4L3KA

Crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Urease accessory protein UreE
publication title Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study.
pubmed doi rcsb
source organism Sporosarcina pasteurii
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4l3kA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 4l3kA02
1GMWA 3TJ8A 3NXZA 3LZ8A 3AGXA 3AGYA 3AGZA 1C3GA 3LA0A 3L9ZA 1XAOA 1NLTA 1GMWD 3NY0A 4L3KA 2QLDA 2HFVA 2Q2GA 1EB0A 4J80A 2B26A 1GMUA 3I38A 1EARA 3TJ9A 1GMVA 3TJAA
chains in the Genus database with same CATH superfamily
1OIAA 5KFTA 3CIZA 1RWUA 3EMTA 4PXBA 1UTAA 4NCGA 1VQLS 3NMAA 2BJ3A 4C3KA 3BSCA 3D9BA 1LFPA 3KFWX 1EQMA 4MKAA 1S1XB 2Q1LA 3JTNA 4Y2IA 5K8MA 3UN2A 2XHCA 3IS9A 1NU4A 2V68A 4I56A 4OJ1A 4ZA1A 4FP9A 1GX5A 1HFEL 2DBBA 4DJBA 5IWAJ 3NS5A 2IVMA 3CJ5A 2OH2A 5H9EJ 4LFCJ 5C42B 2Y0BB 4IO1A 3QPIA 2M0GB 4K2JA 2D3UA 1ZM3A 4PXCA 2AJ1A 2IAJB 3E3XA 1M1KT 2AU0A 1DTQA 1M90T 2QA4G 2QLBB 4CO2A 3EPGA 1G3OA 4ZVUB 2QLWA 3FRYA 2U1AA 3ILIA 4NPOA 5I3UA 1RU2A 3BKFA 4KQZA 5I42A 5GAEU 1SJ1A 3CNQP 1VQ4S 4IFVB 5B0AA 4GRSA 3MM5B 2VFUA 3H5UA 4KV8A 2MQQA 2ALYB 5AT1B 2N7YA 1CC7A 3UR3C 1ACMB 3M8PB 3IC1A 1IJEB 3R27A 3OR1B 3PKMA 4NXMJ 3J7YU 1RWWB 5LMNJ 4G1IA 3ZC4A 3IRXB 4L76A 1J5EJ 2ZWPA 2AMCB 5KFNA 4PG7A 3M8WA 3OUYB 2GVDA 2DYAA 1UWBB 2KHDA 1NDPA 4DFMA 3MM6B 2JFKA 5DQGA 4K4WA 3KHHA 4DN0A 4PG4A 3CCMS 3CJRA 3T1HJ 4CLFA 4V19J 2GV1A 5D15A 1NKCA 5G0RA 2UUAJ 4MIBA 2AYBA 4Z37A 4J9NA 2CKWA 4F26A 1IKYB 5IM0B 2K3IA 3AHPA 3SCKE 4K4YA 2F65A 2AGQA 3LALA 2IM1A 2QLJB 3EGZA 1U1NA 3DOMA 2XLKA 1U1KA 3EXCX 4O4RA 3VHQA 4NLGA 4ZLNA 1F5CA 4B3MJ 4ZPAA 3OTCA 4OV1A 4NYOA 4AE5A 3KLFA 3O5TB 4GMKA 5DO2A 4C0HA 1ZOTA 1HMVB 2DPJA 1PILA 1WWHA 1CULB 2VKZG 3MWBA 2K3KA 2JFDA 1UVKA 3GE9A 2ATCB 1EB0A 2Z2YB 4DR7F 1S48A 1TELA 2CPIA 3UCGA 1FWLA 2AT1B 2AJFE 3PW2A 3D2WA 2YNGB 4JYAJ 2W9AA 2PE8A 1M5HA 4R5PA 4RZRA 3W9JA 3UPFA 2QA1A 3CJ8A 3HLUA 3UN3A 2VG7B 1D9DA 4I6WA 2XYHB 2LXFA 5CQGA 2UXDF 1K1QA 2UXBJ 2I9SA 1XNQF 5KFFA 1QJHA 3G2XA 3VVTA 2KFNA 4ZVTB 1X5TA 3MMCA 3J81U 1HD0A 1IQZA 2OTLS 1GTHA 1VDHA 1RTHA 2CQ0A 2JRRA 3K7RA 3CDBA 3BR8A 1LEOA 3AQPA 3C2PA 1MLAA 2V63A 3ZZ0A 1UA0A 2J0QD 5ETPA 4KRWA 5KFJA 4F4AA 4LSNB 4B17A 3CC4S 4M5NA 1RADB 2ZBRA 3BGOP 4JI8J 4F4KA 1U45A 4PUOB 6AT1B 2RE1A 3RBZA 2ABYA 1RKJA 2C28A 3W3SA 1HIYA 5B08A 2CA9A 1WC4A 3BSAA 3QT5A 5C5JA 9ATCB 2LU2A 1S1VB 3VF0B 2MZRA 3R3TA 4C4WA 1S6OA 5HO4A 3WDOA 3QMQA 3BQ2A 2V2QA 1JLGA 3DU6A 3SFUA 3AD7C 4CM0A 3CW2C 3RRKA 3H8YA 1E6VB 3KK3A 1I1GA 4DV3F 3RG6A 2HLUA 4ED8A 1KLMB 2J0WA 2XTJP 3D6MB 1RLDA 1FHTA 4BCAA 2ZFHA 1HLWA 2NPIA 2ZH6A 4B9TA 4P2XA 1KQFB 1RTDA 2B51A 3Q2TC 1EKRA 3KK1A 4DR4J 2MXYA 1GK8A 2YKNB 5IC4B 1RBLA 4J9MA 4YY3J 2CWXA 5CYMA 1H2VZ 2MQ8A 4TQRA 4WP3A 1S9EA 4QR1A 5KFSA 3UR0A 3C16B 1ZBTA 1WOPA 4CT9A 2CNOB 1T7PA 3WX4A 4NA1A 2C2DA 4C98A 5L39A 5LXRA 3SZ2A 4CLWA 1Q86T 4DV5F 4ZP8A 3NWRA 2F5GA 1S4EA 1W2BR 4O3OA 4DR1F 1SKSA 2YTCA 1RTIB 2GJIA 2EBGA 4KH1B 2RJZA 1RT2A 4NYPA 1FK9B 2OO4A 2WONB 4RPFA 1C3GA 5HMZA 1WDTA 2W2OP 3R7NB 4EMDA 3R1LA 3ZZOA 2E5LF 3BS9A 1TL7A 1HNWF 3R6LB 2AJ2A 2ZH8A 1ZM2A 4JB8B 4RW6B 2J6TA 2EK6A 1CEZA 1KFDA 4ZOSA 4U95A 4B9LA 3NCRA 2CZ4A 1UFKA 2WZ1A 2KI2A 4Q2MA 5H9EK 3PZPA 4NLPA 4F4WA 1M1HA 1DY3A 2NLWA 2DNMA 3LP0A 4I6AA 2M5YA 4KT0C 4ZVQB 3IRWP 4EU0A 1X4CA 3SBMA 1YRXA 1FA0A 4LQ3A 5CCMA 2JVMA 2VPXB 3Q22A 5FLXU 1X0FA 1NK6A 4N76A 3WZ0A 2XO7A 1KD1T 3CUNA 2UV8G 3FEXB 3PCOB 4IG0A 3H5YA 3MM7B 4BC9A 2WSFC 2XB2D 3UD5A 1YZ6A 3LP1B 1ZTTA 4ZVGA 4ECXA 2OD4A 3KJVA 1NK4A 3I32A 2ZDOA 3A3OB 4NEZA 5IV4A 3UFCX 3HO1A 4UOFA 1BQMA 1R0AB 3LUYA 3S7RA 2EK1A 1V3ZA 2PN6A 2RU3A 2FJAB 3EGNA 2E29A 2UV8A 4TQSA 3W66A 1UJ5A 4KY3A 2FHOB 5A8KB 2A3JA 4FNIA 1SVDA 4DWIA 2Y9HA 1T05A 2GGPB 1YJRA 1UPPA 1GTEA 2BJ7A 1M5OC 3A8KA 1NBEB 2K1RA 