3TJ8A

Crystal structure of helicobacter pylori uree bound to ni2+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 42
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tj8A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tj8A02
3TJ9A 1C3GA 3AGZA 1NLTA 3NXZA 2QLDA 3NY0A 2HFVA 3AGYA 4J80A 3TJ8A 3LA0A 1GMVA 3L9ZA 1XAOA 1GMUA 3LZ8A 2B26A 4L3KA 3AGXA 2Q2GA 3I38A 1EB0A 1EARA 1GMWA 3TJAA 1GMWD
chains in the Genus database with same CATH superfamily
1FX2A 4Z2XA 3IM8A 3VAMA 1PGZA 4LQ3A 1X5TA 4A8FA 4USHA 2CPIA 3RAMA 2PFDA 1NKEA 3EGNA 1Y00A 3W2WA 2I5JA 2IPOB 3SXLA 3ILJA 3ET6A 3G8TA 5T14A 3T41A 1V5IB 2Y9HA 5M2PA 3KUHA 4NX9A 1Q16B 1JLCB 1WHYA 2AEJA 3MM6B 4RW9A 3DYAB 2LQ5A 1FI4A 2PI4A 2XEXA 2FJEB 4LF8J 4ZVQB 4EZ6A 1ZAXA 2EBGA 3W2VB 3AOBA 3GG1A 4YB6A 3DC2A 1J5OA 3M8YA 4DCPB 3RB3A 1U47A 4LRCA 3LP2B 1Q7YT 3AOAA 3MTKA 3NGUA 1T05B 4GKKF 1NXIA 3A1YG 3H5SA 4UQTA 2AIRB 4RJVA 4PPZA 1CQNA 3OXLA 1QAXA 5HP1A 2I6WA 4KO0B 1ROFA 3KXDA 1NPPA 3J80Y 3OFEA 3DRSA 3TWZA 4EI2A 4P72A 5DDOC 1OSDA 4XPEA 1N36J 1IBLF 2B26A 1OY8A 3B6BA 3IBFB 2ZWPA 4FKYA 4USVA 3T19A 4B9MA 1X4DA 1TK0A 3A4TA 1VK8A 1N88A 1VLYA 4TVAB 2HNZA 2O01C 3V81A 1TTHB 2PMZD 5ETPA 4DQQA 3RW6A 4Y2KA 1FKOA 3MCSA 4D3HA 4QWDA 2B7CB 2KT3A 3QPIA 2MQQA 2IMWP 5A2QU 1B0PA 3EJMA 4O0IA 2BV3A 4NI2B 5IZHA 1N5SA 3H25A 1JLQA 5F0WA 1KBRA 2JFDA 6AT1B 3QLHB 2WVCA 1U48A 4BC9A 1WKKA 2OPQA 5CHCB 2WBRA 2OTLS 1XMOF 5JJBA 1UW9A 4RNNA 5HK4A 3LQVA 3MM7A 2Q66A 1UPPA 1YITS 3M2UB 1IBKJ 3ZZRA 3CDWA 2LQ9A 2FC8A 1ZZNA 3CT9A 4EFAC 5J2MB 3CULA 3R5CA 3UD5A 3ZTPA 5BR8J 3QT8A 1FWPA 1U6ZA 3UDLA 2GCFA 1WEZA 3GSIA 3ETMA 3TARA 2GX8A 1TVRB 5E7OB 2E1RA 1NK7A 5T7LA 2EW9A 3I9ZA 4LF4J 2HS4A 3K57A 2M5YA 3G82B 4C4WA 3RTVA 2QC3A 1UP1A 4ZCLA 1B0TA 3W9JA 5IT4A 4LF5J 5DG8A 5LJ3Y 1CJTB 1JJHA 3JSBA 2FVQA 3MF5A 1OPIA 2YPYA 3C6UB 3JSMB 2O3DA 2JEGA 5D4NA 2RH3A 3GFXA 4NYOA 2CQ2A 2YNIA 3NY0A 2GIQA 2W24A 1RT7A 2DXDA 3OLBA 1M0SA 1ZZFA 1NB7A 4W92B 3S1TA 4B3OA 1S76D 5F9LA 4DR2F 1H2VZ 4DR7J 4LFAJ 4EU0A 5HAOA 2DHGA 2BM1A 3C6TB 2ADCA 2L41A 3HT3A 2YKMB 4AFFA 3MM5A 4QQBA 1GH8A 1R0AB 1B4SA 5HMXA 2VONA 1P9YA 1RHKB 2ZD1A 2UXCJ 2OSRA 3MCNA 4WP3A 3AJ1A 2Y8WA 3KJVB 4C8OA 3RBEA 2YKQA 4FF1A 1X5PA 3BN7A 5IOLA 1FRXA 3OTCA 2XYGB 2JRSA 1U1KA 4KGMA 2DB1A 4RW8B 3OV7A 4L76A 5GAEI 3H5UA 2KM8C 1JLGA 4WBFA 4LJMA 1VRQC 3MOZA 4NA2A 5D4OA 2VOOA 1QTNB 5A8KB 2HLUA 2QA2A 2XS7A 2EKNA 2LU2A 3BH6B 1HFEL 2JEFA 3TAQA 4RNOA 2HPUA 2RB7A 3VTIA 4CH7A 3GTYX 1URRA 3Q8UA 3EZ5A 1Z1ZA 3QT7A 1VIXA 3BSAA 5H1SV 3UFCX 5J1NA 2A3JA 2CQHA 2QLWA 1J5EF 1RAOA 4ENOA 4USUA 4LF7J 1SJ3P 3C6EC 1S1UA 3KMSA 2KHDA 1T03B 2BW7A 1Q79A 1VFJA 1MNEA 3R7SB 1TZ0A 1VS3A 3SSQA 5EGYA 2C2OB 3MR5A 1RJJA 3H2VE 2FVRA 5KFBA 1VQKS 1H72C 2ZBCA 1N34F 1N54B 4PPDA 3M4XA 3H90A 3MAAA 1S0VA 2CVEA 4XO0A 2ZZNA 1U2RA 5DLFA 3EXYA 4U96A 1S6QB 4JI0J 4R0EA 2CQ4A 1FFSB 1XNQJ 1VISA 1QJHA 3O8WA 1UFLA 3OHAA 3UO0A 1QAJA 5HANA 4WFZA 1UWBB 1RAGB 5JVHQ 3HK2A 1RWXB 3KLGB 2VDHA 1SJQA 2K7KA 4KAIA 4J9VA 4I7FA 2XY7A 1KQFB 2IAJB 3MAQA 1HNWJ 2GVDB 1HPZA 2G0JA 3ISNC 3CCUS 3CJ4A 3HHEA 2HHSA 3MAHA 4QR0A 1V6HA 3CMAS 5HLFB 2GO8A 4WYLA 2D74B 3U27A 1H7XA 1GTEA 2RF2A 1EETB 4PG4A 4F0MA 4Q7AA 4WXWA 4F26A 3A3NB 4DQPA 1B99A 4OFZA 2I9SA 2ZBRA 1K9MT 1VDHA 3I0RA 4PZVA 1Q95G 1N33F 4OJ1A 2BQRA 1GMWA 2OEKA 3FZBA 4DCOB 4UZBA 3EWGA 3HZEA 1SH0A 2QYCA 3DOMB 3CPWR 4OHXA 4RL1A 4DI6A 2DR8A 4X62J 1FE4A 4DX6A 3QJLA 3VV2B 3P4UB 2EKYA 1U4BA 3R1LA 3J81j 3BS9A 2IYIA 2C1EB 5ETKA 3P8BB 5K5MA 2VIHA 2CJYB 3I4HX 2O67A 3CE8A 3TZYA 4CO1A 4ZLLA 5I42B 5C7PA 2DNQA 1FNOA 1T9WA 3ICLA 2XBPA 1RISA 2AYEA 3M2VA 3F41A 4DFMA 3LANA 3SDEB 1Q1KA 4R0JA 5AE1A 1HMVB 1T9VA 3KNGA 2DHSA 4IOCQ 2CQIA 1XC9A 2D1CA 3HULA 1BC6A 2ZE2B 3IN5A 4DPYA 4PCQA 1TFYA 1SVDA 3S6EA 2XMUA 3UN3A 1JB0C 2DGUA 4J7CA 2YNFA 3QO9B 4KB7A 3N5BA 4F0KA 2FB0A 2MKJA 5DGAA 1VQ9S 5DZ7A 2GAHC 4RBUA 1VRUB 3M8ZA 1BUXA 3A8IA 4YR2A 1NPRA 2Q1LA 4AL7A 4DEZA 2DNZA 4IQXA 1NK4A 3SSRA 4NMLA 2F3JA 4DR3F 5IS2A 2VQFF 4O4RA 1SQEA 5LMNF 2VPYB 3M1VB 3N6MA 1XK8A 1FKPA 1YZ7A 2YH0A 1X8DA 3G8SA 2CPDA 4M5LA 2R9LA 4WIIA 2K3IA 2ZHBA 3VF0B 2IJRA 4R8UA 4DR5F 2N3OA 2DRDA 2VHGA 3D1HA 4WZQA 1FDDA 2HQCA 2Q6CA 1MMLA 4LRBA 5A6WA 3MR6A 4IR9A 3DU6A 4P2SA 4UTGA 1X4GA 3BGRA 1NSPA 4QWBA 3G6XA 3DLJA 1XWLA 1HARA 1TV6B 2RKIA 4PAAA 2FZKB 3H7HB 5B0FA 4NCGA 3I5BA 3WX4A 1S0MA 3QRRA 1WWHA 4M5GA 2V4JB 2BMBA 3TZWA 1I6JA 2HZAA 3GR1A 5HVFA 3V6JA 4IQMA 3FSIA 3NMAA 3ELHA 2CYYA 1PAUB 5DG9A 7FDRA 3CC7S 5F0UA 4A8OA 1X0FA 2FVPA 4USKA 1LFPA 4J9NA 4E0DA 1CEZA 4RR5A 3KLFA 3OR1A 4X66F 4K4ZA 2JZ5A 3TX8A 2YKNB 4AXJA 4Y34A 2UV8G 2B5JB 1CG2A 2KZZA 1TP7A 4YS2A 2JJ4D 1XERA 1B64A 4O23A 2E5GA 3SEOA 4OHZA 1RCOB 2XGQA 1C4AA 2IBKA 1S1VA 4A4JA 5G0RA 5CH7B 4ELUA 1ZH5A 3B8HA 4H4OA 2ZH3A 5IQQA 7AT1B 5CZXA 3I87A 3PHEA 3G6ES 4DV6F 3RG6A 1YJRA 4DL5A 1TKXB 2OI2A 1MWYA 1SV5A 3R5AA 4URSA 1OQ6A 1U09A 3JAMY 3G2XA 3VAKA 4MH8A 3FKBA 3L3CA 2YKPA 1BQMB 2VDIA 2JL9A 2D9PA 3KK2B 4P74A 1UJ6A 4Q0BB 3MI7X 2J5AA 4ZIWA 4JI2J 4G65A 1YK9A 3NCPA 2VU5A 5HVHA 4KHMA 1WF1A 4O3NA 4QZVB 1ZTWA 2KI2A 3G8QA 2IBOA 3NGDA 2YBVA 5DETA 5C24B 4B3TF 3PKMA 1RHRB 4DN9A 4LSNA 3I5AA 3LP0A 5KFCA 3O3LA 1N6QA 1N32J 4TQSA 5KG0A 4UOGA 3WQPA 4CO4A 1H2UX 2GW8A 4YDDB 2LMIA 1I94J 1KVIA 3GV5B 5IV4A 3I82A 3DRXA 2OPPA 2M2BA 3X1LB 2EWHA 3QGGA 3OUYB 4X64J 3Q89A 4TY8B 4KT0C 5KFGA 2ZWOA 1BXNA 3TW0A 4OYZA 3OD2A 3LP1B 2ZH8A 4F4ZA 4FPRA 1NLTA 2QX0A 2MEWA 4NCAA 2YPZA 4HH1A 4DHVA 1VQ7S 4ERDA 4MKVA 1UETA 1TUVA 3GYGA 2RSQA 1HNIB 5CD4H 3FC9A 4MYTA 3QFHA 2WVFA 4ZVTB 1RUSA 3NXZA 3MZIA 2CVIA 3PYDA 3C19A 2FVCA 1TKDA 3MM6A 4X4RA 3D66A 1X5SA 3LGMA 2A10A 5EHHA 1D09B 3DYAA 4NLVA 1SJFA 1YHQS 1KSPA 4D3GA 1AZSB 2QL7B 2OPSB 1N5YB 2XMAA 4WKRA 3W2VA 1FRKA 3HP6A 2GHVC 3MD3A 2LYVA 4OI3A 2B8QA 5L38A 3LP2A 2ROPA 2Q43A 1LWEB 4HR2A 3E51A 3CJKB 3UNYA 1IKWB 2ROGA 4J80A 2J0WA 3MGJA 3MMCB 1T05A 2OMOA 3AJDA 2NXNA 3DN9A 3G71S 4MIBA 4UUXA 1TELA 2KG1A 1RAHB 3KJFB 5CCMA 1JJ2R 4F25A 1T3NA 2RU9A 4KO0A 2PMWA 1M5SA 4J9OA 2QTWA 2JLEA 1NH8A 1FERA 3KLHB 4ZJOA 4ER8A 1VC5A 4DR4J 3R2CJ 4ECQA 1QSSA 3R6GB 1WG1A 1YZ6A 3MM9B 2JHEA 1PSDA 4ED7A 4KE5A 1IR2A 1CJKB 1KQSR 2D3ZA 4BS2A 3HO1A 5THWA 4B9NA 4IO9Q 3OTEA 2EFVA 1H38A 1LQ9A 4Y28C 3DLLQ 4URGA 3PRBA 2B6AB 3OFFA 4DR6F 2XM3A 1M5HA 4NLWA 1PYTA 1GNKA 2CQBA 1M5KC 2KKHA 1FVSA 3BDEA 5GAHU 2OTJS 3QWPA 4ELVA 1YRXA 5DS7A 2Y1RI 2CJQA 3GB0A 2HVDA 1VJQA 2GMLA 5LJ5Y 5KFEA 4NI2A 1GXLA 1HNVA 5ETQA 4F4WA 1RT2A 1HQUB 2E1PA 4KY3A 2BJDA 2F9DA 1U45A 1WC0A 3IRXA 1KQKA 1HW9A 3NNAA 2BDPA 1EQ0A 3HSDA 3M2UA 2Z2MA 2DJWA 1FWLA 3W3SA 1P27B 3LUYA 2IY5B 5J2MA 2Y1JA 1FX4A 3PFOA 3O2IA 5C25B 2XWYA 1S9FA 4U8YA 4RW7A 3W8PA 3G4SS 1SH3A 2BE2B 5KG2A 3NOCA 4U8VA 2IDEA 2XI2A 5K14B 1TVRA 5EWEA 2LQ8A 1BHNA 4EBEA 2MZJA 4XK8C 2EG1A 3DDKA 3HHLC 5F8JA 4ZDNA 4DLGA 2WOMA 2QT7A 5IM0A 2I2YA 5KFRA 3LF0A 3UPFA 1ICEB 4DSEA 3H4DA 3PM9A 3QWUA 1CJTA 2ZH6A 1CPZA 3TQ1A 1KFDA 4NLSA 1R8BA 5KFFA 1KHWA 3JSMA 3C15B 4WPAA 1R6VA 1VRTB 4DV2F 2UXBJ 1JWWA 3QIDA 1K0TA 1B7YB 5DQGA 4PEOA 2DIUA 3NGSA 2RRBA 3N0VA 3DLEB 3VAHA 1T94A 2E66A 3BBFA 2M3DA 5U47A 2J9DA 3D7SB 2YKMA 3GIJA 1C0TB 4TXSA 1FVQA 3A3PB 1HHTP 4KFBB 1RA6A 4LVNP 1VR6A 2CJ9A 2DY9A 3SQGB 1T8EA 2HRUA 4FZVA 3QGIA 3TA1A 4ANCA 4LF8F 1RT3B 2ZZMA 3DI6B 3KJVA 1AFIA 4OX6A 1MG7A 3W7BA 1JLEB 3OL9A 3HX9A 1B3TA 1PYSB 3GILA 2C2MB 5SZTA 1FFGB 3BQ1A 3AB4B 1PJ6A 1GMVA 5CYMB 1Q5YA 1MLAA 4EWTA 1NSAA 1Q53A 3BSNA 1SKRA 9ATCB 1LWXA 2E5HA 5A8KA 1NZ8A 3HVWA 1H7WA 1GEHA 1YJVA 2L9WA 1N36F 2ZBIA 3OT9A 3PYEA 4NLYA 3U02A 4C2MA 1T9UA 2NS1B 1NAQA 2GQCA 4OI4A 3RR7A 3W1YC 4ZCIA 2KB2A 2AGOA 1VQ4S 5F41A 4WP9A 4PRFA 2Z56B 3F0NA 2HFNA 2W4DA 4Y2CA 4X4SA 3SFUA 1RAEB 2CNOB 5KFQA 1T11A 4OZ3A 2MGZB 3NS7B 1DURA 5H9FK 2HBZB 2HVIA 2G9OA 2DO0A 1PKUA 2W01A 1T03A 2KFYA 4NASA 3R5GA 3UQSA 3DLKB 3O44A 4OQJA 3HSJA 3CCES 4LMZA 1Y11A 1F60B 1ZETA 1MMDA 5F3TA 1IBKF 2AW0A 2XY6A 2QLXA 1M5VC 3T5HA 3R2DJ 1NO8A 4LBHA 2HVHA 2RQMA 2K2PA 4GKKJ 1S6QA 3TUIC 4F2RA 1SPBP 5DDQC 4ED5A 2M88A 1B70B 3MHYA 2EVZA 5IC6B 5KFIA 3BZQA 1KHVA 5T41A 4CM2A 2ILYA 3ADAC 3KJNB 1Y9OA 2CZ9A 4KGXB 4OZ2A 3LAKA 4JBCA 3JAMU 5HQ8A 2X51A 2DBBA 4CO3A 5D4PA 4CWBA 4DU8A 2CDRB 2IAJA 3HHLA 4PWDA 2GVDA 2HGMA 2VPXB 4CCHA 3Q22A 3HKWA 2YX4A 4QWEA 2VICA 4BCAA 4DL6A 5HLFA 3JTPA 5E5NA 4ID5B 1DBDA 4DZDA 5KFHA 3HJVA 1EETA 4JI8J 3AODA 2HG4A 1FXRA 3UD3P 2XCPA 2RDIA 1LK7A 4KR0B 1VQPS 2VKRA 1TL1B 3PG9A 3EGWB 1DFDA 2VA3A 4B17A 1F1BB 4LFAF 1F2HA 5AT1B 4PYAA 2I38A 3E3XA 2X1AA 5KG1A 4ZOSA 5CCLA 5L9XA 3SCKE 2DEIA 1FWKA 2M8HA 2DXFA 2Z57B 4C8ZA 4CO5A 4ES2A 2UXCF 4DR1F 1RLDA 1DRZA 2ZM6F 4NYZA 4PG5A 4F7VA 3EVMA 4DX7A 3B54A 5I42A 1KFSA 3RRKA 1LEOA 2DY1A 3B82A 2MY8A 2QL9B 1H2TZ 1RACB 3F56A 3V4IB 2E7VA 1R7IA 4FVCA 3UN2A 3Q8SB 1KVJA 3IG1A 2JRRA 3M8QB 1RWWB 5HATA 3DXBA 3SDEA 1F6TA 1TL7B 1TQLA 2PT0A 2LA6A 2GS8A 4FXWA 1TL4A 2EI5A 5ETNA 1VQYA 4U7UD 2MMYA 1FRJA 3LWLA 2NXCA 4IFVB 2VFVA 3EGVA 3QT6A 2YNGA 4EEYA 3UVJA 4I6AA 5FIIA 2D3O1 4L74A 4Y2IA 3TZXA 3AD8C 3CXCR 2LEPA 1PJ7A 2G2OA 3QO9A 3BM7A 1NKBA 2IM3A 1NSKL 3IRWP 4LT6A 1SB6A 3WIUA 1G2EA 4P9SA 3OVSA 4C0OC 2KH9A 1Y5NB 1HQ2A 1LWFA 3CCTA 3H40A 3ZXWA 3HHKA 3OVAA 2BKNA 2X7IA 1Z2ZA 5GAEU 3M1VA 2XLIA 1FJ7A 3TYTA 1WF0A 4KGVB 4ILMA 1JK9B 4A8SA 3KG0A 1EIYB 1UVMA 2BRKA 2XMWA 2BJ1A 3A8JA 3WX8A 4W98A 4KYZA 3FGVA 1KP6A 3ZNJ1 2GQQA 5KTQA 5A6PA 2PEBA 1G7CB 1TV6A 4CI0B 2DGTA 1WNEA 4I2QB 3SSSA 4YY3F 3HF5A 2FD2A 1F5AA 2DH8A 3NAHA 5D3GB 3K5OA 1WHWA 5KG7A 3OLAA 3QJPA 1UTAA 4IDKB 3SCJE 3DRRA 2G1DA 4LRFA 1HNWF 2Y1LB 2RRAA 1F3VA 2V4RA 4LIWA 3R6LB 2HSEB 4EYHB 4MKAA 4ECVA 3HMJG 3ISZA 4PWUA 5GVQA 3K7RA 2ZC3A 3MPDA 2C22A 3CMES 1FT8A 5HMYA 4DWIA 4OYWA 4NXMF 4KHRA 2LP4A 4DUZF 2H54B 5L1KA 1AA1B 4A46A 1UMJA 4N76A 4CIOA 1S72S 4LQ9A 4KHPJ 2WW4A 4LIRA 4X62F 3G86A 4DU7A 1XQIA 4ZLJA 1N34J 2D41A 2ODXA 5HQLA 3QAEA 4FF4A 3PJ9A 1HBNB 1HYSB 2OO4A 2QLFB 5A8RB 3ZNUA 1B0VA 1RU2A 4ECUA 4IG3B 4LF6F 2Q3PA 1TKXA 2DHAA 2CQDA 1LXNA 2NZ4A 3SYZA 5L1LA 3MFIA 4UZCA 1VC6A 2NQPA 1Y10A 1S9EB 3W8GA 2ZNZA 4KIAA 3ZTOA 1BQMA 1M1KT 2NCKL 3LA0A 2CJAA 2UUWA 4ECXA 2QJ3A 2UVWA 4Q0BA 2KT5A 3KNAA 1HL6A 2Y0SD 3AGZA 