS A;  2NZC A;  3GYN A;  3WX4 A;  4DL0 C;  3LAN A;  2M8D B;  1UVN A;  2CQI A;  1LWE A;  3UQS A;  4PAA A;  3H59 A;  3D1H A;  4Y65 A;  3OUY A;  4KTQ A;  2OFG X;  4DWI A;  1P9Q C;  2VU5 A;  4NZ6 A;  1FXD A;  3FRY A;  2XNQ A;  3KG4 A;  2VOD A;  2VQE F;  5B7W A;  2IDL A;  2G9O A;  2YX1 A;  4NMX A;  4ZP7 A;  1OQ6 A;  3WZ0 A;  5EGY A;  3M2U A;  3R8Y A;  2AD9 A;  2MKY A;  2WW4 A;  4M1K A;  4Q0B A;  2XYG B;  3K0J A;  2BOP A;  1UL3 A;  4KGV B;  3PFE A;  3KMS A;  3M2R A;  2MY7 A; 
#chains in the Genus database with same CATH homology
 3TJ9 A;  3NY0 A;  3TJA A;  2HFV A;  1GMV A;  1EAR A;  3AGX A;  2B26 A;  3L9Z A;  3NXZ A;  3LA0 A;  3AGZ A;  1EB0 A;  1GMU A;  4J80 A;  2QLD A;  3TJ8 A;  1XAO A;  3I38 A;  3AGY A;  1GMW D;  1C3G A;  2Q2G A;  3LZ8 A;  1GMW A;  4L3K A;  1NLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...