3TJ8A

Crystal structure of helicobacter pylori uree bound to ni2+
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
total genus 42
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tj8A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tj8A02
3AGYA 3L9ZA 3NY0A 3AGZA 1C3GA 3AGXA 1XAOA 2HFVA 4J80A 1EB0A 3NXZA 3LA0A 1GMUA 4L3KA 1GMWD 2QLDA 1GMVA 1NLTA 3I38A 2B26A 1EARA 2Q2GA 3TJ8A 3TJAA 3LZ8A 1GMWA 3TJ9A
chains in the Genus database with same CATH superfamily
4NYZA 3ZZTA 2W8LA 4A8KA 4ECVA 4O3SA 2K8GA 1DTQA 3J80U 4P73A 2BBEA 4OX9J 3C8YA 3LF0A 4DFKA 3JTPA 2OMOA 2YNFA 2D3O1 3QATA 1M1KT 1S1WA 4DPWA 3KHLA 2R7QA 1S0MA 4C8MA 2W01A 4K8RA 1U09A 4K0KF 4USUA 2HFNA 4L76A 3FC9A 4DU7A 4DR2J 1HNVA 3CD0A 4OI2A 4CDIA 3VALA 1D9DA 2VBXA 4IFVB 2IC3B 4KFBB 1PGZA 4RJVA 2CJQA 1Q8KA 3LP1B 3NWGA 2QA4G 2ODXA 4PXCA 1NDCA 2ZFHA 3SSQA 1RT5A 2K3KA 1HD0A 3P45B 1N0VC 3THPA 5F8MA 3OLAA 2HK2A 1O5JA 1XNRJ 3NNCA 1CBKA 3ZZ0A 4CT8A 3V5RA 3HKWA 3W64A 4TU9A 4DL2A 1H0HB 2ZVIA 2Z2YB 5KFKA 2HPUA 4DUYJ 3W60A 4ID5A 4XK8C 1DAXA 4B08A 1HR0J 3GIIA 4PYDA 2PA8D 1NSQA 2L9WA 2P9CA 2RNEA 4Y2CA 3MMBA 4AT1B 2XM3A 4RO0A 4AQYF 2C2RA 4USWA 2V5HG 4UY8T 4K2XA 2LDIA 1SJ3P 1FVSA 1GK8A 3TA2A 5D3GB 4B3RJ 2B0GA 1UMJA 2XGQA 1I1GA 2F4VJ 4IYQA 4AE5A 1OYEA 5HO4A 4LJMA 5JMNA 1S0OA 5D0RA 3V6DA 5EWGA 2DB1A 4P7VA 1WG5A 3EGZA 2YKAA 3MMCB 1NK9A 4A4JA 1UTAA 3CC2S 3T1YF 3D54A 1RWOB 1G1XA 2PA3A 4P10A 3LUYA 4CNYA 2HQGA 2WVDA 4ITSA 1PG5B 1TUVA 2GIQA 2ZM6F 4A8XA 3MDFA 5C25B 1U24A 5HBMB 1NKCA 4NLSA 1P1LA 3CXCR 1NAQA 4RWXA 3AKOB 1VQYA 3C16A 2UUAF 3QO9A 2BVZA 4IQXA 4NLDA 2ZM6J 2YNHA 4BWMA 5HN0A 2BANB 1JJ2R 4ZVHA 3W5ZA 2B4VA 1NLTA 1REVA 1C1CB 1FA0A 3M8QB 3BGUA 5ETMA 2YNGA 1EKSA 2BKOA 2C42A 2VL1A 2QC3A 3AOBA 2ZOMA 2B43A 4J7CA 1G4CA 3IMQJ 3MCMA 4RW8B 1IKWB 1YJWS 1NO8A 2QSFA 2GNKA 2DNNA 4DOZA 2RUSA 1KSPA 3NL0A 1JLBA 1VMBA 2A10A 1ZM2A 3O6QA 4I68A 5AE2A 5CYJA 2DR8A 2HBRB 2POKA 5KFLA 3MCOA 2XMTA 5KFSA 4PR6A 1G3OA 3CC7S 4QPTA 3JQJA 1NJXA 2XCPA 5I42B 1VDHA 3NS5A 1VQKS 3I5AA 4CLUA 1YGYA 1P6TA 1Y7PA 4ETXA 2KT5A 2CPJA 4O23A 3BREA 2DY9A 3NXZA 3WDOA 3PIPQ 1U0HB 1UW9A 4KHMA 2VG6A 5C2CA 4ZCKA 5L9NA 5KT4A 2W4DA 1R6VA 4WXWA 2A6MA 3ET6A 2B26A 1BQMA 4ZLNA 4ILRA 4KE5A 4XTTA 5HMXA 3J7YU 3MMAA 5SUHA 1MSWD 1NBEB 4ELTA 4LF8F 2YKQA 1S99A 4DSIA 4Y3CA 2A3JA 2QLWA 4RW4A 2W7PA 3DOLA 3M6WA 3OUYA 2DRAA 3JSYA 2YWFA 2J0WA 3TOQA 4C9DA 3OFHA 2ZJRQ 3OVAA 5B0EA 1FWKA 2QG9B 3AOCA 3DYAA 5IS2A 4K0KJ 5HJYA 1JXEA 2AJ2A 2FLPA 4XAKA 2ZHOA 3H25A 4UY85 2HVZA 1XR7A 4DV6F 2D3OR 3VTIA 3IAM9 2DY1A 4Q45A 3H4DA 4OYPA 4CZCA 2BJ1A 2LU1A 4I2PA 3W2VA 3KHHA 5D4NA 1ZZNA 1ZETA 3Q24A 2J8SA 4ERDA 4WU3A 1WKJA 4ZPCA 3BQ1A 2HURA 1HI8A 3GE9A 2EFNA 2V8GA 2VC0A 3VQSA 4QCLA 2CJAA 2N3LA 3TEHB 4C2MA 4X4SA 2XCAA 1VGYA 3A13A 3FFIA 1RT5B 2MZJA 2GAHC 2VQFJ 5J2NB 2HVDA 2RVJA 1NDPA 2BJEA 1IJEB 4OZJA 3OV7A 1JLEB 4NEYA 3UPFA 2IM0A 1AROP 1BD6A 3SFGA 4YS2A 4X65J 2ZH5A 2YX1A 1JK9B 4K5SA 4DV0J 4V19J 1KLNA 2DHHA 1OQ3A 3M30B 2ZZMA 1JJHA 1N33J 2HGNA 1REVB 5AJ3F 1S97A 4PWDB 1KWMA 2CJ9A 3GYXB 5ADZA 3EM1A 3FEZA 3L7OA 3PTWA 3Q8RB 2B4UA 3TX0A 4JUZA 2RHSB 3WBZA 4A8YA 1L3SA 2FJXA 2XO6A 1EJ7L 1NM2A 5IFMA 2XC9A 2UUBF 5HROA 1AZSA 2PIIA 3BKTA 2P8IA 1J27A 2MYFA 2QMXA 4MH8A 2V63A 5C42B 4DCOB 2AYBA 2GZOA 1SQFA 4RW7A 1B3TA 4HT7A 2VJVA 5KG3A 2AYMA 2ZJQQ 2DT9A 5J1EA 2WZ1A 3X1LB 3UCUP 4ECSA 2HAFA 2HGMA 1QY7A 2DCLA 3HVWA 3QJLA 3FUYA 4N47A 3J7A1 4AL7A 1IKXB 2OMLA 5LJ5Y 4M5MA 4RX6A 3JSMB 3WHIA 1CQMA 3EMTA 4X66F 5DZ7A 2OP5A 1I6JA 4IR9A 4RBVA 3X3UA 3SCIE 3IRXA 3HVTA 4CLKA 3M8WA 3KK1B 2LXIA 2XYPB 3CCES 1W2IA 3BF4A 3BO4A 1UL3A 3EICA 4LFCJ 1TKTA 3MMAB 3TO8A 4A8MP 2C2ZB 3M8RA 2ZH4A 3M8SA 4TLRA 1T11A 2HZAA 3DLGA 4LREA 4NOHA 2XZTB 4JI8F 4OI6A 3TA0A 3UWTA 1CLFA 1NUEA 3SV4A 2Y0BB 1KQKA 4Y65A 1T02A 3MM7B 1UVNA 4KGKA 1F0XA 1RTIA 4GVLA 4U95A 4MJKA 1HBOB 3OXGA 1RXOB 2AGOA 4JI3F 4IDKA 3OVSA 3I5BA 1JNRB 4RPFA 4IO9Q 3BGRB 3HP6A 1R0AB 4PWDA 3IM9A 4PQUA 4ZP9A 4RBTA 1IVZA 2MSSA 2DBBA 1QDUB 2C2EA 5HSPA 3PFOA 4B3MF 1W26A 2ZE2B 1IKYA 3R7BB 4H4MA 2BW2A 3R1HA 1VFJA 3RW7A 1IBMF 4Q0BA 1FE0A 2PT0A 2Z0GA 4N77A 5J1PA 3SYZA 2I1RA 4WFZA 3FGVA 2E1PA 3CC4S 4EYIB 3PRBA 2DH8A 3QBCA 1RU2A 4X84A 3I56S 1TTHB 2W2PP 3A12A 4YQWA 5KFFA 3C5XC 3M7VA 2CNOB 2VPZB 2LYVA 3FFIB 3OPKA 5ETTA 3BGLA 2CPDA 4O4GA 2A1BA 1F9HA 2UV8G 2YVSA 1HNZJ 5BXIA 2NSBA 5M2RA 3GQCA 4F4ZA 3K17A 5IT9Y 4IG3A 2I6WA 2JVMA 3KWMA 1QAXA 1YQHA 1U48A 1OYDA 4U9RA 1S1XB 4CWBA 1I51B 3BJYA 1S4EA 3KG0A 4LQ9A 4TLQA 3LOUA 3TAPA 4B9VA 3HVTB 3UI3A 2KJWA 1J5OA 2K1RB 4R8UB 2E9RX 5KG5A 4WTOB 3Q8PB 3B6BA 3PW7A 1IN0A 4DX6A 3R97A 1NPRA 3GSIA 1N34J 3P8BB 2EG2A 1DBDA 3MM5A 3FCWA 2PE8A 3NY0A 4W92B 1FJGJ 1HWKA 2Z57B 1QTMA 4QIVA 2LKZA 1OS5A 2KU7A 2CPZA 3OQ2A 4WWSA 3K5LA 3PZPA 4CO4A 4BDPA 3GCXP 1KRPA 2OKQA 4KGMA 4YY3F 2OTLS 3PO4A 1YJTA 4W98A 2HS4A 2X1FA 2C2KB 1TQLA 4JI3J 1E6VB 2OLWA 2W7AA 4CTAB 2XS5A 3ISZA 5ETPA 4AYBD 2RT3A 1RADB 4F3MA 1FHTA 1S9GA 1WJ9A 4FVMA 4QR1A 2CDQA 3CT9A 5L1KA 3PVXA 1LWEB 1QUPA 5KFTA 2BE9B 3LP2B 4DFMA 2KVIA 3DLKA 3PEHA 4ZVTB 3VAFA 3FRYA 3BYPA 3PKMA 3W2WA 3QT8A 4WZMA 1U1MA 4TU8A 2J9EA 3VQTA 2O1PA 2R2UA 4DX5A 4FBUA 4USVA 1NJWA 3F56A 2HVHA 2KM8C 1XBWA 4LF1A 1URNA 5FD1A 3Q23A 2JJ4D 4PRFA 4M5HA 3TEGA 2E1CA 5C24B 3DLBA 1C3GA 1RE1B 2J9DA 1KFSA 1NJIT 2XS7A 1RCXB 4OHWA 4O3QA 2O67A 4OX6A 5F41A 2KO1A 1XTZA 1HI1A 2LXFA 1YHQS 1JLFB 2NZCA 1U8WA 4CRJA 1WOOA 3UE2A 1P1TA 3G2XA 3MM8A 3RR8A 2CWKA 1J5OB 2E9ZA 1TV6B 3SBMA 5LT5A 2Q2GA 1LWFA 1ELOA 1YITS 2GHPA 2MHEA 2MLZA 1S7IA 1TZ0A 1D1UA 3QGHA 2NYIA 4LIRA 3KJNB 5HP1A 1C0UB 4TU7A 2MLYA 1UFWA 2VU5A 2YY3A 3A8IA 4HI2A 1YRUA 3G87A 3R27A 4MK9A 4TY8B 4JI7F 4C8ZA 1TL7A 4ANCA 5HJXA 4DL5A 3PX0A 4H4KC 3CDBA 1BGXT 4YB1P 2OIHA 1HBMB 2VODA 3JS9A 1X4CA 4K4XA 3MM8B 4XDCA 3RAMA 2ZBQA 1FRIA 5IV3A 1FRKA 4DN9A 1CG2A 3A8JA 3JAMY 3J7Z5 2LLZA 2XWXA 2Y8WA 2V4RA 3M6VA 4URGA 3OSPA 3KLVA 1I94F 2ACYA 5CQGA 2XY6A 3PY8A 3S7RA 5KFEA 1U45A 2CJBA 3OFGA 3KK3B 2OELA 4M63A 4OJHA 4U7UK 3ZTOA 3IBFB 1H38A 1RT3A 2MTLA 1UVMA 2D3UA 3CNQP 3OR1B 3IR6B 3DRXA 3N4WA 5EX0A 5DG9A 4K4SA 4AXIA 2MKCA 3E2EA 2E1MC 3HXMA 2YWGA 3BGRA 1R0AA 4UQTA 2Z2LA 4GC6A 2L9DA 1NPPA 3R5JB 5DO2A 5EHHA 2ZKUA 1V3SA 3UO0A 4XPEA 5HLFB 1JJ4A 3HM9A 4CO0A 3M1VA 4EI2A 5I3QA 2XGPA 1YI2S 4K4UA 3QRPA 3AGZA 1O6XA 4MAKA 4CYUB 4FYVB 4ZP7A 2B6AB 3HZEA 1U49A 1QSSA 5SZTA 4WU2A 4Q44A 2GHVC 2VJUA 2W1BA 1AB8A 3LP1A 1YRXA 3HJFA 3HMJG 1U8SA 4AUKA 3M2RA 3T1YJ 4WYWA 1FI4A 2BE2B 4C11B 2JWNA 3FRZA 2IVFB 4DL3A 3ETMA 3UCGA 2OUGA 1RTZA 1WC4A 2GIRA 1HHSA 3DI6B 3KYLA 3H90A 3E51A 5KFBA 2B9EA 2ILZA 2J9DE 2LQ8A 2YQ1A 3HT0A 4NLYA 4ED4A 5DM7Q 2XBPA 2YNFB 1F60B 5AT1B 3ZFVA 5EN1A 2V4QA 4MTPA 2VHGA 2JHEA 2MKYA 3KUEA 2JEIA 4K4WA 2FGOA 2GW8A 2OEMA 3L9ZA 2P5VA 4F4XA 4O3RA 1RT1A 5F3TA 4RW7B 2OH2A 4DSFA 1RT4A 1RSCA 3GZ7A 1M0SA 3HHNB 5F3ZA 3I9ZA 3N0VA 5EGYA 1NHKL 1L3UA 2HIQA 3WC0A 4CLPA 3K5PA 3J81U 4DU8A 1FD2A 4ZPWR 4DX8H 3GU0A 4Y28C 3BSCA 5I3UB 4L72B 2JLFA 1FFWB 3P6YC 3WIUA 3MAAB 1RA6A 3SSRA 4AD6A 1WNEA 3G82B 3MHYA 4ID8A 1VQ5S 1GXUA 3KHGA 2XSJA 2ADCA 4LMZA 4LIWA 2A0FB 2D1CA 2UXCF 2CDRB 2GCFA 1QE1B 2VDIA 4IG0A 5CABA 2E29A 3TVKA 4KQZA 3KLHA 5G0RA 3PM9A 3GV8B 4M5KA 4IOAQ 2P6SA 2MB0B 4DS5A 4ZVGA 4O0NA 1YX2A 1SVDA 2RU9A 2YTCA 4I1TA 3UW1A 2ZH3A 2GV1A 4TXSA 5E2QA 1XMBA 2ZZTA 4ZLJA 3KLIB 4B9LA 1JLAA 2Z4PA 3LAKA 1UJ5A 2R2SA 4ED3A 1SB6A 5GAHI 4LF7J 1Y3JA 4OJGA 4KHPF 3CJ3A 2KFNA 1BHNA 1RBAA 3BN4A 4MIBA 2IYGA 4CLTA 4C0OC 4DPTA 3DU5A 5LMUJ 3LPYA 2CA9A 3NNAA 5KG0A 4IOBA 3QSYB 2V67A 5F9NA 4IRCA 1M5HA 4WE1A 3EZUA 1YLXA 4FNIA 4JI4J 8ATCB 1HNZF 1AUSL 1P9YA 2VC1A 2CQ0A 4PYAA 1E6VA 4CTAA 5D4OA 3H7HB 4FF1A 3DOMA 4ELUA 1JB0C 4RUBA 4DCJB 1Y3KA 3I9V9 3M4XA 2DNYA 3CJ8A 3VWSA 2VG5B 2M3DA 5I4MA 1DLOA 3GIKA 1CJUB 3I5CA 3MEEB 4QIFA 1VLYA 1SH0A 2F4FA 4USTA 3JAMU 2HVIA 1C1CA 1VQ4S 3C15B 4X65F 4QQBA 4X4RA 1MWQA 4DR6F 2HNDB 3GLJA 2H4YB 2K1RA 2ZNZA 4FDFA 4I56A 1N32F 2VQFF 3TZYA 3Q8VA 1TKZA 3NGDA 4MK8A 1PSDA 2UU9J 3BR8A 3HULA 3HX9A 1Q82T 2BA9A 2Z56B 1OSDA 4FF3A 3R3TA 4L74A 2VFTA 2J6UA 1XNRF 4ECRA 2NXNA 4CH1A 2HWHA 1S10A 2GC8A 3D2WA 3VGTA 4LF4F 4X62J 3JSBA 1T9WA 4NL5A 1FDDA 4OYBA 2ZC3A 3ZO7A 3G6ES 4D3GA 4F02A 1RLCL 2NZ4A 1WKLA 2CZVC 1T9UA 2Z58B 4IFYA 1NEEA 3MM9A 3H20A 3HVAA 1VRTB 2R7WA 4C7QA 1NKEA 3R5AA 4X66J 1WHWA 3UCZP 2HWIA 4PXBA 4X64J 1IM6A 3TRGA 3M9NB 3MR7A 1RYSA 3ETOA 3ZZOA 2RDIA 3FMBA 2XLJA 1Y00A 2JC0A 1V5VA 2BE2A 2CAJA 3DXSX 3IR7B 4MKVA 4PQAA 4UOGA 2MQPA 1ZPVA 2AWZA 5GAEU 2RD5C 2AU0A 4M5IA 3IRWP 2QEXS 1JLGA 1WHXA 2M70A 2PFDA 2RQMA 4ZKAA 1R43A 4DPXA 3V6KA 1U47A 2DPIA 2HMIB 3ZZZA 2ZBCA 2QL7B 4N76A 1P27B 2F5GA 2F7VA 2N4CA 1B4SA 1UFLA 2P9EA 2UUTA 2ZOFA 5IWAJ 4YP3A 1UJ6A 3CJKA 3IR5B 1N4LA 2WSCC 2ASLA 1SC6A 2XNRA 1JLAB 4KIAA 3JTOA 4EK2A 3J81Y 4EEYA 2UUWA 3L7PA 3I96A 3C14A 3DRSA 3MD3A 4ZVFA 1UVKA 4A8OA 4DN0A 4ANEA 4OYIA 4JI2J 2FZGB 3GIRA 5DG7A 1Q1KA 4TY9A 3TVYA 1LFPA 2OPSA 2WBRA 5E33A 4PUOA 1Y10A 3CGIA 4ZHRB 1QSYA 3HHLD 2ALZA 4DV0F 2AJ0A 4EYHB 3D9BA 1RWPB 3AQOA 4HHUA 3T1HJ 2YBVA 4ZCIA 4QYZK 1P9QC 2HIYA 5KG2A 2V0NA 3RB4A 1PBAA 2GFFA 4IRDA 1T94A 1F3VA 4CCHA 3NMAA 2RAQA 3LALA 1SL2A 4ANDA 3JB9k 1WOSA 3W5XA 1HPZA 4M94A 3DFEA 1NSKL 3OBIA 1NB2A 2Q1LA 1K1SA 4ES1A 4ZK7M 3MAQA 3LPEA 4V19X 5AXLA 5K14A 5B0DA 5IT4A 3CUNA 2ZBIA 1F5CA 3D6FB 4USJC 1F9FA 3FQKA 4ED7A 3FEXB 2VBWA 2L3MA 4CNZA 5D6GA 1XC9A 2CZ4A 5KFDA 1ZZFA 1X4HA 1Q8IA 4H4KA 4WCEQ 2X3GA 4ZA1A 2OPRA 1WEYA 1HNWF 4JI5J 3L95X 2M9KA 3CE8A 2W9CA 3QLHA 3WQPA 9ATCB 1H2VZ 2AX0A 2EC2A 5L1IA 1CJVB 2UXCJ 5A6PA 1XNQF 5KG6A 4FZVA 2DHAA 1WHVA 2XZWA 3FCVA 2VF3A 2QFJA 4LF8J 3M8QA 1VRTA 4W4MA 3R7NB 4LFBF 1WEZA 2Y9HA 2WAQD 3A3OB 1FTCA 2MZSA 4F67A 4RZRA 4GRSA 1RTJA 2F65A 2X3DA 2VD3A 3BPDA 2OPPB 3M6XA 2QT7A 3I4PA 5E3PA 2R9LA 4TVAB 4X4TA 2ALYB 1LW2B 4FS1A 4HACA 2HHUA 4MIAA 2X51A 3CEDA 1D0EA 5KFQA 5D4PA 3OTCA 1ZYQA 2RDJA 4KH1B 2KKHA 5DLFA 3RYLA 4DFPA 3I82A 4IH5A 3GILA 2CRLA 3V4MA 1PO6A 1U0SA 2WOMB 4Z7YA 2LU2A 2BX6A 2QJ3A 1FEHA 2QV6A 4J9LA 3QT5A 2FVSA 2KHCA 2CQDA 5A8RB 3LTOA 2HNDA 2VKRA 3PNIA 2BJ8A 3P96A 4F0MA 4ZPTR 3SXLA 2H9ZA 3CO9A 3N6LA 3W9JA 1KNZA 1YJUA 2V94A 