1RCXB 3J81U 5IWAF 1OPZA 5HL7Q 2CQPA 4ECWA 3LWMA 1S4EA 2C28A 2YWEA 3SI8A 2R8HA 1WI6A 1TL3B 4QIFA 4P10A 1LW2B 2P8IA 4I6WA 1ZAVA 2BVZA 2FY1A 1NJYA 1R27B 3CJ8A 3A3OB 1P1LA 4V19X 1FF2A 4ZVPB 2JEJA 4J9LA 2DGQA 1N33J 1P6TA 3PW4A 2AV5A 2VD3A 4YHHF 2KG0A 3MTJA 1WEYA 4LF2A 4KQZA 2CJXB 5B09A 4P52A 3MWBA 3OUYA 4TY8A 3LP1A 1TU0B 3JQKA 3HHDA 1C0UA 1DQ9A 1JKHB 2HAFA 4U7CA 3T9NA 4WFYA 3EM1A 3CMQA 2LQBA 4MK8A 1NNDA 4K4UA 4CTAB 2AEMA 1HNIA 3V4MA 4LR7A 1SI9A 3DXSX 3EX7B 3MPVA 4F8RA 4YB1P 2OAUA 1CSJA 3N4WA 2BBEA 2HGNA 5D15A 2MLXA 5LMUF 1ZOTA 5IC4B 1WSRA 5I4MA 2W2OP 4Y6IA 4R25A 1AZSA 3M6UA 4B9VA 4DJBA 2R8JA 2OPSA 4USTA 1N5YA 4ED1A 1WC5A 3OXFA 4HT7A 4KSEB 1U24A 2YTCA 4M5DB 1EHWA 4L6V3 4PUOB 5KFDA 4PXDA 1KOOA 3HVRA 4NLDA 4RW6B 2KFZA 1LWEA 3OXGA 4JI1J 2PN6A 3CJKA 1IKWA 3GFHA 2WRMA 1IKYA 3ZTRA 2E7WA 5CYQB 2U1AA 4FYVB 2OFGX 2FPHX 3MCOA 3TEGA 3G6YA 4FDFA 4N8NA 2XSJB 3LTOA 2BJ7A 2AX1A 4CT8A 3FMBA 4DR3J 3ENQA 1UL3A 3KLEB 1CULB 2HHVA 2VQFJ 5LMNJ 2C2RA 2OHDA 1PBAA 3K2YA 4JV1A 5LXYA 2HWTA 3MM9A 3N9UC 1RP5A 1NK6A 4QOTA 4B9TA 2Z2ZA 2E5JA 1CJKA 3ONQA 3PR5B 4HKQA 1JIHA 5DJBA 1NHKL 5IV3A 1R31A 1XTZA 3HHNB 2FJXA 2HNYB 1UZHA 2H5EA 2R8GA 2QA4G 4DR5J 4Q43A 4NE9C 2VG6A 1IUJA 5LOQA 2SXLA 2AGQA 3P96A 5HVGA 2DNHA 5KFJA 1N4LA 1K44A 4ES1A 4NRUA 4BDPA 1CLFA 3AXMA 5B0GA 1VQOS 3NS5A 2HS3A 1KKHA 3DLBA 2NZCA 1HBMA 2FTRA 3T6JA 2VODA 4C8KA 3P6YC 1JLBB 1KRPA 3A12A 3ITHA 4ED2A 2P9CA 4F67A 2AYGA 5C25A 2J6UA 1KNZA 1P1TA 2BE2A 4OJGA 1F5BA 2OPRB 3TVZA 4IG0A 5K14A 1WDDA 1FHTA 3PW0A 4X4TA 4A8MP 4X66J 2H51B 1ZA2B 2Z30B 1HNXF 4KV8B 4FYDA 1N32F 3HZGA 2K7JA 1ZTTA 2KRBA 4OLOA 4CYUB 2MZTA 1FE0A 3W61A 4WFAQ 4OHWA 1UEVA 2ZUGA 1LFWA 1UVKA 4OZJA 3P5BP 4TN2A 1HI0P 3BGFA 3ISND 4BHQA 4XTTA 2W2PP 3BQ0A 4OI0A 1BQXA 3UNGC 1FNXH 2QV6A 2HHTA 4RNMA 4LRDA 4ED3A 2UV8A 4G1QB 3N6LA 2DNLA 3UWTA 4ECZA 2GHPA 2AT1B 2AZ1A 4G1IA 1IQZA 2XO7A 2F7VA 1C0TA 3N79A 2EFPA 2MZRA 4DUYF 2MQLA 2CZVC 4KFBA 3CD5A 1IVZA 1RGVA 2BX6A 4ZVOB 3D1OA 3TNVA 1FCAA 4ZA1A 1FXLA 2ATCB 3L95X 3EYZA 2XO6A 3RGIA 3EGZA 3KG1A 4UY8T 1RT3A 1VGYA 4MT1A 3KOAA 1VQ5S 2W4CA 2D7SA 3CJ3A 5HROB 1Z4UA 2JLGA 2AJFE 1S0OA 1EKRA 5EUHA 3LH2S 5HJXA 4ZPBA 1S4FA 2DGVA 4ECYA 3EUNA 1W25A 1NH7A 3HD2A 4J9KA 3NBPB 5CYMA 3BEGB 2FYXA 4L72B 5F8NA 1JNZB 3EVOA 1DARA 2GIFA 1QVGR 5MLCV 1AW0A 1WC4A 1N5TA 2EK6A 5HSPA 2FQQB 1WTFA 3D54A 3DCAA 5J1EB 4KGKA 3BB5A 2GV1A 5KT3A 3TI0A 3KHHA 4HDGA 4IKAA 5F9NA 2VFUA 2FY8A 4RW4B 3EDQB 3CNQP 2RILA 2J8SA 3HDSA 2BRLA 2B0GA 2D9OA 1S48A 3VCDA 3DLGB 1CVJA 5GMEA 2GO9A 4F36A 4HVZA 3CCQS 5KFKA 1S1WB 4GVBA 4RLEA 4DSLA 3CTRA 4Q2LA 2MGZA 3OR2B 2RQCA 2J9DE 2OKQA 1Q78A 2YKAA 3Q8YA 3AQOA 4NA1A 2YQ1A 1A7GE 3DLKA 1C4CA 4S0MA 3JTOA 3R5JB 4B9LA 4HI1A 4M95A 4GMKA 3R97A 4WTOB 2WVDA 1N5QA 1SXLA 2CNKB 2V67A 4O4GB 2HS0A 4F50A 3BKFA 2Z2LA 3MM8B 2AJ4A 3HLUA 4M5NA 1IM4A 1TKZB 3L4BC 3POTA 4X4OA 3GIMA 2OD4A 2X1BA 1SBRA 2CJBA 5KT2A 3VALA 2DNGA 1Z2LA 5D0HA 5C5JA 2FVSA 2LECA 2B4UA 1VYAA 3B4DA 4HL9A 4A8KA 2HHWA 1L3KA 5ETSA 2HGLA 4PXCA 4DBQA 1IWAA 2R7TA 4NEZA 4H4MB 3CCJS 2FJDB 4J9SA 2DRBA 1RT4B 3AD7C 2EBEA 1Q0NA 4ETZA 5IFMA 1VCTA 1TK5A 2C2KB 4B3RF 3VAGA 3B4MA 3IR5B 1FJEB 1HWUA 4CT9A 5J1PA 1BQNB 4K4WA 5KFMA 3AAWB 1ULRA 3ULHA 3BKTA 4LR9A 1Y5LB 2HMIB 4C97A 2DR9A 1RK8A 4ID5A 1I5OB 2KVQE 1XJWB 3OTOJ 4Y3CA 1PG5B 2IYGA 2UU9F 2AMCB 3RUBL 5GADI 1WOSA 3W65A 4F3OA 4C11B 3QIPB 3PVXA 3J7ZT 4ED6A 3Q23A 1HI8A 1CS4B 3M7VA 3OJUA 1WHXA 4ZIVA 2W9BB 1U1LA 2QLDA 2UUBJ 3IM9A 5LL6d 4C9DA 2K06A 4IOBA 3IXQA 1RKIA 1DTTB 3MUTP 2WAQD 1VC0A 1JLFA 5DG7A 2RS8A 2WCXA 2HRYA 2GGPB 1BWVA 1HWJA 2YWHA 4HT5A 3H5YA 4I0WA 1X60A 1VQ6S 4LUBA 4DFKA 1TAQA 3KK1B 1V9OA 2NXEA 2ZBPA 3AOCA 2YWKA 1E6YA 3EPIA 3D0IE 4I69A 4TYBA 4RX6A 2W7PA 3NG8A 2B43A 3TP2A 1RTJB 2R7XA 4OZ5A 2FLPA 2KFNA 1DAXA 1X4AA 2CA9A 1S9GB 4ZLNA 3V4IA 1M90T 3JB9k 2VF3A 3GU0A 2JZ8A 1KLMB 1V3ZA 4DG1B 5KG4A 3C8YA 4DSKA 3TJ9A 1TL7A 3IGNA 3ENWA 1FRLA 1K1SA 4KKOA 4IFVA 3E01B 2WBMA 1IJFB 3QT5A 2FZGB 3FNNA 2BANA 1T3OA 4ALZA 2ALYB 2YY3A 2O1PA 4AXIA 1PJ5A 4DV2J 4XDCA 1HWLA 5HI7A 1GMUA 1YRUA 2G2YA 1WOPA 1A0OB 1RWMB 2LFVA 5CABA 3IO1A 1WD6A 1VQLS 2MKHA 1Q8KA 3TUZC 3DM2B 4WK1A 3KG4A 2IDLA 3OTDA 1R8PA 3B78A 4K4VA 2ZZTA 1LXJA 2ZDOA 3D1QA 2XI3A 1FDAA 4FP9A 3QYYA 2AD9A 2DVIA 4HDHA 1OY6A 2QEXS 2B4OA 2VPWB 3H98A 1RT5B 2DNKA 1NDCA 2JH3A 4AQYF 3W2WB 2XMTA 1KR4A 2F4VF 1RBAA 2HW3A 3OSNA 2EC0A 4DPTA 2HAIA 5BYSA 3IAS9 4M5KA 4DSJA 3AD9C 4K4SA 4YUDA 5LSLA 2H1YA 1ZM3A 5RUBA 3IS9A 5C42B 3MMJA 3Q24A 4I2QA 1Q8LA 3THVA 5KT6A 1G4CA 5L46A 3OL8A 4EK2A 5D3GA 2OUGA 4IDKA 1AYEA 4UT4A 4Q45A 4OJHA 5DDPC 1DHMA 2CJKA 5B08A 3GONA 3NEKA 4WFNQ 1GQEA 3DOLA 3EPGA 2DR5A 2F63A 1FXDA 4NZ7A 2H4WB 3GZ7A 2DGWA 1C3GA 1T95A 4JI8F 2JVOA 1IJEB 4FYWB 4C6AA 2B51A 5JMNA 1IWGA 2XWXA 3BDPA 2AU0A 2B3TB 1V3SA 3TA0A 2L48A 4DSIA 3TA2A 3HXMA 2VBWA 3BSCA 3KWMA 2CPEA 1A9NB 1TMMA 4DV0F 2HNZB 3GCXP 4PQUB 3W5YA 1ZPWX 5H9EJ 3UDVA 5MAOA 3QJJA 2J8AA 3G96A 2Q6BA 1D0EA 3MR7A 3KYLA 1HBNA 1VHIA 2ZC4A 1RKJA 1QD1A 1HYSA 1NDLA 3SBMA 5A8RA 3X3UA 2IVFB 2ZITA 4IG3A 1J2VA 2G2ZA 2FIUA 2R7VA 2OFHX 4UF4A 2V2QA 1JLQB 5AJ3F 2O66A 3CO9A 3IGVA 3WDOA 2WVBA 4DL0C 3RBXA 1N0UA 2YWWA 2OPQB 1S9EA 4RNHA 3MEDA 4P7TA 4Q5VA 2BOPA 4CLKA 4H4KA 4HEA9 3MEKA 3SMZA 3J7A1 3K17A 5CAAA 2KT2A 3V2UC 1FKAF 2GHWA 4OYMA 4CLPA 3M8SA 3BV8A 5B0DA 4DQSA 3H8YA 4CRJA 4Q2MA 5KFZA 4B3MJ 1TL3A 4NLGA 2CDQA 1LW2A 3PZPA 1TAUA 5KFAA 5HN0A 1S57A 4NYPA 3FSXA 4MIWA 4OX7A 3T5JA 3VQTA 3FUYA 4UUWA 2QMUB 4JI5F 2V34A 2HHPA 3T9ZA 1NUEA 1SKWA 3NLCA 4GC7A 2OELA 2N4DA 1H74A 3HHLD 2GA7A 1UJ4A 4YB5A 4C3LA 1HBOA 4YP3A 3UE2A 5EX0A 2KU7A 4V1Ak 4FN5A 5G4DA 2PSZA 2OH2A 1RSCA 1JKHA 4TU8A 2YNIB 4DR1J 4OZNA 3CIMA 2H5JB 3PEHA 2ZM6J 3MEEA 3QAUA 2DGXA 4K0KF 4Y65A 4CTAA 1C1CA 2J9EA 3JS9A 5DQIA 2E1CA 2HQGA 3SZ2A 4LF9F 3RBZA 3G9CA 1JQGA 1Q81T 1MU2B 4F4KA 2QLBB 2CQ3A 1K47A 3US5A 3CD0A 2W7AA 1D8YA 2R8KA 4FNIA 1YJ9S 1U8SA 4M5DA 3HFKA 1NK5A 4PUOA 2MTLA 4RW6A 4CLWA 4CLSA 3ILOA 2Z4PA 2Q79A 4BWJA 4OMFG 4URQU 2H5IB 2VKZG 4FVMA 1SKUB 5DM7Q 1FO1A 5CYQA 2F8HA 4OI6A 4ZPCA 2MHEA 4E8UA 1NRKA 2RU3A 1R6YA 4KPYA 4C8NA 1L3UA 3GIRA 3KLEA 1CULA 3ZFVA 2EEYA 1YX2A 1NK8A 3CDAA 1NU4A 3UCGA 1TUGB 3I55S 3NS6A 3IMQJ 1HR0J 5A8WB 1FESA 4KHPF 4DV7F 3CD7A 4OLPA 4DXLA 3KHLA 2JOQA 4QYRA 2HNYA 5KFPA 2GJIA 4HI2A 2MKIA 4QPXA 3GPAA 2WW8A 1ZYQA 5B0BA 3OBIA 1S1UB 4NLUA 1KC8T 3AXKA 3NP5A 3H0PA 4J9RA 1WG4A 5DZ6A 1XN9A 1VMBA 4OV6A 3JSRA 4L75A 2WB4A 5AE2A 1L5UA 4YY3J 1R8HA 1YI2S 2ZJRQ 3UDCA 4J9UE 2BOAA 2YWFA 3LO3A 3GR0A 2KZMA 3MAAB 2VC0A 1IM6A 5DDRC 5H9EK 1AUSL 1OYDA 1X7VA 1U1PA 1SJRA 1JLBA 3BF4A 1WSVA 1RWKB 2ZVSA 2ZOFA 1SQGA 1HBUB 1D9AA 2KXNB 2XS5A 2JDJA 2OPRA 3PRDA 3D4JA 3ZTQA 2O5DA 2UVUA 4DL2A 2VOPA 4EO6A 3THTA 2HNDB 2QO3A 4KV8A 4I7FB 3CCWA 2W9CB 4F2SA 3VVTA 4NXMJ 1RBLA 4DUZJ 4QIEA 2A6OA 4YFUA 4CYUA 3VHQA 1ZS6A 4E2FB 3PY8A 5DQHA 3KLVA 5F3ZA 1FD8A 3VR1A 1UVJA 2V8GA 4HTJA 2HIYA 1U49A 4O44B 1UEKA 2JEIA 3WZ0A 4L73A 1BLUA 5L1IA 1MROB 4LF6J 2EXUA 3UR0A 3I0RB 2ZUAA 2CPJA 2V2ZA 4G1QA 3RJMB 4HTIA 1U26A 2LQJA 3KLIA 2CNLB 3AB2B 2L08A 4PG7A 4P71A 2XG8A 3VQSA 2VFTA 1NBEB 4DS4A 7FD1A 8ATCB 3K0JA 2AHOB 5IWAJ 5GAGI 4TLQA 2DK2A 3K5PA 3V5RA 2YH1A 1WELA 4I68A 3FEYB 2MQMA 2H3EB 5HROA 3Q2SC 4CP5A 1OQ3A 4JI1F 3GLJA 4DPXA 2AYBA 1RA7A 2FHJD 2CKWA 1MN9A 3I32A 1WORA 4LBPA 3NBPA 2MJUA 3MPYA 3K5LA 1RYSA 4MTPA 4YHHJ 1SC3B 2D69A 2KM8B 1A6LA 2CQGA 5JVGQ 3BGLA 4YR3A 4R5PB 5HBMB 4CH1A 3H2UB 1DQ8A 3M8RA 1SIZA 3NNCA 1UCNA 2UZAA 2E5LF 4LFCJ 3J80U 4RW4A 3DGVA 1IXKA 2VFRA 2R7WA 4TYAA 1F0XA 2X1GA 3DLGA 1FRHA 4ZS6A 4M5HA 3Q86A 4CNYA 3HM9A 5BYQA 1WTBA 3PFEA 3C2PA 5CZVA 3BN4A 1S1WA 1S12A 2HK3A 3RBDA 2EK1A 3OR2A 4O3RA 3C66A 5LMUJ 4C8LA 5FJ4A 3CC2S 1FKPB 1U6BA 1Q4RA 2WSFC 3IBCB 4ECTA 4DX5A 1PIEA 3BGOP 4O4GA 2A2DA 4O0NA 2ZKUA 5J2NA 3MM8A 2BJEA 1VLOA 4WCEQ 2X3GA 2VG7A 3VWSA 2HHXA 2HQDA 2GJ2A 2DHHA 1XIQA 1KTVA 2PA3A 1G3OA 4Z37A 2EPIA 2IHR1 2C3MA 2RKIB 3CB4A 3K8WA 4F02A 3T5LA 2BW2A 1WJ9A 3M2RB 4Q44A 4NLTA 2BE9B 1FDBA 4OYIA 4B08A 4F4XA 1S6PA 2UUCJ 3CJ5A 1FTRA 1TR0A 2AJQA 2YNHA 1E6VA 3TVYA 3BH7B 1X9WA 1S59A 3PJWA 1YQHA 1NDPA 2H9ZA 3CJRA 1BQNA 1NDKA 3LZ8A 4IRDA 3CCRS 5CA5A 3L7OA 4MYUA 1N48A 3KLFB 5LSOA 2HVEA 2L9NA 2R2UA 2KJWA 1VQMS 4K8RA 2PFFB 1KTQA 3M8WA 5F8LA 4FKXA 3G87A 2KHCA 3BPSP 5I3UB 2FJAB 2NREA 1GXUA 4RU2A 3L7UA 4C11A 2Z58B 5KOXA 2UXDF 4DV4F 1VBYA 1CS4A 2OD6A 4G3IA 1F2GA 2W9BA 2X1FA 2CZ4A 3L09A 3N5FA 5D8HB 1RBOB 1DTTA 1Q82T 4IYQA 1YIJS 2Q2GA 5KT7A 4CLLA 4H4OB 4N5SA 2GGPA 2XLKA 1RXOB 3BR9A 2GZOA 2NPFA 3MUMP 3O5TB 5IT0A 1QAYA 3KK1A 3FSYA 2G13A 3P3DA 3J7YU 3I38A 1O0PA 3GCWP 2VH7A 2HRTA 1RTJA 1OS5A 4JI3J 3V6HA 1S9GA 2QG9B 3WBZA 1X4EA 1SIWB 1HNXJ 3QBCA 3JTNA 3BBCA 1KLMA 4K5RA 4LF1A 1H73A 5J2PB 2RRNA 1XMQJ 3FRYA 1KWMA 5BJRA 1WI8A 3T1YF 2LKZA 3E01A 4CLTA 2PIIA 5K8OA 4OZ0A 3T1AA 1YDLA 4DV5F 2W9AA 1JXVA 1L3SA 2IRUA 4GO5X 1RDRA 8RUCA 4NL5A 3GQCA 4NZ6A 1YJWS 4PR6A 2HLTA 3PRVA 2XMVA 2UUAF 1V3RA 4UW2A 1JLCA 2OIHA 4DUYJ 3GYNA 4QU7A 2QMWA 4DPWA 4WFBQ 2BM0A 4RWWA 3CJSA 1DTQB 3OW2R 1RTZA 1XNRF 1D9DA 1RT5A 2M4MA 1RT1B 3RYLA 1S7IA 3BKUA 2E1AA 2LU1A 1K1QA 3CO0P 5KFLA 2CWKA 4HHHA 2VBYA 4C8YA 4XIUA 2J7WA 1Y4ZB 2DPJA 4PKDB 2LDIA 2XMMA 1U2FA 1NPKA 5H9FJ 1TKTB 1Q8IA 1KD1T 4B3SF 2OEJA 2COLA 8AT1B 5C42A 4DFJA 5F8MA 4OHVA 3AA8A 4N77A 3TZZA 1LOUA 5AXLA 2C3PA 1LWCB 2M52A 1RAJA 4Q8FA 5K20B 4HLBA 2W2MP 2XYHB 4CZCA 4QCLA 2J7KA 4K2XA 2ZH1A 2ZHAA 1S77D 3PR4A 4ICLB 1QM9A 4HH0A 4C7QA 3JSYA 1IKXB 2AP6A 1HQEB 1QUPA 2FLNA 2K8GA 4XDDA 4EZ9A 5KFSA 3OTOF 2K3KA 3OTBA 1U7LA 2CUYA 3CJ2A 3M30B 1BY9A 2AZ3A 4F3MA 3NNHA 2FGCA 2V63A 2VUGA 4OYBA 3QLHA 3QATA 3LPYA 2V9KA 4M63A 4KTQA 2UUBF 3KJQB 4PQUA 4X65F 4P2FA 2R42A 1U1NA 2ABYA 2XZDB 4ZPDA 2QGFB 4J91A 3OVBA 3IP0A 3TX0A 4F04B 2H48B 4TQRA 3AFGA 2XHCA 1HNVB 5E33A 5C2GA 1RT2B 5D6GA 4JV5J 2N4CA 1AUDA 4E98A 1CJVB 3VGVA 3IRXB 5M2UA 5KOWA 3TRGA 2BJ8A 1SQFA 3G82A 1OO0B 4CDIA 1OMSA 5KFOA 2V9WA 1FDNA 4ZN1A 4ILRA 5GADU 4B3RJ 2XULA 4KH1B 3MURP 3VZIA 2N7YA 5L9NA 2HQFA 4G6VB 4RW7B 3FZ2A 4FBTA 3HJFA 4ZPTR 3D6MB 5SUHA 3T1HF 2ALZA 2M70A 3C6UA 5E2QA 5J2QB 2MJNA 2WK4A 2Y3YA 2UU9J 4QPTA 3CVKA 