3ULHA 1SUQB 1Q78A 3HHNB 1VI7A 2ASJA 2E9RX 2NUUG 4AXIA 3MPYA 3EDQB 1GH8A 5IFMA 1U0HB 3M2RA 1HA1A 2C2EA 1Z2LA 2M88A 1VRUB 1DQAA 3GZ7A 3OFGA 1ZH5A 4HI1A 4CO3A 2PI5A 4DR6F 3W65A 1G1XA 2B7BB 3THVA 3DRSA 4EI2A 1Q53A 4WCEQ 3UDLA 3D1QA 1RBOB 3AOBA 2QYGA 3LO3A 2BOAA 3EZ5A 4GKKF 3BN4A 3QNWB 3C15A 4WXWA 3RR8A 2UXCF 4KJIA 2FQQB 1S9GB 1GQEA 2X1FA 4DX7A 2ZJQQ 3VGTA 1L3TA 3ET6A 1TFYA 1FKAF 3LP2B 3EGWB 2ZHBA 2CZ9A 1YJTA 1NH8A 2JHEA 1FDDA 1T9TA 3V6HA 3I38A 1OPZA 2DGUA 2CPXA 4X4TA 2VD3A 4DOZA 5HBMA 1FWKA 4YB7A 2JNJA 4LF2A 1I51B 2YX1A 4DPXA 4Z2XA 4F8RA 3IWNC 1JLBB 1S49A 2B9YA 2XHWA 2JWNA 1RT3B 2VBZA 1RLCL 3TOQA 4LR8A 1KVIA 4S0MA 1S57A 2V94A 3WIUA 4O4GA 1HPZA 4QU7A 1JNZB 3MMBB 3GFYA 4QPTA 5A2QY 2P8IA 4IG3A 2V6AA 3W2VA 3NAHA 4J9OA 1NH7A 3EVOA 3I5AA 3DLKA 5DETA 2JVOA 5KFWA 1AROP 5ETNA 1VC5A 1ZM4A 2HMIA 2FGCA 4NLTA 4WE1B 3HULA 1H38A 2HRYA 3G4SS 1LWCB 2MY8A 2JOQA 4ZJQA 2OFGX 2QL7B 3DRRA 2EFPA 3MAHA 4M63A 1Q8KA 4X84A 1XNRF 3KMSA 1QLNA 3KNAA 1WOSA 4QIFA 1VRQC 5HJYA 1U1MA 4F0MA 2GVZA 1N5YA 1S77D 4QZVB 2YXLA 2KZZA 4FN5A 1VBXA 1SQFA 4LRBA 3JS9A 1FTRA 1RSCA 4DL0C 4H4OB 5GMDA 1FFWB 3LPEA 5ADZA 5B7WA 2LQ9A 2N3OA 4ECUA 4F3QA 3ZZYA 3PYDA 2VJVA 2IC3A 1SKUB 3RYLA 2QMWA 2Q2GA 4ECRA 4LF9F 2XS2A 1ZZNA 4BS2A 1NUEA 1DLOA 5K8PA 4J90A 3UNYA 2XZDB 1X7VA 4M5GA 1H98A 2OAUA 1AB8A 4RX6A 3CCVS 3KHRA 2WVFA 2OEJA 2E1AA 2IY5B 4L3KA 3T6BA 4WFNQ 4USJC 5LMUJ 3MR3A 4CQ1A 5DLGA 4O0IA 2MGZA 2YNFA 3RBXA 1F5BA 1Q7LB 1WKJA 4IRKA 2V69A 5DDRC 5LSLA 4J91A 1VQMS 2UXDJ 4DV4J 4DZDA 4MFBA 2OPQA 5GAGI 3Q89A 5JMNA 3NWGA 4ZP7A 5HATA 4OQJA 2B8PA 4DPOA 4H4KC 2ZJRQ 4CLPA 2L9NA 3OTOF 3SEOA 2R8IA 1R43A 2Z4PA 4ED7A 4ZVSB 4C8ZA 4LFAJ 4TNOA 5HLFB 3OHBA 5AE1A 3IAM9 2GJ2A 4RU2A 3ZTRA 1WNEA 1KQGB 3HT3A 1PAEX 3TQEA 3TRGA 1TFWA 1KOHA 2H54B 1LQ9A 2Q43A 8ATCB 3CE8A 1GXUA 4CO5A 4YB1P 1HBUA 5A6PA 1S79A 1JKHB 2QGFB 1RWPB 2HQDA 3H20A 3OL8A 1HNVA 2FZKB 5EDWA 4OX6A 1VQ5S 2DD8S 2PFFB 1GMWA 2ZKTA 2WAQD 2PA3A 4NMLA 3KLIB 5KFCA 2V2ZA 1H7WA 1EQ0A 4HACA 3TAMB 2C2KB 2RRNA 1C4CA 3TQ1A 4FYXB 1LW2A 1DURA 2AGOA 2IA0A 4I6YA 1SJFA 1B0VA 4OYWA 1BGXT 3DDIA 3DGPB 3LH2S 1NJIT 4XPCA 3H4DA 1RWKB 3ENWA 1FXDA 2CVEA 1HWJA 2JZ5A 1U2RA 3QJPA 4J9SA 4N77A 3OLBA 1IR0A 3BSNA 1XN9A 1CLFA 3P8BB 2KT2A 1S0NA 3KTQA 3BGRB 2B9EA 2BE7D 1T9UA 2DT9A 2BQUA 2V8HA 2FLLA 2C3YA 3KLHA 1QVGR 2QFJA 2VG5A 3LGMA 5LM7E 2J7KA 1YX2A 3MCMA 2FJBB 3HHLB 4A8YA 1LV5A 4LF6F 2CUYA 2XGPA 5ETQA 3W8GA 1UVJA 3W9IA 3NS7B 5F8LA 1UEKA 2FPHX 3I5BA 3JB9k 2DNZA 4AQYF 4ZVEA 3PRDA 2KTQA 3DRXA 5LSRA 4DU7A 5F8IA 2RQKA 1VQ9S 4Y65A 1U6FA 3Q23A 1YHQS 4ZP9A 2DRAA 1GMVA 2COLA 5KFEA 3X3UA 4RNFA 3AGYA 2MZJA 2FVSA 4DV5J 1RU1A 2LKZA 1VQPS 3ZFVA 5IT9Y 4Q44A 3QJLA 2I5JB 2VH7A 4QWCA 1YLXA 2UP1A 4CYUA 3WX8A 4UUWA 2YQ3A 4JI3J 3HJFA 2MEWA 5CYQA 2FDNA 3R5DA 1WTBA 4YOEA 3NNCA 5L1KA 2IDEA 3T5JA 3SCLE 2Z56B 2VJUA 1FRKA 2ZBPA 2DXDA 3RBEA 4L3NA 2HVZA 3MOJB 2A10A 4WBFA 2E5JA 3M2VA 1TK8A 3OW2R 1EETB 3TANA 3RGIA 1F3VA 1Y11A 4TY8A 4UOHA 3PO4A 1R3NA 3N0VA 3IA0A 4QWAA 3V6DB 3VWSA 4DF4A 4KR0B 3KG4A 2E1MC 4WK3A 1S1UA 4BC7A 3KG1A 1VIXA 1KN6A 1WHYA 2ZC3A 3GV5B 4J9PA 3NRBA 2HAIA 4JI0F 4QW8A 2MDAA 4TLQA 4CNZA 1KHVA 5BR8F 4I2PB 2YWEA 4WIQA 2H5JB 2BANA 3EJMA 4ZS6A 1Q4RA 1HD1A 4KPCA 4YP3A 1UKUA 1F0XA 4EUVA 4B9NA 3OXFA 5U47A 3CJKA 5D0RA 4P71A 4OHVA 3I9ZA 1R6YA 1YG0A 4W98A 3A12A 4KKOB 1H0HB 2W8KA 4FXVA 3J80Y 3Q8UA 5KG5A 2FIUA 3POTA 2AYEA 4DPTA 2ZM6F 1T3NA 2GHVC 2IJRA 2ILZA 3C8YA 2DISA 2CJAA 4DQPA 1VLYA 1S1WA 2AGPA 2W7PA 3T5LA 2DNQA 2C1EB 1N88A 5JUMA 3V4IB 3TJAA 2E9ZA 1EZZB 4YDXA 3BO3A 2V8DA 5F8HA 2XYGB 1UETA 1FWPA 3SDEA 3I0SA 4Q45A 2DGSA 2IJFA 1VCTA 3CO9A 4FBUA 1RHKB 4X4SA 3OR2B 1RAGB 1NDLA 2H65B 3G96A 2YNIA 4Y28C 1YIJS 4DV7F 1T3OA 3W2WA 5HROA 4FYYB 1CJKB 5KG0A 2R8JA 4OZJA 5GAHU 1Y3KA 4K59A 2XCAA 5M2PA 3U1MA 1TV6B 1YBTA 