3AXMA 3D6HB 4X64F 2CQCA 3SCJE 4NEZA 1U2FA 5J1EB 3T5JA 2VBYA 5KT6A 1FKAF 3TR5A 1RTDA 4KPYA 1TL4A 2ZBRA 2RQKA 2YWEA 4QZVB 4OZ5A 5A8KB 3KLEB 3V4IA 1N6QB 1LW0A 3H2UB 4NX9A 2FJWA 3DRSB 2QA4S 2FHMA 2ZDOA 4LF4J 3QIPB 4Y6IA 3RR7A 2IRYA 1WC1A 4ZJOA 3KLFB 1W2BR 1YG0A 3DOKB 1XMOF 3MECA 1S49A 3RRGA 1AA1B 4A8QA 1DRZA 1MROB 3G9CA 2PEBA 4YUDA 1X9SA 2CJXB 2HQFA 4O4GB 3FNNA 4GKJJ 2WVFA 2BXJA 2RIJA 3MD1A 2XO7A 1LK5A 1T8EA 1KVJA 2RDDA 2GMHA 3BH7B 3KJFB 2HMIA 1YJVA 3LAMA 5KOXA 2DR9A 2G4BA 1K0TA 2OEJA 4NA1A 1N5SA 2QYCA 4KKOB 2MPUA 1N5YB 1KLMB 3QPIA 4ED2A 1RZMA 3GP9A 4LRDA 3MOJB 3CCJS 3CIMA 3ZTSA 1UFKA 3QRRA 3DLLQ 4RNOA 3HHEA 4M5NA 2G13A 4USMA 1ZS6A 3FKBA 1TAUA 1FCAA 1APSA 1JLEA 5KT3A 2U1AA 3K8WA 4ZVUB 1YJ7A 4WP8A 3ZZYA 1RKIA 2Y0SD 3O8WA 2D69A 4LF6J 1BXNA 1R8BA 1HLWA 5HVHA 4QWEA 3C6EC 2QA2A 2YH0A 1UP1A 1OSCA 1VOMA 1KQGB 1JJCB 4KV8A 1Y5IB 4DCPB 2APOA 1JLCA 5A76A 3QYYA 1EETB 1NRKA 2DNKA 3AD9C 4BWJA 5KFNA 3QFWA 4DF8A 2FY1A 4LQ3A 5LL6d 1DURA 3DC2A 3I6PA 4Y0FA 3QIDA 4DL6A 1MMNA 1NZ8A 2N3OA 2YWKA 4OYWA 5CAAA 3K0JA 2K2PA 4DL0C 3PJWA 1JX4A 4Y2MA 2W4CA 2YKNA 3FZBA 5KOWA 3MI7X 2EC0A 4N56A 3EZOA 5DDRC 2G1HA 3KDNA 1TP7A 4NASA 1EB0A 1VQ6S 3A8EA 1TL1A 1WI8A 4DHVA 1GT8A 1IKXA 3HDSA 3DXBA 3DOLB 3MR3A 3EX7B 4IH6A 5F0UA 3CPWR 3CJ0A 3UNYA 2H51B 3D66A 1SJRA 3R8YA 3SCLE 5DDPC 5A8RA 1RT7A 2ATCB 2AZ1A 4QIGA 3K8VA 5FDLA 3UDVA 3MURP 1R31A 3SSSA 4DV3F 1FNXH 2WSFC 2FJEB 4OZ0A 4C11A 3CDUA 1H72C 3C14B 4GO7X 1QLNA 4QWCA 2DTJA 4P71A 4BC7A 3VF0B 3RW6A 3BV8A 3L09A 2CZ9A 4QBUA 4KO0B 3DGVA 4H4OA 4QR0A 4J9RA 1EP4B 2DGUA 2FVRA 5ETVA 2LCWA 1RA7A 1SH2A 3DMJB 4NLQA 3M2VB 3QGPA 2DGTA 4NRUA 4CM2A 5HQMA 2HLTA 2W2NP 3AB2B 2DPJA 2VG7B 2VV5A 1RTJB 3KFWX 4I69A 4LR7A 3U02A 4N8NA 4LRCA 1NLKL 2KJVA 1U1PA 1VQ8S 1CJTB 2DXDA 2HFUA 2C2DA 3B4DA 4OHXA 1BQNB 4I7FA 1RWVB 3LWLA 4YR3A 2NREA 5C24A 1S6PB 1FRLA 1N34F 4YB6A 1RWMB 2XMJA 3H4BA 3KNGA 1N0UA 2CPFA 1SC4B 3K59A 2YNGB 2LQ5A 2AGPA 2CQBA 1S77D 1S72S 5IQQA 5J2NA 2Z8QA 4IFYB 3AGYA 1G7CB 2X1GA 3KG1A 1TL5A 2FDNA 2MJNA 4FKYA 1KBRA 4UOFA 4JI6F 4YMEA 5HMZA 5FLXY 1JWWA 2DK2A 3M2VA 3DLEA 4QW9A 4ZVRB 5T7LA 2C3PA 2NPFA 5LXYA 2KTQA 3IN5A 3CCTA 4TY8A 3R5DA 1HL6A 1C1BB 4K4TA 1XWLA 2FJDB 2KB2A 2J5AA 3RB3A 1TKTB 2M4MA 1LW0B 3W63A 3THVA 2AYGA 3MPDA 4WKRA 1TV6A 4DPYA 2Y1RI 3WIVA 1X4BA 4O3OA 3KK2B 4NA2A 4BBYA 5ETKA 1SJ1A 3C2PA 3OHBA 2G0IA 5LSRA 4O44A 4WP3A 4DLEA 1NHUA 1YBUA 3CDEA 5BYSA 3OTBA 1S1VA 1XMQJ 3Q22A 4C97A 2V34A 2CADA 2LMIA 5LMNJ 2PEHA 3T5HA 1T03B 1U4BA 1KTQA 3R2CJ 2D9PA 1MU2A 2LFVA 2IJRA 2ASJA 2ZDPA 1H2UX 1S4FA 3HFVA 3M2RB 3NCRA 4L73A 1RWNB 4ZITA 1PBUA 5H1SV 2ZH1A 1VQ7S 4LR9A 1C1BA 2RRBA 2IAJA 2P2CB 1IKVB 1FT8A 3FCHA 2BM1A 4I2QB 4TNOA 5E3AA 4B3TJ 4I67A 4OL8A 1PYSB 4Y2AA 4DBQA 4P6QA 2YQ3A 3MPYA 1LWEA 4LSNA 3DGPB 3TUIC 2FJAB 1X9MA 3P49B 5IT0A 3W7BA 4HI1A 3LGHA 2FLOA 1IWAA 2L9NA 1TFYA 2VA3A 1A7GE 2HKEA 2HFZA 3MM6B 2KXHA 1SXLA 4R0EA 1RQ0A 5K8OA 2IM3A 5B0AA 3UQSA 3VGSA 6FDRA 1BUXA 3JYTB 1V9OA 4GKKJ 2DITA 2GGPA 3TQEA 2PFFB 2MGZB 3ENWA 1Y9OA 1NH8A 2ZE2A 2FTRA 4J9UE 4NA3A 2Q6CA 1U02A 4TYBA 4NPOA 4JI1F 2ILYA 2UXBF 3RUBL 5GAGU 2W9BA 2AQ4A 4O44B 2B9YA 1YK9A 2HQ3A 2LP4A 2H4WB 3IBCB 1YJNS 2KN4A 2Y1LB 2U2FA 1QVFR 3KK2A 3MAAA 2MXYA 4U67Q 4F26A 3I0SA 2AHOB 5J2MA 2KZMA 2QLFB 3ICLA 3GPAA 1S6QB 2GVZA 2QSWA 2L48A 5K8NA 1N36J 2HFSA 1SBRA 1RT6B 2I5JB 3CDWA 1HARA 1R7IA 3Q8SB 5D4LA 3OL7A 2O5DA 4RU9A 2XLKA 4DS4A 1Q8BA 4M8LA 2AEFA 1CS4B 1B99A 5IM0B 5KFIA 4FN5A 3ZTPA 3DLEB 2DR7A 1RT1B 3I55S 2B51A 3MR2A 4ELVA 3ILOA 2ZH2A 5HI7A 2FHJD 2YKMA 1X8DA 4ECTA 1UEUA 1KOHA 3SZ2A 5KFRA 1KDNA 1HBUB 3MOZA 1MMLA 1FJGF 2W9BB 3NBPB 1UZDA 1IR1A 1F5AA 2C3UA 4DI6A 3M9OB 3GTYX 1RAAB 4L3KA 2YQ0A 2NQPA 2NXUA 4C8YA 4HH1A 3ZTQA 2IIHA 3IGVA 2KZZA 5GAEI 3FZ2A 2DNGA 4BS2A 1UA0A 2M2BA 4F36A 4CLWA 1N33F 2J7KA 3BEGB 3E8OA 1EKRA 4F7VA 3CCRS 4NI2A 3EVMA 3IXQA 1IBKF 1CSJA 3T41A 2WHOA 5DLGA 2DNLA 1Q5YA 5DS7A 2LA6A 3NMRA 3P5BP 2QLXA 1VBZA 1YBAA 3NKYA 1TELA 4S0MA 3HSJA 5GAHU 5A2QY 4OYAA 1FNOA 4MIWA 4QWDA 1N36F 3PW2A 2QRRA 2HHWA 3KLIA 2PN6A 2IAJB 4I2QA 2JVOA 2Z2ZA 2BKNA 3DHWC 5DQIA 2CNLB 1WORA 4DQSA 5ETQA 1NXIA 3U7JA 1U25A 4N7TA 3MR5A 2ZVSA 3H2LA 1TL3B 3QJJA 2CVEA 4ZJLA 1WF0A 2FC9A 3W66A 3PW5A 2HBZB 3DM2A 3TJ8A 1KLMA 2IMWP 2DNHA 2BW7A 4OI4A 2MKHA 5IC6B 3IAS9 1FJEB 4WFNQ 4WFAQ 3G82A 2ATLA 3HKZD 2FJVA 3EGWB 5KFVA 2EI5A 4Y00A 5AE1A 1X5OA 2YKMB 1Q81T 4J9QA 3RBZA 3NEKA 1N5QA 3GR0A 5AXMA 5A0YA 5B0CA 3TANA 1S9EB 4KC5A 2R3VA 2VICA 5F9LA 1WEXA 1D8YA 3J7YI 5KFUA 1D09B 2DRBA 2V6AA 4JI0F 2QMUB 5L1LA 6FD1A 2CPIA 3HK2A 2HEKA 2RE1A 3C6TA 2ZJPQ 4LUBA 1C0UA 4RUAA 2IFXA 4DL4A 3W2VB 1VK8A 3OTDA 4JI8J 1OY8A 1RHKB 4KR0B 4JBCA 4K50A 1HIYA 1QJHA 2ZNYA 2HS3A 1JLQB 1Y0HA 5DRKA 1CJKB 2MSTA 3ADAC 1RHUB 5KT7A 2RQ4A 1OPZA 2F8HA 4RW9A 4QYZJ 1ZA1B 4LF5F 1HWUA 5GAGI 1BY9A 3RAXA 1FNMA 4F4WA 2DNMA 1HBNB 2XHCA 3CJ4A 3VV2B 5B08A 3HSDA 5D3GA 4MYTA 4GO5X 1PAUB 2DHGA 2WB4A 3IG1A 1WDDA 2IA0A 4ILMA 3MM6A 2BJDA 2WOMA 1CJTA 3HHLC 5F8IA 1VBKA 2MQ8A 1KONA 1VISA 3DDIA 5K8MA 3G4SS 2QGFB 3LGNA 3I0RB 4K59A 1H74A 4GC7A 2VG7A 1M1HA 4UTGA 3QGGA 1HYSB 2V2QA 3KLGB 1PAEX 1RUSA 1UETA 1ZBTA 3Q86A 1FXRA 4KPCA 2EFPA 1SUQA 4QWBA 3MFIA 3GWCA 2DRDA 3SIPB 3UDCA 1NCLA 2DGWA 2MZRA 1CC7A 4R0JA 2VFSA 2DIUA 4J91A 3QRQA 3EZ5A 2A2CA 2GJIA 2IHR1 2E7XA 1K73T 4LF6F 2UXDF 4W90B 3IBWA 1GMWA 2XQCA 5FJ4A 4TKTA 3A1YG 5GMDA 2ZBPA 1RHRB 1DTTA 3HSGA 2HYIB 2WW8A 4ICLB 4ZLPA 3CCUS 4IQMA 5DQGA 2XSJB 3CVKA 2OPRB 5C7PA 5M2UA 3J80Y 4RW9B 1Q86T 4EO8A 4NXMF 1OQ6A 3D3CJ 1KP6A 2CQIA 3AAWB 3MEGB 4JI2F 3KDOA 4NCAA 1V5IB 4B9SA 2YKNB 1QTNB 1I3OB 5IM0A 3LH2S 5I3PA 2JFDA 4M5JA 1HQ2A 1F2HA 2HNZB 1C0TA 1HWJA 3G6YA 1UWBA 3VZIA 2IA6A 4LSLA 1KQFB 2OPQA 4N5SA 3PR4A 3IM8A 3EUNA 5IWAF 4WXOA 3S6EA 4ES2A 2KFZA 4DV7J 2BKPA 1RDRA 2CPHA 1CC8A 3SI8A 3OXFA 4KHPJ 2M8DB 2DHXA 1C4AA 3R5BA 2SXLA 3RBDA 5H9EK 5D8HB 7AT1B 2AD9A 4K2JA 2B9XA 3LQVA 3POTB 3H5SA 4OJ1A 4U6PA 5J2PB 3A4TA 3G96A 1CULB 2JVRA 2V4JA 3B8HA 2AKWB 4JOUA 5K5MA 3SCKE 2HZCA 4EO6A 4R5PB 4WP9A 4DV4F 2DH7A 2FD2A 3BH6B 3EDQB 2ZWOA 4NLOA 3DI6A 4U7CA 1WTBA 1SV5B 4LBIA 4DV1J 3GG0A 4WJBA 4JV5J 4OQJA 4C0BA 1NNDA 5KG7A 1TUWA 1QM9A 3BBCA 4F8RA 4DR7J 3I87A 3CJTA 4P74A 4EZ6A 1PKUA 4ETZA 2LQ9A 3ULHA 2OO4A 4C48A 1VBXA 2HHQA 3GFYA 5E0OA 1NDLA 2KI2A 3OL6A 1T0TV 2RKIA 4OHVA 2FJBB 1H7WA 1M1GA 1LWCB 3DHXA 3OVBA 4P75A 2CPYA 3VCDA 2MY7A 5CH7B 3MFHA 4J9KA 4ZDNA 2PSZA 3BM7A 3K5NA 4DEZA 2UUBJ 1HPZB 3OR1A 3R6GB 4ED1A 3NWRA 3M32A 4HL9A 2XZDB 3PO5A 2ZZNA 5KFOA 4DV5F 3GJTB 2LEAA 5A8KA 3LO3A 4ECUA 1RT2B 3V4IB 3GR1A 2QX0A 2YWHA 1KR4A 2JX2A 2NS1B 3NS6A 4UW2A 5CYQA 1HI0P 3CJRA 4F0KA 3CCWA 1FK9A 1Q4RA 2DR6A 3C6UA 3MM5B 4RLEA 4RNFA 3KNAA 2RRNA 2GVDA 3W62A 4P7TA 2VKZG 3GIJA 2OEKA 4WBFA 4R8UA 2ROGA 1TL1B 2PD1A 2W2QP 1PJ7A 3HHLA 5KT2A 1UAWA 1PC5A 2HRYA 3HO1A 4QWAA 1LNQA 2CQ1A 2DD8S 1RU1A 2G9OA 3PG9A 4YEAA 5F8NA 3DDKA 2ERRA 4KGXB 1L5UA 2BOPA 5L1JA 3QGIA 2DNZA 4DQPA 2DXFA 2H54B 1HNIA 2B7BB 2HNYB 2RUGA 4GKJF 5HP1B 5CD4H 2LQBA 5L8RC 5H9FJ 3EE3A 3P5TL 2KFYA 3CF5Q 2Y1JA 4J9VA 5CZVA 2D9OA 1ICEB 5T7LB 2CQ4A 1UKUA 4KSEB 1Z1ZA 3CIZA 3QSIA 2BR0A 1NK6A 4LVOP 1JXVA 2AX1A 2RKIB 1ZOTA 2NXEA 4NCGB 5EX3A 3U1LA 1RAIB 2YWWA 3Q2TC 2ZWPA 4U7UD 1TUGB 2RQCA 4KAIA 3MEGA 3M2UA 2V50A 1NSPA 1WTFA 1J2VA 4DV6J 2V69A 4A8SA 2J6TA 4JV5F 3BGFA 3D6MB 2CJYB 2FB0A 4UUWA 5GVQA 4C3MA 1B7FA 4ZP6A 3EYZA 4DV2F 3BPSP 3AXKA 3MEDA 1I94J 4Q0BB 1VQ9S 3EPGA 3FJ2A 3GG1A 4RW8A 5DGAA 4AFFA 1QD1A 3N6MA 3W9HA 1P8GA 5J2PA 1OMSA 3HHDA 2AEJA 5BJRA 5JUMA 3OL8A 3VAMA 4A47A 1SKRA 2JZ5A 4EZ9A 2CQPA 1EQMA 1RHQB 2R7RA 4OZ3A 1SL1A 1HBOA 4ZVEA 1S1UA 2BMBA 3S01A 1HW8A 2J9CA 3CD7A 1LFWA 2GS8A 3A3NB 3C16B 3FDSA 3MM7A 3PX4A 4HDHA 4C8LA 3BZQA 4RR5A 2ZOGA 2VPYB 3OSNA 5D78A 3G71S 5U47A 4G6VB 2HNYA 1VRUB 2ZD1A 3AH6A 2WONA 3V2UC 4NZ7A 2V8VA 3OTEA 1JKHA 1DQAA 3CJ5A 3PEJA 2ABYA 2PI4A 3UVJB 2BABA 3AA8A 2MKKA 4B3SJ 1PIEA 4OFZA 3PW4A 4JI1J 1OJ4A 5D0GA 2BDPA 1T9XA 1H7XA 4B17A 2CYYA 3D7SB 4EWTA 1KFDA 1VCTA 2FVPA 4J5OA 5RUBA 5G4DA 4DV2J 4EBDA 3OUYB 2AGQA 3EXYA 4JI5F 1N48A 1NKBA 2KXFA 4URSA 5T41A 5HVGA 4KBIA 4ECYA 1OWXA 1UZHA 5L46A 2CJKA 1OY9A 1Y4ZB 3UN2A 2YKOA 3CULA 2HVEA 3QT7A 2V68A 4E8UA 3JQMA 2EK1A 5DQHA 1VHIA 4ZVQB 3IS9A 1LOUA 2YX7A 1MG7A 3O2IA 2FHJA 3BB5A 3BBBA 3R6LB 3H42A 3GV5B 4DV7F 5C5JA 3G6VA 4HYKA 4F2SA 1S6QA 1WDTA 3FQLA 4IOCQ 1BE4A 2C3YA 4NZ6A 1VI7A 1IBKJ 1SCJB 2AYEA 4ED5A 3DDNA 1T9VA 2H3EB 4WFYA 2XMKA 1FX2A 2AZ3A 1M5VC 4JV0A 4NCBA 4OHZA 3G8SA 1ZM4A 1X7VA 1VYAA 2DIVA 3BYRA 3FMWA 1IBLJ 1S1TA 3KJVA 5DJBA 5LMNF 1S6PA 3M6UA 5H9FK 1YZ7A 4GVBA 2ZUAA 4KTQA 1XQIA 2RB7A 2OJ3A 2C2MB 3M8ZA 3QLHB 2R42A 4OZ2A 4FYDA 4P52A 1WWHA 1N5YA 3GV7B 1X31C 1S57A 1WF1A 3OXLA 4DR1J 4NLWA 1RAOA 4AQYJ 1CJKA 2XHWA 1AXQA 2HS0A 1E6YB 2ZKTA 4FVCA 4K7QA 4ZVPB 3TA1A 1QUVA 5F0WA 2N7CA 1UA1A 2EFGA 2O3DA 2IBKA 3IP0A 4KB7A 2F9JA 3NCPA 4G1IA 3C46A 4DR4J 4OZ1A 3FSXA 2M88A 2M8HA 4HHHA 3SDEA 1Q53A 5E3RA 4WKYA 2DNRA 5HMWA 5KT5A 4DL7A 1SL0A 3G86A 5C25A 5KFMA 1RAJA 2QTWA 4IH7A 4XDDA 4ATNA 3AJ1A 4L6V3 2XY7A 5D0EA 3W61A 1UVLA 2L08A 3PJ9A 4JI6J 1T05A 1D9FA 4EGLA 3D68A 1XAOA 2GMLA 1N5VA 4J80A 4RW6B 4V1Ak 5CCMA 1TR0A 1FTRA 3MCNA 3TAQA 3W8GA 2OI2A 2UP1A 4B3OB 1CEZA 3DYAB 4LVNP 1FRMA 3V6DB 1C4CA 4GKKF 4UT4A 5LXRA 4USHA 4ZHRA 4DV4J 2DJWA 1DJ0A 2BEFA 2OPSB 2DGXA 3AY0A 2VG5A 4NXNJ 1TVRA 3D67A 4YN3B 4PUOB 1R8CA 2PMWA 4LRFA 3KMSA 2NR0A 1Q7LB 1YWXA 3NOGA 4QJVA 3D0IE 1RHJB 1VRUA 2EK6A 2ZD1B 3PCOB 4DR3F 4NYOA 1AW0A 2J0XA 3M32B 3D5MA 3FK4A 3I4HX 1S1XA 3BSOA 3OD2A 1S79A 3W5YA 1FRXA 2NYHA 1SKUB 3CDAA 4OIXA 3SMZA 3SEOA 4BC9A 4CO3A 1U0HA 5K20B 4RNNA 2DGOA 1FFSB 1RWWB 1B0VA 1LWFB 1VQMS 4UUXA 3C19A 1XN9A 4HACB 2KHDA 3NLCA 2CNKB 3AFGA 2QYGA 1SC3B 1S1UB 2HRTA 3PX6A 2XYHB 1M5PC 3S1TA 2XMAA 1T95A 2UVRA 2QZ8A 4CT9A 2E1AA 3B82A 1D3WA 4OHYA 5IT9U 3HD1A 4N8OA 4TYAA 4XPCA 2MQLA 4DR6J 1KHWA 1Z2ZA 1F9EB 3SQGB 1X4EA 3I32A 3I38A 1EARA 5E7OB 3ZZRA 3CCMS 4J9SA 4BHQA 5LJ3Y 2X1AA 2DGVA 2EFQA 3N79A 5IQ6A 4C8NA 1IKYB 3KLHB 1MWYA 2W9CB 2XNQA 1RYRA 3TJAA 1IBCB 3N6NA 3AD7C 1GEHA 1O51A 1HBUA 4M1KA 2HHTA 2ASYA 4DQQA 2BRKA 1JLQA 4KRWA 4NCGA 1NK8A 1VQNS 2YKPA 