3WC0A 2WOMB 2BKPA 5IM0B 3CDBA 2HFZA 3IFEA 4IH7A 1RHMB 2JC0A 3IWLA 2QN6B 3C6TA 3SIPB 4F3QA 1ZPVA 2W1BA 1R0AA 1R8CA 1N52B 4DQRA 3C3LA 1WKLA 3LGNA 3I0SB 2FJBB 3THPA 3GYXB 3D3CJ 2DKOB 2XLJA 1OY9A 1S10A 2PD1A 2IA0A 4M5IA 5K8MA 2QL5B 3TQEA 4EUVA 2AJ2A 1F9EB 2B4PA 3QZ7A 2ASJA 3O1LA 2VFSA 3D68A 4ZVSB 3MR2A 4RW8A 4DFPA 4N8OA 4QYZK 1MU2A 1I1GA 2GIRA 3HVTB 2NLWA 1UJ5A 1CC8A 2DNMA 3SFGA 4ZLPA 2D3OR 2WZ1A 5EN1A 3GV7B 4N56A 4J9QA 1CJUB 5ETLA 2MZ1A 1NKCA 2ACYA 1XMBA 3D6TB 5KAKA 1WEXA 4CLYA 2K1RB 2MKSA 3D0HE 3SV3A 3D9BA 3K8VA 4ETXA 3OPKA 2OJ3A 3IC1A 3KDOA 4P7VA 1VIOA 4IUFA 3Q8VA 2HBRB 4DX8H 1RTHB 3CCZA 1WF2A 3GJSB 1X4CA 2HURA 1ZAWA 4ZK7M 2CPHA 3AKOB 4RBTA 4LFBJ 4MJKA 3LGHA 4JI4F 2DHXA 4AYBD 5KG6A 1REVB 1SJ1A 4OX9J 1DQAA 4WU3A 1NK0A 3PYGA 3LALA 1F9HA 1WC3A 3JYTB 2PEHA 1SCJB 2RNEA 5F8HA 4FXVA 1QE1B 1OSCA 5K8PA 1RWOB 5A8WA 1PILA 4I1TA 3W60A 2Z2YB 4MKYA 4XAKA 4AQYJ 2F9JA 2VBZA 2LEAA 3IWNC 4LSLB 2F4VJ 2PE8A 1S1XB 2JC1A 4ZVFA 3BBBA 2NYHA 4OI2A 2IRYA 2QA4S 2ASLA 2VA2A 5K8NA 3MPWA 4NLRA 1UWBA 4FNHA 1S99A 2F65A 4N7TA 3P5TL 4FF3A 1TMJA 5HMWA 4C48A 3KLGA 1LV5A 1NLKL 4MAKA 5ADZA 5DRKA 4OI1A 3G6VA 1HD1A 2HKEA 2JVRA 4JOUA 4B3MF 5CQGA 2V6AA 1HBUA 2ASDA 3BPDA 2FC9A 2HHHF 3FJ2A 3H42A 4CO2A 2BYCA 2HFVA 5I3QA 3K58A 3CWJA 2XCAA 2F5GA 3OFGA 4ZJQA 4BC7A 1S49A 2HNDA 5ETTA 2DT9A 2QYGA 4AE5A 4P2XA 1EX8A 2W9CA 1HA1A 2VV5A 5LXRA 4DV3J 1WOOA 2W8LA 4OX8A 3HHLB 2NXUA 1LW0B 1Y0HA 4PWDB 4DV0J 4USMA 1SL0A 3PHTA 3DOMA 3TOQA 4Y00A 1IR0A 2ZH5A 4B02A 3FVYA 4O44A 2LA4A 3GJTB 3VZHA 3HD1A 4LREA 3PX0A 2NUHA 1X4BA 1L3TA 2DPIA 1MROA 4ZVHA 1ZBTA 4ED8A 4X4NA 3D6FB 5AJ3J 3S01A 3KKFA 2DH9A 3A8EA 4O3QA 2R7RA 3AQPA 3CC4S 3R5DA 2V2VA 3KFWX 4NLOA 3QSIA 4KH0B 2RT3A 2YX1A 1FTCA 5AXMA 4LBIA 2MQNA 4BLGA 1HMVA 1JLAB 2NSBA 5B0AA 5B7WA 2FLOA 2ZE2A 2A0FB 2P6TA 4U95A 1URNA 2IVMA 2RDDA 2YQ0A 1NJXA 2AWZA 3FQKA 4AT1B 4GRSA 2QFIA 3QMQA 4O3OA 4YOEA 3AH6A 3IG1B 3UN5A 3AA9A 2HBQB 1YGYA 2G0IA 1RAAB 1VRUA 4JI5J 4QU6A 3LPEA 4WXOA 4K4YA 4NXNJ 1HHQA 5CD4A 2MQ8A 1Q86T 1AXQA 2ZBQA 1RWUA 2RQKA 5FDLB 2YNGB 1VQ8S 3L9ZA 4M1KA 2YVSA 3PIPQ 2ASYA 4R5PA 5HBMA 3UVJB 2NXJA 4A8XA 4FS2A 4OHYA 4EO8A 2QA1A 1HR0F 4RU9A 1U0SA 2W25A 2I1RA 3PX4A 4OJ3A 2CPZA 3FK4A 1RAFB 3W9HA 2IIHA 2V5HG 4K0KJ 1EARA 3TVKA 4LR8A 2KXHA 2DEJA 3GE9A 2A1BA 2R2SA 5JUMA 1EQMA 4ZHRB 4IRKA 2V8PA 3CCSS 5HQMA 4RBVA 4OYOA 4LF9J 1LWFB 4O3PA 3PCOB 2DNOA 3LAMA 4DZ6A 3GJQB 2FDNA 3KUGA 1WACA 3A8KA 2VBXA 4L3NA 3MECB 3KK3B 3GFZA 1FRMA 2ZEJA 1NMEB 4JI6F 3R8YA 4CM0A 3I6PA 2GFFA 1UW4A 1AROP 2V4JA 3DRYA 5BYRA 4JYAF 2ROEA 9RUBA 2XSFA 4J9PA 4J90A 5EX3A 3T5KA 1K0VA 1Y3JA 3R7NB 1W26A 1S79A 4I56A 2XTJP 2BJ9A 4ZMMA 1GT8A 1YJNS 2C2DA 3PO4A 1SJ4P 2JLFA 2PGCA 3M2RA 2RMLA 2YKNA 3JXOA 3EZOA 1KQGB 3DRRB 2CRLA 1PAEX 3C5XC 2B5JA 3Q8RB 4I67A 2DNRA 3MOJB 4LVOP 1N0VC 1DY3A 4DV7J 2PC6A 1O5JA 1PBUA 1S97A 1HKAA 5E0OA 3NOGA 2UVRA 4AL6A 1BMQB 4MFBB 6FD1A 4OYPA 1LKZA 2ZH2A 3W63A 2VPZB 4ZP8A 3C16B 2CPXA 2HHUA 1GAOA 5I3UA 3KHRA 3S7RA 1MSWD 2IC3B 1YBUA 1YG0A 4F4YA 2R4FA 2DNYA 1GTHA 2XGPA 4ZPAA 3QFWA 3R7BB 4B9SA 4PXBA 3CD6S 1LK5A 4QJVA 3WIVA 1UZDA 3KK2A 1H6KX 2CQCA 2MKYA 3AJ2A 4W4MA 4KJIA 4RZRA 1REGX 3ZZUA 2HEKA 3CDUA 1JMTA 2CADA 4BWMA 4ES3A 2PMHA 5F8IA 1HWIA 3I9V9 2RUSA 2FZCB 1UKUA 2A2CA 1UA0A 1UPMB 4N41A 1T9XA 1UWAA 3I4PA 3A13A 5C24A 2PO4A 4KBIA 3D0GE 3FCWA 2RDJA 2GJFA 1UVIA 4DV1F 3RW7A 4M8LA 2C3OA 2QFJA 1OIAA 3BSOA 2QZ8A 2PDAA 5J2PA 2GNKA 3W5XA 3M8PB 1UAWA 3NGTA 2ZOMA 3QRPA 1S7HA 2MHNA 1R3NA 2YXLA 4JUZA 4C3MA 5E3RA 4LFCF 2Z0GA 5B0CA 2M9KA 1O6XA 4JP8A 4C3KA 1NK9A 3FMWA 1RWNB 5GAGU 2IMOA 2F40A 4A8YA 1HIYA 2NR0A 2RAQA 4NA3A 2EFGA 4UOFA 1GMWD 2A18A 1MWZA 4OV1A 2ZH9A 1U25A 3EDRB 3DKDA 2ZNYA 1YRTA 3D3BJ 3NCQA 3RU0A 1QAIA 3VAFA 1L3VA 3HSZA 4ATNA 2GVZB 1QTMA 4X4UA 4YEAA 1UFKA 4C8MA 1RB0A 4GKJJ 1C0UB 1XR5A 3VAJA 1DTQA 3KMQA 3ZC4A 4EGLA 1VHFA 3UW1A 3NWGA 4WE1B 3H59A 4A8WA 4USJC 2XZWA 3W9IA 2B9YA 1RT1A 1YKWA 4CQ1A 3OQ2A 2C2EA 3CEDA 1HNZF 1RQ0A 5B0EA 2RD5C 1EJ7L 3MMCA 2FHMA 3QRQA 2LLZA 1R8AA 2ILZA 2WONB 4IOAQ 4MMOA 4PABA 3UR3C 1TKTA 3BGUA 1GX6A 1FK9B 3CCLS 3PV8A 3ILIA 4X4VA 4IR1A 3TUPA 1ITPA 1FJCA 4ZCMA 3KLHA 3F44A 4FYYB 1LWCA 2MQOA 2XY5A 3Q0AA 1HW8A 4PG8A 3FBCA 2UUCF 3TAMB 2G0CA 2N7CA 1YTYA 2NUUG 2E5LJ 4RO0A 3FDSA 2KL8A 4PWWA 4OYXA 3P45B 4Z7YA 1IKYB 1JXEA 1PCAA 1RTDB 5E3QA 5FLXY 3V6DB 3MMBB 2VJVA 4GO7X 5E41A 2B6AA 4ICLA 2FGOA 2DO4A 2C2ZB 1S0NA 1IKXA 1HQEA 2R2TA 1KLNA 1ZA1B 3M30A 4OZLA 5CXTA 1YSJA 1TK8A 1F3FA 5E3AA 3VVUA 1HQUA 3NCRA 5KFXA 2HWIA 3N01A 4IFYB 1CC7A 4ZVUB 2DIVA 4ECRA 1YJTA 3DGPB 1HWKA 4DCJB 1R43A 3HFZB 3MXHP 4USIA 1I3OB 2XQCA 4M5JA 2ACMA 1QVFR 3MCMA 4I6YA 4DPUA 2VG6B 3RB6A 3DNCA 3GFYA 2NYIA 2DR7A 4ID8A 4RNFA 1CQMA 3KUEA 3TEHB 5ETRA 4DN0A 4NPOA 2CPFA 3M32B 4JI7F 2UUTA 2R7SA 2IJNA 3JQJA 3TR5A 1CJVA 4JI3F 4GVLA 2QSFA 2ZDPA 1U8WA 3DRPB 4WWSA 3K59A 4DL7A 2ERRA 4RWXA 2DGOA 2IM0A 2B7BB 1W2IA 2KDOA 1HBMB 2E9TA 4JV0A 1XMQF 3OFHA 3ITHB 3Q2TC 1T9TA 4NOHA 2BE7D 3PNIA 2CAJA 2Y1IA 2VQEF 4IG0B 2BXJA 3C15A 3U1NA 1VRTA 2MLYA 5J2QA 1H0HB 2DXEA 2P6SA 4DF4A 1SH2A 4DF8A 3R5BA 3ZZTA 3BR8A 1RTIB 2MKKA 2W7OA 4DOZA 2MSSA 4OYAA 3DLEA 3PKYA 2CWXA 2VG5B 1H98A 2ZFHA 2UXDJ 4DV4J 4W90B 1U6FA 4PG6A 1VBKA 2VZ9A 1FJGJ 3NMRA 1QLNA 1RWVB 3IWXA 2RS2A 3SQGA 2AYMA 3TO8A 1D3WA 3MEGB 3EXCX 3RAXA 3I0SA 4LRAA 1Q5VA 4ELTA 4RUBA 4KRWA 4PXEA 4CH0S 3DI6A 5M2RA 4YN3B 1JLEA 3UDEA 3CDEA 3OHBA 1RT6B 3AY0A 3M9OB 4P75A 4O3SA 3J81Y 2KXFA 4K2JA 1IKVB 3W66A 4UY85 1VQNS 1YLXA 1WUUA 1G6BA 1IBMJ 2AJ0A 4DQIA 3R3TA 3SCIE 2EFNA 1KOHA 4QR2A 3MUVP 1EAYC 3HVTA 4YB7A 3D6HB 4QW9A 5AE3A 1CJUA 3BQ2A 3T1YJ 3SV4A 2K1RA 3PO5A 4JV2A 4Y0FA 3NGRA 3I31A 5HJYA 4X4PA 2JVMA 4YR0A 4USWA 4DV5J 1D8ZA 2QLJB 2R3VA 3DMJB 2B9EA 3PXGa 2HHQA 1RTHA 2ZOGA 1GK8A 1RABB 3UI3A 1WKJA 4I2PB 5IXUA 4DUTA 3CW2C 2UUAJ 2YWGA 3CUNA 1REVA 2HWHA 2F1FA 2JX2A 2ZKTA 2YKOA 3JYTA 4BBYA 4QBUA 4QIWD 2XB2D 5AXNA 1IN0A 1QE1A 5KT4A 4ZKAA 1XNRJ 2WHOA 2CG8A 3CJQA 2D3UA 3ZZ0A 3ENAA 5A0YB 4LSLA 3M05A 1KS2A 2CPYA 4GVBB 1S1XA 1FD2A 1FEEA 4K7QA 2WSCC 2YQ3A 2DNPA 2FLLA 3FFIB 3U1LA 3ETOA 2FJVA 1T7PA 3TANA 4JV5F 4B3SJ 1U1QA 2DD8S 2MPUA 1X5OA 1NCLA 2J7UA 3NWRA 2CNNB 2PA8D 2JWNA 2VASA 4P2MA 5HO4A 4Z7CA 3OL7A 4YMEA 2CXEA 3F73A 3POTB 3BYRA 1P9QC 3EMTA 2CG4A 3MMAB 1XBWA 2R7OA 5BR8F 4DLEA 3TUJC 1U0HB 2OLWA 5D0EA 2I8EA 2LXUA 4I4BA 3C14B 2DRAA 3OJSA 2L3MA 4LF4F 4HACB 3QGHA 1TL1A 3DOKB 2KO1A 1IBLJ 2X3DA 1U1MA 5D0GA 3DU5A 1QSYA 4NLXA 3E2EA 3OSPA 4QW8A 1DZ5A 2XNRA 4C0BA 2EG2A 4LF5F 1LW0A 1BGXT 4X65J 3ZZPA 4C0HA 3J7Z5 4LSZB 4XPCA 5JXSA 3Q83A 5KFNA 3IBWA 2HQ3A 3H20A 3S8SA 2MDAA 2RJZA 5GMKa 2MSTA 3CCMS 1EP4B 3QNWB 4JB8B 2RHSB 4CLFA 4H4KC 2F8EX 1SL1A 4ZPWR 4DR7F 1IR1A 1KVKA 3I56S 1OWXA 1AT1B 6FDRA 2EC2A 2J9CA 1XMOJ 3C46A 1C1BB 1WC1A 3GMGA 1Q8BA 2P9GA 4CLUA 1JLFB 1R89A 1QUVA 3M8QA 2ZH7A 1GXTA 1JLAA 4TLRA 1AFJA 3GIIA 3PIOQ 2AQ4A 1RLCL 2LXFA 2B4VA 1X31C 2LCWA 4FYXB 3ILLA 2WB1D 1S1TB 4WYWA 2OMLA 2HBYB 1E6YB 2WSEC 3T1HJ 1RE1B 3RRHA 3CJ0A 2Y8YA 5ETVA 2MZSA 1YVFA 1IQTA 1DLOB 5IT9Y 3RB4A 1S6OA 3PACA 2E9ZA 2H4YB 1UVLA 2YX7A 4AUKA 2KYXA 3KTQA 4PYDA 4A8QA 2E7XA 2V2KA 3UD4P 4LFBF 2J6TA 3IR7B 4OX9F 2J0XA 2XMJA 4ZCKA 4KKOB 1SUQB 3BO2A 5FDLA 3QZ8A 4MK7A 2GQ2A 2A6MA 4ED0A 2WTFA 3MDFA 2BANB 1HD0A 3M6XA 4YQWA 2M8DB 4X84A 1UA1A 2OGUA 1HI1A 3WHIA 2M0GB 5DLGA 3PEJA 3RR8A 3M9MB 2QIFA 2I5JB 5LT5A 5ETMA 2ZJQQ 3ET6B 1XR6A 3H4BA 4DR2J 3V6KA 2RHQB 2BQ3A 2VC1A 2F8MA 1MMNA 4ZHRA 4Y2AA 4LF7F 3D28A 4RW9B 2AKWB 3W64A 5FLXU 4OIXA 4NLQA 2LXIA 1PYOB 3JQMA 1UVNA 3VGSA 4HYKA 2Z8QA 2V50A 4RUAA 2ATLA 2P5VA 3CJTA 3MECA 3KK3A 3K5NA 1MW7A 4Y2MA 1J5OB 4NZ0A 5IQ6A 1NSQA 3PX6A 1W2BR 1ZM9A 4U6PA 2E29A 2W4PA 1S6UA 2U2FA 1SC1B 1VOMA 2FHKA 1WHVA 1X9MA 5D0RA 3HFVA 1TL5A 4RKUC 4JI0F 5BXIA 4ZP7A 2E5IA 1XNQF 5HP1B 3AT1B 2E1MC 4JI4J 3IS9B 2CQ1A 3DRSB 5KFTA 3U7JA 3H2LA 3OL6A 3Q8PB 3DHXA 1JJCB 3FBFA 2L9DA 4DV3F 1U02A 4U9RA 4NLPA 3ZZZA 2R8IA 1AB8A 3BJYA 2OSQA 3V81B 3DOLB 1QSLA 4K5SA 2GMJA 1FKOB 2JSXA 1K73T 1P8GA 3R27A 4MFBA 1J5EJ 3RRGA 1O8BA 3RZAA 5KG5A 2HZVA 2Y0BB 3C16A 3K5MA 2IJFA 1VI7A 4ECSA 2KRRA 1Y7PA 2IC3A 4FBUA 2CFXA 3HVAA 5L8RC 1V5VA 3MM7B 3SQOP 3Q8QB 1Q7LB 3ZZYA 1N5VA 3CF5Q 1WC6A 1RHQB 2DTJA 3U1MA 3L7PA 3FCHA 4C98A 4ZVGA 2V8VA 1R0CB 3PJXA 1D9FA 5C2CA 1MWQA 4KGZB 3FCVA 1NHUA 1PO6A 3M6WA 2LVWA 2BJ3A 2NPIA 3AGXA 4P73A 4DMZA 4TU9A 4QWCA 1Y3KA 2G4BA 2HHHJ 5T7LB 3MEDB 4EBCA 2FHJA 3TJ8A 5D77A 4MKBA 5DM6Q 1T02A 1GFWB 3HKZD 1JXLA 1EKSA 3EICA 3MFHA 2UVVA 1WDTA 4NXNF 3TJAA 2QRRA 2WVEA 4ZJLA 1D1UA 2XC9A 3M8PA 4NCBA 2ZVIA 2QE5A 1F9FA 5KFUA 2BQUA 2IRXA 5EWFA 1FRIA 1NJIT 5KT5A 3GIKA 1RT7B 2BEFA 4I64A 2HYIB 4WK3A 4FXDA 3ENVA 4ILLA 4B3OB 5KFWA 2C2NA 3MM5B 3FQLA 2G1HA 1HBOB 4ZP6A 4ITSA 4WP8A 1F5CA 2B56A 1IBCB 2GVZA 2ZJPQ 2DYAA 4TKTA 4P6QA 2ZD1B 2BA9A 3AHPA 3FEXB 4WU2A 4K4TA 5A76A 1N56A 5CYJA 1YBAA 4A47A 3RAQA 3EE3A 2N82B 3MEEB 4WE1A 5I3PA 2B9WA 2DCLA 1FNMA 1S5ZA 1C1CB 1NEEA 4H54A 2QMXA 2CQ0A 2IVYA 1YJ7A 2BR0A 2DITA 3I96A 3P49B 1KONA 2MKCA 3N28A 1JLGB 1WG5A 4L3KA 2J76E 2WONA 4N47A 2EFOA 2HQIA 2XSJA 4KC5A 4F0HA 1FK9A 3BREA 1U2CA 1SC4B 1NB2A 4IO1A 1FA0A 3UCUP 2I0XA 3H5XA 2H65B 3TAMA 3N6NA 2P9EA 2V4QA 1JNRB 4J9MA 1RTDA 3V6DA 3MMBA 4U7UK 2RQ4A 4MIAA 4X4QA 5E3CA 1YJUA 1BWEA 1VBXA 3PW2A 3BO4A 5HMZA 4K59A 1X9SA 2LDYA 3DHWC 4UOHA 1OJ4A 1W7WA 2OP5A 2RIJA 5KG3A 3CIZA 4NWBA 5LSRA 4IFYA 4CLZA 4JI6J 3ZTSA 1SC6A 3DGPA 4NRTA 4FS1A 1ZM2A 4JYAJ 3IR6B 2FHOB 4DL4A 1K8AT 2BKOA 3SCLE 2HFSA 4HHJA 1FEHA 4DDFA 2POKA 2MXYA 4QR1A 3D2WA 1NHVA 1RZMA 4WF9Q 3M6VA 5ITHA 2LEBA 3FBEA 3MR3A 3M32A 1UFWA 3DFEA 2W8KA 1BD6A 3LOUA 2W2QP 2J0QD 3RB0A 3DRPA 1ZM4A 1KN6A 3UCZP 2GAGC 3DLHA 5KFVA 2RVJA 4JI2F 5A2QY 1T9YA 2V0NA 1HPZB 3VAIA 4DSFA 3MPUB 3PYFA 2RF2B 1X4HA 1RAIB 2XMKA 2ZH4A 3QSYB 2B8PA 1B7FA 1VBZA 2APOA 1MN7A 1O51A 2DGSA 2F4FA 2DCUB 1RTIA 3DDIA 3T3FA 3K89A 2MZQA 2V68A 1G1XA 3FBBA 1NJZA 2VG5A 2AX0A 3CSKA 1I94F 4TY9A 4CNZA 3AGYA 1M5PC 2HFUA 3J7YI 5IT9U 1HLWA 4X64F 3HI9A 1M1GA 2UP1A 4GKJF 2BUNA 2FJWA 2AGPA 2FUG9 4DV6J 3MEGA 3GV8B 3FEZA 3DDNA 2R2RA 1U1OA 1TFWA 4EMDA 3ZO7A 4U67Q 4ZVEA 1RADB 1R0BG 2E9RX 1RT6A 2KYZA 5EWGA 