4ICLB 4RW4A 1RT4B 2F63A 3C6TB 3M32A 1XEZA 1NB2A 2FLPA 3D6TB 2BQ3A 3MAAA 4ED3A 5IXUA 2GO9A 1FI4A 1SI9A 1RWNB 2F9DA 4NCGB 2OTJS 4GKKJ 4K4XA 3T9ZA 1JLFA 2MY7A 1HNIB 1JNRB 3EXYA 3K2YA 1KLNA 2G4BA 1MMLA 2VG6B 2ZOFA 4U96A 1XERA 4W4MA 4NLSA 2R7VA 1J27A 3MM8B 2ZZNA 2A2CA 1NK7A 2ZH2A 4YHHJ 5KT3A 1HNZJ 1YKWA 1DTQB 2VICA 1YZ7A 4P75A 4CLYA 2Y1JA 4B9UA 5I42B 3CDAA 4ELUA 4FYDA 4WFXA 3PIPQ 2CADA 2HFVA 4M8LA 4HKQA 1JJ2R 1YQHA 2DNYA 2WVBA 4WFBQ 2AEFA 4AT1B 3FSIA 3SV3A 1DHMA 2UU9F 1XJWB 2QLFB 4OYZA 1XAOA 2FHJD 1RT5B 2IFXA 2VOOA 2VB6A 4KYZA 4FYVB 3ZTOA 1UJ6A 4A8OA 4NASA 2JX2A 2WTFA 1S1TB 4J5OA 3ISZA 2R9LA 1HI8A 1WD6A 1LWEB 2VFTA 1C1CA 4KE5A 2MKHA 3QO9A 3HSZA 1RWOB 5F3TA 3CF5Q 1XNRJ 4IH7A 1CJUB 1WG1A 1FXRA 4NLWA 3WIVA 4D3GA 4DS5A 3C14A 2ATLA 5DG7A 3QWUA 5ETVA 5J2NA 2EFOA 3DOMB 3LTOA 1YTYA 3DGVA 1JJHA 1JJ4A 3EUNA 5BYRA 2CQHA 2X3GA 3DKDA 1VISA 1UVIA 3CCJS 2CQ4A 4CLLA 2HVDA 1MSWD 4YQWA 2RVJA 4ECWA 3PR4A 3MAQA 2B4VA 3CGIA 3HZGA 4D3HA 1NXIA 4QU6A 2Q79A 2M8DB 1PGZA 2PIIA 1DBDA 3WHIA 1IJFB 3MCNA 4YN3B 2ZVSA 1ZTWA 3GP9A 2ZZMA 1N0UA 2PEHA 2WOMA 4KGMA 4UW2A 3ZTPA 4WU2A 4ZPTR 3QSIA 3KK2B 2QZ8A 4LF9J 4BBYA 4R0JA 3UCZP 3BREA 4U8YA 3NS6A 4O3QA 3MEEB 2G13A 2I8EA 4G6VB 3AJ2A 3S01A 5ETRA 2ZC4A 4PWDB 4WKRA 1YBUA 1CPZA 1DAXA 1EP4A 4RBUA 3O44A 4A8MP 3BH6B 3EWGA 3CCRS 3B6BA 1MNEA 3THPA 1TP7A 4H4KA 2GAHC 2BE9B 5A8RB 1GFWB 4ANDA 1JLAA 2BACA 4PYDA 2GAGC 2QSWA 4RNNA 3MR7A 3DMJB 4NA2A 4DL5A 3D28A 2XSJA 4NI2A 3MMCB 3T6JA 2DGVA 2BKNA 2HEKA 3UN5A 3DLJA 1S10A 3M8QB 2B5JA 3IBCB 4C11A 3GSDA 3ZZUA 2XY6A 4USHA 2HHSA 2A6OA 3HHLD 5D77A 1YI2S 1H73A 1XMOF 5KT4A 4IOAQ 1VQSA 1EAYC 3O2IA 2HK3A 5DDOC 5F0WA 3N6NA 2MLXA 3FBEA 1VQ7S 1RT7B 4DL6A 3RR7A 1A0OB 3HDSA 2R2UA 3IP0A 2MTLA 2B0GA 3FBBA 2MQPA 3E01B 4PQUB 4F4YA 3FJ2A 2QMXA 4ED4A 3GYXB 3I0RA 2BJDA 2BM1A 1J5OA 1NHKL 3BBCA 1NDKA 3R9LA 3E8OA 3VCDA 5KG6A 3MOZA 2Q66A 2RDIA 2R8HA 2YKPA 3LAKA 3VAKA 3NXZA 1QSYA 4H4MB 2K8GA 1OJ4A 2KKHA 4DLEA 2Q3PA 4O3SA 1IN0A 9RUBA 3I55S 3NGRA 5AXKA 3MMAB 2JJ4D 2HHHF 2WW4A 2Z30B 4KB7A 3H4BA 4DV6J 4QOTA 3HXMA 3DRYA 1L3SA 3TP2A 3R1HA 1HBOA 3B82A 2V67A 1P6TA 1B99A 2W9CB 4OI0A 3CDEA 4U6PA 2CRLA 3L95X 4MYUA 1LKZA 2KO1A 4O44A 1Z4UA 2J9DE 5EX3A 1AFJA 4ZLJA 4ALZA 2J7UA 5CYMB 1SV5A 5CD4A 2DH8A 1RHQB 1LK5A 5E3CA 5LOQA 2XNRA 2GZOA 3MUMP 2A1BA 1FXLA 4ZVRB 3AOAA 5K8OA 3TZZA 4IYQA 5ETTA 4PXDA 1SH0A 2ZEJA 2DHAA 5A2QU 4NE9C 1FKPB 1IUJA 4RW8A 5L1LA 2VFSA 4Q2LA 1H7XA 4CH7A 2DCUB 1IR2A 5JVGQ 1ITPA 3SXLA 1IKWA 1RKIA 4DF8A 3BGUA 1FNOA 4ZVFA 1TL3A 1Q5VA 4ED1A 4X4QA 2ROEA 3G71S 2IHR1 4WIIA 2LCWA 1T03A 2HHUA 5C24B 3H25A 1DFDA 1T0TV 3FBCA 3TJ8A 1SBRA 5B09A 1HBNA 4NRTA 4R25A 2CQBA 3HJVA 3TVZA 5CABA 4EBEA 4X2BA 3LAMA 2EW9A 3MPDA 3LP0B 2Y3YA 5KFPA 2IM3A 2KH9A 5IZHA 1SJQA 4ZVOB 4KAIA 1N56A 2W24A 3UDEA 1NB7A 3AB2B 4I2QA 2EPIA 1E6YB 4L72B 1IR1A 3GV8B 2CJ9A 4AL6A 3DRPA 4ZLLA 4P72A 4PRFA 3HSDA 3CT9A 1IBKF 2F7VA 1Y4ZB 1HHTP 5H9FK 4WFZA 4KIAA 2DVIA 4ZPWR 4QR0A 1K47A 4P2FA 3LWMA 2DIUA 4IH5A 4ZMMA 2RILA 4W90B 3JQMA 3MURP 5J1PA 1L3UA 1H6KX 1SCJB 1N33F 3NGDA 1T9YA 3L7PA 3AODA 1NDCA 4RNMA 2X7IA 3BV8A 1P8GA 3MDFA 2ZD1B 3D6FB 3G6XA 3H42A 3KXDA 1N5QA 1CJVA 1PG5B 4JI0J 2DH9A 1S76D 3B78A 4DFKA 2G0IA 2W9BA 3EGVA 4RKUC 5BR8J 2N7CA 5B0DA 4QW9A 1H3DA 4Y2MA 3EPIA 2WK4A 4N56A 2HW3A 1V6HA 4PPZA 1IKXA 1R8HA 2HS4A 4ECTA 1N8RT 3OHAA 4EK2A 4JI5F 4HHJA 4V1Ak 3JYTA 5AXLA 1ROFA 3QIPA 1REGX 5JXSA 3N6LA 3UD4P 1WC1A 5KFBA 2E1PA 2CQ3A 1T05B 2OFHX 3PM9A 2NR0A 2ZM6J 4FPRA 4HDGA 1NAQA 3A8JA 1VRTA 3ZNUA 1IWAA 1LK7A 2W2MP 1NPKA 5DRKA 4OHWA 2YNHB 4PR6A 4UY8T 2NXUA 3LA0A 3DI6A 2NUHA 2POKA 3M2UA 2EFQA 3CDUA 3MTKA 2XGQA 3PY8A 3HPOA 3HZEA 1ULRA 5KFIA 2HBZB 3FBFA 3DRSB 2HK2A 3PRVA 2D7SA 3DLGA 1KS2A 1SQGA 1RHJB 1REVA 4DV7J 2FTRA 2N3LA 5DZ7A 3ZNJ1 1HW8A 3PW0A 2VASA 2KYXA 4QR2A 1F5AA 4M5DA 