4A48A 1BC6A 3LP2A 4DF4A 1DARA 2HK3A 4G1PA 2Q79A 2YXLA 3J7ZT 2BQ3A 4IR1A 3NCQA 3W65A 3VVTA 5HMYA 2YX4A 4HT5A 1BWEA 1WF2A 4LSZB 3W8PA 4OI1A 5LMUF 4DPUA 2FLLA 1WUUA 4NLTA 1S6OA 1U6ZA 2R8KA 5J2MB 1EQ0A 3EXCX 1EHWA 4H54A 2XG8A 2CVIA 1G6BA 2AJFE 1Y5LB 2H1YA 3GB0A 3HHLB 1QAYA 4F3QA 2XLIA 1TMJA 4KHRA 3QZ7A 1HNXJ 1HMVA 1MN7A 1HQEA 3LANA 4XIUA 4ECQA 2XS2A 2B3TB 2B9WA 3EGVA 5CYMA 3ONQA 2KRBA 3ZTRA 1IBLF 1YJRA 5KFHA 5T14A 2C28A 1KC8T 4LF5J 2EW9A 5CCLA 2UUCJ 1UJ4A 1BQXA 1ZM3A 2VFRA 3IC1A 3PYGA 3Q8UA 2R2RA 1R27B 4FF4A 4X4UA 2B8QA 4E0DA 2FLNA 3MPWA 2AT1B 1T3OA 2QA1A 1FKPB 2JZ8A 3FBBA 3H8YA 3KKFA 4P72A 5IC4B 4E2FB 3PKYA 4IUFA 4NLGA 1Q7YT 4IG3B 3CJKB 4PG5A 3BQ0A 1Q16B 3OL9A 1O0PA 4JI0J 2F40A 1KHVA 3RJMB 2GQQA 1BWVA 1S9GB 3C66A 5KTQA 2J6SA 1LWXA 3MXHP 1NDKA 1YSJA 2HHHF 4DR3J 4LFBJ 4RUHA 2FVCA 3CJSA 4DV3J 1LQ9A 2A6OA 1RJJA 3ISND 3H59A 2BJ7A 4DFJA 1IXKA 3OR2B 1WKKA 1J5EF 2IC3A 3Q2SC 3T6BA 2XWYA 3PHTA 2VOOA 3C3LA 5ETNA 1CJVA 2R7UA 4QU7A 4QOTA 3HI9A 2F1FA 1CQNA 3MZIA 4I6AA 4IG0B 4ZIVA 5GADI 4KKOA 3IWXA 3TW0A 2C22A 2W2MP 3MM9B 4WTYA 3EJMA 4ZCLA 1J5EJ 1URRA 1H6KX 2E5JA 2W9AA 1HNWJ 1FE4A 1R0CB 3M8PB 2EPIA 4I64A 5D0HA 3FSIA 2R8IA 4FKXA 3HJVA 4X4QA 1DY3A 4O3PA 3RAQA 4J90A 1LV5A 1QAJA 3QO9B 3VR1A 1K0VA 2HWTA 1SH3A 2XI2A 1D8ZA 1HQUB 1NPKA 3F44A 4A8WA 2DNQA 3US5A 1HWIA 1UW4A 5HBMA 1Q78A 3C6TB 3QIPA 2AIRB 3ENQA 3DLGB 2J7WA 4ED8A 5HAOA 4B3TF 1UWBB 1TKZB 2NXCA 2N4DA 3JTNA 4KT0C 2VBZA 3VVUA 2J76E 3ILJA 4ED6A 2CQHA 5DDQC 5LSLA 1TVRB 4FNHA 1DQ8A 4DR1F 2CFXA 2MLXA 1NB7A 3ILLA 2MZTA 5DZ6A 4YFUA 2ZH9A 2UUCF 3WC2A 4J37A 4JB8B 2WBMA 1XNQJ 1LXJA 1HD1A 2N82B 1DLOB 1IUJA 4RW4B 4DMZA 4DUZF 2BQRA 2Q66A 4Q2MA 1UWAA 2NUUG 3P3DA 4UOCA 2GGPB 2HRUA 4OV6A 4WYLA 4UOHA 4PZVA 3BQ2A 4H4MB 1F5BA 1T05B 3FSYA 3SQGA 1FRJA 2B7CB 2V8PA 3D0GE 2JOQA 1OPIA 2Y8YA 4I6YA 3Q0AA 1R8AA 2GA7A 1N5TA 2R8HA 4OYZA 5JVHQ 3ISNC 3RBEA 1SJ4P 3EPIA 3T3FA 4CM0A 2HQDA 4IO1A 3DLKB 1U26A 2O66A 3THTA 2WVBA 3HFKA 4ZOSA 4G3IA 2P6TA 2KG1A 1X60A 5B0FA 1AFJA 3EVWA 2KG0A 3H0PA 1JLGB 1U6FA 1S6UA 1RISA 2KT2A 2ZEJA 2CQGA 4HTJA 4DQRA 3D3BJ 2VPWB 1FKOA 3H2VE 3MCSA 4M5DB 2GIFA 2F9DA 4QYRA 3S8SA 2ZH6A 2B5JB 3IWNC 3UFCX 3WX8A 1VK3A 2J8AA 3KJQB 4QR2A 3RB0A 1TMMA 5G0RB 2MZ1A 4LRAA 4QIEA 1RK8A 1NSAA 4LBPA 1S76D 2JEJA 1S59A 1KVIA 1RABB 1IBMJ 2QN6B 4CLFA 1K47A 3K5OA 1YRTA 4ECZA 2VONA 3VAJA 1GTHA 1V3ZA 3CB4A 4RW6A 1YJ9S 4NE9C 4XO0A 4CLLA 4HEA9 7FD1A 1JIHA 4DUTA 2FY8A 2YNIA 1XJWB 3CJ2A 4CIOA 1OIAA 3Q83A 3N01A 3KUGA 4CQ1A 3K89A 4DUYF 2E44A 1YDLA 1I5OB 2XYGB 3BKUA 3PW0A 5L38A 1JXLA 1HFEL 3RRKA 3NGSA 4UZBA 1RT4B 1Q8LA 2HFVA 4F2RA 5HROB 1X5PA 5AXNA 3HZGA 3BGOP 4CLZA 2CPEA 3GJSB 3G8TA 2DXEA 4C3LA 2WK4A 1N52B 1TAQA 2XMMA 5L9XA 1GXLA 4LFCF 5AXKA 1E6YA 4P2SA 3OHAA 3FVYA 2PI5A 5HANA 2DCUB 3C15A 4O4RA 2OHDA 3HFZB 3OFEA 3TZWA 4F4YA 4WZQA 2KYZA 2MKJA 2R7OA 1W25A 4WIIA 5E3CA 3IFEA 3SQOP 3UDEA 4DJBA 1HA1A 5GMKa 3LW5C 2QMWA 3M8YA 4DR2F 3V6JA 4N41A 1U6BA 2HSEB 4KYZA 4CLYA 5M2PA 1U1RA 1RWUA 1SQEA 4M5LA 2JEGA 1IQTA 2AW0A 3K2YA 1HNXF 1JMTA 4TQRA 2FHKA 2I38A 4K5RA 2WONB 1VJWA 4F25A 1C2PA 1BQMB 4DR5J 5KFWA 2HG4A 3MF5A 2FUG9 3ITHA 1N32J 3V81A 4F0HA 1FKOB 4M5DA 3T6JA 3UN5A 4DX7A 1NU4A 5IXUA 4YHHJ 4K4YA 4NXMJ 4HKQA 4C6AA 1FJ7A 4YR0A 2COLA 1Y5NB 1B7YB 1VIXA 2VG6B 4J9PA 1RB0A 4LFAJ 4CYUA 1GMWD 5A8WB 1PYTA 3DMJA 2MQNA 2WCXA 1MROA 3O1LA 2LXUA 4USIA 4Z2XA 3KTQA 4YOEA 1IM4A 2W4PA 4AXJA 5GADU 3I0RA 1U2CA 1PCAA 2RMLA 2VASA 2KT3A 1VLOA 4J9MA 1M5KC 1YZ6A 3DRYA 3ZZPA 1FKPA 4NI2B 1TU0B 2XB2D 1KQSR 2AMCB 2K7JA 2VPXB 1KS2A 3AODA 2MZQA 3GCWP 3ZNUA 1RAGB 2DHSA 2FIUA 3K5MA 1FWLA 1S48A 2V9KA 2HHPA 3T9NA 4ER8A 2OAUA 2A18A 4CO1A 5HVFA 4KGVB 2YH1A 4FF2A 3QWUA 3BO2A 4DZDA 3PYDA 2C2NA 2WVEA 1RAEB 2FQQB 1SPBP 4FXDA 2J7UA 1NHVA 5D77A 2V8DA 3NNHA 1WACA 3PRVA 1HMVB 1WC5A 2WRMA 8RUCA 1U1QA 2CWXA 4HTIA 2ADBA 2J0SD 2UXDJ 1GMUA 4ZVSB 1JKHB 2R7XA 2H48B 3BO3A 1X4GA 2VZ9A 5J2QB 4EUVA 3N9UC 1K8AT 3G6XA 1GTEA 4ZIWA 5DGBA 3D28A 2RILA 1XIQA 2C3OA 3QT6A 4LSLB 4OX8A 1H2TZ 1EETA 3KHRA 4RNHA 2ZH7A 4KJIA 1S7HA 4ZVOB 2OD6A 4HLBA 2V8HA 2IVYA 1R8PA 2FYXA 2WW4A 3A3PB 3KUHA 1UPPA 2IDLA 3GIMA 4ED0A 2MKSA 4CH0S 1EIYB 1H98A 1TKXB 3BBFA 2O01C 1PJ6A 1FDAA 1GFWB 2E5HA 1N54B 3F41A 1JLBB 2PC6A 1W7WA 3MPVA 4JP8A 3VHQA 5HQ8A 3TZZA 3B4MA 1N56A 3KG4A 1TK5A 1ZAVA 2LEPA 1PILA 4OYXA 1QAIA 4X4NA 2LA4A 1X4DA 4WFXA 1X0FA 4ILLA 3U1MA 4CI0B 3TP2A 2QLBB 1FWPA 1R8HA 1FERA 1RTHA 3BSNA 2JFKA 2BANA 2GO8A 1ZM9A 3W2WB 5HK4A 3Q8QB 2E5LJ 3GONA 3TUPA 1X5SA 2R8GA 3CCVS 2X1BA 3M1VB 4IKAA 2XEXA 2HGLA 1LWCA 4F04B 2JH3A 1VS3A 2D7SA 4A8FA 4Q2LA 1JQGA 1Z2LA 5K14B 4BLGA 1VC6A 4OZLA 1HYSA 4I6WA 2VOPA 2HAIA 4OZNA 2WTFA 4MKBA 2WVCA 5E41A 2CXEA 4Q8FA 2W8KA 4C8OA 3HLUA 4RBUA 1UVJA 4OMFG 4HH0A 4CO2A 2EFVA 2E5GA 3NS7B 3TVZA 1B70B 2BRLA 1IR2A 4FYWB 4IFVA 5AJ3J 1PC4A 2V9WA 3TUZC 3H98A 2N7YA 3RRHA 4MT1A 3TQ1A 3FBEA 3J7AN 3CMES 1GMVA 2EBGA 1Q79A 3G8QA 3RB6A 1X4FA 2OFGX 1RAHB 3R5CA 2JLEA 5CD4A 5EWFA 5CZXA 2NSCA 1ZAXA 2C1EB 4ZMMA 3HVRA 4B9NA 4C3KA 5CYQB 1Q5VA 3TZXA 3MMBB 5IOLA 2XULA 1UVIA 4PKDB 4IRKA 2CKWA 4Q7AA 3TAMA 5DDOC 4YB5A 5EDWA 4C0HA 1VIOA 3MEKA 1B64A 2GJ2A 2ZC4A 4LFAF 3VAGA 4WF9Q 1JLCB 1C0TB 1RWKB 1S9EA 1WI6A 2EKYA 4ZN3A 4LF9F 1LW2A 4L3NA 1FESA 4YHHF 2YNIB 2R2TA 1M5OC 4DWIA 2MDAA 4D3HA 1S12A 2RF2A 2ZITA 3M8PA 5L39A 1NJYA 2I9SA 1LEOA 4U96A 4X2BA 3OFFA 6AT1B 1RWXB 2EXUA 2PMHA 5KFYA 1EAYC 2OSRA 1A0OB 1KEKA 3MTJA 3R1LA 1NK0A 3PFEA 3PRDA 4KFBA 1BLUA 3DRPB 4ZPAA 1CJUA 2HLUA 3HHKA 1XEZA 3MEEA 4EMDA 4F4AA 5B0BA 1EZZB 1GAOA 1M5SA 4GVBB 2CIMA 1HNVB 4DUZJ 1TL3A 2QO3A 3GYGA 4DLGA 3VGUA 3NG8A 3HPOA 4R25A 4Q5VA 1G2EA 2FC8A 2KM8B 4B3SF 4B9MA 4ECWA 5E5NA 1MMDA 1LXNA 2DNPA 3GFHA 5HL7Q 3O3LA 2JLGA 4K4ZA 1F1BB 1SI9A 1ZH5A 4CH7A 4QU6A 2JL9A 1VQOS 1T3NA 3W1YC 2AJ4A 4DSJA 2MEWA 1L3KA 4DDFA 2IBOA 3PHEA 4H4OB 2OPQB 4MK7A 4AL5A 1FVQA 3WZ0A 4CLSA 3KK1A 4G65A 3H5UA 5A6WA 1N8RT 2GO9A 2LVWA 1YKWA 2R4FA 1Q0NA 2DGSA 2LDYA 4M5GA 3MAHA 2VQEF 4R5PA 4GMKA 2Y1IA 1RTDB 4O0IA 2IJNA 2H65B 4JYAF 5B0GA 3TJ9A 2JRRA 3E3XA 3P4UB 3MMJA 2E9TA 2BYCA 1S1VB 1DFDA 3JSMA 1FRHA 1YBTA 3ZXWA 1DQ9A 1SKSA 2JDJA 4I4BA 5ITHA 3AGXA 4ALZA 1WSRA 3AD8C 3NAHA 1GX6A 3SV3A 1U1KA 3L7UA 1RT2A 1S5ZA 3RGIA 3ENAA 1OO0B 2HHHJ 2H5IB 4PG8A 1FEEA 2KRRA 2MQOA 2IJFA 3NGRA 1AZSB 3WX4A 4EFAC 4LF9J 1RKJA 2I5JA 2WSEC 2W25A 3H5YA 2CPXA 3PDNA 5KFXA 4CO5A 5A0YB 3I0SB 4WFBQ 1RBLA 3D1QA 2BQUA 3ENVA 3LZ8A 1WC0A 2X7IA 3HSZA 3RTVA 2UU9F 3N5FA 2VA2A 4P2XA 2WB1D 3U27A 4RUCA 2AJQA 4MFBA 3RZAA 3OLBA 2CG8A 2DO0A 3AB4B 2AV5A 4Z7CA 1KTVA 4LT6A 5D15A 1L3VA 3V6HA 3JYTA 4QPXA 1BQNA 1IKWA 4I7FB 3BN7A 2F4VF 2ZUGA 2ACMA 3OR2A 3HD2A 5KFAA 3TUJC 5FIIA 3GFZA 4HDGA 4U8VA 1T9YA 4DXLA 1EX8A 5LM7E 1MWZA 1CPZA 3M9MB 1YVFA 3AQPA 3POTA 1ACMB 1X5TA 4DPOA 1HR0F 1AFIA 4IDKB 2R7VA 2HHVA 3EGNA 1FF2A 1X9WA 3M05A 2Z30B 3FBFA 2YNHB 2XI3A 1RTIB 2EBEA 1F3FA 1ZAWA 2FZCB 1ZTWA 1A6LA 3GJQB 3T1AA 4KO0A 5ETRA 5HLFA 2VFUA 3OJSA 4ES3A 1REGX 2W24A 1N6QA 3NOCA 3K58A 3GYNA 1NK5A 2LECA 1CVJA 3IS9B 2VH7A 3E01B 2QE5A 3R9LA 3TAMB 2HBQB 2HQIA 5K9FA 2I2YA 3IRXB 4FYYB 4MYUA 2ROPA 3EDRB 4DR7F 4C8KA 2ROEA 4MMOA 1SKWA 3NP5A 4DV1F 3CW2C 3DCAA 3LA0A 4OYMA 1F6TA 4LR8A 3R2DJ 2GAGC 5CYMB 3CCLS 4PEOA 3F0NA 2IVMA 1NZAA 1LKZA 5ETLA 5THWA 2DEJA 3L3CA 3JXOA 1NK4A 3N5BA 4ZCMA 1FK9B 3C6UB 2FGCA 1DTTB 2CQ3A 3IO1A 4HVZA 1A9NB 2HHXA 5F8LA 2UVVA 2HFOA 2BUNA 4L75A 3CD6S 2I8EA 3B78A 3E01A 4NLPA 5BR8F 2B5JA 3KXDA 3DU6A 2VIHA 1X4AA 3PIOQ 4HR2A 3MUMP 2F8MA 5CHCB 1FX4A 2GJFA 1NH7A 1MN9A 2M52A 2UZAA 3QNWB 2QL9B 1NMEB 2KH9A 1NK7A 1HW9A 5MAOA 3EWGA 4O3NA 5JXSA 4UF4A 3PXGa 5F8GA 3HF5A 2FZKB 2GVZB 4EBEA 2UVUA 1WSVA 2RS2A 3PYFA 2OPPA 1FDBA 2BV3A 5FLXU 2C2OB 1KVKA 4ZP8A 3AA9A 2GHWA 1K9MT 4FXWA 2H5EA 2DYAA 2FVQA 1T7PA 1RTHB 3KOAA 3V81B 3F73A 2R8JA 4K4VA 1K44A 3M30A 1RI7A 5KG1A 4OX7A 2MKIA 4ENOA 1B0PA 4NZ0A 4I0WA 3KK3A 5ETOA 1S1TB 1B0TA 2C3MA 4RKUC 1HBNA 2MQQA 2L41A 3OTOJ 3KJVB 2RSQA 3MEDB 5BYRA 4U8YA 4PG6A 5JJBA 2HZVA 2DKOB 4PQUB 3M2UB 3TI0A 4Y34A 2R7SA 1FXDA 3IWLA 1H73A 3IGNA 3D1OA 4ZPVR 1DTQB 1O8BA 2BJ9A 2K7KA 2YPZA 4RL1A 1HBMA 4ECXA 1WELA 3Q89A 3MWBA 4LSNB 4P9SA 4DG1B 2EEYA 3H40A 3AJDA 4PG7A 1TL7B 3MECB 1GX5A 3NRBA 4PWWA 5KFCA 5KFJA 1ZTTA 3T9ZA 4FXVA 4DQIA 1IKVA 3RG6A 1V3RA 2DISA 5DM6Q 4RNMA 1FFGB 1SIWB 1HNIB 1HQUA 4Y2KA 2HNZA 4LF7F 5E3QA 3MUVP 1U1NA 1Q95G 4PXEA 3MMCA 4TN2A 3QWPA 2EFOA 4DR5F 4YDDB 3PV8A 3MTKA 4AL6A 4ZS6A 4OYOA 4G1QB 3LP0B 2GQCA 2MMYA 3BKFA 3TYTA 2EKNA 3OTOF 3VAHA 2GVDB 4DSEA 3CWJA 4B3OA 2G0CA 3NAIA 2MGZA 5KAKA 1VQSA 2PDAA 3NGUA 1DHMA 1YTYA 2KYXA 4LRBA 4P2FA 2HBYB 3N28A 5GMEA 1X0PA 1IWGA 1H3DA 5DG8A 4RU2A 1JNZB 1KKHA 4EU0A 4PAAA 1VBYA 3DOMB 1NJZA 1KOOA 1LK7A 1S0VA 1SJQA 2G0JA 1U2RA 3R5GA 1U1OA 3KMQA 3IA0A 2IRXA 4JI7J 2D74B 3UR0A 4MKYA 2BE7D 2RRAA 2CG4A 4OI3A 3K57A 1SUQB 4PWUA 4BCAA 4NMLA 1XR5A 4PG4A 2VFVA 2YPYA 1VRQC 1ROFA 2E7VA 2G2YA 3LGMA 1ZPWX 5BR8J 3ITHB 1XK8A 3OW2R 1ZA2B 1RT3B 4X4OA 3ZNJ1 5ETSA 2RS8A 2UXBJ 2F3JA 2GQ2A 3BDEA 2V2KA 2K06A 4KH0B 1IJFB 3O44A 3A8KA 3DRPA 3L4BC 3OJUA 2ZHBA 2BJ3A 3VZHA 3CMAS 2D3ZA 1HHQA 2OFHX 2Q3PA 3B54A 2ZH8A 4ZJQA 3ILIA 4MFBB 1CULA 1N88A 2IM1A 2OD4A 2IM2A 2V4JB 3LP0A 3QQCD 2EVZA 4WK1A 1VJQA 3VAKA 5B7WA 5H9EJ 5K8PA 3PJXA 3UDLA 2B8PA 2RH3A 3AJ2A 1UPMB 2KVQE 1FDNA 2F63A 4OLPA 4URQU 4WIQA 2CQ2A 1WC3A 2MQMA 2V2ZA 4PXDA 3OT9A 1R6YA 1U7LA 1SIZA 2B4OA 1PYOB 3D1HA 1OY6A 5B09A 2BM0A 3DOKA 3U1NA 2OTJS 3QZ8A 3T5KA 1XERA 2BZ2A 4QW8A 2HHSA 1FD8A 1RT6A 1WG1A 4F4KA 2BACA 2K3IA 1WD6A 2NPIA 1S9FA 2B56A 3UD3P 2J0QD 4ZLLA 1RHMB 1SQGA 3RU0A 1RGVA 4DG1A 2KDOA 3CO0P 1HWLA 3GSDA 4KY3A 2KXNB 4J9OA 4OI0A 3I31A 4YY3J 1VR6A 1MLAA 3PACA 1T9TA 2PMZD 4FP9A 1RACB 1V6HA 3AOAA 5A2QU 1Z4UA 1JLFA 3TX8A 3UD4P 4PCQA 3CMQA 3BDPA 4DR4F 2DH9A 2G1DA 2PO4A 3DNCA 3DLJA 2NCKL 4FPRA 2LQJA 2G2OA 4QIWD 2IDEA 2UV8A 3K7RA 2DNOA 2DO4A 2ZHAA 2JNJA 2VB6A 5C2GA 2DVIA 2Y3YA 3UVJA 3VGVA 1U1LA 4RWWA 1FJCA 1WG4A 1UEKA 2E5IA 1SC1B 2D41A 1AT1B 2W2OP 2XMWA 3ELHA 3TNVA 5AE3A 1WOPA 4KGZB 1RBOB 2B4PA 5HATA 3UNGC 4A46A 4NRTA 2JSXA 3ET6B 4Z37A 4ID5B 3CCZA 3DLHA 3D4JA 1YIJS 3CD5A 2UUAJ 1UCNA 3DGPA 2E7WA 