3HSGA 2VJUA 1M5OC 3E8OA 5E3PA 2CIMA 2V8DA 1IKVA 3KLIB 3LW5C 3M2VB 2V94A 3GJRB 4DV1J 2XNQA 1DJ0A 4F4AA 2C3YA 3WC2A 2C42A 3VGUA 3BO3A 4ZITA 1RWPB 4MK9A 1M1HA 4K50A 1QDUB 3W62A 5J1EA 2R7UA 1JX4A 4TNOA 2BZ2A 4RUHA 5L39A 2YNFB 4ANEA 4FPIA 2IM2A 1SKSA 4B3TJ 3GG0A 4Q8EA 2AJ1A 3DMJA 1VJWA 5DO2A 1RHUB 3HT0A 1NJWA 4I2PA 3GWCA 2XZTB 4PQAA 1ELOA 2OEMA 3GSDA 4DR4F 2RUGA 3KDNA 5AXKA 1XEZA 4RPFA 3PDNA 4WKYA 2ZHOA 1N8RT 4AL5A 4WJBA 5D4LA 3W5ZA 2MLZA 3IAM9 1XR7A 3PTWA 2W2NP 5LM7E 3NKYA 4B9UA 4IH5A 2R7QA 1KEKA 3VGTA 2KVIA 1X4FA 4ZN3A 2JFKA 3J7AN 1APSA 4R8UB 1TKZA 5A0YA 3D5MA 1HNZJ 3NRBA 1PC4A 3O6QA 2GC8A 4A48A 4KPCA 2PI5A 4DL3A 2IM1A 2V8HA 3BGRB 4UQGA 2XS2A 2GMHA 3FFIA 2IFXA 1RI7A 5DGBA 4NCGB 3NL0A 2B9XA 4DPOA 2DR6A 1BE4A 4H4MA 4OZ1A 1UEUA 3T6BA 1XAOA 1RT4A 2QSWA 5GAHI 5J2NB 1I51B 3HPOA 2XYPB 3MMAA 5K9FA 1U0HA 2VG7B 2AF6A 4K4XA 3KHGA 4G1PA 4EYIB 4ED4A 2HMIA 1FFWB 1KDNA 4FF2A 3C14A 3OR1B 4ZVRB 4RUCA 3R9LA 3EVWA 1YWXA 2KJVA 3FRZA 1JJ4A 4ANDA 4HACA 5GMDA 2RE1A 1NM2A 3D67A 3R1HA 2AEFA 3QIPA 1Y5IB 3DOKA 4GC6A 1YBTA 4NEYA 1S6PB 2C3UA 1QY7A 1H3DA 2YNHB 1E6VB 2XHWA 4WZMA 4DS5A 3IA0A 2MYFA 4J5OA 1FJGF 1S1VB 3NGKA 5G0RB 2J6SA 4DR6J 2HIQA 3HCXA 3ZZOA 3TAPA 3PW5A 4M5MA 2UXBF 2HZCA 2M7SA 1HHSA 4WIQA 4AD6A 1SV5B 2VB6A 4QWAA 4HHUA 4EBDA 1EP4A 3BYPA 1J27A 3GP9A 2HK2A 1PC5A 5FD1A 4JI7J 4M94A 2BACA 2N3LA 3NAIA 2ADBA 2KTQA 4UOCA 2MY7A 2E44A 1T0TV 5L1JA 1IBMF 1C1BA 3CGIA 2V69A 2KN4A 4TU7A 4DG1A 5D78A 2JNJA 1CBKA 4QIGA 1RYRA 2NSCA 1OYEA 2HVZA 2VL1A 2MQPA 4CO0A 3CCVS 4V19J 1TUWA 1C2PA 1NZAA 1S1TA 2HFOA 3I5CA 2VQEJ 5KFYA 4YDXA 2IA6A 1SL2A 3M9NB 2J0SD 4NMXA 3QGPA 1VQSA 1ACMB 4X2BA 4LSNB 4ZPVR 1DLOA 3MD1A 5ETOA 1U1RA 3LP0B 4QIVA 1N6QB 1EZZB 1GX5A 1VK3A 4J37A 2MB0B 1EB0A 4OL8A 1RU1A 2DH7A 3PW7A 4IRCA 4QYZJ 5EDWA 5F8GA 4WTYA 2OPPB 3DM2A 1RHJB 2BABA 2EFQA 1SUQA 2DNNA 4IH6A 4ZP9A 2P2CB 4WFXA 3QQCD 3EZUA 1X0PA 2DISA 1LNQA
chains in the Genus database with same CATH topology
3TJ9A 1C3GA 3AGZA 1NLTA 3NXZA 2QLDA 3NY0A 2HFVA 3AGYA 4J80A 3TJ8A 3LA0A 1GMVA 3L9ZA 1XAOA 1GMUA 3LZ8A 2B26A 4L3KA 3AGXA 2Q2GA 3I38A 1EB0A 1EARA 1GMWA 3TJAA 1GMWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ9 A;  1C3G A;  3AGZ A;  1NLT A;  3NXZ A;  2QLD A;  3NY0 A;  2HFV A;  3AGY A;  4J80 A;  3TJ8 A;  3LA0 A;  1GMV A;  3L9Z A;  1XAO A;  1GMU A;  3LZ8 A;  2B26 A;  4L3K A;  3AGX A;  2Q2G A;  3I38 A;  1EB0 A;  1EAR A;  1GMW A;  3TJA A;  1GMW D; 
#chains in the Genus database with same CATH topology
 1FX2 A;  4Z2X A;  3IM8 A;  3VAM A;  1PGZ A;  4LQ3 A;  1X5T A;  4A8F A;  4USH A;  2CPI A;  3RAM A;  2PFD A;  1NKE A;  3EGN A;  1Y00 A;  3W2W A;  2I5J A;  2IPO B;  3SXL A;  3ILJ A;  3ET6 A;  3G8T A;  5T14 A;  3T41 A;  1V5I B;  2Y9H A;  5M2P A;  3KUH A;  4NX9 A;  1Q16 B;  1JLC B;  1WHY A;  2AEJ A;  3MM6 B;  4RW9 A;  3DYA B;  2LQ5 A;  1FI4 A;  2PI4 A;  2XEX A;  2FJE B;  4LF8 J;  4ZVQ B;  4EZ6 A;  1ZAX A;  2EBG A;  3W2V B;  3AOB A;  3GG1 A;  4YB6 A;  3DC2 A;  1J5O A;  3M8Y A;  4DCP B;  3RB3 A;  1U47 A;  4LRC A;  3LP2 B;  1Q7Y T;  3AOA A;  3MTK A;  3NGU A;  1T05 B;  4GKK F;  1NXI A;  3A1Y G;  3H5S A;  4UQT A;  2AIR B;  4RJV A;  4PPZ A;  1CQN A;  3OXL A;  1QAX A;  5HP1 A;  2I6W A;  4KO0 B;  1ROF A;  3KXD A;  1NPP A;  3J80 Y;  3OFE A;  3DRS A;  3TWZ A;  4EI2 A;  4P72 A;  5DDO C;  1OSD A;  4XPE A;  1N36 J;  1IBL F;  2B26 A;  1OY8 A;  3B6B A;  3IBF B;  2ZWP A;  4FKY A;  4USV A;  3T19 A;  4B9M A;  1X4D A;  1TK0 A;  3A4T A;  1VK8 A;  1N88 A;  1VLY A;  4TVA B;  2HNZ A;  2O01 C;  3V81 A;  1TTH B;  2PMZ D;  5ETP A;  4DQQ A;  3RW6 A;  4Y2K A;  1FKO A;  3MCS A;  4D3H A;  4QWD A;  2B7C B;  2KT3 A;  3QPI A;  2MQQ A;  2IMW P;  5A2Q U;  1B0P A;  3EJM A;  4O0I A;  2BV3 A;  4NI2 B;  5IZH A;  1N5S A;  3H25 A;  1JLQ A;  5F0W A;  1KBR A;  2JFD A;  6AT1 B;  3QLH B;  2WVC A;  1U48 A;  4BC9 A;  1WKK A;  2OPQ A;  5CHC B;  2WBR A;  2OTL S;  1XMO F;  5JJB A;  1UW9 A;  4RNN A;  5HK4 A;  3LQV A;  3MM7 A;  2Q66 A;  1UPP A;  1YIT S;  3M2U B;  1IBK J;  3ZZR A;  3CDW A;  2LQ9 A;  2FC8 A;  1ZZN A;  3CT9 A;  4EFA C;  5J2M B;  3CUL A;  3R5C A;  3UD5 A;  3ZTP A;  5BR8 J;  3QT8 A;  1FWP A;  1U6Z A;  3UDL A;  2GCF A;  1WEZ A;  3GSI A;  3ETM A;  3TAR A;  2GX8 A;  1TVR B;  5E7O B;  2E1R A;  1NK7 A;  5T7L A;  2EW9 A;  3I9Z A;  4LF4 J;  2HS4 A;  3K57 A;  2M5Y A;  3G82 B;  4C4W A;  3RTV A;  2QC3 A;  1UP1 A;  4ZCL A;  1B0T A;  3W9J A;  5IT4 A;  4LF5 J;  5DG8 A;  5LJ3 Y;  1CJT B;  1JJH A;  3JSB A;  2FVQ A;  3MF5 A;  1OPI A;  2YPY A;  3C6U B;  3JSM B;  2O3D A;  2JEG A;  5D4N A;  2RH3 A;  3GFX A;  4NYO A;  2CQ2 A;  2YNI A;  3NY0 A;  2GIQ A;  2W24 A;  1RT7 A;  2DXD A;  3OLB A;  1M0S A;  1ZZF A;  1NB7 A;  4W92 B;  3S1T A;  4B3O A;  1S76 D;  5F9L A;  4DR2 F;  1H2V Z;  4DR7 J;  4LFA J;  4EU0 A;  5HAO A;  2DHG A;  2BM1 A;  3C6T B;  2ADC A;  2L41 A;  3HT3 A;  2YKM B;  4AFF A;  3MM5 A;  4QQB A;  1GH8 A;  1R0A B;  1B4S A;  5HMX A;  2VON A;  1P9Y A;  1RHK B;  2ZD1 A;  2UXC J;  2OSR A;  3MCN A;  4WP3 A;  3AJ1 A;  2Y8W A;  3KJV B;  4C8O A;  3RBE A;  2YKQ A;  4FF1 A;  1X5P A;  3BN7 A;  5IOL A;  1FRX A;  3OTC A;  2XYG B;  2JRS A;  1U1K A;  4KGM A;  2DB1 A;  4RW8 B;  3OV7 A;  4L76 A;  5GAE I;  3H5U A;  2KM8 C;  1JLG A;  4WBF A;  4LJM A;  1VRQ C;  3MOZ A;  4NA2 A;  5D4O A;  2VOO A;  1QTN B;  5A8K B;  2HLU A;  2QA2 A;  2XS7 A;  2EKN A;  2LU2 A;  3BH6 B;  1HFE L;  2JEF A;  3TAQ A;  4RNO A;  2HPU A;  2RB7 A;  3VTI A;  4CH7 A;  3GTY X;  1URR A;  3Q8U A;  3EZ5 A;  1Z1Z A;  3QT7 A;  1VIX A;  3BSA A;  5H1S V;  3UFC X;  5J1N A;  2A3J A;  2CQH A;  2QLW A;  1J5E F;  1RAO A;  4ENO A;  4USU A;  4LF7 J;  1SJ3 P;  3C6E C;  1S1U A;  3KMS A;  2KHD A;  1T03 B;  2BW7 A;  1Q79 A;  1VFJ A;  1MNE A;  3R7S B;  1TZ0 A;  1VS3 A;  3SSQ A;  5EGY A;  2C2O B;  3MR5 A;  1RJJ A;  3H2V E;  2FVR A;  5KFB A;  1VQK S;  1H72 C;  2ZBC A;  1N34 F;  1N54 B;  4PPD A;  3M4X A;  3H90 A;  3MAA A;  1S0V A;  2CVE A;  4XO0 A;  2ZZN A;  1U2R A;  5DLF A;  3EXY A;  4U96 A;  1S6Q B;  4JI0 J;  4R0E A;  2CQ4 A;  1FFS B;  1XNQ J;  1VIS A;  1QJH A;  3O8W A;  1UFL A;  3OHA A;  3UO0 A;  1QAJ A;  5HAN A;  4WFZ A;  1UWB B;  1RAG B;  5JVH Q;  3HK2 A;  1RWX B;  3KLG B;  2VDH A;  1SJQ A;  2K7K A;  4KAI A;  4J9V A;  4I7F A;  2XY7 A;  1KQF B;  2IAJ B;  3MAQ A;  1HNW J;  2GVD B;  1HPZ A;  2G0J A;  3ISN C;  3CCU S;  3CJ4 A;  3HHE A;  2HHS A;  3MAH A;  4QR0 A;  1V6H A;  3CMA S;  5HLF B;  2GO8 A;  4WYL A;  2D74 B;  3U27 A;  1H7X A;  1GTE A;  2RF2 A;  1EET B;  4PG4 A;  4F0M A;  4Q7A A;  4WXW A;  4F26 A;  3A3N B;  4DQP A;  1B99 A;  4OFZ A;  2I9S A;  2ZBR A;  1K9M T;  1VDH A;  3I0R A;  4PZV A;  1Q95 G;  1N33 F;  4OJ1 A;  2BQR A;  1GMW A;  2OEK A;  3FZB A;  4DCO B;  4UZB A;  3EWG A;  3HZE A;  1SH0 A;  2QYC A;  3DOM B;  3CPW R;  4OHX A;  4RL1 A;  4DI6 A;  2DR8 A;  4X62 J;  1FE4 A;  4DX6 A;  3QJL A;  3VV2 B;  3P4U B;  2EKY A;  1U4B A;  3R1L A;  3J81 j;  3BS9 A;  2IYI A;  2C1E B;  5ETK A;  3P8B B;  5K5M A;  2VIH A;  2CJY B;  3I4H X;  2O67 A;  3CE8 A;  3TZY A;  4CO1 A;  4ZLL A;  5I42 B;  5C7P A;  2DNQ A;  1FNO A;  1T9W A;  3ICL A;  2XBP A;  1RIS A;  2AYE A;  3M2V A;  3F41 A;  4DFM A;  3LAN A;  3SDE B;  1Q1K A;  4R0J A;  5AE1 A;  1HMV B;  1T9V A;  3KNG A;  2DHS A;  4IOC Q;  2CQI A;  1XC9 A;  2D1C A;  3HUL A;  1BC6 A;  2ZE2 B;  3IN5 A;  4DPY A;  4PCQ A;  1TFY A;  1SVD A;  3S6E A;  2XMU A;  3UN3 A;  1JB0 C;  2DGU A;  4J7C A;  2YNF A;  3QO9 B;  4KB7 A;  3N5B A;  4F0K A;  2FB0 A;  2MKJ A;  5DGA A;  1VQ9 S;  5DZ7 A;  2GAH C;  4RBU A;  1VRU B;  3M8Z A;  1BUX A;  3A8I A;  4YR2 A;  1NPR A;  2Q1L A;  4AL7 A;  4DEZ A;  2DNZ A;  4IQX A;  1NK4 A;  3SSR A;  4NML A;  2F3J A;  4DR3 F;  5IS2 A;  2VQF F;  4O4R A;  1SQE A;  5LMN F;  2VPY B;  3M1V B;  3N6M A;  1XK8 A;  1FKP A;  1YZ7 A;  2YH0 A;  1X8D A;  3G8S A;  2CPD A;  4M5L A;  2R9L A;  4WII A;  2K3I A;  2ZHB A;  3VF0 B;  2IJR A;  4R8U A;  4DR5 F;  2N3O A;  2DRD A;  2VHG A;  3D1H A;  4WZQ A;  1FDD A;  2HQC A;  2Q6C A;  1MML A;  4LRB A;  5A6W A;  3MR6 A;  4IR9 A;  3DU6 A;  4P2S A;  4UTG A;  1X4G A;  3BGR A;  1NSP A;  4QWB A;  3G6X A;  3DLJ A;  1XWL A;  1HAR A;  1TV6 B;  2RKI A;  4PAA A;  2FZK B;  3H7H B;  5B0F A;  4NCG A;  3I5B A;  3WX4 A;  1S0M A;  3QRR A;  1WWH A;  4M5G A;  2V4J B;  2BMB A;  3TZW A;  1I6J A;  2HZA A;  3GR1 A;  5HVF A;  3V6J A;  4IQM A;  3FSI A;  3NMA A;  3ELH A;  2CYY A;  1PAU B;  5DG9 A;  7FDR A;  3CC7 S;  5F0U A;  4A8O A;  1X0F A;  2FVP A;  4USK A;  1LFP A;  4J9N A;  4E0D A;  1CEZ A;  4RR5 A;  3KLF A;  3OR1 A;  4X66 F;  4K4Z A;  2JZ5 A;  3TX8 A;  2YKN B;  4AXJ A;  4Y34 A;  2UV8 G;  2B5J B;  1CG2 A;  2KZZ A;  1TP7 A;  4YS2 A;  2JJ4 D;  1XER A;  1B64 A;  4O23 A;  2E5G A;  3SEO A;  4OHZ A;  1RCO B;  2XGQ A;  1C4A A;  2IBK A;  1S1V A;  4A4J A;  5G0R A;  5CH7 B;  4ELU A;  1ZH5 A;  3B8H A;  4H4O A;  2ZH3 A;  5IQQ A;  7AT1 B;  5CZX A;  3I87 A;  3PHE A;  3G6E S;  4DV6 F;  3RG6 A;  1YJR A;  4DL5 A;  1TKX B;  2OI2 A;  1MWY A;  1SV5 A;  3R5A A;  4URS A;  1OQ6 A;  1U09 A;  3JAM Y;  3G2X A;  3VAK A;  4MH8 A;  3FKB A;  3L3C A;  2YKP A;  1BQM B;  2VDI A;  2JL9 A;  2D9P A;  3KK2 B;  4P74 A;  1UJ6 A;  4Q0B B;  3MI7 X;  2J5A A;  4ZIW A;  4JI2 J;  4G65 A;  1YK9 A;  3NCP A;  2VU5 A;  5HVH A;  4KHM A;  1WF1 A;  4O3N A;  4QZV B;  1ZTW A;  2KI2 A;  3G8Q A;  2IBO A;  3NGD A;  2YBV A;  5DET A;  5C24 B;  4B3T F;  3PKM A;  1RHR B;  4DN9 A;  4LSN A;  3I5A A;  3LP0 A;  5KFC A;  3O3L A;  1N6Q A;  1N32 J;  4TQS A;  5KG0 A;  4UOG A;  3WQP A;  4CO4 A;  1H2U X;  2GW8 A;  4YDD B;  2LMI A;  1I94 J;  1KVI A;  3GV5 B;  5IV4 A;  3I82 A;  3DRX A;  2OPP A;  2M2B A;  3X1L B;  2EWH A;  3QGG A;  3OUY B;  4X64 J;  3Q89 A;  4TY8 B;  4KT0 C;  5KFG A;  2ZWO A;  1BXN A;  3TW0 A;  4OYZ A;  3OD2 A;  3LP1 B;  2ZH8 A;  4F4Z A;  4FPR A;  1NLT A;  2QX0 A;  2MEW A;  4NCA A;  2YPZ A;  4HH1 A;  4DHV A;  1VQ7 S;  4ERD A;  4MKV A;  1UET A;  1TUV A;  3GYG A;  2RSQ A;  1HNI B;  5CD4 H;  3FC9 A;  4MYT A;  3QFH A;  2WVF A;  4ZVT B;  