5MLCV 2EEYA 2XYPB 2HHPA 2K7KA 3UE2A 1KONA 3T3FA 4DL2A 3U02A 1LWFB 1KEKA 1WORA 1OSCA 1XWLA 2PMWA 5HBMB 4JBCA 1U4BA 1CS4B 4JUZA 2ZJPQ 2PGCA 2HGMA 2HZCA 2NREA 2QL5B 4E2FB 4UT4A 4GKJF 2NPFA 3JAMY 3NBPA 4DQRA 3R5GA 3VZIA 4CLZA 1N4LA 2DR8A 3C6UA 2APOA 2FY1A 1BQNB 3ICLA 4QPXA 2XEXA 3HP6A 1NKEA 1WG5A 4ZVPB 3KDOA 1HPZB 1Y00A 2I0XA 1IKVA 5AJ3J 2GIRA 1KVJA 3GCXP 1TVRA 2XC9A 2DR9A 3W2VB 3G6ES 4JI6J 1Z1ZA 5D4LA 4JI4F 3W62A 3GIJA 4U7CA 3DLKB 2V0NA 4DCOB 2HQIA 3M1VA 1WI6A 2HQCA 1NK9A 1BD6A 1FF2A 4LBHA 4U67Q 2I2YA 2ASDA 3R6GB 3D1HA 4F04B 2FHKA 4X62F 2JEGA 4USKA 1WHXA 3ISND 4V19X 4RNOA 4ED2A 4CTAA 2J7WA 2GVZB 3N4WA 5RUBA 3HHKA 1DTTA 5IT9U 2BJ8A 4LF5F 1TMMA 2XS7A 2DXEA 5EWEA 2JSXA 4ECQA 2VA3A 1C0TA 3UDCA 1S12A 1U02A 2KVIA 2HVIA 2R7RA 2KZMA 2HWTA 1KWMA 2EFNA 5KG2A 3FGVA 4CO1A 1ZA2B 5CAAA 1QD1A 1HBMA 3RAXA 2ZITA 1H2TZ 4J37A 5KOXA 2P9CA 4A8SA 4OMFG 2VFRA 1FD2A 2OELA 1D0EA 4XDCA 4NLYA 4QYZJ 4ZKAA 4ZCIA 4MK7A 3BDEA 4AXJA 1RB0A 1TUWA 5KOWA 5B0GA 3X1LB 1SL2A 1TU0B 5HVFA 4OLOA 5GMEA 1TL1B 2UUCF 2N4DA 2ZKUA 1RI7A 2XMVA 2IRUA 4KBIA 1W7WA 5THWA 5CA5A 4P9SA 4ZCKA 2YNFB 1PC4A 3D54A 1GEHA 5HMYA 5C42A 1GT8A 3GONA 2RQMA 2VQFJ 4LF8F 3MECB 1JIHA 1HWKA 3HT0A 2NZCA 4DCPB 2HHXA 3MR2A 2RT3A 2OPQB 4M5LA 1FFSB 4KO0B 3PG9A 3D0HE 1N5SA 1FJ7A 1UVLA 3RU0A 2R7QA 4IFVA 3MM5A 2W25A 3NGKA 3N9UC 1N32F 1MMNA 3AA8A 1RDRA 3ILOA 3Q24A 2XNQA 3ZZPA 3M8PA 1AXQA 3BN7A 5KFYA 4F25A 4WXOA 3OR1A 5D78A 1TL4A 3QGGA 4DI6A 3D0IE 3SSSA 1JLQB 3TA0A 5LJ5Y 3ELHA 4LSLA 1JMTA 1HBUB 4N47A 4CT8A 4ETXA 3OUYA 1WF1A 3IR6B 3IO1A 2UUBJ 3VGSA 4LMZA 4DSJA 3UI3A 1O51A 3MM6A 3CEDA 3R97A 3E2EA 2ZH3A 3KJFB 3OSNA 3T1YF 1IKYA 3HVTB 3OT9A 1I94F 1VYAA 3WBZA 5IM0A 4E98A 2CNKB 4PYAA 4CH1A 4HHUA 1QM9A 5ITHA 3JTPA 4EZ9A 4OYMA 2AYGA 1VJWA 1D1UA 2V5HG 2CPDA 1UVMA 3FFIB 1C1BA 4MT1A 4LREA 5F3ZA 1HMVA 2LLZA 2UVVA 4ZIWA 2XMWA 2HHHJ 4DR3F 5FDLB 1B70B 3ZXWA 4F4ZA 3AQOA 4USIA 1CULA 4TKTA 1KTQA 1RXOB 2CPFA 2IJNA 1FDAA 2IVFB 1ZS6A 4ECSA 3GJSB 4JV0A 5HANA 1N36F 3MR5A 1OY8A 1U1PA 1MU2B 3MI7X 2YNGA 1B7YB 3AT1B 4HDHA 4Q8EA 3A8IA 3J7ZT 2RRAA 1NK0A 2R2RA 3TUIC 3VV2B 2G1DA 1RAIB 4MIWA 3FEZA 2MHEA 3M6UA 1ZM9A 1SJ4P 1RAHB 1YRUA 1HWLA 4LVNP 2AQ4A 1XQIA 1FESA 3TZXA 2V8PA 3HMJG 3MM9A 8RUCA 2WW8A 2OPRB 2BRLA 2HSEB 4BHQA 4NRUA 2L41A 3Q2SC 4USWA 5DM7Q 3FCHA 2IYGA 4ID8A 4CYUB 1TKDA 4DLGA 3MD3A 5CYQB 3N6MA 3HFZB 1NSAA 1O0PA 3GYGA 4YB6A 2XI2A 4PUOA 2AEJA 2J8AA 3J81j 5J2PB 1WC0A 3BSOA 5KFDA 4NL5A 2RKIA 4CO0A 4RLEA 1HWUA 4DBQA 2CXEA 1N34J 2FD2A 1S1VA 3M2VB 4AUKA 3EVWA 3CJTA 2JLEA 3FKBA 4Y2KA 5F8JA 2MJNA 1GAOA 5EHHA 3BKTA 3Q8PB 2Q6CA 2XWXA 1BC6A 1QDUB 4F4XA 1XMQF 2VQEF 4F67A 1KLMA 3LOUA 2NXNA 5KFMA 2QEXS 2R4FA 2VDIA 4JI7F 5AXNA 3R5CA 1HL6A 5HJXA 1QTMA 2QFIA 4O0NA 2Y1RI 1U8WA 3D3BJ 2BANB 4RU9A 3DCAA 2KJVA 4DSKA 3CPWR 2ZH7A 3FZ2A 3ITHA 4KHPJ 2RDDA 1Y5NB 2YKNA 3G8SA 1SC1B 3HF5A 4K4ZA 2QC3A 3DYAB 4X64J 1U2CA 4Y2CA 5DJBA 2HBRB 2NSCA 2RNEA 1VBKA 1S6UA 3EE3A 3POTB 3F0NA 1WC5A 2F1FA 4OZ1A 4B3OB 2HPUA 1S1WB 2R2TA 2GW8A 1UFLA 1EKSA 2PC6A 2VDHA 4OIXA 1RTIA 3I87A 3IGVA 1R89A 3VTIA 1QUVA 4QYZK 3HHLC 2DCLA 3MF5A 1FK9A 1NLKL 2DY9A 4MKYA 2WONA 2MKSA 3DFEA 4FF4A 2K7JA 2CQGA 3H0PA 1WKLA 5DLFA 1LW0A 5J1EB 2QIFA 5IT4A 1HQEB 3ILJA 3W2WB 1IBMF 2KG0A 1RTZA 4RW6A 1OO0B 3K59A 4YFUA 1Q82T 1IBLF 2R7SA 1D9FA 2J9CA 3UWTA 2CQIA 2L9WA 1VQKS 1WF0A 2OEKA 2Y1IA 3G82B 3KMQA 3RW6A 4NEYA 2AYMA 4P10A 3M32B 3CD5A 2WBRA 2E44A 3HHDA 3C6EC 1X9SA 4NCAA 3KUHA 1DQ8A 4DPUA 3M8RA 4C48A 1JLFB 1N6QB 4PPDA 3W8PA 2W4DA 2DNKA 4NLXA 1QAYA 4PEOA 4DR5J 3SSQA 3H90A 4OI2A 4JV5J 4DSFA 4DV1J 1S72S 1LOUA 2XMMA 1RHMB 5CZVA 4LRFA 4UZCA 1LWXA 4B3RJ 4M5KA 1RGVA 2NZ4A 2OEMA 4XDDA 3HHEA 4EBCA 2C42A 2JVRA 3K0JA 3K8WA 1UW9A 2JC0A 1X8DA 2I38A 3MM7A 3CCZA 2YKMB 1NPPA 2H3EB 1NMEB 1XBWA 4I7FB 2MSSA 3LP1A 2LVWA 5C25B 