2QFIA 3AT1B 4NMXA 5A8WA 3CCQS 3KLGA 1EP4A 1WC6A 1AYEA 2GX8A 4EBCA 1GH8A 2M5YA 3H5XA 5KFPA 4B9UA 4Q8EA 2RHQB 5I42A 1MW7A 1DZ5A 5LOQA 5KG4A 3QAUA 3GJRB 2XTJP 3W9IA 2W7OA 2LEBA 3T19A 3FEYB 3BS9A 3PYEA 1ITPA 2FHOB 5J1NA 1QVGR 3AHPA 3FBCA 2QIFA 1KD1T 4PPZA 1RCOB 2QLDA 5FDLB 2NXJA 3IG1B 1QE1A 5DETA 4F50A 1MU2B 3T1HF 1VC5A 2PGCA 2G2ZA 2Z2MA 4C4WA 2V2VA 3EVOA 3UR3C 3NBPA 2M7SA 4WPAA 3DKDA 4B3MJ 4JYAJ 4G1QA 4YDXA 3J81j 3MUTP 2VQEJ 2E66A 3DRRB 4DV5J 3UN3A 4DSKA 1K1QA 2XY5A 3BSAA 4YB7A 3JQKA 4FBTA 4WK3A 4PABA 3JSRA 3QMQA 1XR6A 4NLUA 2MY8A 4LF2A 4Y2IA 3TWZA 5C42A 1AUDA 1FXLA 3GMGA 7FDRA 3KLFA 2NUHA 4P2MA 4B9TA 4CP5A 3D0HE 2EG1A 2H5JB 9RUBA 4X4PA 1TKDA 1RP5A 2MJUA 3O5TB 3PR5B 2IRUA 2P9GA 4E98A 4USKA 2HQCA 3CJQA 5J2QA 3NGKA 4NLRA 4NYPA 5EUHA 2CUYA 2F8EX 5CA5A 3DRRA 4ZPDA 1WHYA 4PPDA 2RJZA 1SJFA 3W3SA 2I0XA 3CSKA 4J9NA 4HHJA 3HT3A 1PJ5A 1VC0A 3DM2B 3MPUB 2IYIA 4TQSA 2MHNA 4ICLA 1FO1A 1XMQF 1L3TA 2JEFA 2AF6A 1GNKA 3UD5A 1M90T 1VHFA 5KFGA 4M95A 2NLWA 5KFZA 5IZHA 2DR5A 2KL8A 3DN9A 4OX9F 3D6TB 4NLXA 2FPHX 3ZC4A 4DZ6A 2OSQA 1GXTA 5BYQA 1TK0A 3TARA 4DSLA 3MGJA 2Q43A 1RAFB 3NGTA 2B6AA 3Q8YA 4WE1B 4X62F 2ASDA 3MR6A 4OV1A 1S0NA 5CXTA 2IMOA 1RLDA 4FYXB 5MLCV 4UQGA 3GFXA 3CCSS 2JC1A 3VAIA 1BMQB 2AP6A 1UEVA 2VUGA 2XSFA 1GQEA 1VQPS 4JV2A 3T5LA 4MKAA 4Q43A 1D9AA 4YR2A 2AJ1A 4FS2A 2IPOB 4UZCA 4FPIA 3RBXA 1VQLS 4I2PB 4C98A 2QL5B 3SFUA 5F8HA 2QLJB 5EWEA 1IQZA 4NLVA 4NWBA 2RU3A 5F8JA 4B02A 2DEIA 3KLEA 4OJ3A 1TK8A 1KN6A 5JVGQ 3QFHA 1SV5A 2M0GB 4LBHA 2HW3A 2R7TA 2GMJA 2OGUA 1RT7B 2CNNB 2Q6BA 3ZZUA 3LWMA 3R7SB 4ZN1A 4ZPBA 1MNEA 3CTRA 5HQLA 3BR9A 2JRSA 1T03A 3HCXA 4B3RF 1S1WB 2UVWA 2A2DA 2BOAA 1TKXA 4F3OA 1R89A 1HQEB 1R0BG 3QAEA 2XMUA 1TFWA 4X4VA 2RF2B 2VDHA 3QJPA 1IR0A 4OLOA 1ULRA 5I3UA 1CS4A 2EWHA 4JI4F 1Y11A 5LSOA 2E1RA 8AT1B 1HKAA 2DGQA 5IV4A 3SDEB 1XMOJ 2AEMA 4NXNF 2IY5B 1F2GA 4KV8B 4JV1A 2E5LF 1QSLA 1R3NA 2XMVA 1HHTP
chains in the Genus database with same CATH topology
3AGYA 3L9ZA 3NY0A 3AGZA 1C3GA 3AGXA 1XAOA 2HFVA 4J80A 1EB0A 3NXZA 3LA0A 1GMUA 4L3KA 1GMWD 2QLDA 1GMVA 1NLTA 3I38A 2B26A 1EARA 2Q2GA 3TJ8A 3TJAA 3LZ8A 1GMWA 3TJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGY A;  3L9Z A;  3NY0 A;  3AGZ A;  1C3G A;  3AGX A;  1XAO A;  2HFV A;  4J80 A;  1EB0 A;  3NXZ A;  3LA0 A;  1GMU A;  4L3K A;  1GMW D;  2QLD A;  1GMV A;  1NLT A;  3I38 A;  2B26 A;  1EAR A;  2Q2G A;  3TJ8 A;  3TJA A;  3LZ8 A;  1GMW A;  3TJ9 A; 
#chains in the Genus database with same CATH topology
 4NYZ A;  3ZZT A;  2W8L A;  4A8K A;  4ECV A;  4O3S A;  2K8G A;  1DTQ A;  3J80 U;  4P73 A;  2BBE A;  4OX9 J;  3C8Y A;  3LF0 A;  4DFK A;  3JTP A;  2OMO A;  2YNF A;  2D3O 1;  3QAT A;  1M1K T;  1S1W A;  4DPW A;  3KHL A;  2R7Q A;  1S0M A;  4C8M A;  2W01 A;  4K8R A;  1U09 A;  4K0K F;  4USU A;  2HFN A;  4L76 A;  3FC9 A;  4DU7 A;  4DR2 J;  1HNV A;  3CD0 A;  4OI2 A;  4CDI A;  3VAL A;  1D9D A;  2VBX A;  4IFV B;  2IC3 B;  4KFB B;  1PGZ A;  4RJV A;  2CJQ A;  1Q8K A;  3LP1 B;  3NWG A;  2QA4 G;  2ODX A;  4PXC A;  1NDC A;  2ZFH A;  3SSQ A;  1RT5 A;  2K3K A;  1HD0 A;  3P45 B;  1N0V C;  3THP A;  5F8M A;  3OLA A;  2HK2 A;  1O5J A;  1XNR J;  3NNC A;  1CBK A;  3ZZ0 A;  4CT8 A;  3V5R A;  3HKW A;  3W64 A;  4TU9 A;  4DL2 A;  1H0H B;  2ZVI A;  2Z2Y B;  5KFK A;  2HPU A;  4DUY J;  3W60 A;  4ID5 A;  4XK8 C;  1DAX A;  4B08 A;  1HR0 J;  3GII A;  4PYD A;  2PA8 D;  1NSQ A;  2L9W A;  2P9C A;  2RNE A;  4Y2C A;  3MMB A;  4AT1 B;  2XM3 A;  4RO0 A;  4AQY F;  2C2R A;  4USW A;  2V5H G;  4UY8 T;  4K2X A;  2LDI A;  1SJ3 P;  1FVS A;  1GK8 A;  3TA2 A;  5D3G B;  4B3R J;  2B0G A;  1UMJ A;  2XGQ A;  1I1G A;  2F4V J;  4IYQ A;  4AE5 A;  1OYE A;  5HO4 A;  4LJM A;  5JMN A;  1S0O A;  5D0R A;  3V6D A;  5EWG A;  2DB1 A;  4P7V A;  1WG5 A;  3EGZ A;  2YKA A;  3MMC B;  1NK9 A;  4A4J A;  1UTA A;  3CC2 S;  3T1Y F;  3D54 A;  1RWO B;  1G1X A;  2PA3 A;  4P10 A;  3LUY A;  4CNY A;  2HQG A;  2WVD A;  4ITS A;  1PG5 B;  1TUV A;  2GIQ A;  2ZM6 F;  4A8X A;  3MDF A;  5C25 B;  1U24 A;  5HBM B;  1NKC A;  4NLS A;  1P1L A;  3CXC R;  1NAQ A;  4RWX A;  3AKO B;  1VQY A;  3C16 A;  2UUA F;  3QO9 A;  2BVZ A;  4IQX A;  4NLD A;  2ZM6 J;  2YNH A;  4BWM A;  5HN0 A;  2BAN B;  1JJ2 R;  4ZVH A;  3W5Z A;  2B4V A;  1NLT A;  1REV A;  1C1C B;  1FA0 A;  3M8Q B;  3BGU A;  5ETM A;  2YNG A;  1EKS A;  2BKO A;  2C42 A;  2VL1 A;  2QC3 A;  3AOB A;  2ZOM A;  2B43 A;  4J7C A;  1G4C A;  3IMQ J;  3MCM A;  4RW8 B;  1IKW B;  1YJW S;  1NO8 A;  2QSF A;  2GNK A;  2DNN A;  4DOZ A;  2RUS A;  1KSP A;  3NL0 A;  1JLB A;  1VMB A;  2A10 A;  1ZM2 A;  3O6Q A;  4I68 A;  5AE2 A;  5CYJ A;  2DR8 A;  2HBR B;  2POK A;  5KFL A;  3MCO A;  2XMT A;  5KFS A;  4PR6 A;  1G3O A;  3CC7 S;  4QPT A;  3JQJ A;  1NJX A;  2XCP A;  5I42 B;  1VDH A;  3NS5 A;  1VQK S;  3I5A A;  4CLU A;  1YGY A;  1P6T A;  1Y7P A;  4ETX A;  2KT5 A;  2CPJ A;  4O23 A;  3BRE A;  2DY9 A;  3NXZ A;  3WDO A;  3PIP Q;  1U0H B;  1UW9 A;  4KHM A;  2VG6 A;  5C2C A;  4ZCK A;  5L9N A;  5KT4 A;  2W4D A;  1R6V A;  4WXW A;  2A6M A;  3ET6 A;  2B26 A;  1BQM A;  4ZLN A;  4ILR A;  4KE5 A;  4XTT A;  5HMX A;  3J7Y U;  3MMA A;  5SUH A;  1MSW D;  1NBE B;  4ELT A;  4LF8 F;  2YKQ A;  1S99 A;  4DSI A;  4Y3C A;  2A3J A;  2QLW A;  4RW4 A;  2W7P A;  3DOL A;  3M6W A;  3OUY A;  2DRA A;  3JSY A;  2YWF A;  2J0W A;  3TOQ A;  4C9D A;  3OFH A;  2ZJR Q;  3OVA A;  5B0E A;  1FWK A;  2QG9 B;  3AOC A;  3DYA A;  5IS2 A;  4K0K J;  5HJY A;  1JXE A;  2AJ2 A;  2FLP A;  4XAK A;  2ZHO A;  3H25 A;  4UY8 5;  2HVZ A;  1XR7 A;  4DV6 F;  2D3O R;  3VTI A;  3IAM 9;  2DY1 A;  4Q45 A;  3H4D A;  4OYP A;  4CZC A;  2BJ1 A;  2LU1 A;  4I2P A;  3W2V A;  3KHH A;  5D4N A;  1ZZN A;  1ZET A;  3Q24 A;  2J8S A;  4ERD A;  4WU3 A;  1WKJ A;  4ZPC A;  3BQ1 A;  2HUR A;  1HI8 A;  3GE9 A;  2EFN A;  2V8G A;  2VC0 A;  3VQS A;  4QCL A;  2CJA A;  2N3L A;  3TEH B;  4C2M A;  4X4S A;  2XCA A;  1VGY A;  3A13 A;  3FFI A;  1RT5 B;  2MZJ A;  2GAH C;  2VQF J;  5J2N B;  2HVD A;  2RVJ A;  1NDP A;  2BJE A;  1IJE B;  4OZJ A;  3OV7 A;  1JLE B;  4NEY A;  3UPF A;  2IM0 A;  1ARO P;  1BD6 A;  3SFG A;  4YS2 A;  4X65 J;  2ZH5 A;  2YX1 A;  1JK9 B;  4K5S A;  4DV0 J;  4V19 J;  1KLN A;  2DHH A;  1OQ3 A;  3M30 B;  2ZZM A;  1JJH A;  1N33 J;  2HGN A;  1REV B;  5AJ3 F;  1S97 A;  4PWD B;  1KWM A;  2CJ9 A;  3GYX B;  5ADZ A;  3EM1 A;  3FEZ A;  3L7O A;  3PTW A;  3Q8R B;  2B4U A;  3TX0 A;  4JUZ A;  2RHS B;  3WBZ A;  4A8Y A;  1L3S A;  2FJX A;  2XO6 A;  1EJ7 L;  1NM2 A;  5IFM A;  2XC9 A;  2UUB F;  5HRO A;  1AZS A;  2PII A;  3BKT A;  2P8I A;  1J27 A;  2MYF A;  2QMX A;  4MH8 A;  2V63 A;  5C42 B;  4DCO B;  2AYB A;  2GZO A;  1SQF A;  4RW7 A;  1B3T A;  4HT7 A;  2VJV A;  5KG3 A;  2AYM A;  2ZJQ Q;  2DT9 A;  5J1E A;  2WZ1 A;  3X1L B;  3UCU P;  4ECS A;  2HAF A;  2HGM A;  1QY7 A;  2DCL A;  3HVW A;  3QJL A;  3FUY A;  4N47 A;  3J7A 1;  4AL7 A;  1IKX B;  2OML A;  5LJ5 Y;  4M5M A;  4RX6 A;  3JSM B;  3WHI A;  1CQM A;  3EMT A;  4X66 F;  5DZ7 A;  2OP5 A;  1I6J A;  4IR9 A;  4RBV A;  3X3U A;  3SCI E;  3IRX A;  3HVT A;  4CLK A;  3M8W A;  3KK1 B;  2LXI A;  2XYP B;  3CCE S;  1W2I A;  3BF4 A;  3BO4 A;  1UL3 A;  3EIC A;  4LFC J;  1TKT A;  3MMA B;  3TO8 A;  4A8M P;  2C2Z B;  3M8R A;  2ZH4 A;  3M8S A;  4TLR A;  1T11 A;  2HZA A;  3DLG A;  4LRE A;  4NOH A;  2XZT B;  4JI8 F;  4OI6 A;  3TA0 A;  3UWT A;  1CLF A;  1NUE A;  3SV4 A;  2Y0B B;  1KQK A;  4Y65 A;  1T02 A;  3MM7 B;  1UVN A;  4KGK A;  1F0X A;  1RTI A;  4GVL A;  4U95 A;  4MJK A;  1HBO B;  3OXG A;  1RXO B;  2AGO A;  4JI3 F;  4IDK A;  3OVS A;  3I5B A;  1JNR B;  4RPF A;  4IO9 Q;  3BGR B;  3HP6 A;  1R0A B;  4PWD A;  3IM9 A;  4PQU A;  4ZP9 A;  4RBT A;  1IVZ A;  2MSS A;  2DBB A;  1QDU B;  2C2E A;  5HSP A;  3PFO A;  4B3M F;  1W26 A;  2ZE2 B;  1IKY A;  3R7B B;  4H4M A;  2BW2 A;  3R1H A;  1VFJ A;  3RW7 A;  1IBM F;  4Q0B A;  1FE0 A;  2PT0 A;  2Z0G A;  4N77 A;  5J1P A;  3SYZ A;  2I1R A;  4WFZ A;  3FGV A;  2E1P A;  3CC4 S;  4EYI B;  3PRB A;  2DH8 A;  3QBC A;  1RU2 A;  4X84 A;  3I56 S;  1TTH B;  2W2P P;  3A12 A;  4YQW A;  5KFF A;  3C5X C;  3M7V A;  2CNO B;  2VPZ B;  2LYV A;  3FFI B;  3OPK A;  5ETT A;  3BGL A;  2CPD A;  4O4G A;  2A1B A;  1F9H A;  2UV8 G;  2YVS A;  1HNZ J;  5BXI A;  2NSB A;  5M2R A;  3GQC A;  4F4Z A;  3K17 A;  5IT9 Y;  4IG3 A;  2I6W A;  2JVM A;  3KWM A;  1QAX A;  1YQH A;  1U48 A;  1OYD A;  4U9R A;  1S1X B;  4CWB A;  1I51 B;  3BJY A;  1S4E A;  3KG0 A;  4LQ9 A;  4TLQ A;  3LOU A;  3TAP A;  4B9V A;  3HVT B;  3UI3 A;  2KJW A;  1J5O A;  2K1R B;  4R8U B;  2E9R X;  5KG5 A;  4WTO B;  3Q8P B;  3B6B A;  3PW7 A;  1IN0 A;  4DX6 A;  3R97 A;  1NPR A;  3GSI A;  1N34 J;  3P8B B;  2EG2 A;  1DBD A;  3MM5 A;  3FCW A;  2PE8 A;  3NY0 A;  4W92 B;  1FJG J;  1HWK A;  2Z57 B;  1QTM A;  4QIV A;  2LKZ A;  1OS5 A;  2KU7 A;  2CPZ A;  3OQ2 A;  4WWS A;  3K5L A;  3PZP A;  4CO4 A;  4BDP A;  3GCX P;  1KRP A;  2OKQ A;  4KGM A;  4YY3 F;  2OTL S;  3PO4 A;  1YJT A;  4W98 A;  2HS4 A;  2X1F A;  2C2K B;  1TQL A;  4JI3 J;  1E6V B;  2OLW A;  2W7A A;  4CTA B;  2XS5 A;  3ISZ A;  5ETP A;  4AYB D;  2RT3 A;  1RAD B;  4F3M A;  1FHT A;  1S9G A;  1WJ9 A;  4FVM A;  4QR1 A;  2CDQ A;  3CT9 A;  5L1K A;  3PVX A;  1LWE B;  1QUP A;  5KFT A;  2BE9 B;  3LP2 B;  4DFM A;  2KVI A;  3DLK A;  3PEH A;  4ZVT B;  3VAF A;  3FRY A;  3BYP A;  3PKM A;  3W2W A;  3QT8 A;  4WZM A;  1U1M A;  4TU8 A;  2J9E A;  3VQT A;  2O1P A;  2R2U A;  4DX5 A;  4FBU A;  4USV A;  1NJW A;  3F56 A;  2HVH A;  2KM8 C;  1XBW A;  4LF1 A;  1URN A;  5FD1 A;  3Q23 A;  2JJ4 D;  4PRF A;  4M5H A;  3TEG A;  2E1C A;  5C24 B;  3DLB A;  1C3G A;  1RE1 B;  2J9D A;  1KFS A;  1NJI T;  2XS7 A;  1RCX B;  4OHW A;  4O3Q A;  2O67 A;  4OX6 A;  5F41 A;  2KO1 A;  1XTZ A;  1HI1 A;  2LXF A;  1YHQ S;  1JLF B;  2NZC A;  1U8W A;  4CRJ A;  1WOO A;  3UE2 A;  1P1T A;  3G2X A;  3MM8 A;  3RR8 A;  2CWK A;  1J5O B;  2E9Z A;  1TV6 B;  3SBM A;  5LT5 A;  2Q2G A;  1LWF A;  1ELO A;  1YIT S;  2GHP A;  2MHE A;  2MLZ A;  1S7I A;  1TZ0 A;  1D1U A;  3QGH A;  