1RUS A;  3NXZ A;  3MZI A;  2CVI A;  3PYD A;  3C19 A;  2FVC A;  1TKD A;  3MM6 A;  4X4R A;  3D66 A;  1X5S A;  3LGM A;  2A10 A;  5EHH A;  1D09 B;  3DYA A;  4NLV A;  1SJF A;  1YHQ S;  1KSP A;  4D3G A;  1AZS B;  2QL7 B;  2OPS B;  1N5Y B;  2XMA A;  4WKR A;  3W2V A;  1FRK A;  3HP6 A;  2GHV C;  3MD3 A;  2LYV A;  4OI3 A;  2B8Q A;  5L38 A;  3LP2 A;  2ROP A;  2Q43 A;  1LWE B;  4HR2 A;  3E51 A;  3CJK B;  3UNY A;  1IKW B;  2ROG A;  4J80 A;  2J0W A;  3MGJ A;  3MMC B;  1T05 A;  2OMO A;  3AJD A;  2NXN A;  3DN9 A;  3G71 S;  4MIB A;  4UUX A;  1TEL A;  2KG1 A;  1RAH B;  3KJF B;  5CCM A;  1JJ2 R;  4F25 A;  1T3N A;  2RU9 A;  4KO0 A;  2PMW A;  1M5S A;  4J9O A;  2QTW A;  2JLE A;  1NH8 A;  1FER A;  3KLH B;  4ZJO A;  4ER8 A;  1VC5 A;  4DR4 J;  3R2C J;  4ECQ A;  1QSS A;  3R6G B;  1WG1 A;  1YZ6 A;  3MM9 B;  2JHE A;  1PSD A;  4ED7 A;  4KE5 A;  1IR2 A;  1CJK B;  1KQS R;  2D3Z A;  4BS2 A;  3HO1 A;  5THW A;  4B9N A;  4IO9 Q;  3OTE A;  2EFV A;  1H38 A;  1LQ9 A;  4Y28 C;  3DLL Q;  4URG A;  3PRB A;  2B6A B;  3OFF A;  4DR6 F;  2XM3 A;  1M5H A;  4NLW A;  1PYT A;  1GNK A;  2CQB A;  1M5K C;  2KKH A;  1FVS A;  3BDE A;  5GAH U;  2OTJ S;  3QWP A;  4ELV A;  1YRX A;  5DS7 A;  2Y1R I;  2CJQ A;  3GB0 A;  2HVD A;  1VJQ A;  2GML A;  5LJ5 Y;  5KFE A;  4NI2 A;  1GXL A;  1HNV A;  5ETQ A;  4F4W A;  1RT2 A;  1HQU B;  2E1P A;  4KY3 A;  2BJD A;  2F9D A;  1U45 A;  1WC0 A;  3IRX A;  1KQK A;  1HW9 A;  3NNA A;  2BDP A;  1EQ0 A;  3HSD A;  3M2U A;  2Z2M A;  2DJW A;  1FWL A;  3W3S A;  1P27 B;  3LUY A;  2IY5 B;  5J2M A;  2Y1J A;  1FX4 A;  3PFO A;  3O2I A;  5C25 B;  2XWY A;  1S9F A;  4U8Y A;  4RW7 A;  3W8P A;  3G4S S;  1SH3 A;  2BE2 B;  5KG2 A;  3NOC A;  4U8V A;  2IDE A;  2XI2 A;  5K14 B;  1TVR A;  5EWE A;  2LQ8 A;  1BHN A;  4EBE A;  2MZJ A;  4XK8 C;  2EG1 A;  3DDK A;  3HHL C;  5F8J A;  4ZDN A;  4DLG A;  2WOM A;  2QT7 A;  5IM0 A;  2I2Y A;  5KFR A;  3LF0 A;  3UPF A;  1ICE B;  4DSE A;  3H4D A;  3PM9 A;  3QWU A;  1CJT A;  2ZH6 A;  1CPZ A;  3TQ1 A;  1KFD A;  4NLS A;  1R8B A;  5KFF A;  1KHW A;  3JSM A;  3C15 B;  4WPA A;  1R6V A;  1VRT B;  4DV2 F;  2UXB J;  1JWW A;  3QID A;  1K0T A;  1B7Y B;  5DQG A;  4PEO A;  2DIU A;  3NGS A;  2RRB A;  3N0V A;  3DLE B;  3VAH A;  1T94 A;  2E66 A;  3BBF A;  2M3D A;  5U47 A;  2J9D A;  3D7S B;  2YKM A;  3GIJ A;  1C0T B;  4TXS A;  1FVQ A;  3A3P B;  1HHT P;  4KFB B;  1RA6 A;  4LVN P;  1VR6 A;  2CJ9 A;  2DY9 A;  3SQG B;  1T8E A;  2HRU A;  4FZV A;  3QGI A;  3TA1 A;  4ANC A;  4LF8 F;  1RT3 B;  2ZZM A;  3DI6 B;  3KJV A;  1AFI A;  4OX6 A;  1MG7 A;  3W7B A;  1JLE B;  3OL9 A;  3HX9 A;  1B3T A;  1PYS B;  3GIL A;  2C2M B;  5SZT A;  1FFG B;  3BQ1 A;  3AB4 B;  1PJ6 A;  1GMV A;  5CYM B;  1Q5Y A;  1MLA A;  4EWT A;  1NSA A;  1Q53 A;  3BSN A;  1SKR A;  9ATC B;  1LWX A;  2E5H A;  5A8K A;  1NZ8 A;  3HVW A;  1H7W A;  1GEH A;  1YJV A;  2L9W A;  1N36 F;  2ZBI A;  3OT9 A;  3PYE A;  4NLY A;  3U02 A;  4C2M A;  1T9U A;  2NS1 B;  1NAQ A;  2GQC A;  4OI4 A;  3RR7 A;  3W1Y C;  4ZCI A;  2KB2 A;  2AGO A;  1VQ4 S;  5F41 A;  4WP9 A;  4PRF A;  2Z56 B;  3F0N A;  2HFN A;  2W4D A;  4Y2C A;  4X4S A;  3SFU A;  1RAE B;  2CNO B;  5KFQ A;  1T11 A;  4OZ3 A;  2MGZ B;  3NS7 B;  1DUR A;  5H9F K;  2HBZ B;  2HVI A;  2G9O A;  2DO0 A;  1PKU A;  2W01 A;  1T03 A;  2KFY A;  4NAS A;  3R5G A;  3UQS A;  3DLK B;  3O44 A;  4OQJ A;  3HSJ A;  3CCE S;  4LMZ A;  1Y11 A;  1F60 B;  1ZET A;  1MMD A;  5F3T A;  1IBK F;  2AW0 A;  2XY6 A;  2QLX A;  1M5V C;  3T5H A;  3R2D J;  1NO8 A;  4LBH A;  2HVH A;  2RQM A;  2K2P A;  4GKK J;  1S6Q A;  3TUI C;  4F2R A;  1SPB P;  5DDQ C;  4ED5 A;  2M88 A;  1B70 B;  3MHY A;  2EVZ A;  5IC6 B;  5KFI A;  3BZQ A;  1KHV A;  5T41 A;  4CM2 A;  2ILY A;  3ADA C;  3KJN B;  1Y9O A;  2CZ9 A;  4KGX B;  4OZ2 A;  3LAK A;  4JBC A;  3JAM U;  5HQ8 A;  2X51 A;  2DBB A;  4CO3 A;  5D4P A;  4CWB A;  4DU8 A;  2CDR B;  2IAJ A;  3HHL A;  4PWD A;  2GVD A;  2HGM A;  2VPX B;  4CCH A;  3Q22 A;  3HKW A;  2YX4 A;  4QWE A;  2VIC A;  4BCA A;  4DL6 A;  5HLF A;  3JTP A;  5E5N A;  4ID5 B;  1DBD A;  4DZD A;  5KFH A;  3HJV A;  1EET A;  4JI8 J;  3AOD A;  2HG4 A;  1FXR A;  3UD3 P;  2XCP A;  2RDI A;  1LK7 A;  4KR0 B;  1VQP S;  2VKR A;  1TL1 B;  3PG9 A;  3EGW B;  1DFD A;  2VA3 A;  4B17 A;  1F1B B;  4LFA F;  1F2H A;  5AT1 B;  4PYA A;  2I38 A;  3E3X A;  2X1A A;  5KG1 A;  4ZOS A;  5CCL A;  5L9X A;  3SCK E;  2DEI A;  1FWK A;  2M8H A;  2DXF A;  2Z57 B;  4C8Z A;  4CO5 A;  4ES2 A;  2UXC F;  4DR1 F;  1RLD A;  1DRZ A;  2ZM6 F;  4NYZ A;  4PG5 A;  4F7V A;  3EVM A;  4DX7 A;  3B54 A;  5I42 A;  1KFS A;  3RRK A;  1LEO A;  2DY1 A;  3B82 A;  2MY8 A;  2QL9 B;  1H2T Z;  1RAC B;  3F56 A;  3V4I B;  2E7V A;  1R7I A;  4FVC A;  3UN2 A;  3Q8S B;  1KVJ A;  3IG1 A;  2JRR A;  3M8Q B;  1RWW B;  5HAT A;  3DXB A;  3SDE A;  1F6T A;  1TL7 B;  1TQL A;  2PT0 A;  2LA6 A;  2GS8 A;  4FXW A;  1TL4 A;  2EI5 A;  5ETN A;  1VQY A;  4U7U D;  2MMY A;  1FRJ A;  3LWL A;  2NXC A;  4IFV B;  2VFV A;  3EGV A;  3QT6 A;  2YNG A;  4EEY A;  3UVJ A;  4I6A A;  5FII A;  2D3O 1;  4L74 A;  4Y2I A;  3TZX A;  3AD8 C;  3CXC R;  2LEP A;  1PJ7 A;  2G2O A;  3QO9 A;  3BM7 A;  1NKB A;  2IM3 A;  1NSK L;  3IRW P;  4LT6 A;  1SB6 A;  3WIU A;  1G2E A;  4P9S A;  3OVS A;  4C0O C;  2KH9 A;  1Y5N B;  1HQ2 A;  1LWF A;  3CCT A;  3H40 A;  3ZXW A;  3HHK A;  3OVA A;  2BKN A;  2X7I A;  1Z2Z A;  5GAE U;  3M1V A;  2XLI A;  1FJ7 A;  3TYT A;  1WF0 A;  4KGV B;  4ILM A;  1JK9 B;  4A8S A;  3KG0 A;  1EIY B;  1UVM A;  2BRK A;  2XMW A;  2BJ1 A;  3A8J A;  3WX8 A;  4W98 A;  4KYZ A;  3FGV A;  1KP6 A;  3ZNJ 1;  2GQQ A;  5KTQ A;  5A6P A;  2PEB A;  1G7C B;  1TV6 A;  4CI0 B;  2DGT A;  1WNE A;  4I2Q B;  3SSS A;  4YY3 F;  3HF5 A;  2FD2 A;  1F5A A;  2DH8 A;  3NAH A;  5D3G B;  3K5O A;  1WHW A;  5KG7 A;  3OLA A;  3QJP A;  1UTA A;  4IDK B;  3SCJ E;  3DRR A;  2G1D A;  4LRF A;  1HNW F;  2Y1L B;  2RRA A;  1F3V A;  2V4R A;  4LIW A;  3R6L B;  2HSE B;  4EYH B;  4MKA A;  4ECV A;  3HMJ G;  3ISZ A;  4PWU A;  5GVQ A;  3K7R A;  2ZC3 A;  3MPD A;  2C22 A;  3CME S;  1FT8 A;  5HMY A;  4DWI A;  4OYW A;  4NXM F;  4KHR A;  2LP4 A;  4DUZ F;  2H54 B;  5L1K A;  1AA1 B;  4A46 A;  1UMJ A;  4N76 A;  4CIO A;  1S72 S;  4LQ9 A;  4KHP J;  2WW4 A;  4LIR A;  4X62 F;  3G86 A;  4DU7 A;  1XQI A;  4ZLJ A;  1N34 J;  2D41 A;  2ODX A;  5HQL A;  3QAE A;  4FF4 A;  3PJ9 A;  1HBN B;  1HYS B;  2OO4 A;  2QLF B;  5A8R B;  3ZNU A;  1B0V A;  1RU2 A;  4ECU A;  4IG3 B;  4LF6 F;  2Q3P A;  1TKX A;  2DHA A;  2CQD A;  1LXN A;  2NZ4 A;  3SYZ A;  5L1L A;  3MFI A;  4UZC A;  1VC6 A;  2NQP A;  1Y10 A;  1S9E B;  3W8G A;  2ZNZ A;  4KIA A;  3ZTO A;  1BQM A;  1M1K T;  2NCK L;  3LA0 A;  2CJA A;  2UUW A;  4ECX A;  2QJ3 A;  2UVW A;  4Q0B A;  2KT5 A;  3KNA A;  1HL6 A;  2Y0S D;  3AGZ A;  1RCX B;  3J81 U;  5IWA F;  1OPZ A;  5HL7 Q;  2CQP A;  4ECW A;  3LWM A;  1S4E A;  2C28 A;  2YWE A;  3SI8 A;  2R8H A;  1WI6 A;  1TL3 B;  4QIF A;  4P10 A;  1LW2 B;  2P8I A;  4I6W A;  1ZAV A;  2BVZ A;  2FY1 A;  1NJY A;  1R27 B;  3CJ8 A;  3A3O B;  1P1L A;  4V19 X;  1FF2 A;  4ZVP B;  2JEJ A;  4J9L A;  2DGQ A;  1N33 J;  1P6T A;  3PW4 A;  2AV5 A;  2VD3 A;  4YHH F;  2KG0 A;  3MTJ A;  1WEY A;  4LF2 A;  4KQZ A;  2CJX B;  5B09 A;  4P52 A;  3MWB A;  3OUY A;  4TY8 A;  3LP1 A;  1TU0 B;  3JQK A;  3HHD A;  1C0U A;  1DQ9 A;  1JKH B;  2HAF A;  4U7C A;  3T9N A;  4WFY A;  3EM1 A;  3CMQ A;  2LQB A;  4MK8 A;  1NND A;  4K4U A;  4CTA B;  2AEM A;  1HNI A;  3V4M A;  4LR7 A;  1SI9 A;  3DXS X;  3EX7 B;  3MPV A;  4F8R A;  4YB1 P;  2OAU A;  1CSJ A;  3N4W A;  2BBE A;  2HGN A;  5D15 A;  2MLX A;  5LMU F;  1ZOT A;  5IC4 B;  1WSR A;  5I4M A;  2W2O P;  4Y6I A;  4R25 A;  1AZS A;  3M6U A;  4B9V A;  4DJB A;  2R8J A;  2OPS A;  4UST A;  1N5Y A;  4ED1 A;  1WC5 A;  3OXF A;  4HT7 A;  4KSE B;  1U24 A;  2YTC A;  4M5D B;  1EHW A;  4L6V 3;  4PUO B;  5KFD A;  4PXD A;  1KOO A;  3HVR A;  4NLD A;  4RW6 B;  2KFZ A;  1LWE A;  3OXG A;  4JI1 J;  2PN6 A;  3CJK A;  1IKW A;  3GFH A;  2WRM A;  1IKY A;  3ZTR A;  2E7W A;  5CYQ B;  2U1A A;  4FYV B;  2OFG X;  2FPH X;  3MCO A;  3TEG A;  3G6Y A;  4FDF A;  4N8N A;  2XSJ B;  3LTO A;  2BJ7 A;  2AX1 A;  4CT8 A;  3FMB A;  4DR3 J;  3ENQ A;  1UL3 A;  3KLE B;  1CUL B;  2HHV A;  2VQF J;  5LMN J;  2C2R A;  2OHD A;  1PBA A;  3K2Y A;  4JV1 A;  5LXY A;  2HWT A;  3MM9 A;  3N9U C;  1RP5 A;  1NK6 A;  4QOT A;  4B9T A;  2Z2Z A;  2E5J A;  1CJK A;  3ONQ A;  3PR5 B;  4HKQ A;  1JIH A;  5DJB A;  1NHK L;  5IV3 A;  1R31 A;  1XTZ A;  3HHN B;  2FJX A;  2HNY B;  1UZH A;  2H5E A;  2R8G A;  2QA4 G;  4DR5 J;  4Q43 A;  4NE9 C;  2VG6 A;  1IUJ A;  5LOQ A;  2SXL A;  2AGQ A;  3P96 A;  5HVG A;  2DNH A;  5KFJ A;  1N4L A;  1K44 A;  4ES1 A;  4NRU A;  4BDP A;  1CLF A;  3AXM A;  5B0G A;  1VQO S;  3NS5 A;  2HS3 A;  1KKH A;  3DLB A;  2NZC A;  1HBM A;  2FTR A;  3T6J A;  2VOD A;  4C8K A;  3P6Y C;  1JLB B;  1KRP A;  3A12 A;  3ITH A;  4ED2 A;  2P9C A;  4F67 A;  2AYG A;  5C25 A;  2J6U A;  1KNZ A;  1P1T A;  2BE2 A;  4OJG A;  1F5B A;  2OPR B;  3TVZ A;  4IG0 A;  5K14 A;  1WDD A;  1FHT A;  3PW0 A;  4X4T A;  4A8M P;  4X66 J;  2H51 B;  1ZA2 B;  2Z30 B;  1HNX F;  4KV8 B;  4FYD A;  1N32 F;  3HZG A;  2K7J A;  1ZTT A;  2KRB A;  4OLO A;  4CYU B;  2MZT A;  1FE0 A;  3W61 A;  4WFA Q;  4OHW A;  1UEV A;  2ZUG A;  1LFW A;  1UVK A;  4OZJ A;  3P5B P;  4TN2 A;  1HI0 P;  3BGF A;  3ISN D;  4BHQ A;  4XTT A;  2W2P P;  3BQ0 A;  4OI0 A;  1BQX A;  3UNG C;  1FNX H;  2QV6 A;  2HHT A;  4RNM A;  4LRD A;  4ED3 A;  2UV8 A;  4G1Q B;  3N6L A;  2DNL A;  3UWT A;  4ECZ A;  2GHP A;  2AT1 B;  2AZ1 A;  4G1I A;  1IQZ A;  2XO7 A;  2F7V A;  1C0T A;  3N79 A;  2EFP A;  2MZR A;  4DUY F;  2MQL A;  2CZV C;  4KFB A;  3CD5 A;  1IVZ A;  1RGV A;  2BX6 A;  4ZVO B;  3D1O A;  3TNV A;  1FCA A;  4ZA1 A;  1FXL A;  2ATC B;  3L95 X;  3EYZ A;  2XO6 A;  3RGI A;  3EGZ A;  3KG1 A;  4UY8 T;  1RT3 A;  1VGY A;  4MT1 A;  3KOA A;  1VQ5 S;  2W4C A;  2D7S A;  3CJ3 A;  5HRO B;  1Z4U A;  2JLG A;  2AJF E;  1S0O A;  1EKR A;  5EUH A;  3LH2 S;  