2C2ZB 3O8WA 3VZHA 2YWFA 2ZWOA 3GMGA 2GA7A 1P9YA 4C8KA 1FD8A 2CQ2A 4MMOA 2XCPA 1SJ3P 4J9RA 3MCSA 3SFGA 1R0AA 5K14A 2GHWA 4Y00A 3P5BP 4HT7A 1CVJA 3QFHA 2Y8YA 4P7TA 3FQLA 1DZ5A 3FQKA 2HIYA 4PG5A 1C1CB 4PXEA 2HNYA 3SQGA 2V2VA 3QO9B 2RS8A 4DUYF 4DSLA 4NLVA 4K5RA 4UF4A 2XG8A 2GMHA 1FRHA 2E5IA 3D4JA 3C14B 2VFVA 4FVCA 1SUQA 1QSLA 1T95A 2W8LA 3RB4A 1JXLA 2NXCA 2OJ3A 3C46A 2HNDA 2XY7A 4I69A 1U0HA 2G0CA 3IR7B 1CC8A 3TVKA 2CPYA 4LF5J 4P2SA 2WCXA 2RQ4A 5KT5A 4CH0S 1GNKA 4NWBA 4C8MA 4GO5X 3W64A 2B4PA 2MQNA 4M5IA 4Y6IA 3PV8A 4OZ3A 2D1CA 4URGA 1GMWD 3AH6A 4XO0A 4ZIVA 3NCPA 3PDNA 3P4UB 2DO0A 2QLXA 3GJTB 4P7VA 4P6QA 2QT7A 2DGTA 2WVDA 4G65A 5K5MA 1R31A 2PMHA 1HYSA 5IWAF 4GVLA 4LFCF 1M1GA 4DDFA 2ASLA 3OTBA 2O5DA 5HN0A 1URRA 1F9EB 4ID5B 3L7OA 3DDNA 1JLAB 2NXJA 4KHRA 4IO9Q 2V4QA 2UUCJ 2RDJA 1YJ9S 2DPIA 1JLBA 2BABA 3IG1A 1UEVA 4JV1A 1FJCA 3TWZA 4ZHRB 3PR5B 3D68A 4C11B 3N01A 3RB0A 1RA6A 2MZ1A 2XLJA 5LMNF 1PBAA 1J5EF 3A1YG 4EGLA 5T14A 4DG1A 5D0EA 3R7BB 3MUVP 1KQSR 3D7SB 3UD3P 1W26A 1WKKA 2B56A 4XAKA 3M30A 3EZUA 1N32J 3T5KA 3T1HF 4DL4A 3MPUB 2UUAF 2W4PA 2PDAA 1NJWA 3DHXA 2CPEA 2D74B 5A8WB 3I5CA 3AXMA 2P6TA 1B4SA 5F8MA 4IQMA 3MZIA 1S0OA 2X1AA 1LNQA 3PVXA 2IM0A 1PC5A 3DLEB 3HVAA 2XQCA 2KHCA 2E1CA 1X4AA 3M05A 4XTTA 4OYPA 4DHVA 2IMOA 2J76E 4TU9A 2BMBA 2KG1A 2V4JA 3B4DA 1F9HA 4HHHA 4ANEA 1U8SA 3AGXA 5FLXY 4YEAA 2BE2B 1MWQA 5ETSA 2BUNA 1HBOB 5GAEI 1NKBA 4RBTA 4HEA9 4ED0A 3GG0A 4CNYA 3BF4A 2BJ9A 4JYAF 4DN9A 5FJ4A 4C3LA 3WC2A 3PW4A 3J7YI 4OYOA 1M5KC 3AJ1A 1G6BA 1EJ7L 5KFLA 4MKBA 5E3QA 2WBMA 4LR7A 3OTEA 2PEBA 4ANCA 2PT0A 2VPYB 1CQNA 4GO7X 1CJTA 3A3NB 4ECVA 2IPOB 4OX9F 2Z8QA 3RZAA 2FHJA 2JEIA 2OMOA 2AJ0A 3ZTSA 3OXGA 2MQLA 2P6SA 5F9LA 4TN2A 5ETKA 1RCOB 4CM2A 3DXBA 4JI1F 3W5ZA 4X65F 4RW8B 2AV5A 5D6GA 4L75A 2H4YB 3NG8A 2W4CA 2YH1A 3QLHA 2VBWA 3L9ZA 3ZZZA 4K0KJ 1IKWB 1UZDA 2EC0A 3KHLA 2RUGA 3RW7A 3NL0A 1TL3B 1CG2A 3TR5A 2IRXA 1T03B 4RO0A 4F3MA 5HQ8A 3TVYA 1U1LA 2DNPA 2R7XA 4LBPA 1YRTA 5HLFA 1VK3A 2DNGA 2LQJA 3GTYX 3ISNC 1ZPVA 1HBNB 1JJCB 1S6PA 3ENVA 1SC6A 3PJXA 3CCLS 1JKHA 2B4UA 2FJVA 1UCNA 1YWXA 2MHNA 1P27B 1M5SA 1OS5A 3IM9A 1N48A 3KLIA 2HFSA 2MMYA 2P9EA 4P52A 4OHXA 3DRPB 4QIVA 4TXSA 2X51A 3GIRA 2ZE2A 3I56S 4JI2J 4WFYA 5SZTA 2CQ1A 3NEKA 1UZHA 3CULA 2LA6A 5A0YB 4B9MA 3TZYA 2CPHA 2M7SA 3VAIA 5HMWA 4KH0B 1RT6B 4RW7B 1RT1A 2J6UA 2BXJA 3H7HB 5DQIA 2JZ8A 1MW7A 1TR0A 3AD9C 2E7VA 4ED5A 4C3MA 6FDRA 3H5SA 2VQEJ 3T5HA 5L1JA 3BGRA 4MK8A 4YY3F 3CCES 2DGWA 4JI7J 3KLGB 3PYFA 4URQU 3DHWC 2W9BB 2F40A 4O3NA 3HHLA 5CD4H 3BQ1A 3IBFB 1VC0A 2UZAA 2IYIA 4OJHA 2XMTA 2DB1A 4CWBA 4TYAA 3JYTB 2ADCA 2W2NP 3QIPB 3KLEA 4AFFA 4ES1A 1O6XA 3LANA 1S99A 1KR4A 2XMUA 3H5XA 2RQCA 5ETLA 3WC0A 4CZCA 1JLEB 5HI7A 3HKZD 2M52A 4C9DA 4RUHA 1EX8A 1QSSA 4EFAC 4GVBA 4IR9A 1VRTB 3M6VA 2QYCA 3NKYA 4K4VA 4LF4F 1ICEB 1UVNA 5L1IA 1PBUA 3QT6A 2DGXA 3DI6B 2BX6A 3M2UB 4WF9Q 4CLKA 1RISA 4X66F 1X5PA 1TKTB 3W9HA 2CJXB 3NOCA 2FLNA 1Q7YT 4FKYA 2BRKA 1O5JA 2PA8D 1RTJB 1REVB 2HWIA 2OPPA 4HH1A 2YWWA 5I3QA 1D3WA 4KSEB 4WZMA 4PKDB 3OVBA 5J2MA 1FEEA 4I68A 4M5DB 2YQ1A 4YB5A 2GQ2A 4RJVA 1JLCA 2DR6A 1SIZA 4J9KA 3AJDA 1F9FA 4XIUA 4KGVB 1V9OA 4OLPA 2V2KA 3R5JB 2XMJA 3ZZRA 2WB1D 1EETA 2HNZB 1TKXA 2EFGA 3FRZA 3CDWA 3KDNA 3GLJA 3NBPB 2CZVC 2BJ1A 4IFYB 3DM2B 1GX6A 3CCTA 3V6DA 1HQUA 2YKAA 4LF1A 5I3PA 3HFVA 2C2NA 5CCLA 3C19A 2GFFA 3PACA 3NAIA 3PYEA 3CCUS 1NJXA 4F0KA 2FVQA 1I3OB 4DUZF 5E33A 4LIRA 4DR7J 1SH3A 2EG2A 2A2DA 4FKXA 1TKZB 3QIDA 4CI0B 2LEBA 4OYXA 2A0FB 4NLQA 2ZH4A 5SUHA 4J80A 4NCBA 2HURA 3CJSA 3TA2A 3RBDA 5E5NA 2U2FA 1H2UX 2EWHA 1LFWA 1PYOB 2EG1A 3LPYA 2KYZA 4DUTA 4KKOA 4QQBA 4TYBA 2LP4A 1XNQJ 1T9VA 3DOKA 1TUGB 2WB4A 3EM1A 2HFZA 3PO5A 1FE0A 3K5PA 3JQJA 3H2LA 1S0VA 2IDLA 1R8AA 4CTAB 1AFIA 2YWGA 2CYYA 2OI2A 4CDIA 2QO3A 2AX1A 3BZQA 