2NYI A;  4LIR A;  3KJN B;  5HP1 A;  1C0U B;  4TU7 A;  2MLY A;  1UFW A;  2VU5 A;  2YY3 A;  3A8I A;  4HI2 A;  1YRU A;  3G87 A;  3R27 A;  4MK9 A;  4TY8 B;  4JI7 F;  4C8Z A;  1TL7 A;  4ANC A;  5HJX A;  4DL5 A;  3PX0 A;  4H4K C;  3CDB A;  1BGX T;  4YB1 P;  2OIH A;  1HBM B;  2VOD A;  3JS9 A;  1X4C A;  4K4X A;  3MM8 B;  4XDC A;  3RAM A;  2ZBQ A;  1FRI A;  5IV3 A;  1FRK A;  4DN9 A;  1CG2 A;  3A8J A;  3JAM Y;  3J7Z 5;  2LLZ A;  2XWX A;  2Y8W A;  2V4R A;  3M6V A;  4URG A;  3OSP A;  3KLV A;  1I94 F;  2ACY A;  5CQG A;  2XY6 A;  3PY8 A;  3S7R A;  5KFE A;  1U45 A;  2CJB A;  3OFG A;  3KK3 B;  2OEL A;  4M63 A;  4OJH A;  4U7U K;  3ZTO A;  3IBF B;  1H38 A;  1RT3 A;  2MTL A;  1UVM A;  2D3U A;  3CNQ P;  3OR1 B;  3IR6 B;  3DRX A;  3N4W A;  5EX0 A;  5DG9 A;  4K4S A;  4AXI A;  2MKC A;  3E2E A;  2E1M C;  3HXM A;  2YWG A;  3BGR A;  1R0A A;  4UQT A;  2Z2L A;  4GC6 A;  2L9D A;  1NPP A;  3R5J B;  5DO2 A;  5EHH A;  2ZKU A;  1V3S A;  3UO0 A;  4XPE A;  5HLF B;  1JJ4 A;  3HM9 A;  4CO0 A;  3M1V A;  4EI2 A;  5I3Q A;  2XGP A;  1YI2 S;  4K4U A;  3QRP A;  3AGZ A;  1O6X A;  4MAK A;  4CYU B;  4FYV B;  4ZP7 A;  2B6A B;  3HZE A;  1U49 A;  1QSS A;  5SZT A;  4WU2 A;  4Q44 A;  2GHV C;  2VJU A;  2W1B A;  1AB8 A;  3LP1 A;  1YRX A;  3HJF A;  3HMJ G;  1U8S A;  4AUK A;  3M2R A;  3T1Y J;  4WYW A;  1FI4 A;  2BE2 B;  4C11 B;  2JWN A;  3FRZ A;  2IVF B;  4DL3 A;  3ETM A;  3UCG A;  2OUG A;  1RTZ A;  1WC4 A;  2GIR A;  1HHS A;  3DI6 B;  3KYL A;  3H90 A;  3E51 A;  5KFB A;  2B9E A;  2ILZ A;  2J9D E;  2LQ8 A;  2YQ1 A;  3HT0 A;  4NLY A;  4ED4 A;  5DM7 Q;  2XBP A;  2YNF B;  1F60 B;  5AT1 B;  3ZFV A;  5EN1 A;  2V4Q A;  4MTP A;  2VHG A;  2JHE A;  2MKY A;  3KUE A;  2JEI A;  4K4W A;  2FGO A;  2GW8 A;  2OEM A;  3L9Z A;  2P5V A;  4F4X A;  4O3R A;  1RT1 A;  5F3T A;  4RW7 B;  2OH2 A;  4DSF A;  1RT4 A;  1RSC A;  3GZ7 A;  1M0S A;  3HHN B;  5F3Z A;  3I9Z A;  3N0V A;  5EGY A;  1NHK L;  1L3U A;  2HIQ A;  3WC0 A;  4CLP A;  3K5P A;  3J81 U;  4DU8 A;  1FD2 A;  4ZPW R;  4DX8 H;  3GU0 A;  4Y28 C;  3BSC A;  5I3U B;  4L72 B;  2JLF A;  1FFW B;  3P6Y C;  3WIU A;  3MAA B;  1RA6 A;  3SSR A;  4AD6 A;  1WNE A;  3G82 B;  3MHY A;  4ID8 A;  1VQ5 S;  1GXU A;  3KHG A;  2XSJ A;  2ADC A;  4LMZ A;  4LIW A;  2A0F B;  2D1C A;  2UXC F;  2CDR B;  2GCF A;  1QE1 B;  2VDI A;  4IG0 A;  5CAB A;  2E29 A;  3TVK A;  4KQZ A;  3KLH A;  5G0R A;  3PM9 A;  3GV8 B;  4M5K A;  4IOA Q;  2P6S A;  2MB0 B;  4DS5 A;  4ZVG A;  4O0N A;  1YX2 A;  1SVD A;  2RU9 A;  2YTC A;  4I1T A;  3UW1 A;  2ZH3 A;  2GV1 A;  4TXS A;  5E2Q A;  1XMB A;  2ZZT A;  4ZLJ A;  3KLI B;  4B9L A;  1JLA A;  2Z4P A;  3LAK A;  1UJ5 A;  2R2S A;  4ED3 A;  1SB6 A;  5GAH I;  4LF7 J;  1Y3J A;  4OJG A;  4KHP F;  3CJ3 A;  2KFN A;  1BHN A;  1RBA A;  3BN4 A;  4MIB A;  2IYG A;  4CLT A;  4C0O C;  4DPT A;  3DU5 A;  5LMU J;  3LPY A;  2CA9 A;  3NNA A;  5KG0 A;  4IOB A;  3QSY B;  2V67 A;  5F9N A;  4IRC A;  1M5H A;  4WE1 A;  3EZU A;  1YLX A;  4FNI A;  4JI4 J;  8ATC B;  1HNZ F;  1AUS L;  1P9Y A;  2VC1 A;  2CQ0 A;  4PYA A;  1E6V A;  4CTA A;  5D4O A;  3H7H B;  4FF1 A;  3DOM A;  4ELU A;  1JB0 C;  4RUB A;  4DCJ B;  1Y3K A;  3I9V 9;  3M4X A;  2DNY A;  3CJ8 A;  3VWS A;  2VG5 B;  2M3D A;  5I4M A;  1DLO A;  3GIK A;  1CJU B;  3I5C A;  3MEE B;  4QIF A;  1VLY A;  1SH0 A;  2F4F A;  4UST A;  3JAM U;  2HVI A;  1C1C A;  1VQ4 S;  3C15 B;  4X65 F;  4QQB A;  4X4R A;  1MWQ A;  4DR6 F;  2HND B;  3GLJ A;  2H4Y B;  2K1R A;  2ZNZ A;  4FDF A;  4I56 A;  1N32 F;  2VQF F;  3TZY A;  3Q8V A;  1TKZ A;  3NGD A;  4MK8 A;  1PSD A;  2UU9 J;  3BR8 A;  3HUL A;  3HX9 A;  1Q82 T;  2BA9 A;  2Z56 B;  1OSD A;  4FF3 A;  3R3T A;  4L74 A;  2VFT A;  2J6U A;  1XNR F;  4ECR A;  2NXN A;  4CH1 A;  2HWH A;  1S10 A;  2GC8 A;  3D2W A;  3VGT A;  4LF4 F;  4X62 J;  3JSB A;  1T9W A;  4NL5 A;  1FDD A;  4OYB A;  2ZC3 A;  3ZO7 A;  3G6E S;  4D3G A;  4F02 A;  1RLC L;  2NZ4 A;  1WKL A;  2CZV C;  1T9U A;  2Z58 B;  4IFY A;  1NEE A;  3MM9 A;  3H20 A;  3HVA A;  1VRT B;  2R7W A;  4C7Q A;  1NKE A;  3R5A A;  4X66 J;  1WHW A;  3UCZ P;  2HWI A;  4PXB A;  4X64 J;  1IM6 A;  3TRG A;  3M9N B;  3MR7 A;  1RYS A;  3ETO A;  3ZZO A;  2RDI A;  3FMB A;  2XLJ A;  1Y00 A;  2JC0 A;  1V5V A;  2BE2 A;  2CAJ A;  3DXS X;  3IR7 B;  4MKV A;  4PQA A;  4UOG A;  2MQP A;  1ZPV A;  2AWZ A;  5GAE U;  2RD5 C;  2AU0 A;  4M5I A;  3IRW P;  2QEX S;  1JLG A;  1WHX A;  2M70 A;  2PFD A;  2RQM A;  4ZKA A;  1R43 A;  4DPX A;  3V6K A;  1U47 A;  2DPI A;  2HMI B;  3ZZZ A;  2ZBC A;  2QL7 B;  4N76 A;  1P27 B;  2F5G A;  2F7V A;  2N4C A;  1B4S A;  1UFL A;  2P9E A;  2UUT A;  2ZOF A;  5IWA J;  4YP3 A;  1UJ6 A;  3CJK A;  3IR5 B;  1N4L A;  2WSC C;  2ASL A;  1SC6 A;  2XNR A;  1JLA B;  4KIA A;  3JTO A;  4EK2 A;  3J81 Y;  4EEY A;  2UUW A;  3L7P A;  3I96 A;  3C14 A;  3DRS A;  3MD3 A;  4ZVF A;  1UVK A;  4A8O A;  4DN0 A;  4ANE A;  4OYI A;  4JI2 J;  2FZG B;  3GIR A;  5DG7 A;  1Q1K A;  4TY9 A;  3TVY A;  1LFP A;  2OPS A;  2WBR A;  5E33 A;  4PUO A;  1Y10 A;  3CGI A;  4ZHR B;  1QSY A;  3HHL D;  2ALZ A;  4DV0 F;  2AJ0 A;  4EYH B;  3D9B A;  1RWP B;  3AQO A;  4HHU A;  3T1H J;  2YBV A;  4ZCI A;  4QYZ K;  1P9Q C;  2HIY A;  5KG2 A;  2V0N A;  3RB4 A;  1PBA A;  2GFF A;  4IRD A;  1T94 A;  1F3V A;  4CCH A;  3NMA A;  2RAQ A;  3LAL A;  1SL2 A;  4AND A;  3JB9 k;  1WOS A;  3W5X A;  1HPZ A;  4M94 A;  3DFE A;  1NSK L;  3OBI A;  1NB2 A;  2Q1L A;  1K1S A;  4ES1 A;  4ZK7 M;  3MAQ A;  3LPE A;  4V19 X;  5AXL A;  5K14 A;  5B0D A;  5IT4 A;  3CUN A;  2ZBI A;  1F5C A;  3D6F B;  4USJ C;  1F9F A;  3FQK A;  4ED7 A;  3FEX B;  2VBW A;  2L3M A;  4CNZ A;  5D6G A;  1XC9 A;  2CZ4 A;  5KFD A;  1ZZF A;  1X4H A;  1Q8I A;  4H4K A;  4WCE Q;  2X3G A;  4ZA1 A;  2OPR A;  1WEY A;  1HNW F;  4JI5 J;  3L95 X;  2M9K A;  3CE8 A;  2W9C A;  3QLH A;  3WQP A;  9ATC B;  1H2V Z;  2AX0 A;  2EC2 A;  5L1I A;  1CJV B;  2UXC J;  5A6P A;  1XNQ F;  5KG6 A;  4FZV A;  2DHA A;  1WHV A;  2XZW A;  3FCV A;  2VF3 A;  2QFJ A;  4LF8 J;  3M8Q A;  1VRT A;  4W4M A;  3R7N B;  4LFB F;  1WEZ A;  2Y9H A;  2WAQ D;  3A3O B;  1FTC A;  2MZS A;  4F67 A;  4RZR A;  4GRS A;  1RTJ A;  2F65 A;  2X3D A;  2VD3 A;  3BPD A;  2OPP B;  3M6X A;  2QT7 A;  3I4P A;  5E3P A;  2R9L A;  4TVA B;  4X4T A;  2ALY B;  1LW2 B;  4FS1 A;  4HAC A;  2HHU A;  4MIA A;  2X51 A;  3CED A;  1D0E A;  5KFQ A;  5D4P A;  3OTC A;  1ZYQ A;  2RDJ A;  4KH1 B;  2KKH A;  5DLF A;  3RYL A;  4DFP A;  3I82 A;  4IH5 A;  3GIL A;  2CRL A;  3V4M A;  1PO6 A;  1U0S A;  2WOM B;  4Z7Y A;  2LU2 A;  2BX6 A;  2QJ3 A;  1FEH A;  2QV6 A;  4J9L A;  3QT5 A;  2FVS A;  2KHC A;  2CQD A;  5A8R B;  3LTO A;  2HND A;  2VKR A;  3PNI A;  2BJ8 A;  3P96 A;  4F0M A;  4ZPT R;  3SXL A;  2H9Z A;  3CO9 A;  3N6L A;  3W9J A;  1KNZ A;  1YJU A;  2V94 A;  3AXM A;  3D6H B;  4X64 F;  2CQC A;  3SCJ E;  4NEZ A;  1U2F A;  5J1E B;  3T5J A;  2VBY A;  5KT6 A;  1FKA F;  3TR5 A;  1RTD A;  4KPY A;  1TL4 A;  2ZBR A;  2RQK A;  2YWE A;  4QZV B;  4OZ5 A;  5A8K B;  3KLE B;  3V4I A;  1N6Q B;  1LW0 A;  3H2U B;  4NX9 A;  2FJW A;  3DRS B;  2QA4 S;  2FHM A;  2ZDO A;  4LF4 J;  3QIP B;  4Y6I A;  3RR7 A;  2IRY A;  1WC1 A;  4ZJO A;  3KLF B;  1W2B R;  1YG0 A;  3DOK B;  1XMO F;  3MEC A;  1S49 A;  3RRG A;  1AA1 B;  4A8Q A;  1DRZ A;  1MRO B;  3G9C A;  2PEB A;  4YUD A;  1X9S A;  2CJX B;  2HQF A;  4O4G B;  3FNN A;  4GKJ J;  2WVF A;  2BXJ A;  2RIJ A;  3MD1 A;  2XO7 A;  1LK5 A;  1T8E A;  1KVJ A;  2RDD A;  2GMH A;  3BH7 B;  3KJF B;  2HMI A;  1YJV A;  3LAM A;  5KOX A;  2DR9 A;  2G4B A;  1K0T A;  2OEJ A;  4NA1 A;  1N5S A;  2QYC A;  4KKO B;  2MPU A;  1N5Y B;  1KLM B;  3QPI A;  4ED2 A;  1RZM A;  3GP9 A;  4LRD A;  3MOJ B;  3CCJ S;  3CIM A;  3ZTS A;  1UFK A;  3QRR A;  3DLL Q;  4RNO A;  3HHE A;  4M5N A;  2G13 A;  4USM A;  1ZS6 A;  3FKB A;  1TAU A;  1FCA A;  1APS A;  1JLE A;  5KT3 A;  2U1A A;  3K8W A;  4ZVU B;  1YJ7 A;  4WP8 A;  3ZZY A;  1RKI A;  2Y0S D;  3O8W A;  2D69 A;  4LF6 J;  1BXN A;  1R8B A;  1HLW A;  5HVH A;  4QWE A;  3C6E C;  2QA2 A;  2YH0 A;  1UP1 A;  1OSC A;  1VOM A;  1KQG B;  1JJC B;  4KV8 A;  1Y5I B;  4DCP B;  2APO A;  1JLC A;  5A76 A;  3QYY A;  1EET B;  1NRK A;  2DNK A;  3AD9 C;  4BWJ A;  5KFN A;  3QFW A;  4DF8 A;  2FY1 A;  4LQ3 A;  5LL6 d;  1DUR A;  3DC2 A;  3I6P A;  4Y0F A;  3QID A;  4DL6 A;  1MMN A;  1NZ8 A;  2N3O A;  2YWK A;  4OYW A;  5CAA A;  3K0J A;  2K2P A;  4DL0 C;  3PJW A;  1JX4 A;  4Y2M A;  2W4C A;  2YKN A;  3FZB A;  5KOW A;  3MI7 X;  2EC0 A;  4N56 A;  3EZO A;  5DDR C;  2G1H A;  3KDN A;  1TP7 A;  4NAS A;  1EB0 A;  1VQ6 S;  3A8E A;  1TL1 A;  1WI8 A;  4DHV A;  1GT8 A;  1IKX A;  3HDS A;  3DXB A;  3DOL B;  3MR3 A;  3EX7 B;  4IH6 A;  5F0U A;  3CPW R;  3CJ0 A;  3UNY A;  2H51 B;  3D66 A;  1SJR A;  3R8Y A;  3SCL E;  5DDP C;  5A8R A;  1RT7 A;  2ATC B;  2AZ1 A;  4QIG A;  3K8V A;  5FDL A;  3UDV A;  3MUR P;  1R31 A;  3SSS A;  4DV3 F;  1FNX H;  2WSF C;  2FJE B;  4OZ0 A;  4C11 A;  3CDU A;  1H72 C;  3C14 B;  4GO7 X;  1QLN A;  4QWC A;  2DTJ A;  4P71 A;  4BC7 A;  3VF0 B;  3RW6 A;  3BV8 A;  3L09 A;  2CZ9 A;  4QBU A;  4KO0 B;  3DGV A;  4H4O A;  4QR0 A;  4J9R A;  1EP4 B;  2DGU A;  2FVR A;  5ETV A;  2LCW A;  1RA7 A;  1SH2 A;  3DMJ B;  4NLQ A;  3M2V B;  3QGP A;  2DGT A;  4NRU A;  4CM2 A;  5HQM A;  2HLT A;  2W2N P;  3AB2 B;  2DPJ A;  2VG7 B;  2VV5 A;  1RTJ B;  3KFW X;  4I69 A;  4LR7 A;  3U02 A;  4N8N A;  4LRC A;  1NLK L;  2KJV A;  1U1P A;  1VQ8 S;  1CJT B;  2DXD A;  2HFU A;  2C2D A;  3B4D A;  4OHX A;  1BQN B;  4I7F A;  1RWV B;  3LWL A;  4YR3 A;  2NRE A;  5C24 A;  1S6P B;  1FRL A;  1N34 F;  4YB6 A;  1RWM B;  2XMJ A;  3H4B A;  3KNG A;  1N0U A;  2CPF A;  1SC4 B;  3K59 A;  2YNG B;  2LQ5 A;  2AGP A;  2CQB A;  1S77 D;  1S72 S;  5IQQ A;  5J2N A;  2Z8Q A;  4IFY B;  3AGY A;  1G7C B;  2X1G A;  3KG1 A;  1TL5 A;  2FDN A;  2MJN A;  4FKY A;  1KBR A;  4UOF A;  4JI6 F;  4YME A;  5HMZ A;  5FLX Y;  1JWW A;  2DK2 A;  3M2V A;  3DLE A;  4QW9 A;  4ZVR B;  5T7L A;  2C3P A;  2NPF A;  5LXY A;  2KTQ A;  3IN5 A;  3CCT A;  4TY8 A;  3R5D