5HJX A;  4ZPB A;  1S4F A;  2DGV A;  4ECY A;  3EUN A;  1W25 A;  1NH7 A;  3HD2 A;  4J9K A;  3NBP B;  5CYM A;  3BEG B;  2FYX A;  4L72 B;  5F8N A;  1JNZ B;  3EVO A;  1DAR A;  2GIF A;  1QVG R;  5MLC V;  1AW0 A;  1WC4 A;  1N5T A;  2EK6 A;  5HSP A;  2FQQ B;  1WTF A;  3D54 A;  3DCA A;  5J1E B;  4KGK A;  3BB5 A;  2GV1 A;  5KT3 A;  3TI0 A;  3KHH A;  4HDG A;  4IKA A;  5F9N A;  2VFU A;  2FY8 A;  4RW4 B;  3EDQ B;  3CNQ P;  2RIL A;  2J8S A;  3HDS A;  2BRL A;  2B0G A;  2D9O A;  1S48 A;  3VCD A;  3DLG B;  1CVJ A;  5GME A;  2GO9 A;  4F36 A;  4HVZ A;  3CCQ S;  5KFK A;  1S1W B;  4GVB A;  4RLE A;  4DSL A;  3CTR A;  4Q2L A;  2MGZ A;  3OR2 B;  2RQC A;  2J9D E;  2OKQ A;  1Q78 A;  2YKA A;  3Q8Y A;  3AQO A;  4NA1 A;  2YQ1 A;  1A7G E;  3DLK A;  1C4C A;  4S0M A;  3JTO A;  3R5J B;  4B9L A;  4HI1 A;  4M95 A;  4GMK A;  3R97 A;  4WTO B;  2WVD A;  1N5Q A;  1SXL A;  2CNK B;  2V67 A;  4O4G B;  2HS0 A;  4F50 A;  3BKF A;  2Z2L A;  3MM8 B;  2AJ4 A;  3HLU A;  4M5N A;  1IM4 A;  1TKZ B;  3L4B C;  3POT A;  4X4O A;  3GIM A;  2OD4 A;  2X1B A;  1SBR A;  2CJB A;  5KT2 A;  3VAL A;  2DNG A;  1Z2L A;  5D0H A;  5C5J A;  2FVS A;  2LEC A;  2B4U A;  1VYA A;  3B4D A;  4HL9 A;  4A8K A;  2HHW A;  1L3K A;  5ETS A;  2HGL A;  4PXC A;  4DBQ A;  1IWA A;  2R7T A;  4NEZ A;  4H4M B;  3CCJ S;  2FJD B;  4J9S A;  2DRB A;  1RT4 B;  3AD7 C;  2EBE A;  1Q0N A;  4ETZ A;  5IFM A;  1VCT A;  1TK5 A;  2C2K B;  4B3R F;  3VAG A;  3B4M A;  3IR5 B;  1FJE B;  1HWU A;  4CT9 A;  5J1P A;  1BQN B;  4K4W A;  5KFM A;  3AAW B;  1ULR A;  3ULH A;  3BKT A;  4LR9 A;  1Y5L B;  2HMI B;  4C97 A;  2DR9 A;  1RK8 A;  4ID5 A;  1I5O B;  2KVQ E;  1XJW B;  3OTO J;  4Y3C A;  1PG5 B;  2IYG A;  2UU9 F;  2AMC B;  3RUB L;  5GAD I;  1WOS A;  3W65 A;  4F3O A;  4C11 B;  3QIP B;  3PVX A;  3J7Z T;  4ED6 A;  3Q23 A;  1HI8 A;  1CS4 B;  3M7V A;  3OJU A;  1WHX A;  4ZIV A;  2W9B B;  1U1L A;  2QLD A;  2UUB J;  3IM9 A;  5LL6 d;  4C9D A;  2K06 A;  4IOB A;  3IXQ A;  1RKI A;  1DTT B;  3MUT P;  2WAQ D;  1VC0 A;  1JLF A;  5DG7 A;  2RS8 A;  2WCX A;  2HRY A;  2GGP B;  1BWV A;  1HWJ A;  2YWH A;  4HT5 A;  3H5Y A;  4I0W A;  1X60 A;  1VQ6 S;  4LUB A;  4DFK A;  1TAQ A;  3KK1 B;  1V9O A;  2NXE A;  2ZBP A;  3AOC A;  2YWK A;  1E6Y A;  3EPI A;  3D0I E;  4I69 A;  4TYB A;  4RX6 A;  2W7P A;  3NG8 A;  2B43 A;  3TP2 A;  1RTJ B;  2R7X A;  4OZ5 A;  2FLP A;  2KFN A;  1DAX A;  1X4A A;  2CA9 A;  1S9G B;  4ZLN A;  3V4I A;  1M90 T;  3JB9 k;  2VF3 A;  3GU0 A;  2JZ8 A;  1KLM B;  1V3Z A;  4DG1 B;  5KG4 A;  3C8Y A;  4DSK A;  3TJ9 A;  1TL7 A;  3IGN A;  3ENW A;  1FRL A;  1K1S A;  4KKO A;  4IFV A;  3E01 B;  2WBM A;  1IJF B;  3QT5 A;  2FZG B;  3FNN A;  2BAN A;  1T3O A;  4ALZ A;  2ALY B;  2YY3 A;  2O1P A;  4AXI A;  1PJ5 A;  4DV2 J;  4XDC A;  1HWL A;  5HI7 A;  1GMU A;  1YRU A;  2G2Y A;  1WOP A;  1A0O B;  1RWM B;  2LFV A;  5CAB A;  3IO1 A;  1WD6 A;  1VQL S;  2MKH A;  1Q8K A;  3TUZ C;  3DM2 B;  4WK1 A;  3KG4 A;  2IDL A;  3OTD A;  1R8P A;  3B78 A;  4K4V A;  2ZZT A;  1LXJ A;  2ZDO A;  3D1Q A;  2XI3 A;  1FDA A;  4FP9 A;  3QYY A;  2AD9 A;  2DVI A;  4HDH A;  1OY6 A;  2QEX S;  2B4O A;  2VPW B;  3H98 A;  1RT5 B;  2DNK A;  1NDC A;  2JH3 A;  4AQY F;  3W2W B;  2XMT A;  1KR4 A;  2F4V F;  1RBA A;  2HW3 A;  3OSN A;  2EC0 A;  4DPT A;  2HAI A;  5BYS A;  3IAS 9;  4M5K A;  4DSJ A;  3AD9 C;  4K4S A;  4YUD A;  5LSL A;  2H1Y A;  1ZM3 A;  5RUB A;  3IS9 A;  5C42 B;  3MMJ A;  3Q24 A;  4I2Q A;  1Q8L A;  3THV A;  5KT6 A;  1G4C A;  5L46 A;  3OL8 A;  4EK2 A;  5D3G A;  2OUG A;  4IDK A;  1AYE A;  4UT4 A;  4Q45 A;  4OJH A;  5DDP C;  1DHM A;  2CJK A;  5B08 A;  3GON A;  3NEK A;  4WFN Q;  1GQE A;  3DOL A;  3EPG A;  2DR5 A;  2F63 A;  1FXD A;  4NZ7 A;  2H4W B;  3GZ7 A;  2DGW A;  1C3G A;  1T95 A;  4JI8 F;  2JVO A;  1IJE B;  4FYW B;  4C6A A;  2B51 A;  5JMN A;  1IWG A;  2XWX A;  3BDP A;  2AU0 A;  2B3T B;  1V3S A;  3TA0 A;  2L48 A;  4DSI A;  3TA2 A;  3HXM A;  2VBW A;  3BSC A;  3KWM A;  2CPE A;  1A9N B;  1TMM A;  4DV0 F;  2HNZ B;  3GCX P;  4PQU B;  3W5Y A;  1ZPW X;  5H9E J;  3UDV A;  5MAO A;  3QJJ A;  2J8A A;  3G96 A;  2Q6B A;  1D0E A;  3MR7 A;  3KYL A;  1HBN A;  1VHI A;  2ZC4 A;  1RKJ A;  1QD1 A;  1HYS A;  1NDL A;  3SBM A;  5A8R A;  3X3U A;  2IVF B;  2ZIT A;  4IG3 A;  1J2V A;  2G2Z A;  2FIU A;  2R7V A;  2OFH X;  4UF4 A;  2V2Q A;  1JLQ B;  5AJ3 F;  2O66 A;  3CO9 A;  3IGV A;  3WDO A;  2WVB A;  4DL0 C;  3RBX A;  1N0U A;  2YWW A;  2OPQ B;  1S9E A;  4RNH A;  3MED A;  4P7T A;  4Q5V A;  2BOP A;  4CLK A;  4H4K A;  4HEA 9;  3MEK A;  3SMZ A;  3J7A 1;  3K17 A;  5CAA A;  2KT2 A;  3V2U C;  1FKA F;  2GHW A;  4OYM A;  4CLP A;  3M8S A;  3BV8 A;  5B0D A;  4DQS A;  3H8Y A;  4CRJ A;  4Q2M A;  5KFZ A;  4B3M J;  1TL3 A;  4NLG A;  2CDQ A;  1LW2 A;  3PZP A;  1TAU A;  5KFA A;  5HN0 A;  1S57 A;  4NYP A;  3FSX A;  4MIW A;  4OX7 A;  3T5J A;  3VQT A;  3FUY A;  4UUW A;  2QMU B;  4JI5 F;  2V34 A;  2HHP A;  3T9Z A;  1NUE A;  1SKW A;  3NLC A;  4GC7 A;  2OEL A;  2N4D A;  1H74 A;  3HHL D;  2GA7 A;  1UJ4 A;  4YB5 A;  4C3L A;  1HBO A;  4YP3 A;  3UE2 A;  5EX0 A;  2KU7 A;  4V1A k;  4FN5 A;  5G4D A;  2PSZ A;  2OH2 A;  1RSC A;  1JKH A;  4TU8 A;  2YNI B;  4DR1 J;  4OZN A;  3CIM A;  2H5J B;  3PEH A;  2ZM6 J;  3MEE A;  3QAU A;  2DGX A;  4K0K F;  4Y65 A;  4CTA A;  1C1C A;  2J9E A;  3JS9 A;  5DQI A;  2E1C A;  2HQG A;  3SZ2 A;  4LF9 F;  3RBZ A;  3G9C A;  1JQG A;  1Q81 T;  1MU2 B;  4F4K A;  2QLB B;  2CQ3 A;  1K47 A;  3US5 A;  3CD0 A;  2W7A A;  1D8Y A;  2R8K A;  4FNI A;  1YJ9 S;  1U8S A;  4M5D A;  3HFK A;  1NK5 A;  4PUO A;  2MTL A;  4RW6 A;  4CLW A;  4CLS A;  3ILO A;  2Z4P A;  2Q79 A;  4BWJ A;  4OMF G;  4URQ U;  2H5I B;  2VKZ G;  4FVM A;  1SKU B;  5DM7 Q;  1FO1 A;  5CYQ A;  2F8H A;  4OI6 A;  4ZPC A;  2MHE A;  4E8U A;  1NRK A;  2RU3 A;  1R6Y A;  4KPY A;  4C8N A;  1L3U A;  3GIR A;  3KLE A;  1CUL A;  3ZFV A;  2EEY A;  1YX2 A;  1NK8 A;  3CDA A;  1NU4 A;  3UCG A;  1TUG B;  3I55 S;  3NS6 A;  3IMQ J;  1HR0 J;  5A8W B;  1FES A;  4KHP F;  4DV7 F;  3CD7 A;  4OLP A;  4DXL A;  3KHL A;  2JOQ A;  4QYR A;  2HNY A;  5KFP A;  2GJI A;  4HI2 A;  2MKI A;  4QPX A;  3GPA A;  2WW8 A;  1ZYQ A;  5B0B A;  3OBI A;  1S1U B;  4NLU A;  1KC8 T;  3AXK A;  3NP5 A;  3H0P A;  4J9R A;  1WG4 A;  5DZ6 A;  1XN9 A;  1VMB A;  4OV6 A;  3JSR A;  4L75 A;  2WB4 A;  5AE2 A;  1L5U A;  4YY3 J;  1R8H A;  1YI2 S;  2ZJR Q;  3UDC A;  4J9U E;  2BOA A;  2YWF A;  3LO3 A;  3GR0 A;  2KZM A;  3MAA B;  2VC0 A;  1IM6 A;  5DDR C;  5H9E K;  1AUS L;  1OYD A;  1X7V A;  1U1P A;  1SJR A;  1JLB A;  3BF4 A;  1WSV A;  1RWK B;  2ZVS A;  2ZOF A;  1SQG A;  1HBU B;  1D9A A;  2KXN B;  2XS5 A;  2JDJ A;  2OPR A;  3PRD A;  3D4J A;  3ZTQ A;  2O5D A;  2UVU A;  4DL2 A;  2VOP A;  4EO6 A;  3THT A;  2HND B;  2QO3 A;  4KV8 A;  4I7F B;  3CCW A;  2W9C B;  4F2S A;  3VVT A;  4NXM J;  1RBL A;  4DUZ J;  4QIE A;  2A6O A;  4YFU A;  4CYU A;  3VHQ A;  1ZS6 A;  4E2F B;  3PY8 A;  5DQH A;  3KLV A;  5F3Z A;  1FD8 A;  3VR1 A;  1UVJ A;  2V8G A;  4HTJ A;  2HIY A;  1U49 A;  4O44 B;  1UEK A;  2JEI A;  3WZ0 A;  4L73 A;  1BLU A;  5L1I A;  1MRO B;  4LF6 J;  2EXU A;  3UR0 A;  3I0R B;  2ZUA A;  2CPJ A;  2V2Z A;  4G1Q A;  3RJM B;  4HTI A;  1U26 A;  2LQJ A;  3KLI A;  2CNL B;  3AB2 B;  2L08 A;  4PG7 A;  4P71 A;  2XG8 A;  3VQS A;  2VFT A;  1NBE B;  4DS4 A;  7FD1 A;  8ATC B;  3K0J A;  2AHO B;  5IWA J;  5GAG I;  4TLQ A;  2DK2 A;  3K5P A;  3V5R A;  2YH1 A;  1WEL A;  4I68 A;  3FEY B;  2MQM A;  2H3E B;  5HRO A;  3Q2S C;  4CP5 A;  1OQ3 A;  4JI1 F;  3GLJ A;  4DPX A;  2AYB A;  1RA7 A;  2FHJ D;  2CKW A;  1MN9 A;  3I32 A;  1WOR A;  4LBP A;  3NBP A;  2MJU A;  3MPY A;  3K5L A;  1RYS A;  4MTP A;  4YHH J;  1SC3 B;  2D69 A;  2KM8 B;  1A6L A;  2CQG A;  5JVG Q;  3BGL A;  4YR3 A;  4R5P B;  5HBM B;  4CH1 A;  3H2U B;  1DQ8 A;  3M8R A;  1SIZ A;  3NNC A;  1UCN A;  2UZA A;  2E5L F;  4LFC J;  3J80 U;  4RW4 A;  3DGV A;  1IXK A;  2VFR A;  2R7W A;  4TYA A;  1F0X A;  2X1G A;  3DLG A;  1FRH A;  4ZS6 A;  4M5H A;  3Q86 A;  4CNY A;  3HM9 A;  5BYQ A;  1WTB A;  3PFE A;  3C2P A;  5CZV A;  3BN4 A;  1S1W A;  1S12 A;  2HK3 A;  3RBD A;  2EK1 A;  3OR2 A;  4O3R A;  3C66 A;  5LMU J;  4C8L A;  5FJ4 A;  3CC2 S;  1FKP B;  1U6B A;  1Q4R A;  2WSF C;  3IBC B;  4ECT A;  4DX5 A;  1PIE A;  3BGO P;  4O4G A;  2A2D A;  4O0N A;  2ZKU A;  5J2N A;  3MM8 A;  2BJE A;  1VLO A;  4WCE Q;  2X3G A;  2VG7 A;  3VWS A;  2HHX A;  2HQD A;  2GJ2 A;  2DHH A;  1XIQ A;  1KTV A;  2PA3 A;  1G3O A;  4Z37 A;  2EPI A;  2IHR 1;  2C3M A;  2RKI B;  3CB4 A;  3K8W A;  4F02 A;  3T5L A;  2BW2 A;  1WJ9 A;  3M2R B;  4Q44 A;  4NLT A;  2BE9 B;  1FDB A;  4OYI A;  4B08 A;  4F4X A;  1S6P A;  2UUC J;  3CJ5 A;  1FTR A;  1TR0 A;  2AJQ A;  2YNH A;  1E6V A;  3TVY A;  3BH7 B;  1X9W A;  1S59 A;  3PJW A;  1YQH A;  1NDP A;  2H9Z A;  3CJR A;  1BQN A;  1NDK A;  3LZ8 A;  4IRD A;  3CCR S;  5CA5 A;  3L7O A;  4MYU A;  1N48 A;  3KLF B;  5LSO A;  2HVE A;  2L9N A;  2R2U A;  2KJW A;  1VQM S;  4K8R A;  2PFF B;  1KTQ A;  3M8W A;  5F8L A;  4FKX A;  3G87 A;  2KHC A;  3BPS P;  5I3U B;  2FJA B;  2NRE A;  1GXU A;  4RU2 A;  3L7U A;  4C11 A;  2Z58 B;  5KOX A;  2UXD F;  4DV4 F;  1VBY A;  1CS4 A;  2OD6 A;  4G3I A;  1F2G A;  2W9B A;  2X1F A;  2CZ4 A;  3L09 A;  3N5F A;  5D8H B;  1RBO B;  1DTT A;  1Q82 T;  4IYQ A;  1YIJ S;  2Q2G A;  5KT7 A;  4CLL A;  4H4O B;  4N5S A;  2GGP A;  2XLK A;  1RXO B;  3BR9 A;  2GZO A;  2NPF A;  3MUM P;  3O5T B;  5IT0 A;  1QAY A;  3KK1 A;  3FSY A;  2G13 A;  3P3D A;  3J7Y U;  3I38 A;  1O0P A;  3GCW P;  2VH7 A;  2HRT A;  1RTJ A;  1OS5 A;  4JI3 J;  3V6H A;  1S9G A;  2QG9 B;  3WBZ A;  1X4E A;  1SIW B;  1HNX J;  3QBC A;  3JTN A;  3BBC A;  1KLM A;  4K5R A;  4LF1 A;  1H73 A;  5J2P B;  2RRN A;  1XMQ J;  3FRY A;  1KWM A;  5BJR A;  1WI8 A;  3T1Y F;  2LKZ A;  3E01 A;  4CLT A;  2PII A;  5K8O A;  4OZ0 A;  3T1A A;  1YDL A;  4DV5 F;  2W9A A;  1JXV A;  1L3S A;  2IRU A;  4GO5 X;  1RDR A;  8RUC A;  4NL5 A;  3GQC A;  4NZ6 A;  1YJW S;  4PR6 A;  2HLT A;  3PRV A;  2XMV A;  2UUA