1F1BB 4DQIA 3JSRA 1WEXA 1WHWA 4KTQA 1GXLA 1XK8A 1AT1B 2PSZA 4ATNA 5DZ6A 4NZ6A 3H59A 3ADAC 4IOCQ 4NMXA 3MFIA 3OR2A 2HQ3A 5DG8A 2V50A 1KQKA 3MFHA 3E51A 2D3ZA 3SYZA 1HBMB 2RMLA 2X1BA 4X4PA 1CJKA 2VIHA 4JOUA 3TEHB 3GB0A 1OQ3A 1SL0A 1Q16B 1OQ6A 1TV6A 1RT4A 3M8ZA 3J7AN 3PHTA 2YKQA 1NSQA 1KHWA 2QG9B 5T7LA 1CQMA 2Y0SD 1K0TA 2R2SA 4CLUA 2EVZA 3MEKA 1HNIA 2MKKA 3NP5A 1PKUA 1G2EA 3HCXA 4DV3J 2F8HA 2R7OA 4CLTA 5LL6d 3TW0A 2VG6A 4A48A 4YR2A 2KFYA 2G9OA 2YQ0A 1NZ8A 3MM8A 1J2VA 2KM8C 1TMJA 4BLGA 5HSPA 2KDOA 2V9KA 3KOAA 3BDPA 2JLGA 2JEJA 1RYSA 3MEGA 1ZAVA 1MROB 1P1LA 1T02A 2E7XA 2AEMA 4X4RA 2VODA 2W01A 2OKQA 2BJEA 4OZ2A 1RWMB 5CYJA 2B9WA 2X1GA 2NQPA 5E0OA 4OHYA 4FXDA 1YK9A 1RT5A 4LSLB 1TTHB 1RWXB 1OYEA 1WSVA 4FS1A 1S1TA 2BEFA 2I6WA 2JH3A 1Y9OA 4DR1J 1PJ6A 5LSOA 3R2DJ 2H51B 1LWEA 3F56A 2CJKA 3IWLA 1X4GA 4FF2A 2VL1A 2O67A 3GFHA 1CJUA 1Y10A 3FNNA 1WTFA 1QVFR 4ERDA 1RJJA 3M8SA 3VQTA 3P49B 3CC7S 1MWZA 4RBVA 4WTYA 2E5LJ 1WACA 1HNWJ 2LQ5A 4XPEA 1IM4A 4FZVA 4RWWA 2XSFA 4IKAA 1TQLA 2NSBA 2VC0A 1FNMA 1C1BB 4I4BA 4Y34A 4C8OA 2DNLA 1YSJA 4DQQA 2DRDA 3QZ8A 3R7SB 2MKIA 1RACB 1T94A 5IC6B 2V8GA 2SXLA 2RIJA 3JSMB 6FD1A 1S6QB 1VOMA 3VAMA 3IM8A 3D0GE 3KK2A 1NLTA 2QV6A 3MEEA 5LMUF 1QAJA 3PXGa 3V81B 4PWDA 1OY6A 4HLBA 1FO1A 1YJVA 2FJDB 2GJFA 2ERRA 3M4XA 4OYIA 1FERA 5A8RA 4DV4F 3IAS9 1SXLA 5IT0A 4ECZA 3THTA 1YITS 2DHHA 2CWKA 3DMJA 4ETZA 4X4VA 4OX9J 4PWWA 1IVZA 5F41A 3MM9B 5KG3A 3M8QA 2G2OA 3GIKA 4LFAF 2B6AB 4JI1J 2VUGA 2HLTA 4X65J 1R0BG 2HBQB 2V34A 2JEFA 3OV7A 3KJQB 1VMBA 1Q8BA 3MMJA 1VLOA 3W1YC 1VQ6S 2DNHA 4IQXA 2HAFA 3GCWP 1C0UB 3TZWA 1RT7A 3OSPA 4B9SA 4Q0BB 1N0VC 1HKAA 1RAOA 1S59A 4C8NA 5HP1A 2RF2A 3ENAA 4RR5A 1Z2ZA 2KVQE 3E01A 2RAQA 3I31A 4PQUA 2RKIB 5J2QA 1AZSA 1UP1A 2J8SA 5D8HB 1ZYQA 2R7WA 2MYFA 1FVQA 4NZ7A 4H4MA 3GIIA 4WP8A 2XMAA 1KOOA 1A7GE 5D3GB 1NPRA 4FS2A 1FT8A 1WOOA 4DR6J 2B7CB 3MMAA 2ASYA 3G6YA 1RCXB 2GIQA 1Y3JA 2A18A 2YWKA 3RAQA 4YR0A 2DEIA 2DY1A 2UXCJ 5L9XA 4KGXB 2W9CA 4E8UA 2QRRA 2CPZA 3O6QA 3K89A 5FD1A 3R5AA 1KP6A 3IS9B 4HR2A 2XULA 2XLIA 4BDPA 2DO4A 3UO0A 2F8MA 3BB5A 3ITHB 3QBCA 1HR0F 5KFOA 1X0PA 4RNHA 1Q79A 1YDLA 4I67A 2HRUA 2ZDPA 1YJUA 3IFEA 4IH6A 3DOLA 1VHIA 2Y1LB 2ZOMA 1KC8T 1RAAB 5I3UB 2J9EA 5DGAA 2V4RA 2VF3A 3OJUA 2DNOA 4ITSA 3W60A 2VKRA 4KV8B 3O1LA 4KGKA 2BQRA 3N28A 2RH3A 2CDQA 1FKPA 2RRBA 1N54B 3QRPA 3QJJA 1EIYB 2FZGB 4HVZA 2DR7A 4JI3F 1FRIA 2O3DA 4UOCA 2GVDB 2DH7A 1LW0B 4A4JA 3RB6A 3IWXA 2CVIA 4B3TF 5C24A 1DRZA 4LF4J 4OV6A 2DXFA 2DR5A 4CP5A 2I1RA 3FSXA 5G0RB 2JRSA 3CJ3A 2MQOA 2QL9B 4X66J 2WVCA 4QIWD 4X4OA 3D3CJ 4NLUA 5A76A 5GAGU 3PW5A 2XM3A 3KLFB 1FDNA 1E6YA 1WC3A 5MAOA 2FJWA 4N5SA 4LJMA 2D9PA 4DPYA 2H5IB 4ZN1A 1TZ0A 1GMUA 4ELTA 4HI2A 3BO4A 2KN4A 3CCSS 1R0CB 2C22A 3SCIE 2OP5A 2F9JA 5AE2A 2CJQA 2NCKL 5KFZA 1X9WA 5KFHA 2B8QA 4R5PB 2UVWA 2RS2A 4UQGA 3Q86A 4CCHA 4P74A 3W5XA 2ZD1A 3FMWA 4B02A 4RW9A 3TX8A 2YPZA 1KSPA 3CVKA 4DUZJ 1OYDA 4PZVA 2W2QP 3OBIA 3JTOA 5K14B 2CJYB 4L6V3 3CJ0A 2OLWA 1WUUA 2DRBA 2OMLA 3LGHA 1D9AA 1JXVA 3HSGA 4DU8A 3B54A 1RTHB 1NSKL 3H2UB 3NGUA 1L5UA 1QE1A 3BBBA 2VU5A 2HNYB 3SQGB 1XMBA 3K5LA 3HVRA 1TAUA 3K5MA 1FKOA 1U49A 2M70A 4USMA 4I0WA 1D8ZA 4EYIB 2MZTA 3M6WA 3OTOJ 2F4VF 2HNDB 3VALA 1FRJA 4R0EA 4RUAA 1OWXA 4CLSA 3CD6S 2YNHA 1BLUA 4UY85 1RA7A 2CFXA 5DGBA 2ZUGA 3TEGA 1MMDA 2J5AA 3QAEA 1KBRA 3T9NA 2B43A 2HHVA 4O23A 4ILMA 2M3DA 3AXKA 3V6KA 1JLGB 1V3SA 2WSCC 3H98A 3I4HX 3D66A 1RK8A 1SKRA 3DN9A 4LBIA 1RZMA 1Y5LB 2OUGA 3MEDA 3KK3B 4C2MA 3TYTA 3P96A 4DL7A 5CXTA 1R7IA 2LYVA 4ZPBA 3VGUA 2BOPA 4WKYA 2DHSA 4N8NA 3PYGA 3I96A 1HYSB 1AYEA 1LWFA 3LF0A 2ODXA 2P2CB 1K8AT 2JLFA 3PX4A 2A6MA 1BHNA 2M8HA 3IGNA 3P45B 4WYLA 1VQOS 4OI3A 4OFZA 1CS4A 2HFUA 4YHHF 3MHYA 1HNZF 2AF6A 5DQHA 4N41A 4OX7A 1RTDB 5M2RA 2H5EA 1BWEA 4WFAQ 3KK1B 5C2GA 3IG1B 1YGYA 