A;  1HL6 A;  1C1B B;  4K4T A;  1XWL A;  2FJD B;  2KB2 A;  2J5A A;  3RB3 A;  1TKT B;  2M4M A;  1LW0 B;  3W63 A;  3THV A;  2AYG A;  3MPD A;  4WKR A;  1TV6 A;  4DPY A;  2Y1R I;  3WIV A;  1X4B A;  4O3O A;  3KK2 B;  4NA2 A;  4BBY A;  5ETK A;  1SJ1 A;  3C2P A;  3OHB A;  2G0I A;  5LSR A;  4O44 A;  4WP3 A;  4DLE A;  1NHU A;  1YBU A;  3CDE A;  5BYS A;  3OTB A;  1S1V A;  1XMQ J;  3Q22 A;  4C97 A;  2V34 A;  2CAD A;  2LMI A;  5LMN J;  2PEH A;  3T5H A;  1T03 B;  1U4B A;  1KTQ A;  3R2C J;  2D9P A;  1MU2 A;  2LFV A;  2IJR A;  2ASJ A;  2ZDP A;  1H2U X;  1S4F A;  3HFV A;  3M2R B;  3NCR A;  4L73 A;  1RWN B;  4ZIT A;  1PBU A;  5H1S V;  2ZH1 A;  1VQ7 S;  4LR9 A;  1C1B A;  2RRB A;  2IAJ A;  2P2C B;  1IKV B;  1FT8 A;  3FCH A;  2BM1 A;  4I2Q B;  4TNO A;  5E3A A;  4B3T J;  4I67 A;  4OL8 A;  1PYS B;  4Y2A A;  4DBQ A;  4P6Q A;  2YQ3 A;  3MPY A;  1LWE A;  4LSN A;  3DGP B;  3TUI C;  2FJA B;  1X9M A;  3P49 B;  5IT0 A;  3W7B A;  4HI1 A;  3LGH A;  2FLO A;  1IWA A;  2L9N A;  1TFY A;  2VA3 A;  1A7G E;  2HKE A;  2HFZ A;  3MM6 B;  2KXH A;  1SXL A;  4R0E A;  1RQ0 A;  5K8O A;  2IM3 A;  5B0A A;  3UQS A;  3VGS A;  6FDR A;  1BUX A;  3JYT B;  1V9O A;  4GKK J;  2DIT A;  2GGP A;  3TQE A;  2PFF B;  2MGZ B;  3ENW A;  1Y9O A;  1NH8 A;  2ZE2 A;  2FTR A;  4J9U E;  4NA3 A;  2Q6C A;  1U02 A;  4TYB A;  4NPO A;  4JI1 F;  2ILY A;  2UXB F;  3RUB L;  5GAG U;  2W9B A;  2AQ4 A;  4O44 B;  2B9Y A;  1YK9 A;  2HQ3 A;  2LP4 A;  2H4W B;  3IBC B;  1YJN S;  2KN4 A;  2Y1L B;  2U2F A;  1QVF R;  3KK2 A;  3MAA A;  2MXY A;  4U67 Q;  4F26 A;  3I0S A;  2AHO B;  5J2M A;  2KZM A;  2QLF B;  3ICL A;  3GPA A;  1S6Q B;  2GVZ A;  2QSW A;  2L48 A;  5K8N A;  1N36 J;  2HFS A;  1SBR A;  1RT6 B;  2I5J B;  3CDW A;  1HAR A;  1R7I A;  3Q8S B;  5D4L A;  3OL7 A;  2O5D A;  4RU9 A;  2XLK A;  4DS4 A;  1Q8B A;  4M8L A;  2AEF A;  1CS4 B;  1B99 A;  5IM0 B;  5KFI A;  4FN5 A;  3ZTP A;  3DLE B;  2DR7 A;  1RT1 B;  3I55 S;  2B51 A;  3MR2 A;  4ELV A;  3ILO A;  2ZH2 A;  5HI7 A;  2FHJ D;  2YKM A;  1X8D A;  4ECT A;  1UEU A;  1KOH A;  3SZ2 A;  5KFR A;  1KDN A;  1HBU B;  3MOZ A;  1MML A;  1FJG F;  2W9B B;  3NBP B;  1UZD A;  1IR1 A;  1F5A A;  2C3U A;  4DI6 A;  3M9O B;  3GTY X;  1RAA B;  4L3K A;  2YQ0 A;  2NQP A;  2NXU A;  4C8Y A;  4HH1 A;  3ZTQ A;  2IIH A;  3IGV A;  2KZZ A;  5GAE I;  3FZ2 A;  2DNG A;  4BS2 A;  1UA0 A;  2M2B A;  4F36 A;  4CLW A;  1N33 F;  2J7K A;  3BEG B;  3E8O A;  1EKR A;  4F7V A;  3CCR S;  4NI2 A;  3EVM A;  3IXQ A;  1IBK F;  1CSJ A;  3T41 A;  2WHO A;  5DLG A;  2DNL A;  1Q5Y A;  5DS7 A;  2LA6 A;  3NMR A;  3P5B P;  2QLX A;  1VBZ A;  1YBA A;  3NKY A;  1TEL A;  4S0M A;  3HSJ A;  5GAH U;  5A2Q Y;  4OYA A;  1FNO A;  4MIW A;  4QWD A;  1N36 F;  3PW2 A;  2QRR A;  2HHW A;  3KLI A;  2PN6 A;  2IAJ B;  4I2Q A;  2JVO A;  2Z2Z A;  2BKN A;  3DHW C;  5DQI A;  2CNL B;  1WOR A;  4DQS A;  5ETQ A;  1NXI A;  3U7J A;  1U25 A;  4N7T A;  3MR5 A;  2ZVS A;  3H2L A;  1TL3 B;  3QJJ A;  2CVE A;  4ZJL A;  1WF0 A;  2FC9 A;  3W66 A;  3PW5 A;  2HBZ B;  3DM2 A;  3TJ8 A;  1KLM A;  2IMW P;  2DNH A;  2BW7 A;  4OI4 A;  2MKH A;  5IC6 B;  3IAS 9;  1FJE B;  4WFN Q;  4WFA Q;  3G82 A;  2ATL A;  3HKZ D;  2FJV A;  3EGW B;  5KFV A;  2EI5 A;  4Y00 A;  5AE1 A;  1X5O A;  2YKM B;  1Q81 T;  4J9Q A;  3RBZ A;  3NEK A;  1N5Q A;  3GR0 A;  5AXM A;  5A0Y A;  5B0C A;  3TAN A;  1S9E B;  4KC5 A;  2R3V A;  2VIC A;  5F9L A;  1WEX A;  1D8Y A;  3J7Y I;  5KFU A;  1D09 B;  2DRB A;  2V6A A;  4JI0 F;  2QMU B;  5L1L A;  6FD1 A;  2CPI A;  3HK2 A;  2HEK A;  2RE1 A;  3C6T A;  2ZJP Q;  4LUB A;  1C0U A;  4RUA A;  2IFX A;  4DL4 A;  3W2V B;  1VK8 A;  3OTD A;  4JI8 J;  1OY8 A;  1RHK B;  4KR0 B;  4JBC A;  4K50 A;  1HIY A;  1QJH A;  2ZNY A;  2HS3 A;  1JLQ B;  1Y0H A;  5DRK A;  1CJK B;  2MST A;  3ADA C;  1RHU B;  5KT7 A;  2RQ4 A;  1OPZ A;  2F8H A;  4RW9 A;  4QYZ J;  1ZA1 B;  4LF5 F;  1HWU A;  5GAG I;  1BY9 A;  3RAX A;  1FNM A;  4F4W A;  2DNM A;  1HBN B;  2XHC A;  3CJ4 A;  3VV2 B;  5B08 A;  3HSD A;  5D3G A;  4MYT A;  4GO5 X;  1PAU B;  2DHG A;  2WB4 A;  3IG1 A;  1WDD A;  2IA0 A;  4ILM A;  3MM6 A;  2BJD A;  2WOM A;  1CJT A;  3HHL C;  5F8I A;  1VBK A;  2MQ8 A;  1KON A;  1VIS A;  3DDI A;  5K8M A;  3G4S S;  2QGF B;  3LGN A;  3I0R B;  4K59 A;  1H74 A;  4GC7 A;  2VG7 A;  1M1H A;  4UTG A;  3QGG A;  1HYS B;  2V2Q A;  3KLG B;  1PAE X;  1RUS A;  1UET A;  1ZBT A;  3Q86 A;  1FXR A;  4KPC A;  2EFP A;  1SUQ A;  4QWB A;  3MFI A;  3GWC A;  2DRD A;  3SIP B;  3UDC A;  1NCL A;  2DGW A;  2MZR A;  1CC7 A;  4R0J A;  2VFS A;  2DIU A;  4J91 A;  3QRQ A;  3EZ5 A;  2A2C A;  2GJI A;  2IHR 1;  2E7X A;  1K73 T;  4LF6 F;  2UXD F;  4W90 B;  3IBW A;  1GMW A;  2XQC A;  5FJ4 A;  4TKT A;  3A1Y G;  5GMD A;  2ZBP A;  1RHR B;  1DTT A;  3HSG A;  2HYI B;  2WW8 A;  4ICL B;  4ZLP A;  3CCU S;  4IQM A;  5DQG A;  2XSJ B;  3CVK A;  2OPR B;  5C7P A;  5M2U A;  3J80 Y;  4RW9 B;  1Q86 T;  4EO8 A;  4NXM F;  1OQ6 A;  3D3C J;  1KP6 A;  2CQI A;  3AAW B;  3MEG B;  4JI2 F;  3KDO A;  4NCA A;  1V5I B;  4B9S A;  2YKN B;  1QTN B;  1I3O B;  5IM0 A;  3LH2 S;  5I3P A;  2JFD A;  4M5J A;  1HQ2 A;  1F2H A;  2HNZ B;  1C0T A;  1HWJ A;  3G6Y A;  1UWB A;  3VZI A;  2IA6 A;  4LSL A;  1KQF B;  2OPQ A;  4N5S A;  3PR4 A;  3IM8 A;  3EUN A;  5IWA F;  4WXO A;  3S6E A;  4ES2 A;  2KFZ A;  4DV7 J;  2BKP A;  1RDR A;  2CPH A;  1CC8 A;  3SI8 A;  3OXF A;  4KHP J;  2M8D B;  2DHX A;  1C4A A;  3R5B A;  2SXL A;  3RBD A;  5H9E K;  5D8H B;  7AT1 B;  2AD9 A;  4K2J A;  2B9X A;  3LQV A;  3POT B;  3H5S A;  4OJ1 A;  4U6P A;  5J2P B;  3A4T A;  3G96 A;  1CUL B;  2JVR A;  2V4J A;  3B8H A;  2AKW B;  4JOU A;  5K5M A;  3SCK E;  2HZC A;  4EO6 A;  4R5P B;  4WP9 A;  4DV4 F;  2DH7 A;  2FD2 A;  3BH6 B;  3EDQ B;  2ZWO A;  4NLO A;  3DI6 A;  4U7C A;  1WTB A;  1SV5 B;  4LBI A;  4DV1 J;  3GG0 A;  4WJB A;  4JV5 J;  4OQJ A;  4C0B A;  1NND A;  5KG7 A;  1TUW A;  1QM9 A;  3BBC A;  4F8R A;  4DR7 J;  3I87 A;  3CJT A;  4P74 A;  4EZ6 A;  1PKU A;  4ETZ A;  2LQ9 A;  3ULH A;  2OO4 A;  4C48 A;  1VBX A;  2HHQ A;  3GFY A;  5E0O A;  1NDL A;  2KI2 A;  3OL6 A;  1T0T V;  2RKI A;  4OHV A;  2FJB B;  1H7W A;  1M1G A;  1LWC B;  3DHX A;  3OVB A;  4P75 A;  2CPY A;  3VCD A;  2MY7 A;  5CH7 B;  3MFH A;  4J9K A;  4ZDN A;  2PSZ A;  3BM7 A;  3K5N A;  4DEZ A;  2UUB J;  1HPZ B;  3OR1 A;  3R6G B;  4ED1 A;  3NWR A;  3M32 A;  4HL9 A;  2XZD B;  3PO5 A;  2ZZN A;  5KFO A;  4DV5 F;  3GJT B;  2LEA A;  5A8K A;  3LO3 A;  4ECU A;  1RT2 B;  3V4I B;  3GR1 A;  2QX0 A;  2YWH A;  1KR4 A;  2JX2 A;  2NS1 B;  3NS6 A;  4UW2 A;  5CYQ A;  1HI0 P;  3CJR A;  4F0K A;  3CCW A;  1FK9 A;  1Q4R A;  2DR6 A;  3C6U A;  3MM5 B;  4RLE A;  4RNF A;  3KNA A;  2RRN A;  2GVD A;  3W62 A;  4P7T A;  2VKZ G;  3GIJ A;  2OEK A;  4WBF A;  4R8U A;  2ROG A;  1TL1 B;  2PD1 A;  2W2Q P;  1PJ7 A;  3HHL A;  5KT2 A;  1UAW A;  1PC5 A;  2HRY A;  3HO1 A;  4QWA A;  1LNQ A;  2CQ1 A;  2DD8 S;  1RU1 A;  2G9O A;  3PG9 A;  4YEA A;  5F8N A;  3DDK A;  2ERR A;  4KGX B;  1L5U A;  2BOP A;  5L1J A;  3QGI A;  2DNZ A;  4DQP A;  2DXF A;  2H54 B;  1HNI A;  2B7B B;  2HNY B;  2RUG A;  4GKJ F;  5HP1 B;  5CD4 H;  2LQB A;  5L8R C;  5H9F J;  3EE3 A;  3P5T L;  2KFY A;  3CF5 Q;  2Y1J A;  4J9V A;  5CZV A;  2D9O A;  1ICE B;  5T7L B;  2CQ4 A;  1UKU A;  4KSE B;  1Z1Z A;  3CIZ A;  3QSI A;  2BR0 A;  1NK6 A;  4LVO P;  1JXV A;  2AX1 A;  2RKI B;  1ZOT A;  2NXE A;  4NCG B;  5EX3 A;  3U1L A;  1RAI B;  2YWW A;  3Q2T C;  2ZWP A;  4U7U D;  1TUG B;  2RQC A;  4KAI A;  3MEG A;  3M2U A;  2V50 A;  1NSP A;  1WTF A;  1J2V A;  4DV6 J;  2V69 A;  4A8S A;  2J6T A;  4JV5 F;  3BGF A;  3D6M B;  2CJY B;  2FB0 A;  4UUW A;  5GVQ A;  4C3M A;  1B7F A;  4ZP6 A;  3EYZ A;  4DV2 F;  3BPS P;  3AXK A;  3MED A;  1I94 J;  4Q0B B;  1VQ9 S;  3EPG A;  3FJ2 A;  3GG1 A;  4RW8 A;  5DGA A;  4AFF A;  1QD1 A;  3N6M A;  3W9H A;  1P8G A;  5J2P A;  1OMS A;  3HHD A;  2AEJ A;  5BJR A;  5JUM A;  3OL8 A;  3VAM A;  4A47 A;  1SKR A;  2JZ5 A;  4EZ9 A;  2CQP A;  1EQM A;  1RHQ B;  2R7R A;  4OZ3 A;  1SL1 A;  1HBO A;  4ZVE A;  1S1U A;  2BMB A;  3S01 A;  1HW8 A;  2J9C A;  3CD7 A;  1LFW A;  2GS8 A;  3A3N B;  3C16 B;  3FDS A;  3MM7 A;  3PX4 A;  4HDH A;  4C8L A;  3BZQ A;  4RR5 A;  2ZOG A;  2VPY B;  3OSN A;  5D78 A;  3G71 S;  5U47 A;  4G6V B;  2HNY A;  1VRU B;  2ZD1 A;  3AH6 A;  2WON A;  3V2U C;  4NZ7 A;  2V8V A;  3OTE A;  1JKH A;  1DQA A;  3CJ5 A;  3PEJ A;  2ABY A;  2PI4 A;  3UVJ B;  2BAB A;  3AA8 A;  2MKK A;  4B3S J;  1PIE A;  4OFZ A;  3PW4 A;  4JI1 J;  1OJ4 A;  5D0G A;  2BDP A;  1T9X A;  1H7X A;  4B17 A;  2CYY A;  3D7S B;  4EWT A;  1KFD A;  1VCT A;  2FVP A;  4J5O A;  5RUB A;  5G4D A;  4DV2 J;  4EBD A;  3OUY B;  2AGQ A;  3EXY A;  4JI5 F;  1N48 A;  1NKB A;  2KXF A;  4URS A;  5T41 A;  5HVG A;  4KBI A;  4ECY A;  1OWX A;  1UZH A;  5L46 A;  2CJK A;  1OY9 A;  1Y4Z B;  3UN2 A;  2YKO A;  3CUL A;  2HVE A;  3QT7 A;  2V68 A;  4E8U A;  3JQM A;  2EK1 A;  5DQH A;  1VHI A;  4ZVQ B;  3IS9 A;  1LOU A;  2YX7 A;  1MG7 A;  3O2I A;  2FHJ A;  3BB5 A;  3BBB A;  3R6L B;  3H42 A;  3GV5 B;  4DV7 F;  5C5J A;  3G6V A;  4HYK A;  4F2S A;  1S6Q A;  1WDT A;  3FQL A;  4IOC Q;  1BE4 A;  2C3Y A;  4NZ6 A;  1VI7 A;  1IBK J;  1SCJ B;  2AYE A;  4ED5 A;  3DDN A;  1T9V A;  2H3E B;  4WFY A;  2XMK A;  1FX2 A;  2AZ3 A;  1M5V C;  4JV0 A;  4NCB A;  4OHZ A;  3G8S A;  1ZM4 A;  1X7V A;  1VYA A;  2DIV A;  3BYR A;  3FMW A;  1IBL J;  1S1T A;  3KJV A;  5DJB A;  5LMN F;  1S6P A;  3M6U A;  5H9F K;  1YZ7 A;  4GVB A;  2ZUA A;  4KTQ A;  1XQI A;  2RB7 A;  2OJ3 A;  2C2M B;  3M8Z A;  3QLH B;  2R42 A;  4OZ2 A;  4FYD A;  4P52 A;  1WWH A;  1N5Y A;  3GV7 B;  1X31 C;  1S57 A;  1WF1 A;  3OXL A;  4DR1 J;  4NLW A;  1RAO A;  4AQY J;  1CJK A;  2XHW A;  1AXQ A;  2HS0 A;  1E6Y B;  2ZKT A;  4FVC A;  4K7Q A;  4ZVP B;  3TA1 A;  1QUV A;  5F0W A;  2N7C A;  1UA1 A;  2EFG A;  2O3D A;  2IBK A;  3IP0 A;  4KB7 A;  2F9J A;  3NCP A;  4G1I A;  3C46 A;  4DR4 J;  4OZ1 A;  3FSX A;  2M88 A;  2M8H A;  4HHH A;  3SDE A;  1Q53 A;  5E3R A;  4WKY A;  2DNR A;  