F;  1V3R A;  4UW2 A;  1JLC A;  2OIH A;  4DUY J;  3GYN A;  4QU7 A;  2QMW A;  4DPW A;  4WFB Q;  2BM0 A;  4RWW A;  3CJS A;  1DTQ B;  3OW2 R;  1RTZ A;  1XNR F;  1D9D A;  1RT5 A;  2M4M A;  1RT1 B;  3RYL A;  1S7I A;  3BKU A;  2E1A A;  2LU1 A;  1K1Q A;  3CO0 P;  5KFL A;  2CWK A;  4HHH A;  2VBY A;  4C8Y A;  4XIU A;  2J7W A;  1Y4Z B;  2DPJ A;  4PKD B;  2LDI A;  2XMM A;  1U2F A;  1NPK A;  5H9F J;  1TKT B;  1Q8I A;  1KD1 T;  4B3S F;  2OEJ A;  2COL A;  8AT1 B;  5C42 A;  4DFJ A;  5F8M A;  4OHV A;  3AA8 A;  4N77 A;  3TZZ A;  1LOU A;  5AXL A;  2C3P A;  1LWC B;  2M52 A;  1RAJ A;  4Q8F A;  5K20 B;  4HLB A;  2W2M P;  2XYH B;  4CZC A;  4QCL A;  2J7K A;  4K2X A;  2ZH1 A;  2ZHA A;  1S77 D;  3PR4 A;  4ICL B;  1QM9 A;  4HH0 A;  4C7Q A;  3JSY A;  1IKX B;  2AP6 A;  1HQE B;  1QUP A;  2FLN A;  2K8G A;  4XDD A;  4EZ9 A;  5KFS A;  3OTO F;  2K3K A;  3OTB A;  1U7L A;  2CUY A;  3CJ2 A;  3M30 B;  1BY9 A;  2AZ3 A;  4F3M A;  3NNH A;  2FGC A;  2V63 A;  2VUG A;  4OYB A;  3QLH A;  3QAT A;  3LPY A;  2V9K A;  4M63 A;  4KTQ A;  2UUB F;  3KJQ B;  4PQU A;  4X65 F;  4P2F A;  2R42 A;  1U1N A;  2ABY A;  2XZD B;  4ZPD A;  2QGF B;  4J91 A;  3OVB A;  3IP0 A;  3TX0 A;  4F04 B;  2H48 B;  4TQR A;  3AFG A;  2XHC A;  1HNV B;  5E33 A;  5C2G A;  1RT2 B;  5D6G A;  4JV5 J;  2N4C A;  1AUD A;  4E98 A;  1CJV B;  3VGV A;  3IRX B;  5M2U A;  5KOW A;  3TRG A;  2BJ8 A;  1SQF A;  3G82 A;  1OO0 B;  4CDI A;  1OMS A;  5KFO A;  2V9W A;  1FDN A;  4ZN1 A;  4ILR A;  5GAD U;  4B3R J;  2XUL A;  4KH1 B;  3MUR P;  3VZI A;  2N7Y A;  5L9N A;  2HQF A;  4G6V B;  4RW7 B;  3FZ2 A;  4FBT A;  3HJF A;  4ZPT R;  3D6M B;  5SUH A;  3T1H F;  2ALZ A;  2M70 A;  3C6U A;  5E2Q A;  5J2Q B;  2MJN A;  2WK4 A;  2Y3Y A;  2UU9 J;  4QPT A;  3CVK A;  3WC0 A;  2WOM B;  2BKP A;  5IM0 B;  3CDB A;  2HFZ A;  3IFE A;  4IH7 A;  1RHM B;  2JC0 A;  3IWL A;  2QN6 B;  3C6T A;  3SIP B;  4F3Q A;  1ZPV A;  2W1B A;  1R0A A;  1R8C A;  1N52 B;  4DQR A;  3C3L A;  1WKL A;  3LGN A;  3I0S B;  2FJB B;  3THP A;  3GYX B;  3D3C J;  2DKO B;  2XLJ A;  1OY9 A;  1S10 A;  2PD1 A;  2IA0 A;  4M5I A;  5K8M A;  2QL5 B;  3TQE A;  4EUV A;  2AJ2 A;  1F9E B;  2B4P A;  3QZ7 A;  2ASJ A;  3O1L A;  2VFS A;  3D68 A;  4ZVS B;  3MR2 A;  4RW8 A;  4DFP A;  4N8O A;  4QYZ K;  1MU2 A;  1I1G A;  2GIR A;  3HVT B;  2NLW A;  1UJ5 A;  1CC8 A;  2DNM A;  3SFG A;  4ZLP A;  2D3O R;  2WZ1 A;  5EN1 A;  3GV7 B;  4N56 A;  4J9Q A;  1CJU B;  5ETL A;  2MZ1 A;  1NKC A;  2ACY A;  1XMB A;  3D6T B;  5KAK A;  1WEX A;  4CLY A;  2K1R B;  2MKS A;  3D0H E;  3SV3 A;  3D9B A;  3K8V A;  4ETX A;  3OPK A;  2OJ3 A;  3IC1 A;  3KDO A;  4P7V A;  1VIO A;  4IUF A;  3Q8V A;  2HBR B;  4DX8 H;  1RTH B;  3CCZ A;  1WF2 A;  3GJS B;  1X4C A;  2HUR A;  1ZAW A;  4ZK7 M;  2CPH A;  3AKO B;  4RBT A;  4LFB J;  4MJK A;  3LGH A;  4JI4 F;  2DHX A;  4AYB D;  5KG6 A;  1REV B;  1SJ1 A;  4OX9 J;  1DQA A;  4WU3 A;  1NK0 A;  3PYG A;  3LAL A;  1F9H A;  1WC3 A;  3JYT B;  2PEH A;  1SCJ B;  2RNE A;  5F8H A;  4FXV A;  1QE1 B;  1OSC A;  5K8P A;  1RWO B;  5A8W A;  1PIL A;  4I1T A;  3W60 A;  2Z2Y B;  4MKY A;  4XAK A;  4AQY J;  2F9J A;  2VBZ A;  2LEA A;  3IWN C;  4LSL B;  2F4V J;  2PE8 A;  1S1X B;  2JC1 A;  4ZVF A;  3BBB A;  2NYH A;  4OI2 A;  2IRY A;  2QA4 S;  2ASL A;  2VA2 A;  5K8N A;  3MPW A;  4NLR A;  1UWB A;  4FNH A;  1S99 A;  2F65 A;  4N7T A;  3P5T L;  4FF3 A;  1TMJ A;  5HMW A;  4C48 A;  3KLG A;  1LV5 A;  1NLK L;  4MAK A;  5ADZ A;  5DRK A;  4OI1 A;  3G6V A;  1HD1 A;  2HKE A;  2JVR A;  4JOU A;  4B3M F;  5CQG A;  2V6A A;  1HBU A;  2ASD A;  3BPD A;  2FC9 A;  2HHH F;  3FJ2 A;  3H42 A;  4CO2 A;  2BYC A;  2HFV A;  5I3Q A;  3K58 A;  3CWJ A;  2XCA A;  2F5G A;  3OFG A;  4ZJQ A;  4BC7 A;  1S49 A;  2HND A;  5ETT A;  2DT9 A;  2QYG A;  4AE5 A;  4P2X A;  1EX8 A;  2W9C A;  1HA1 A;  2VV5 A;  5LXR A;  4DV3 J;  1WOO A;  2W8L A;  4OX8 A;  3HHL B;  2NXU A;  1LW0 B;  1Y0H A;  4PWD B;  4DV0 J;  4USM A;  1SL0 A;  3PHT A;  3DOM A;  3TOQ A;  4Y00 A;  1IR0 A;  2ZH5 A;  4B02 A;  3FVY A;  4O44 A;  2LA4 A;  3GJT B;  3VZH A;  3HD1 A;  4LRE A;  3PX0 A;  2NUH A;  1X4B A;  1L3T A;  2DPI A;  1MRO A;  4ZVH A;  1ZBT A;  4ED8 A;  4X4N A;  3D6F B;  5AJ3 J;  3S01 A;  3KKF A;  2DH9 A;  3A8E A;  4O3Q A;  2R7R A;  3AQP A;  3CC4 S;  3R5D A;  2V2V A;  3KFW X;  4NLO A;  3QSI A;  4KH0 B;  2RT3 A;  2YX1 A;  1FTC A;  5AXM A;  4LBI A;  2MQN A;  4BLG A;  1HMV A;  1JLA B;  2NSB A;  5B0A A;  5B7W A;  2FLO A;  2ZE2 A;  2A0F B;  2P6T A;  4U95 A;  1URN A;  2IVM A;  2RDD A;  2YQ0 A;  1NJX A;  2AWZ A;  3FQK A;  4AT1 B;  4GRS A;  2QFI A;  3QMQ A;  4O3O A;  4YOE A;  3AH6 A;  3IG1 B;  3UN5 A;  3AA9 A;  2HBQ B;  1YGY A;  2G0I A;  1RAA B;  1VRU A;  4JI5 J;  4QU6 A;  3LPE A;  4WXO A;  4K4Y A;  4NXN J;  1HHQ A;  5CD4 A;  2MQ8 A;  1Q86 T;  1AXQ A;  2ZBQ A;  1RWU A;  2RQK A;  5FDL B;  2YNG B;  1VQ8 S;  3L9Z A;  4M1K A;  2YVS A;  3PIP Q;  2ASY A;  4R5P A;  5HBM A;  3UVJ B;  2NXJ A;  4A8X A;  4FS2 A;  4OHY A;  4EO8 A;  2QA1 A;  1HR0 F;  4RU9 A;  1U0S A;  2W25 A;  2I1R A;  3PX4 A;  4OJ3 A;  2CPZ A;  3FK4 A;  1RAF B;  3W9H A;  2IIH A;  2V5H G;  4K0K J;  1EAR A;  3TVK A;  4LR8 A;  2KXH A;  2DEJ A;  3GE9 A;  2A1B A;  2R2S A;  5JUM A;  1EQM A;  4ZHR B;  4IRK A;  2V8P A;  3CCS S;  5HQM A;  4RBV A;  4OYO A;  4LF9 J;  1LWF B;  4O3P A;  3PCO B;  2DNO A;  3LAM A;  4DZ6 A;  3GJQ B;  2FDN A;  3KUG A;  1WAC A;  3A8K A;  2VBX A;  4L3N A;  3MEC B;  3KK3 B;  3GFZ A;  1FRM A;  2ZEJ A;  1NME B;  4JI6 F;  3R8Y A;  4CM0 A;  3I6P A;  2GFF A;  1UW4 A;  1ARO P;  2V4J A;  3DRY A;  5BYR A;  4JYA F;  2ROE A;  9RUB A;  2XSF A;  4J9P A;  4J90 A;  5EX3 A;  3T5K A;  1K0V A;  1Y3J A;  3R7N B;  1W26 A;  1S79 A;  4I56 A;  2XTJ P;  2BJ9 A;  4ZMM A;  1GT8 A;  1YJN S;  2C2D A;  3PO4 A;  1SJ4 P;  2JLF A;  2PGC A;  3M2R A;  2RML A;  2YKN A;  3JXO A;  3EZO A;  1KQG B;  3DRR B;  2CRL A;  1PAE X;  3C5X C;  2B5J A;  3Q8R B;  4I67 A;  2DNR A;  3MOJ B;  4LVO P;  1N0V C;  1DY3 A;  4DV7 J;  2PC6 A;  1O5J A;  1PBU A;  1S97 A;  1HKA A;  5E0O A;  3NOG A;  2UVR A;  4AL6 A;  1BMQ B;  4MFB B;  6FD1 A;  4OYP A;  1LKZ A;  2ZH2 A;  3W63 A;  2VPZ B;  4ZP8 A;  3C16 B;  2CPX A;  2HHU A;  1GAO A;  5I3U A;  3KHR A;  3S7R A;  1MSW D;  2IC3 B;  1YBU A;  1YG0 A;  4F4Y A;  2R4F A;  2DNY A;  1GTH A;  2XGP A;  4ZPA A;  3QFW A;  3R7B B;  4B9S A;  4PXB A;  3CD6 S;  1LK5 A;  4QJV A;  3WIV A;  1UZD A;  3KK2 A;  1H6K X;  2CQC A;  2MKY A;  3AJ2 A;  4W4M A;  4KJI A;  4RZR A;  1REG X;  3ZZU A;  2HEK A;  3CDU A;  1JMT A;  2CAD A;  4BWM A;  4ES3 A;  2PMH A;  5F8I A;  1HWI A;  3I9V 9;  2RUS A;  2FZC B;  1UKU A;  2A2C A;  1UA0 A;  1UPM B;  4N41 A;  1T9X A;  1UWA A;  3I4P A;  3A13 A;  5C24 A;  2PO4 A;  4KBI A;  3D0G E;  3FCW A;  2RDJ A;  2GJF A;  1UVI A;  4DV1 F;  3RW7 A;  4M8L A;  2C3O A;  2QFJ A;  1OIA A;  3BSO A;  2QZ8 A;  2PDA A;  5J2P A;  2GNK A;  3W5X A;  3M8P B;  1UAW A;  3NGT A;  2ZOM A;  3QRP A;  1S7H A;  2MHN A;  1R3N A;  2YXL A;  4JUZ A;  4C3M A;  5E3R A;  4LFC F;  2Z0G A;  5B0C A;  2M9K A;  1O6X A;  4JP8 A;  4C3K A;  1NK9 A;  3FMW A;  1RWN B;  5GAG U;  2IMO A;  2F40 A;  4A8Y A;  1HIY A;  2NR0 A;  2RAQ A;  4NA3 A;  2EFG A;  4UOF A;  1GMW D;  2A18 A;  1MWZ A;  4OV1 A;  2ZH9 A;  1U25 A;  3EDR B;  3DKD A;  2ZNY A;  1YRT A;  3D3B J;  3NCQ A;  3RU0 A;  1QAI A;  3VAF A;  1L3V A;  3HSZ A;  4ATN A;  2GVZ B;  1QTM A;  4X4U A;  4YEA A;  1UFK A;  4C8M A;  1RB0 A;  4GKJ J;  1C0U B;  1XR5 A;  3VAJ A;  1DTQ A;  3KMQ A;  3ZC4 A;  4EGL A;  1VHF A;  3UW1 A;  3NWG A;  4WE1 B;  3H59 A;  4A8W A;  4USJ C;  2XZW A;  3W9I A;  2B9Y A;  1RT1 A;  1YKW A;  4CQ1 A;  3OQ2 A;  2C2E A;  3CED A;  1HNZ F;  1RQ0 A;  5B0E A;  2RD5 C;  1EJ7 L;  3MMC A;  2FHM A;  3QRQ A;  2LLZ A;  1R8A A;  2ILZ A;  2WON B;  4IOA Q;  4MMO A;  4PAB A;  3UR3 C;  1TKT A;  3BGU A;  1GX6 A;  1FK9 B;  3CCL S;  3PV8 A;  3ILI A;  4X4V A;  4IR1 A;  3TUP A;  1ITP A;  1FJC A;  4ZCM A;  3KLH A;  3F44 A;  4FYY B;  1LWC A;  2MQO A;  2XY5 A;  3Q0A A;  1HW8 A;  4PG8 A;  3FBC A;  2UUC F;  3TAM B;  2G0C A;  2N7C A;  1YTY A;  2NUU G;  2E5L J;  4RO0 A;  3FDS A;  2KL8 A;  4PWW A;  4OYX A;  3P45 B;  4Z7Y A;  1IKY B;  1JXE A;  1PCA A;  1RTD B;  5E3Q A;  5FLX Y;  3V6D B;  3MMB B;  2VJV A;  4GO7 X;  5E41 A;  2B6A A;  4ICL A;  2FGO A;  2DO4 A;  2C2Z B;  1S0N A;  1IKX A;  1HQE A;  2R2T A;  1KLN A;  1ZA1 B;  3M30 A;  4OZL A;  5CXT A;  1YSJ A;  1TK8 A;  1F3F A;  5E3A A;  3VVU A;  1HQU A;  3NCR A;  5KFX A;  2HWI A;  3N01 A;  4IFY B;  1CC7 A;  4ZVU B;  2DIV A;  4ECR A;  1YJT A;  3DGP B;  1HWK A;  4DCJ B;  1R43 A;  3HFZ B;  3MXH P;  4USI A;  1I3O B;  2XQC A;  4M5J A;  2ACM A;  1QVF R;  3MCM A;  4I6Y A;  4DPU A;  2VG6 B;  3RB6 A;  3DNC A;  3GFY A;  2NYI A;  2DR7 A;  4ID8 A;  4RNF A;  1CQM A;  3KUE A;  3TEH B;  5ETR A;  4DN0 A;  4NPO A;  2CPF A;  3M32 B;  4JI7 F;  2UUT A;  2R7S A;  2IJN A;  3JQJ A;  3TR5 A;  1CJV A;  4JI3 F;  4GVL A;  2QSF A;  2ZDP A;  1U8W A;  3DRP B;  4WWS A;  3K59 A;  4DL7 A;  2ERR A;  4RWX A;  2DGO A;  2IM0 A;  2B7B B;  1W2I A;  2KDO A;  1HBM B;  2E9T A;  4JV0 A;  1XMQ F;  3OFH A;  3ITH B;  3Q2T C;  1T9T A;  4NOH A;  2BE7 D;  3PNI A;  2CAJ A;  2Y1I A;  2VQE F;  4IG0 B;  2BXJ A;  3C15 A;  3U1N A;  1VRT A;  2MLY A;  5J2Q A;  1H0H B;  2DXE A;  2P6S A;  4DF4 A;  1SH2 A;  4DF8 A;  3R5B A;  3ZZT A;  3BR8 A;  1RTI B;  2MKK A;  2W7O A;  4DOZ A;  2MSS A;  4OYA A;  3DLE A;  3PKY A;  2CWX A;  2VG5 B;  1H98 A;  2ZFH A;  2UXD J;  4DV4 J;  4W90 B;  1U6F A;  4PG6 A;  1VBK A;  2VZ9 A;  1FJG J;  3NMR A;  1QLN A;  1RWV B;  3IWX A;  2RS2 A;  3SQG A;  2AYM A;  3TO8 A;  1D3W A;  3MEG B;  3EXC X;  3RAX A;  3I0S A;  4LRA A;  1Q5V A;  4ELT A;  4RUB A;  4KRW A;  4PXE A;  4CH0 S;  3DI6 A;  5M2R A;  4YN3 B;  1JLE A;  3UDE A;  3CDE A;  3OHB A;  1RT6 B;  3AY0 A;  3M9O B;  4P75 A;  4O3S A;  3J81 Y;  2KXF A;  4K2J A;  1IKV B;  3W66 A;  4UY8 5;  1VQN S;  1YLX A;  1WUU A;  1G6B A;  1IBM J;  2AJ0 A;  4DQI A;  3R3T A;  3SCI E;  2EFN A;  1KOH A;  4QR2 