2JDJA 4ZCMA 4LR9A 5KFGA 4HTIA 1S7HA 1BQNA 5B0BA 2NXEA 4IOBA 3KNGA 2HQGA 2MKYA 3R2CJ 2HHQA 1QUPA 4PG6A 3QGIA 4QWDA 1S9EB 3B4MA 2FVRA 3UQSA 4IRDA 1RAFB 1U1RA 3VGVA 2J0XA 3F73A 3Q83A 1Q1KA 3CD7A 1UJ4A 2OGUA 1FRLA 3HX9A 4DG1B 3BYRA 3FDSA 4KFBA 3RRHA 4LF6J 5GAHI 1SL1A 4A8WA 2B4OA 2BVZA 1NJYA 1QAIA 3MUTP 4ED6A 1ELOA 2MZQA 3M30B 4AQYJ 2PFDA 1WDDA 4XK8C 1RT2B 2UVRA 2AX0A 3BGLA 2IMWP 1VFJA 3NGTA 1PJ5A 1EARA 1FDBA 2ACMA 2R8KA 4X4NA 4F0HA 5LJ3Y 5HQLA 1HARA 3VQSA 1TL7B 5KG7A 2CQDA 3QT7A 3LW5C 1FX4A 1VQNS 4ES3A 1A9NB 5B0EA 2GX8A 5KG1A 4BWJA 3K5NA 3Q8YA 2K06A 3RB3A 2V4JB 3OFFA 1YJ7A 1X60A 2F3JA 3FZBA 1OY9A 1URNA 1Y0HA 3MGJA 1HHSA 1FJGF 2ACYA 2L08A 1RP5A 3OQ2A 5KFRA 1K73T 5BYQA 4A47A 2EBEA 5F9NA 2O01C 3JSBA 1VK8A 3QWPA 3FMBA 3L09A 1R27B 1R6VA 4F7VA 4E0DA 1JX4A 1PAUB 1X4BA 5D0HA 4IG0B 2R8GA 1V5IB 3H40A 2XO6A 3DU5A 1TL1A 4G1QA 1NEEA 4O3PA 1CJTB 1SH2A 3M8YA 1TUVA 3G87A 4J9VA 3BJYA 3KJVB 4NX9A 5KTQA 3BPDA 4ZJLA 3ZO7A 2QN6B 1BQMB 1PCAA 1LXJA 3DDKA 3MECA 5HL7Q 3QLHB 1Q0NA 4MYTA 4MKVA 4AL7A 4BWMA 4KO0A 1UA1A 1U25A 3QAUA 1R8PA 1XC9A 2E1RA 2ZUAA 5CZXA 2DKOB 3AOCA 1SPBP 2R7TA 2ZOGA 3GR1A 3MCOA 2Z57B 7FD1A 3IMQJ 2CNNB 2C3MA 2ZHAA 2ZHOA 2AP6A 2QJ3A 1N5VA 4WJBA 2DEJA 2ALZA 2OPSA 2K1RB 4J9LA 1JLQA 1S6PB 1NCLA 4K7QA 4M5JA 3VAFA 2BM0A 3KUEA 4NLOA 3QZ7A 5IQ6A 2KL8A 1XR5A 2OD6A 3M2RB 1TAQA 2ZH5A 2WRMA 4QBUA 3FC9A 1AUSL 4IDKA 1RWVB 5ETOA 1G7CB 2ZE2B 3HVTA 3HSJA 3DC2A 4DV6F 2D41A 2XWYA 3A3PB 3C15B 3CTRA 1IQTA 4DL3A 1NZAA 1RT1B 4B3SF 3ET6B 4NOHA 1VS3A 2GCFA 3FFIA 2ZZTA 1UAWA 1ZAWA 1FTCA 3QQCD 1KFSA 2HZAA 2L3MA 1BQXA 4FYWB 2FGOA 3KWMA 4TY9A 2AIRB 4K5SA 2EI5A 5FDLA 1RE1B 1X5SA 2Z2MA 4HTJA 2QMUB 3PFEA 3R5BA 1UMJA 4DMZA 5AXMA 4K2XA 1PYSB 1MU2A 1SIWB 3HD1A 2EC2A 4O4GB 5GMKa 4LFBF 1HR0J 4ZP6A 3J7Z5 3KLEB 3UVJA 4HH0A 2CG8A 1B7FA 4IG3B 2OSQA 4Y0FA 4NXNF 5EWGA 2GHPA 2VBXA 4UQTA 4ZLPA 2HG4A 5BJRA 4WK1A 3OVSA 3P5TL 4EO6A 4UUXA 3SCJE 2HMIB 3GG1A 1QAXA 1MG7A 1KVKA 1UL3A 4GVBB 3CCQS 4LF7F 4DR2F 1NK8A 1PYTA 2LEAA 4NLRA 5HAOA 2L48A 5KT2A 3CSKA 4H54A 3DRRB 3OLAA 2JL9A 2OPRA 1RHUB 2HBYB 1YJWS 1N5TA 5E3RA 4OI1A 2UU9J 4RWXA 1WHVA 3NCQA 2RUSA 2DNRA 3VVUA 4OJGA 3F41A 4Q8FA 1FRMA 4FF1A 2LEPA 3OFHA 1N5YB 2OPPB 4C8LA 3W63A 2HYIB 1JXEA 5KFAA 2YX7A 3OXLA 2VPWB 2EXUA 5J2MB 4B3TJ 4R8UA 3LGNA 1JLCB 2ROPA 2YVSA 1MWYA 4TLRA 4A8FA 2BBEA 5D0GA 5ETMA 5J2PA 3GYNA 1VQ8S 2NYHA 3BM7A 3AGZA 2BV3A 1D09B 2DIVA 4DV2F 2IC3B 2P9GA 1TKXB 2H4WB 3NMRA 4TU8A 2FHMA 4B9VA 2Q6BA 2KB2A 1T9WA 3BH7B 1HQUB 3TA1A 1DLOB 2LA4A 2Z2ZA 5T41A 1L3KA 2YKOA 3FVYA 2D69A 4Z7CA 1HQ2A 1T11A 2QA2A 3EDRB 3UW1A 3GILA 3CJ2A 1HWIA 3C3LA 2GQCA 2LXIA 3U7JA 3PX6A 5HK4A 2YWHA 1S1XA 2G0JA 2DK2A 1VBZA 4WU3A 2E7WA 4CO4A 1UW4A 2MQMA 3VAJA 2MGZB 4F2RA 2AKWB 4DS4A 2HVEA 4DPWA 1M5PC 2O66A 4FDFA 2LFVA 3DYAA 4DEZA 1V5VA 2IAJA 3AY0A 1RAEB 4B08A 2FC9A 4MFBB 1HNXF 4OYBA 3NNAA 5KT7A 3DOKB 4B3OA 5D4NA 2QTWA 4LRDA 2EKNA 4N7TA 4M94A 3J80U 4ZPDA 5KAKA 1BMQB 2OHDA 2RHQB 1T8EA 3IN5A 3IRXA 4ZITA 1XMOJ 4TU7A 3ZTQA 3G6VA 4J9UE 1HNVB 1XR6A 2CDRB 1FFGB 5J1EA 1UWBA 4ENOA 1BWVA 1HQEA 2AZ1A 4OZ5A 2LQBA 1U24A 4QWEA 4EO8A 2HGLA 2DJWA 2F4VJ 2CAJA 3QRQA 2LDYA 4C6AA 1K1SA 4FVMA 1ZA1B 2MKJA 3CC2S 3GR0A 1JK9B 4HACB 3FCVA 3G82A 5F8NA 1LW2B 3V5RA 3GFXA 2HHTA 3TI0A 1X4HA 3W5YA 4LVOP 5T7LB 4DSIA 2FYXA 3S1TA 1P1TA 3RUBL 4NA3A 3AAWB 2LU1A 2KXNB 3FEYB 1N6QA 2MSTA 3CWJA 2E9TA 4AD6A 1O8BA 1WELA 2HS0A 1KRPA 3RRGA 2BZ2A 4O3RA 3CJ4A 3KLHB 4Y3CA 2XY5A 5AJ3F 2GMJA 2J0SD 3BPSP 3BBFA 2XZTB 4MIAA 2VG5B 4UZBA 3PKYA 5KT6A 2IRYA 4JI6F 2YY3A 2E5GA 3CD0A 4ER8A 2MKCA 5HVGA 2YKMA 2FY8A 3MEGB 4USTA 4I7FA 2HRTA 3EZOA 2D3O1 1V3RA 5C25A 3N5FA 1H74A 1HHQA 2VG7A 5H9FJ 2ZBIA 2QSFA 5KG4A 1JWWA 3KYLA 3PTWA 4MAKA 4MJKA 3S8SA 4PABA 4G1PA 5J1NA 5GADU 1FE4A 2CJBA 3D5MA 3N79A 1FJEB 2HIQA 1NSPA 1VIOA 2UVUA 