5HMW A;  5KT5 A;  4DL7 A;  1SL0 A;  3G86 A;  5C25 A;  5KFM A;  1RAJ A;  2QTW A;  4IH7 A;  4XDD A;  4ATN A;  3AJ1 A;  4L6V 3;  2XY7 A;  5D0E A;  3W61 A;  1UVL A;  2L08 A;  3PJ9 A;  4JI6 J;  1T05 A;  1D9F A;  4EGL A;  3D68 A;  1XAO A;  2GML A;  1N5V A;  4J80 A;  4RW6 B;  4V1A k;  5CCM A;  1TR0 A;  1FTR A;  3MCN A;  3TAQ A;  3W8G A;  2OI2 A;  2UP1 A;  4B3O B;  1CEZ A;  3DYA B;  4LVN P;  1FRM A;  3V6D B;  1C4C A;  4GKK F;  4UT4 A;  5LXR A;  4USH A;  4ZHR A;  4DV4 J;  2DJW A;  1DJ0 A;  2BEF A;  2OPS B;  2DGX A;  3AY0 A;  2VG5 A;  4NXN J;  1TVR A;  3D67 A;  4YN3 B;  4PUO B;  1R8C A;  2PMW A;  4LRF A;  3KMS A;  2NR0 A;  1Q7L B;  1YWX A;  3NOG A;  4QJV A;  3D0I E;  1RHJ B;  1VRU A;  2EK6 A;  2ZD1 B;  3PCO B;  4DR3 F;  4NYO A;  1AW0 A;  2J0X A;  3M32 B;  3D5M A;  3FK4 A;  3I4H X;  1S1X A;  3BSO A;  3OD2 A;  1S79 A;  3W5Y A;  1FRX A;  2NYH A;  1SKU B;  3CDA A;  4OIX A;  3SMZ A;  3SEO A;  4BC9 A;  4CO3 A;  1U0H A;  5K20 B;  4RNN A;  2DGO A;  1FFS B;  1RWW B;  1B0V A;  1LWF B;  1VQM S;  4UUX A;  3C19 A;  1XN9 A;  4HAC B;  2KHD A;  3NLC A;  2CNK B;  3AFG A;  2QYG A;  1SC3 B;  1S1U B;  2HRT A;  3PX6 A;  2XYH B;  1M5P C;  3S1T A;  2XMA A;  1T95 A;  2UVR A;  2QZ8 A;  4CT9 A;  2E1A A;  3B82 A;  1D3W A;  4OHY A;  5IT9 U;  3HD1 A;  4N8O A;  4TYA A;  4XPC A;  2MQL A;  4DR6 J;  1KHW A;  1Z2Z A;  1F9E B;  3SQG B;  1X4E A;  3I32 A;  3I38 A;  1EAR A;  5E7O B;  3ZZR A;  3CCM S;  4J9S A;  4BHQ A;  5LJ3 Y;  2X1A A;  2DGV A;  2EFQ A;  3N79 A;  5IQ6 A;  4C8N A;  1IKY B;  3KLH B;  1MWY A;  2W9C B;  2XNQ A;  1RYR A;  3TJA A;  1IBC B;  3N6N A;  3AD7 C;  1GEH A;  1O51 A;  1HBU A;  4M1K A;  2HHT A;  2ASY A;  4DQQ A;  2BRK A;  1JLQ A;  4KRW A;  4NCG A;  1NK8 A;  1VQN S;  2YKP A;  4A48 A;  1BC6 A;  3LP2 A;  4DF4 A;  1DAR A;  2HK3 A;  4G1P A;  2Q79 A;  2YXL A;  3J7Z T;  2BQ3 A;  4IR1 A;  3NCQ A;  3W65 A;  3VVT A;  5HMY A;  2YX4 A;  4HT5 A;  1BWE A;  1WF2 A;  4LSZ B;  3W8P A;  4OI1 A;  5LMU F;  4DPU A;  2FLL A;  1WUU A;  4NLT A;  1S6O A;  1U6Z A;  2R8K A;  5J2M B;  1EQ0 A;  3EXC X;  1EHW A;  4H54 A;  2XG8 A;  2CVI A;  1G6B A;  2AJF E;  1Y5L B;  2H1Y A;  3GB0 A;  3HHL B;  1QAY A;  4F3Q A;  2XLI A;  1TMJ A;  4KHR A;  3QZ7 A;  1HNX J;  1HMV A;  1MN7 A;  1HQE A;  3LAN A;  4XIU A;  4ECQ A;  2XS2 A;  2B3T B;  2B9W A;  3EGV A;  5CYM A;  3ONQ A;  2KRB A;  3ZTR A;  1IBL F;  1YJR A;  5KFH A;  5T14 A;  2C28 A;  1KC8 T;  4LF5 J;  2EW9 A;  5CCL A;  2UUC J;  1UJ4 A;  1BQX A;  1ZM3 A;  2VFR A;  3IC1 A;  3PYG A;  3Q8U A;  2R2R A;  1R27 B;  4FF4 A;  4X4U A;  2B8Q A;  4E0D A;  2FLN A;  3MPW A;  2AT1 B;  1T3O A;  2QA1 A;  1FKP B;  2JZ8 A;  3FBB A;  3H8Y A;  3KKF A;  4P72 A;  5IC4 B;  4E2F B;  3PKY A;  4IUF A;  4NLG A;  1Q7Y T;  4IG3 B;  3CJK B;  4PG5 A;  3BQ0 A;  1Q16 B;  3OL9 A;  1O0P A;  4JI0 J;  2F40 A;  1KHV A;  3RJM B;  2GQQ A;  1BWV A;  1S9G B;  3C66 A;  5KTQ A;  2J6S A;  1LWX A;  3MXH P;  1NDK A;  1YSJ A;  2HHH F;  4DR3 J;  4LFB J;  4RUH A;  2FVC A;  3CJS A;  4DV3 J;  1LQ9 A;  2A6O A;  1RJJ A;  3ISN D;  3H59 A;  2BJ7 A;  4DFJ A;  1IXK A;  3OR2 B;  1WKK A;  1J5E F;  2IC3 A;  3Q2S C;  3T6B A;  2XWY A;  3PHT A;  2VOO A;  3C3L A;  5ETN A;  1CJV A;  2R7U A;  4QU7 A;  4QOT A;  3HI9 A;  2F1F A;  1CQN A;  3MZI A;  4I6A A;  4IG0 B;  4ZIV A;  5GAD I;  4KKO A;  3IWX A;  3TW0 A;  2C22 A;  2W2M P;  3MM9 B;  4WTY A;  3EJM A;  4ZCL A;  1J5E J;  1URR A;  1H6K X;  2E5J A;  2W9A A;  1HNW J;  1FE4 A;  1R0C B;  3M8P B;  2EPI A;  4I64 A;  5D0H A;  3FSI A;  2R8I A;  4FKX A;  3HJV A;  4X4Q A;  1DY3 A;  4O3P A;  3RAQ A;  4J90 A;  1LV5 A;  1QAJ A;  3QO9 B;  3VR1 A;  1K0V A;  2HWT A;  1SH3 A;  2XI2 A;  1D8Z A;  1HQU B;  1NPK A;  3F44 A;  4A8W A;  2DNQ A;  3US5 A;  1HWI A;  1UW4 A;  5HBM A;  1Q78 A;  3C6T B;  3QIP A;  2AIR B;  3ENQ A;  3DLG B;  2J7W A;  4ED8 A;  5HAO A;  4B3T F;  1UWB B;  1TKZ B;  2NXC A;  2N4D A;  3JTN A;  4KT0 C;  2VBZ A;  3VVU A;  2J76 E;  3ILJ A;  4ED6 A;  2CQH A;  5DDQ C;  5LSL A;  1TVR B;  4FNH A;  1DQ8 A;  4DR1 F;  2CFX A;  2MLX A;  1NB7 A;  3ILL A;  2MZT A;  5DZ6 A;  4YFU A;  2ZH9 A;  2UUC F;  3WC2 A;  4J37 A;  4JB8 B;  2WBM A;  1XNQ J;  1LXJ A;  1HD1 A;  2N82 B;  1DLO B;  1IUJ A;  4RW4 B;  4DMZ A;  4DUZ F;  2BQR A;  2Q66 A;  4Q2M A;  1UWA A;  2NUU G;  3P3D A;  4UOC A;  2GGP B;  2HRU A;  4OV6 A;  4WYL A;  4UOH A;  4PZV A;  3BQ2 A;  4H4M B;  1F5B A;  1T05 B;  3FSY A;  3SQG A;  1FRJ A;  2B7C B;  2V8P A;  3D0G E;  2JOQ A;  1OPI A;  2Y8Y A;  4I6Y A;  3Q0A A;  1R8A A;  2GA7 A;  1N5T A;  2R8H A;  4OYZ A;  5JVH Q;  3ISN C;  3RBE A;  1SJ4 P;  3EPI A;  3T3F A;  4CM0 A;  2HQD A;  4IO1 A;  3DLK B;  1U26 A;  2O66 A;  3THT A;  2WVB A;  3HFK A;  4ZOS A;  4G3I A;  2P6T A;  2KG1 A;  1X60 A;  5B0F A;  1AFJ A;  3EVW A;  2KG0 A;  3H0P A;  1JLG B;  1U6F A;  1S6U A;  1RIS A;  2KT2 A;  2ZEJ A;  2CQG A;  4HTJ A;  4DQR A;  3D3B J;  2VPW B;  1FKO A;  3H2V E;  3MCS A;  4M5D B;  2GIF A;  2F9D A;  4QYR A;  3S8S A;  2ZH6 A;  2B5J B;  3IWN C;  3UFC X;  3WX8 A;  1VK3 A;  2J8A A;  3KJQ B;  4QR2 A;  3RB0 A;  1TMM A;  5G0R B;  2MZ1 A;  4LRA A;  4QIE A;  1RK8 A;  1NSA A;  4LBP A;  1S76 D;  2JEJ A;  1S59 A;  1KVI A;  1RAB B;  1IBM J;  2QN6 B;  4CLF A;  1K47 A;  3K5O A;  1YRT A;  4ECZ A;  2VON A;  3VAJ A;  1GTH A;  1V3Z A;  3CB4 A;  4RW6 A;  1YJ9 S;  4NE9 C;  4XO0 A;  4CLL A;  4HEA 9;  7FD1 A;  1JIH A;  4DUT A;  2FY8 A;  2YNI A;  1XJW B;  3CJ2 A;  4CIO A;  1OIA A;  3Q83 A;  3N01 A;  3KUG A;  4CQ1 A;  3K89 A;  4DUY F;  2E44 A;  1YDL A;  1I5O B;  2XYG B;  3BKU A;  3PW0 A;  5L38 A;  1JXL A;  1HFE L;  3RRK A;  3NGS A;  4UZB A;  1RT4 B;  1Q8L A;  2HFV A;  4F2R A;  5HRO B;  1X5P A;  5AXN A;  3HZG A;  3BGO P;  4CLZ A;  2CPE A;  3GJS B;  3G8T A;  2DXE A;  4C3L A;  2WK4 A;  1N52 B;  1TAQ A;  2XMM A;  5L9X A;  1GXL A;  4LFC F;  5AXK A;  1E6Y A;  4P2S A;  3OHA A;  3FVY A;  2PI5 A;  5HAN A;  2DCU B;  3C15 A;  4O4R A;  2OHD A;  3HFZ B;  3OFE A;  3TZW A;  4F4Y A;  4WZQ A;  2KYZ A;  2MKJ A;  2R7O A;  1W25 A;  4WII A;  5E3C A;  3IFE A;  3SQO P;  3UDE A;  4DJB A;  1HA1 A;  5GMK a;  3LW5 C;  2QMW A;  3M8Y A;  4DR2 F;  3V6J A;  4N41 A;  1U6B A;  2HSE B;  4KYZ A;  4CLY A;  5M2P A;  1U1R A;  1RWU A;  1SQE A;  4M5L A;  2JEG A;  1IQT A;  2AW0 A;  3K2Y A;  1HNX F;  1JMT A;  4TQR A;  2FHK A;  2I38 A;  4K5R A;  2WON B;  1VJW A;  4F25 A;  1C2P A;  1BQM B;  4DR5 J;  5KFW A;  2HG4 A;  3MF5 A;  2FUG 9;  3ITH A;  1N32 J;  3V81 A;  4F0H A;  1FKO B;  4M5D A;  3T6J A;  3UN5 A;  4DX7 A;  1NU4 A;  5IXU A;  4YHH J;  4K4Y A;  4NXM J;  4HKQ A;  4C6A A;  1FJ7 A;  4YR0 A;  2COL A;  1Y5N B;  1B7Y B;  1VIX A;  2VG6 B;  4J9P A;  1RB0 A;  4LFA J;  4CYU A;  1GMW D;  5A8W B;  1PYT A;  3DMJ A;  2MQN A;  2WCX A;  1MRO A;  3O1L A;  2LXU A;  4USI A;  4Z2X A;  3KTQ A;  4YOE A;  1IM4 A;  2W4P A;  4AXJ A;  5GAD U;  3I0R A;  1U2C A;  1PCA A;  2RML A;  2VAS A;  2KT3 A;  1VLO A;  4J9M A;  1M5K C;  1YZ6 A;  3DRY A;  3ZZP A;  1FKP A;  4NI2 B;  1TU0 B;  2XB2 D;  1KQS R;  2AMC B;  2K7J A;  2VPX B;  1KS2 A;  3AOD A;  2MZQ A;  3GCW P;  3ZNU A;  1RAG B;  2DHS A;  2FIU A;  3K5M A;  1FWL A;  1S48 A;  2V9K A;  2HHP A;  3T9N A;  4ER8 A;  2OAU A;  2A18 A;  4CO1 A;  5HVF A;  4KGV B;  2YH1 A;  4FF2 A;  3QWU A;  3BO2 A;  4DZD A;  3PYD A;  2C2N A;  2WVE A;  1RAE B;  2FQQ B;  1SPB P;  4FXD A;  2J7U A;  1NHV A;  5D77 A;  2V8D A;  3NNH A;  1WAC A;  3PRV A;  1HMV B;  1WC5 A;  2WRM A;  8RUC A;  1U1Q A;  2CWX A;  4HTI A;  2ADB A;  2J0S D;  2UXD J;  1GMU A;  4ZVS B;  1JKH B;  2R7X A;  2H48 B;  3BO3 A;  1X4G A;  2VZ9 A;  5J2Q B;  4EUV A;  3N9U C;  1K8A T;  3G6X A;  1GTE A;  4ZIW A;  5DGB A;  3D28 A;  2RIL A;  1XIQ A;  2C3O A;  3QT6 A;  4LSL B;  4OX8 A;  1H2T Z;  1EET A;  3KHR A;  4RNH A;  2ZH7 A;  4KJI A;  1S7H A;  4ZVO B;  2OD6 A;  4HLB A;  2V8H A;  2IVY A;  1R8P A;  2FYX A;  2WW4 A;  3A3P B;  3KUH A;  1UPP A;  2IDL A;  3GIM A;  4ED0 A;  2MKS A;  4CH0 S;  1EIY B;  1H98 A;  1TKX B;  3BBF A;  2O01 C;  1PJ6 A;  1FDA A;  1GFW B;  2E5H A;  1N54 B;  3F41 A;  1JLB B;  2PC6 A;  1W7W A;  3MPV A;  4JP8 A;  3VHQ A;  5HQ8 A;  3TZZ A;  3B4M A;  1N56 A;  3KG4 A;  1TK5 A;  1ZAV A;  2LEP A;  1PIL A;  4OYX A;  1QAI A;  4X4N A;  2LA4 A;  1X4D A;  4WFX A;  1X0F A;  4ILL A;  3U1M A;  4CI0 B;  3TP2 A;  2QLB B;  1FWP A;  1R8H A;  1FER A;  1RTH A;  3BSN A;  2JFK A;  2BAN A;  2GO8 A;  1ZM9 A;  3W2W B;  5HK4 A;  3Q8Q B;  2E5L J;  3GON A;  3TUP A;  1X5S A;  2R8G A;  3CCV S;  2X1B A;  3M1V B;  4IKA A;  2XEX A;  2HGL A;  1LWC A;  4F04 B;  2JH3 A;  1VS3 A;  2D7S A;  4A8F A;  4Q2L A;  1JQG A;  1Z2L A;  5K14 B;  4BLG A;  1VC6 A;  4OZL A;  1HYS A;  4I6W A;  2VOP A;  2HAI A;  4OZN A;  2WTF A;  4MKB A;  2WVC A;  5E41 A;  2CXE A;  4Q8F A;  2W8K A;  4C8O A;  3HLU A;  4RBU A;  1UVJ A;  4OMF G;  4HH0 A;  4CO2 A;  2EFV A;  2E5G A;  3NS7 B;  3TVZ A;  1B70 B;  2BRL A;  1IR2 A;  4FYW B;  4IFV A;  5AJ3 J;  1PC4 A;  2V9W A;  3TUZ C;  3H98 A;  2N7Y A;  3RRH A;  4MT1 A;  3TQ1 A;  3FBE A;  3J7A N;  3CME S;  1GMV A;  2EBG A;  1Q79 A;  3G8Q A;  3RB6 A;  1X4F A;  2OFG X;  1RAH B;  3R5C A;  2JLE A;  5CD4 A;  5EWF A;  5CZX A;  2NSC A;  1ZAX A;  2C1E B;  4ZMM A;  3HVR A;  4B9N A;  4C3K A;  5CYQ B;  1Q5V A;  3TZX A;  3MMB B;  5IOL A;  2XUL A;  1UVI A;  4PKD B;  4IRK A;  2CKW A;  4Q7A A;  3TAM A;  5DDO C;  4YB5 A;  5EDW A;  4C0H A;  1VIO A;  3MEK A;  1B64 A;  2GJ2 A;  2ZC4 A;  4LFA F;  3VAG A;  4WF9 Q;  1JLC B;  1C0T B;  1RWK B;  1S9E A;  1WI6 A;  2EKY A;  4ZN3 A;  4LF9 F;  1LW2 A;  4L3N A;  1FES A;  4YHH F;  2YNI B;  2R2T A;  1M5O C;  4DWI A;  2MDA A;  4D3H A;  1S12 A;  2RF2 A;  2ZIT A;  3M8P A;  5L39 A;  1NJY A;  2I9S A;  1LEO A;  4U96 A;  4X2B A;  3OFF A;  6AT1 B;  1RWX B;  2EXU A;  2PMH A;  5KFY A;  1EAY C;  2OSR A;  1A0O B;  1KEK A;  3MTJ A;  3R1L A;  1NK0 A;  3PFE A;  3PRD A;  4KFB A;  1BLU A;  3DRP B;  4ZPA A;  1CJU A;  2HLU A;  3HHK A;  1XEZ A;  3MEE A;  4EMD A;  4F4A A;  5B0B A;  1EZZ B;  1GAO A;  1M5S A;  4GVB B;  2CIM