A;  3MUV P;  1EAY C;  3HVT A;  4YB7 A;  3D6H B;  4QW9 A;  5AE3 A;  1CJU A;  3BQ2 A;  3T1Y J;  3SV4 A;  2K1R A;  3PO5 A;  4JV2 A;  4Y0F A;  3NGR A;  3I31 A;  5HJY A;  4X4P A;  2JVM A;  4YR0 A;  4USW A;  4DV5 J;  1D8Z A;  2QLJ B;  2R3V A;  3DMJ B;  2B9E A;  3PXG a;  2HHQ A;  1RTH A;  2ZOG A;  1GK8 A;  1RAB B;  3UI3 A;  1WKJ A;  4I2P B;  5IXU A;  4DUT A;  3CW2 C;  2UUA J;  2YWG A;  3CUN A;  1REV A;  2HWH A;  2F1F A;  2JX2 A;  2ZKT A;  2YKO A;  3JYT A;  4BBY A;  4QBU A;  4QIW D;  2XB2 D;  5AXN A;  1IN0 A;  1QE1 A;  5KT4 A;  4ZKA A;  1XNR J;  2WHO A;  2CG8 A;  3CJQ A;  2D3U A;  3ZZ0 A;  3ENA A;  5A0Y B;  4LSL A;  3M05 A;  1KS2 A;  2CPY A;  4GVB B;  1S1X A;  1FD2 A;  1FEE A;  4K7Q A;  2WSC C;  2YQ3 A;  2DNP A;  2FLL A;  3FFI B;  3U1L A;  3ETO A;  2FJV A;  1T7P A;  3TAN A;  4JV5 F;  4B3S J;  1U1Q A;  2DD8 S;  2MPU A;  1X5O A;  1NCL A;  2J7U A;  3NWR A;  2CNN B;  2PA8 D;  2JWN A;  2VAS A;  4P2M A;  5HO4 A;  4Z7C A;  3OL7 A;  4YME A;  2CXE A;  3F73 A;  3POT B;  3BYR A;  1P9Q C;  3EMT A;  2CG4 A;  3MMA B;  1XBW A;  2R7O A;  5BR8 F;  4DLE A;  3TUJ C;  1U0H B;  2OLW A;  5D0E A;  2I8E A;  2LXU A;  4I4B A;  3C14 B;  2DRA A;  3OJS A;  2L3M A;  4LF4 F;  4HAC B;  3QGH A;  1TL1 A;  3DOK B;  2KO1 A;  1IBL J;  2X3D A;  1U1M A;  5D0G A;  3DU5 A;  1QSY A;  4NLX A;  3E2E A;  3OSP A;  4QW8 A;  1DZ5 A;  2XNR A;  4C0B A;  2EG2 A;  4LF5 F;  1LW0 A;  1BGX T;  4X65 J;  3ZZP A;  4C0H A;  3J7Z 5;  4LSZ B;  4XPC A;  5JXS A;  3Q83 A;  5KFN A;  3IBW A;  2HQ3 A;  3H20 A;  3S8S A;  2MDA A;  2RJZ A;  5GMK a;  2MST A;  3CCM S;  1EP4 B;  3QNW B;  4JB8 B;  2RHS B;  4CLF A;  4H4K C;  2F8E X;  1SL1 A;  4ZPW R;  4DR7 F;  1IR1 A;  1KVK A;  3I56 S;  1OWX A;  1AT1 B;  6FDR A;  2EC2 A;  2J9C A;  1XMO J;  3C46 A;  1C1B B;  1WC1 A;  3GMG A;  1Q8B A;  2P9G A;  4CLU A;  1JLF B;  1R89 A;  1QUV A;  3M8Q A;  2ZH7 A;  1GXT A;  1JLA A;  4TLR A;  1AFJ A;  3GII A;  3PIO Q;  2AQ4 A;  1RLC L;  2LXF A;  2B4V A;  1X31 C;  2LCW A;  4FYX B;  3ILL A;  2WB1 D;  1S1T B;  4WYW A;  2OML A;  2HBY B;  1E6Y B;  2WSE C;  3T1H J;  1RE1 B;  3RRH A;  3CJ0 A;  2Y8Y A;  5ETV A;  2MZS A;  1YVF A;  1IQT A;  1DLO B;  5IT9 Y;  3RB4 A;  1S6O A;  3PAC A;  2E9Z A;  2H4Y B;  1UVL A;  2YX7 A;  4AUK A;  2KYX A;  3KTQ A;  4PYD A;  4A8Q A;  2E7X A;  2V2K A;  3UD4 P;  4LFB F;  2J6T A;  3IR7 B;  4OX9 F;  2J0X A;  2XMJ A;  4ZCK A;  4KKO B;  1SUQ B;  3BO2 A;  5FDL A;  3QZ8 A;  4MK7 A;  2GQ2 A;  2A6M A;  4ED0 A;  2WTF A;  3MDF A;  2BAN B;  1HD0 A;  3M6X A;  4YQW A;  2M8D B;  4X84 A;  1UA1 A;  2OGU A;  1HI1 A;  3WHI A;  2M0G B;  5DLG A;  3PEJ A;  3RR8 A;  3M9M B;  2QIF A;  2I5J B;  5LT5 A;  5ETM A;  2ZJQ Q;  3ET6 B;  1XR6 A;  3H4B A;  4DR2 J;  3V6K A;  2RHQ B;  2BQ3 A;  2VC1 A;  2F8M A;  1MMN A;  4ZHR A;  4Y2A A;  4LF7 F;  3D28 A;  4RW9 B;  2AKW B;  3W64 A;  5FLX U;  4OIX A;  4NLQ A;  2LXI A;  1PYO B;  3JQM A;  1UVN A;  3VGS A;  4HYK A;  2Z8Q A;  2V50 A;  4RUA A;  2ATL A;  2P5V A;  3CJT A;  3MEC A;  3KK3 A;  3K5N A;  1MW7 A;  4Y2M A;  1J5O B;  4NZ0 A;  5IQ6 A;  1NSQ A;  3PX6 A;  1W2B R;  1ZM9 A;  4U6P A;  2E29 A;  2W4P A;  1S6U A;  2U2F A;  1SC1 B;  1VOM A;  2FHK A;  1WHV A;  1X9M A;  5D0R A;  3HFV A;  1TL5 A;  4RKU C;  4JI0 F;  5BXI A;  4ZP7 A;  2E5I A;  1XNQ F;  5HP1 B;  3AT1 B;  2E1M C;  4JI4 J;  3IS9 B;  2CQ1 A;  3DRS B;  5KFT A;  3U7J A;  3H2L A;  3OL6 A;  3Q8P B;  3DHX A;  1JJC B;  3FBF A;  2L9D A;  4DV3 F;  1U02 A;  4U9R A;  4NLP A;  3ZZZ A;  2R8I A;  1AB8 A;  3BJY A;  2OSQ A;  3V81 B;  3DOL B;  1QSL A;  4K5S A;  2GMJ A;  1FKO B;  2JSX A;  1K73 T;  1P8G A;  3R27 A;  4MFB A;  1J5E J;  3RRG A;  1O8B A;  3RZA A;  5KG5 A;  2HZV A;  2Y0B B;  3C16 A;  3K5M A;  2IJF A;  1VI7 A;  4ECS A;  2KRR A;  1Y7P A;  2IC3 A;  4FBU A;  2CFX A;  3HVA A;  5L8R C;  1V5V A;  3MM7 B;  3SQO P;  3Q8Q B;  1Q7L B;  3ZZY A;  1N5V A;  3CF5 Q;  1WC6 A;  1RHQ B;  2DTJ A;  3U1M A;  3L7P A;  3FCH A;  4C98 A;  4ZVG A;  2V8V A;  1R0C B;  3PJX A;  1D9F A;  5C2C A;  1MWQ A;  4KGZ B;  3FCV A;  1NHU A;  1PO6 A;  3M6W A;  2LVW A;  2BJ3 A;  2NPI A;  3AGX A;  4P73 A;  4DMZ A;  4TU9 A;  4QWC A;  1Y3K A;  2G4B A;  2HHH J;  5T7L B;  3MED B;  4EBC A;  2FHJ A;  3TJ8 A;  5D77 A;  4MKB A;  5DM6 Q;  1T02 A;  1GFW B;  3HKZ D;  1JXL A;  1EKS A;  3EIC A;  3MFH A;  2UVV A;  1WDT A;  4NXN F;  3TJA A;  2QRR A;  2WVE A;  4ZJL A;  1D1U A;  2XC9 A;  3M8P A;  4NCB A;  2ZVI A;  2QE5 A;  1F9F A;  5KFU A;  2BQU A;  2IRX A;  5EWF A;  1FRI A;  1NJI T;  5KT5 A;  3GIK A;  1RT7 B;  2BEF A;  4I64 A;  2HYI B;  4WK3 A;  4FXD A;  3ENV A;  4ILL A;  4B3O B;  5KFW A;  2C2N A;  3MM5 B;  3FQL A;  2G1H A;  1HBO B;  4ZP6 A;  4ITS A;  4WP8 A;  1F5C A;  2B56 A;  1IBC B;  2GVZ A;  2ZJP Q;  2DYA A;  4TKT A;  4P6Q A;  2ZD1 B;  2BA9 A;  3AHP A;  3FEX B;  4WU2 A;  4K4T A;  5A76 A;  1N56 A;  5CYJ A;  1YBA A;  4A47 A;  3RAQ A;  3EE3 A;  2N82 B;  3MEE B;  4WE1 A;  5I3P A;  2B9W A;  2DCL A;  1FNM A;  1S5Z A;  1C1C B;  1NEE A;  4H54 A;  2QMX A;  2CQ0 A;  2IVY A;  1YJ7 A;  2BR0 A;  2DIT A;  3I96 A;  3P49 B;  1KON A;  2MKC A;  3N28 A;  1JLG B;  1WG5 A;  4L3K A;  2J76 E;  2WON A;  4N47 A;  2EFO A;  2HQI A;  2XSJ A;  4KC5 A;  4F0H A;  1FK9 A;  3BRE A;  1U2C A;  1SC4 B;  1NB2 A;  4IO1 A;  1FA0 A;  3UCU P;  2I0X A;  3H5X A;  2H65 B;  3TAM A;  3N6N A;  2P9E A;  2V4Q A;  1JNR B;  4J9M A;  1RTD A;  3V6D A;  3MMB A;  4U7U K;  2RQ4 A;  4MIA A;  4X4Q A;  5E3C A;  1YJU A;  1BWE A;  1VBX A;  3PW2 A;  3BO4 A;  5HMZ A;  4K59 A;  1X9S A;  2LDY A;  3DHW C;  4UOH A;  1OJ4 A;  1W7W A;  2OP5 A;  2RIJ A;  5KG3 A;  3CIZ A;  4NWB A;  5LSR A;  4IFY A;  4CLZ A;  4JI6 J;  3ZTS A;  1SC6 A;  3DGP A;  4NRT A;  4FS1 A;  1ZM2 A;  4JYA J;  3IR6 B;  2FHO B;  4DL4 A;  1K8A T;  2BKO A;  3SCL E;  2HFS A;  4HHJ A;  1FEH A;  4DDF A;  2POK A;  2MXY A;  4QR1 A;  3D2W A;  1NHV A;  1RZM A;  4WF9 Q;  3M6V A;  5ITH A;  2LEB A;  3FBE A;  3MR3 A;  3M32 A;  1UFW A;  3DFE A;  2W8K A;  1BD6 A;  3LOU A;  2W2Q P;  2J0Q D;  3RB0 A;  3DRP A;  1ZM4 A;  1KN6 A;  3UCZ P;  2GAG C;  3DLH A;  5KFV A;  2RVJ A;  4JI2 F;  5A2Q Y;  1T9Y A;  2V0N A;  1HPZ B;  3VAI A;  4DSF A;  3MPU B;  3PYF A;  2RF2 B;  1X4H A;  1RAI B;  2XMK A;  2ZH4 A;  3QSY B;  2B8P A;  1B7F A;  1VBZ A;  2APO A;  1MN7 A;  1O51 A;  2DGS A;  2F4F A;  2DCU B;  1RTI A;  3DDI A;  3T3F A;  3K89 A;  2MZQ A;  2V68 A;  1G1X A;  3FBB A;  1NJZ A;  2VG5 A;  2AX0 A;  3CSK A;  1I94 F;  4TY9 A;  4CNZ A;  3AGY A;  1M5P C;  2HFU A;  3J7Y I;  5IT9 U;  1HLW A;  4X64 F;  3HI9 A;  1M1G A;  2UP1 A;  4GKJ F;  2BUN A;  2FJW A;  2AGP A;  2FUG 9;  4DV6 J;  3MEG A;  3GV8 B;  3FEZ A;  3DDN A;  2R2R A;  1U1O A;  1TFW A;  4EMD A;  3ZO7 A;  4U67 Q;  4ZVE A;  1RAD B;  1R0B G;  2E9R X;  1RT6 A;  2KYZ A;  5EWG A;  3HSG A;  2VJU A;  1M5O C;  3E8O A;  5E3P A;  2CIM A;  2V8D A;  1IKV A;  3KLI B;  3LW5 C;  3M2V B;  2V94 A;  3GJR B;  4DV1 J;  2XNQ A;  1DJ0 A;  4F4A A;  2C3Y A;  3WC2 A;  2C42 A;  3VGU A;  3BO3 A;  4ZIT A;  1RWP B;  4MK9 A;  1M1H A;  4K50 A;  1QDU B;  3W62 A;  5J1E A;  2R7U A;  1JX4 A;  4TNO A;  2BZ2 A;  4RUH A;  5L39 A;  2YNF B;  4ANE A;  4FPI A;  2IM2 A;  1SKS A;  4B3T J;  3GG0 A;  4Q8E A;  2AJ1 A;  3DMJ A;  1VJW A;  5DO2 A;  1RHU B;  3HT0 A;  1NJW A;  4I2P A;  3GWC A;  2XZT B;  4PQA A;  1ELO A;  2OEM A;  3GSD A;  4DR4 F;  2RUG A;  3KDN A;  5AXK A;  1XEZ A;  4RPF A;  3PDN A;  4WKY A;  2ZHO A;  1N8R T;  4AL5 A;  4WJB A;  5D4L A;  3W5Z A;  2MLZ A;  3IAM 9;  1XR7 A;  3PTW A;  2W2N P;  5LM7 E;  3NKY A;  4B9U A;  4IH5 A;  2R7Q A;  1KEK A;  3VGT A;  2KVI A;  1X4F A;  4ZN3 A;  2JFK A;  3J7A N;  1APS A;  4R8U B;  1TKZ A;  5A0Y A;  3D5M A;  1HNZ J;  3NRB A;  1PC4 A;  3O6Q A;  2GC8 A;  4A48 A;  4KPC A;  2PI5 A;  4DL3 A;  2IM1 A;  2V8H A;  3BGR B;  4UQG A;  2XS2 A;  2GMH A;  3FFI A;  2IFX A;  1RI7 A;  5DGB A;  4NCG B;  3NL0 A;  2B9X A;  4DPO A;  2DR6 A;  1BE4 A;  4H4M A;  4OZ1 A;  1UEU A;  3T6B A;  1XAO A;  1RT4 A;  2QSW A;  5GAH I;  5J2N B;  1I51 B;  3HPO A;  2XYP B;  3MMA A;  5K9F A;  1U0H A;  2VG7 B;  2AF6 A;  4K4X A;  3KHG A;  4G1P A;  4EYI B;  4ED4 A;  2HMI A;  1FFW B;  1KDN A;  4FF2 A;  3C14 A;  3OR1 B;  4ZVR B;  4RUC A;  3R9L A;  3EVW A;  1YWX A;  2KJV A;  3FRZ A;  1JJ4 A;  4AND A;  4HAC A;  5GMD A;  2RE1 A;  1NM2 A;  3D67 A;  3R1H A;  2AEF A;  3QIP A;  1Y5I B;  3DOK A;  4GC6 A;  1YBT A;  4NEY A;  1S6P B;  2C3U A;  1QY7 A;  1H3D A;  2YNH B;  1E6V B;  2XHW A;  4WZM A;  4DS5 A;  3IA0 A;  2MYF A;  4J5O A;  1FJG F;  1S1V B;  3NGK A;  5G0R B;  2J6S A;  4DR6 J;  2HIQ A;  3HCX A;  3ZZO A;  3TAP A;  3PW5 A;  4M5M A;  2UXB F;  2HZC A;  2M7S A;  1HHS A;  4WIQ A;  4AD6 A;  1SV5 B;  2VB6 A;  4QWA A;  4HHU A;  4EBD A;  1EP4 A;  3BYP A;  1J27 A;  3GP9 A;  2HK2 A;  1PC5 A;  5FD1 A;  4JI7 J;  4M94 A;  2BAC A;  2N3L A;  3NAI A;  2ADB A;  2KTQ A;  4UOC A;  2MY7 A;  2E44 A;  1T0T V;  5L1J A;  1IBM F;  1C1B A;  3CGI A;  2V69 A;  2KN4 A;  4TU7 A;  4DG1 A;  5D78 A;  2JNJ A;  1CBK A;  4QIG A;  1RYR A;  2NSC A;  1OYE A;  2HVZ A;  2VL1 A;  2MQP A;  4CO0 A;  3CCV S;  4V19 J;  1TUW A;  1C2P A;  1NZA A;  1S1T A;  2HFO A;  3I5C A;  2VQE J;  5KFY A;  4YDX A;  2IA6 A;  1SL2 A;  3M9N B;  2J0S D;  4NMX A;  3QGP A;  1VQS A;  1ACM B;  4X2B A;  4LSN B;  4ZPV R;  1DLO A;  3MD1 A;  5ETO A;  1U1R A;  3LP0 B;  4QIV A;  1N6Q B;  1EZZ B;  1GX5 A;  1VK3 A;  4J37 A;  2MB0 B;  1EB0 A;  4OL8 A;  1RU1 A;  2DH7 A;  3PW7 A;  4IRC A;  4QYZ J;  5EDW A;  5F8G A;  4WTY A;  2OPP B;  3DM2 A;  1RHJ B;  2BAB A;  2EFQ A;  1SUQ A;  2DNN A;  4IH6 A;  4ZP9 A;  2P2C B;  4WFX A;  3QQC D;  3EZU A;  1X0P A;  2DIS A;  1LNQ A; 
#chains in the Genus database with same CATH homology
 3TJ9 A;  1C3G A;  3AGZ A;  1NLT A;  3NXZ A;  2QLD A;  3NY0 A;  2HFV A;  3AGY A;  4J80 A;  3TJ8 A;  3LA0 A;  1GMV A;  3L9Z A;  1XAO A;  1GMU A;  3LZ8 A;  2B26 A;  4L3K A;  3AGX A;  2Q2G A;  3I38 A;  1EB0 A;  1EAR A;  1GMW A;  3TJA A;  1GMW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...