A;  1HNV B;  4DUZ J;  1TL3 A;  2QO3 A;  3GYG A;  4DLG A;  3VGU A;  3NG8 A;  3HPO A;  4R25 A;  4Q5V A;  1G2E A;  2FC8 A;  2KM8 B;  4B3S F;  4B9M A;  4ECW A;  5E5N A;  1MMD A;  1LXN A;  2DNP A;  3GFH A;  5HL7 Q;  3O3L A;  2JLG A;  4K4Z A;  1F1B B;  1SI9 A;  1ZH5 A;  4CH7 A;  4QU6 A;  2JL9 A;  1VQO S;  1T3N A;  3W1Y C;  2AJ4 A;  4DSJ A;  2MEW A;  1L3K A;  4DDF A;  2IBO A;  3PHE A;  4H4O B;  2OPQ B;  4MK7 A;  4AL5 A;  1FVQ A;  3WZ0 A;  4CLS A;  3KK1 A;  4G65 A;  3H5U A;  5A6W A;  1N8R T;  2GO9 A;  2LVW A;  1YKW A;  2R4F A;  1Q0N A;  2DGS A;  2LDY A;  4M5G A;  3MAH A;  2VQE F;  4R5P A;  4GMK A;  2Y1I A;  1RTD B;  4O0I A;  2IJN A;  2H65 B;  4JYA F;  5B0G A;  3TJ9 A;  2JRR A;  3E3X A;  3P4U B;  3MMJ A;  2E9T A;  2BYC A;  1S1V B;  1DFD A;  3JSM A;  1FRH A;  1YBT A;  3ZXW A;  1DQ9 A;  1SKS A;  2JDJ A;  4I4B A;  5ITH A;  3AGX A;  4ALZ A;  1WSR A;  3AD8 C;  3NAH A;  1GX6 A;  3SV3 A;  1U1K A;  3L7U A;  1RT2 A;  1S5Z A;  3RGI A;  3ENA A;  1OO0 B;  2HHH J;  2H5I B;  4PG8 A;  1FEE A;  2KRR A;  2MQO A;  2IJF A;  3NGR A;  1AZS B;  3WX4 A;  4EFA C;  4LF9 J;  1RKJ A;  2I5J A;  2WSE C;  2W25 A;  3H5Y A;  2CPX A;  3PDN A;  5KFX A;  4CO5 A;  5A0Y B;  3I0S B;  4WFB Q;  1RBL A;  3D1Q A;  2BQU A;  3ENV A;  3LZ8 A;  1WC0 A;  2X7I A;  3HSZ A;  3RTV A;  2UU9 F;  3N5F A;  2VA2 A;  4P2X A;  2WB1 D;  3U27 A;  4RUC A;  2AJQ A;  4MFB A;  3RZA A;  3OLB A;  2CG8 A;  2DO0 A;  3AB4 B;  2AV5 A;  4Z7C A;  1KTV A;  4LT6 A;  5D15 A;  1L3V A;  3V6H A;  3JYT A;  4QPX A;  1BQN A;  1IKW A;  4I7F B;  3BN7 A;  2F4V F;  2ZUG A;  2ACM A;  3OR2 A;  3HD2 A;  5KFA A;  3TUJ C;  5FII A;  3GFZ A;  4HDG A;  4U8V A;  1T9Y A;  4DXL A;  1EX8 A;  5LM7 E;  1MWZ A;  1CPZ A;  3M9M B;  1YVF A;  3AQP A;  3POT A;  1ACM B;  1X5T A;  4DPO A;  1HR0 F;  1AFI A;  4IDK B;  2R7V A;  2HHV A;  3EGN A;  1FF2 A;  1X9W A;  3M05 A;  2Z30 B;  3FBF A;  2YNH B;  2XI3 A;  1RTI B;  2EBE A;  1F3F A;  1ZAW A;  2FZC B;  1ZTW A;  1A6L A;  3GJQ B;  3T1A A;  4KO0 A;  5ETR A;  5HLF A;  2VFU A;  3OJS A;  4ES3 A;  1REG X;  2W24 A;  1N6Q A;  3NOC A;  3K58 A;  3GYN A;  1NK5 A;  2LEC A;  1CVJ A;  3IS9 B;  2VH7 A;  3E01 B;  2QE5 A;  3R9L A;  3TAM B;  2HBQ B;  2HQI A;  5K9F A;  2I2Y A;  3IRX B;  4FYY B;  4MYU A;  2ROP A;  3EDR B;  4DR7 F;  4C8K A;  2ROE A;  4MMO A;  1SKW A;  3NP5 A;  4DV1 F;  3CW2 C;  3DCA A;  3LA0 A;  4OYM A;  1F6T A;  4LR8 A;  3R2D J;  2GAG C;  5CYM B;  3CCL S;  4PEO A;  3F0N A;  2IVM A;  1NZA A;  1LKZ A;  5ETL A;  5THW A;  2DEJ A;  3L3C A;  3JXO A;  1NK4 A;  3N5B A;  4ZCM A;  1FK9 B;  3C6U B;  2FGC A;  1DTT B;  2CQ3 A;  3IO1 A;  4HVZ A;  1A9N B;  2HHX A;  5F8L A;  2UVV A;  2HFO A;  2BUN A;  4L75 A;  3CD6 S;  2I8E A;  3B78 A;  3E01 A;  4NLP A;  5BR8 F;  2B5J A;  3KXD A;  3DU6 A;  2VIH A;  1X4A A;  3PIO Q;  4HR2 A;  3MUM P;  2F8M A;  5CHC B;  1FX4 A;  2GJF A;  1NH7 A;  1MN9 A;  2M52 A;  2UZA A;  3QNW B;  2QL9 B;  1NME B;  2KH9 A;  1NK7 A;  1HW9 A;  5MAO A;  3EWG A;  4O3N A;  5JXS A;  4UF4 A;  3PXG a;  5F8G A;  3HF5 A;  2FZK B;  2GVZ B;  4EBE A;  2UVU A;  1WSV A;  2RS2 A;  3PYF A;  2OPP A;  1FDB A;  2BV3 A;  5FLX U;  2C2O B;  1KVK A;  4ZP8 A;  3AA9 A;  2GHW A;  1K9M T;  4FXW A;  2H5E A;  2DYA A;  2FVQ A;  1T7P A;  1RTH B;  3KOA A;  3V81 B;  3F73 A;  2R8J A;  4K4V A;  1K44 A;  3M30 A;  1RI7 A;  5KG1 A;  4OX7 A;  2MKI A;  4ENO A;  1B0P A;  4NZ0 A;  4I0W A;  3KK3 A;  5ETO A;  1S1T B;  1B0T A;  2C3M A;  4RKU C;  1HBN A;  2MQQ A;  2L41 A;  3OTO J;  3KJV B;  2RSQ A;  3MED B;  5BYR A;  4U8Y A;  4PG6 A;  5JJB A;  2HZV A;  2DKO B;  4PQU B;  3M2U B;  3TI0 A;  4Y34 A;  2R7S A;  1FXD A;  3IWL A;  1H73 A;  3IGN A;  3D1O A;  4ZPV R;  1DTQ B;  1O8B A;  2BJ9 A;  2K7K A;  2YPZ A;  4RL1 A;  1HBM A;  4ECX A;  1WEL A;  3Q89 A;  3MWB A;  4LSN B;  4P9S A;  4DG1 B;  2EEY A;  3H40 A;  3AJD A;  4PG7 A;  1TL7 B;  3MEC B;  1GX5 A;  3NRB A;  4PWW A;  5KFC A;  5KFJ A;  1ZTT A;  3T9Z A;  4FXV A;  4DQI A;  1IKV A;  3RG6 A;  1V3R A;  2DIS A;  5DM6 Q;  4RNM A;  1FFG B;  1SIW B;  1HNI B;  1HQU A;  4Y2K A;  2HNZ A;  4LF7 F;  5E3Q A;  3MUV P;  1U1N A;  1Q95 G;  4PXE A;  3MMC A;  4TN2 A;  3QWP A;  2EFO A;  4DR5 F;  4YDD B;  3PV8 A;  3MTK A;  4AL6 A;  4ZS6 A;  4OYO A;  4G1Q B;  3LP0 B;  2GQC A;  2MMY A;  3BKF A;  3TYT A;  2EKN A;  3OTO F;  3VAH A;  2GVD B;  4DSE A;  3CWJ A;  4B3O A;  2G0C A;  3NAI A;  2MGZ A;  5KAK A;  1VQS A;  2PDA A;  3NGU A;  1DHM A;  1YTY A;  2KYX A;  4LRB A;  4P2F A;  2HBY B;  3N28 A;  5GME A;  1X0P A;  1IWG A;  1H3D A;  5DG8 A;  4RU2 A;  1JNZ B;  1KKH A;  4EU0 A;  4PAA A;  1VBY A;  3DOM B;  1NJZ A;  1KOO A;  1LK7 A;  1S0V A;  1SJQ A;  2G0J A;  1U2R A;  3R5G A;  1U1O A;  3KMQ A;  3IA0 A;  2IRX A;  4JI7 J;  2D74 B;  3UR0 A;  4MKY A;  2BE7 D;  2RRA A;  2CG4 A;  4OI3 A;  3K57 A;  1SUQ B;  4PWU A;  4BCA A;  4NML A;  1XR5 A;  4PG4 A;  2VFV A;  2YPY A;  1VRQ C;  1ROF A;  2E7V A;  2G2Y A;  3LGM A;  1ZPW X;  5BR8 J;  3ITH B;  1XK8 A;  3OW2 R;  1ZA2 B;  1RT3 B;  4X4O A;  3ZNJ 1;  5ETS A;  2RS8 A;  2UXB J;  2F3J A;  2GQ2 A;  3BDE A;  2V2K A;  2K06 A;  4KH0 B;  1IJF B;  3O44 A;  3A8K A;  3DRP A;  3L4B C;  3OJU A;  2ZHB A;  2BJ3 A;  3VZH A;  3CMA S;  2D3Z A;  1HHQ A;  2OFH X;  2Q3P A;  3B54 A;  2ZH8 A;  4ZJQ A;  3ILI A;  4MFB B;  1CUL A;  1N88 A;  2IM1 A;  2OD4 A;  2IM2 A;  2V4J B;  3LP0 A;  3QQC D;  2EVZ A;  4WK1 A;  1VJQ A;  3VAK A;  5B7W A;  5H9E J;  5K8P A;  3PJX A;  3UDL A;  2B8P A;  2RH3 A;  3AJ2 A;  1UPM B;  2KVQ E;  1FDN A;  2F63 A;  4OLP A;  4URQ U;  4WIQ A;  2CQ2 A;  1WC3 A;  2MQM A;  2V2Z A;  4PXD A;  3OT9 A;  1R6Y A;  1U7L A;  1SIZ A;  2B4O A;  1PYO B;  3D1H A;  1OY6 A;  5B09 A;  2BM0 A;  3DOK A;  3U1N A;  2OTJ S;  3QZ8 A;  3T5K A;  1XER A;  2BZ2 A;  4QW8 A;  2HHS A;  1FD8 A;  1RT6 A;  1WG1 A;  4F4K A;  2BAC A;  2K3I A;  1WD6 A;  2NPI A;  1S9F A;  2B56 A;  3UD3 P;  2J0Q D;  4ZLL A;  1RHM B;  1SQG A;  3RU0 A;  1RGV A;  4DG1 A;  2KDO A;  3CO0 P;  1HWL A;  3GSD A;  4KY3 A;  2KXN B;  4J9O A;  4OI0 A;  3I31 A;  4YY3 J;  1VR6 A;  1MLA A;  3PAC A;  1T9T A;  2PMZ D;  4FP9 A;  1RAC B;  1V6H A;  3AOA A;  5A2Q U;  1Z4U A;  1JLF A;  3TX8 A;  3UD4 P;  4PCQ A;  3CMQ A;  3BDP A;  4DR4 F;  2DH9 A;  2G1D A;  2PO4 A;  3DNC A;  3DLJ A;  2NCK L;  4FPR A;  2LQJ A;  2G2O A;  4QIW D;  2IDE A;  2UV8 A;  3K7R A;  2DNO A;  2DO4 A;  2ZHA A;  2JNJ A;  2VB6 A;  5C2G A;  2DVI A;  2Y3Y A;  3UVJ A;  3VGV A;  1U1L A;  4RWW A;  1FJC A;  1WG4 A;  1UEK A;  2E5I A;  1SC1 B;  2D41 A;  1AT1 B;  2W2O P;  2XMW A;  3ELH A;  3TNV A;  5AE3 A;  1WOP A;  4KGZ B;  1RBO B;  2B4P A;  5HAT A;  3UNG C;  4A46 A;  4NRT A;  2JSX A;  3ET6 B;  4Z37 A;  4ID5 B;  3CCZ A;  3DLH A;  3D4J A;  1YIJ S;  3CD5 A;  2UUA J;  1UCN A;  3DGP A;  2E7W A;  2QFI A;  3AT1 B;  4NMX A;  5A8W A;  3CCQ S;  3KLG A;  1EP4 A;  1WC6 A;  1AYE A;  2GX8 A;  4EBC A;  1GH8 A;  2M5Y A;  3H5X A;  5KFP A;  4B9U A;  4Q8E A;  2RHQ B;  5I42 A;  1MW7 A;  1DZ5 A;  5LOQ A;  5KG4 A;  3QAU A;  3GJR B;  2XTJ P;  3W9I A;  2W7O A;  2LEB A;  3T19 A;  3FEY B;  3BS9 A;  3PYE A;  1ITP A;  2FHO B;  5J1N A;  1QVG R;  3AHP A;  3FBC A;  2QIF A;  1KD1 T;  4PPZ A;  1RCO B;  2QLD A;  5FDL B;  2NXJ A;  3IG1 B;  1QE1 A;  5DET A;  4F50 A;  1MU2 B;  3T1H F;  1VC5 A;  2PGC A;  2G2Z A;  2Z2M A;  4C4W A;  2V2V A;  3EVO A;  3UR3 C;  3NBP A;  2M7S A;  4WPA A;  3DKD A;  4B3M J;  4JYA J;  4G1Q A;  4YDX A;  3J81 j;  3MUT P;  2VQE J;  2E66 A;  3DRR B;  4DV5 J;  3UN3 A;  4DSK A;  1K1Q A;  2XY5 A;  3BSA A;  4YB7 A;  3JQK A;  4FBT A;  4WK3 A;  4PAB A;  3JSR A;  3QMQ A;  1XR6 A;  4NLU A;  2MY8 A;  4LF2 A;  4Y2I A;  3TWZ A;  5C42 A;  1AUD A;  1FXL A;  3GMG A;  7FDR A;  3KLF A;  2NUH A;  4P2M A;  4B9T A;  4CP5 A;  3D0H E;  2EG1 A;  2H5J B;  9RUB A;  4X4P A;  1TKD A;  1RP5 A;  2MJU A;  3O5T B;  3PR5 B;  2IRU A;  2P9G A;  4E98 A;  4USK A;  2HQC A;  3CJQ A;  5J2Q A;  3NGK A;  4NLR A;  4NYP A;  5EUH A;  2CUY A;  2F8E X;  5CA5 A;  3DRR A;  4ZPD A;  1WHY A;  4PPD A;  2RJZ A;  1SJF A;  3W3S A;  2I0X A;  3CSK A;  4J9N A;  4HHJ A;  3HT3 A;  1PJ5 A;  1VC0 A;  3DM2 B;  3MPU B;  2IYI A;  4TQS A;  2MHN A;  4ICL A;  1FO1 A;  1XMQ F;  1L3T A;  2JEF A;  2AF6 A;  1GNK A;  3UD5 A;  1M90 T;  1VHF A;  5KFG A;  4M95 A;  2NLW A;  5KFZ A;  5IZH A;  2DR5 A;  2KL8 A;  3DN9 A;  4OX9 F;  3D6T B;  4NLX A;  2FPH X;  3ZC4 A;  4DZ6 A;  2OSQ A;  1GXT A;  5BYQ A;  1TK0 A;  3TAR A;  4DSL A;  3MGJ A;  2Q43 A;  1RAF B;  3NGT A;  2B6A A;  3Q8Y A;  4WE1 B;  4X62 F;  2ASD A;  3MR6 A;  4OV1 A;  1S0N A;  5CXT A;  2IMO A;  1RLD A;  4FYX B;  5MLC V;  4UQG A;  3GFX A;  3CCS S;  2JC1 A;  3VAI A;  1BMQ B;  2AP6 A;  1UEV A;  2VUG A;  2XSF A;  1GQE A;  1VQP S;  4JV2 A;  3T5L A;  4MKA A;  4Q43 A;  1D9A A;  4YR2 A;  2AJ1 A;  4FS2 A;  2IPO B;  4UZC A;  4FPI A;  3RBX A;  1VQL S;  4I2P B;  4C98 A;  2QL5 B;  3SFU A;  5F8H A;  2QLJ B;  5EWE A;  1IQZ A;  4NLV A;  4NWB A;  2RU3 A;  5F8J A;  4B02 A;  2DEI A;  3KLE A;  4OJ3 A;  1TK8 A;  1KN6 A;  5JVG Q;  3QFH A;  1SV5 A;  2M0G B;  4LBH A;  2HW3 A;  2R7T A;  2GMJ A;  2OGU A;  1RT7 B;  2CNN B;  2Q6B A;  3ZZU A;  3LWM A;  3R7S B;  4ZN1 A;  4ZPB A;  1MNE A;  3CTR A;  5HQL A;  3BR9 A;  2JRS A;  1T03 A;  3HCX A;  4B3R F;  1S1W B;  2UVW A;  2A2D A;  2BOA A;  1TKX A;  4F3O A;  1R89 A;  1HQE B;  1R0B G;  3QAE A;  2XMU A;  1TFW A;  4X4V A;  2RF2 B;  2VDH A;  3QJP A;  1IR0 A;  4OLO A;  1ULR A;  5I3U A;  1CS4 A;  2EWH A;  4JI4 F;  1Y11 A;  5LSO A;  2E1R A;  8AT1 B;  1HKA A;  2DGQ A;  5IV4 A;  3SDE B;  1XMO J;  2AEM A;  4NXN F;  2IY5 B;  1F2G A;  4KV8 B;  4JV1 A;  2E5L F;  1QSL A;  1R3N A;  2XMV A;  1HHT P; 
#chains in the Genus database with same CATH homology
 3AGY A;  3L9Z A;  3NY0 A;  3AGZ A;  1C3G A;  3AGX A;  1XAO A;  2HFV A;  4J80 A;  1EB0 A;  3NXZ A;  3LA0 A;  1GMU A;  4L3K A;  1GMW D;  2QLD A;  1GMV A;  1NLT A;  3I38 A;  2B26 A;  1EAR A;  2Q2G A;  3TJ8 A;  3TJA A;  3LZ8 A;  1GMW A;  3TJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...