2GO8A 3K8VA 3SI8A 1IM6A 5EUHA 4YR3A 2LDIA 4FF3A 1F2GA 3TUPA 5HVHA 2GMLA 2VC1A 1SQEA 4LSNA 5C7PA 1G4CA 4LRAA 1FX2A 1L3VA 2V9WA 2XMKA 2MB0B 2CNLB 3QT8A 4DSEA 1SKWA 1X5OA 3M7VA 2RD5C 4USUA 3FK4A 4F3OA 3W7BA 3T19A 3T1AA 3TO8A 5D4OA 3BO2A 1PO6A 2KFZA 4M1KA 1Q95G 3PW7A 1W2IA 3GWCA 1R8BA 4MK9A 2DGQA 1FJGJ 4Q7AA 4TY8B 3NGSA 5E41A 5M2UA 5B0FA 5IS2A 1E6VA 2CQCA 2G2YA 1S1UB 1RYRA 5KFUA 3M9MB 2VONA 1IBKJ 1W25A 1IWGA 3GU0A 1VR6A 1UFWA 1S7IA 4RUBA 3G8QA 3PX0A 3MPWA 2VQFF 4ID5A 3QGPA 5JVHQ 1OPIA 2YPYA 2QX0A 5L38A 2ROGA 4ZPVR 4K4SA 4DFJA 5HQMA 2N4CA 3K57A 3OL9A 1N33J 3CJKB 4P2MA 2GQQA 1KNZA 4ECYA 5KFXA 3JSYA 4ZHRA 3BKUA 3LQVA 3GQCA 1Q8IA 3CJQA 4RL1A 4AL5A 1SB6A 3MR6A 2CPJA 3PHEA 3C16A 2AZ3A 5DS7A 3PEJA 3I82A 1R8CA 2VHGA 1U09A 1BUXA 4AYBD 3Q8RB 2AD9A 2UUBF 2XBPA 4OZNA 4YMEA 1BE4A 2W2PP 4C97A 4JI5J 4TVAB 2HS3A 2FUG9 3G8TA 2BKOA 2MJUA 1D8YA 3SDEB 3I0SB 5HP1B 2RF2B 2Z58B 8AT1B 4Q43A 3VAHA 5J2QB 1AZSB 3GPAA 4OZ0A 2YNIB 2C2MB 1YBAA 5HROB 5A8WA 4FBTA 3PFOA 1HI1A 2LECA 2BW7A 2NYIA 3DLEA 1U48A 1PIEA 1U6BA 1UWAA 2GC8A 2EKYA 2ZBQA 5HMXA 4RW4B 4U7UK 1AA1B 3MAAB 4DXLA 2BE2A 1JB0C 4L73A 3TAQA 5BYSA 3WQPA 4G3IA 2FJEB 5E2QA 1XIQA 2LXUA 4B3SJ 4DV0F 2BDPA 2ZH1A 4ILLA 3CXCR 3KKFA 3M9OB 3ILLA 4F2SA 3JXOA 3L3CA 1RABB 4Q5VA 2E5HA 1DARA 3VAGA 4HYKA 2YH0A 4PWUA 3NLCA 5G4DA 2R7UA 2IVYA 1T9XA 1WF2A 1RHRB 4K4UA 1S5ZA 4GKJJ 5E3AA 3DOLB 3G86A 2C2RA 4WYWA 3MD1A 1WI8A 1FVSA 3J81Y 4W92B 4K4TA 1WG4A 4HT5A 1K9MT 3UDVA 3A8EA 1F60B 3Q8QB 4NZ0A 4WP9A 4ILRA 4LFBJ 3EX7B 3B8HA 4KHMA 1OMSA 3SIPB 4U7UD 4RUCA 2C3PA 1M0SA 5DG9A 2CQPA 4NXNJ 2F8EX 3DLLQ 4JI4J 3BQ0A 3K17A 3TJ9A 1I5OB 1NNDA 2IBKA 4OYAA 2C2OB 3HM9A 1Q5YA 4DQSA 3CCWA 4LF7J 1WC6A 3T41A 4DR2J 3C5XC 5A8KA 2KJWA 3IXQA 4FNHA 5KFQA 1VJQA 1VQYA 1X4EA 3KLVA 4I64A 2GGPA 4X62J 4QIEA 5GVQA 3J7A1 4OZLA 5IQQA 4EYHB 3D6HB 2DHXA 1N34F 4F02A 1LXNA 5J2NB 3ETMA 4F50A 1XR7A 2VZ9A 3EICA 2H9ZA 4DCJB 2R3VA 2QLDA 1VRUA 3CB4A 5KFVA 1YJNS 5A6WA 2W7OA 1EHWA 1Q81T 4N8OA 4QJVA 5LXYA 1KKHA 3LZ8A 2MLZA 4JP8A 5A0YA 2AWZA 1ZZFA 2F4FA 5GADI 4DV2J 1S9GA 2WOMB 4WTOB 1RT6A 4RW7A 5H1SV 2WHOA 2R42A 2XZWA 4ZPCA 4P73A 3LP2A 3U27A 1X4FA 1U1QA 1NHVA 4QWBA 2FVPA 2NS1B 2QA4S 2E66A 4KHPF 3R8YA 1HW9A 4C8YA 1EP4B 2O1PA 2WSEC 1CBKA 1X9MA 1U2FA 4X64F 2K2PA 2KRRA 4RW9B 2IIHA 4DFPA 3KLGA 2FB0A 1HI0P 4J9QA 3AA9A 4UOGA 4LSZB 4DX6A 2HHWA 1B0TA 2XSJB 4NI2B 5F0UA 2IM2A 3HK2A 2H48B 1RT3A 4K50A 5L9NA 4LUBA 3US5A 4OI4A 1X4DA 2B5JB 1QE1B 3MMBA 1FCAA 5DDQC 1K0VA 1B64A 4NXMF 2HWHA 1KTVA 4L74A 4LF8J 2C3OA 1FKOB 3OL6A 1JLEA 1QY7A 4LQ9A 2WVEA 1HNXJ 1ZAXA 2ZBCA 1PSDA 3F44A 4WE1A 2OIHA 1X31C 4X4UA 1LWCA 1H72C 1K44A 3I9V9 2HZVA 2QE5A 3HD2A 4IUFA 5JJBA 1WEZA 3OL7A 2G2ZA 3I0RB 2PMZD 4ZVHA 4USVA 1TKTA 1J5OB 3SSRA 2LMIA 1ZPWX 3V4MA 2IBOA 4QIGA 2MZSA 3FCWA 3G9CA 4C0BA 1RTJA 2PI4A 3QGHA 4B3MF 3NY0A 4WZQA 3I4PA 1RAJA 3MEDB 1FRXA 3BGFA 2KM8B 4DR5F 3D1OA 3SMZA 4JV5F 4WPAA 2XI3A 3QSYB 4DV1F 4ES2A 4GC6A 5EWFA 3T1YJ 2FVCA 4EBDA 4H4OA 4A8KA 1I94J 2KT3A 2MPUA 1F2HA 1DQ9A 4B3RF 2RHSB 5C2CA 2XS5A 1A6LA 2CIMA 3Q8SB 2DGOA 3AKOB 3VR1A 2HNZA 3FUYA 2W1BA 4IFYA 3DM2A 2X3DA 5KFKA 3UNGC 2VBYA 2KT5A 1NJZA 1B0PA 1RUSA 4U9RA 4OJ3A 1JQGA 3OFEA 4O44B 4J7CA 3DLBA 4YS2A 4DR3J 4ELVA 1SV5B 3DNCA 2FC8A 1VGYA 3AD8C 2UXBF 3JAMU 5E7OB 3HFKA 3Q8VA 2UUTA 3PEHA 1TKZA 4KFBB 4NYZA 1PJ7A 1N36J 2YX4A 5EX0A 4C0OC 3MPVA 2FJXA 2G1HA 3N5BA 4CRJA 4I1TA 3TUJC 4Y2AA 3RTVA 2D9OA 2VPZB 4Z7YA 1NK5A 2HVHA 2BR0A 3EYZA 3GV7B 3GSIA 4UTGA 3QATA 3GFZA 3NOGA 4JI8F 4OHZA 4OI6A 1MN7A 1BXNA 4DX8H 5DM6Q 3CIMA 1B3TA 4M95A 3QYYA 4ZN3A 1NHUA 3OD2A 2HGNA 1IBCB 1M5VC 2M2BA 5D4PA 2AHOB 2HKEA 3OPKA 4YUDA 3MXHP 3Q0AA 3HI9A 4OX8A 3OTDA 4I2QB 4C7QA 3I6PA 5F8GA 1F3FA 2DITA 5LT5A 3QRRA 3A4TA 3TAMA 3M9NB 2BW2A 2UUWA 3U1NA 1NM2A 1OSDA 4ZDNA 3P6YC 2KRBA 4EEYA 2V8VA 3PRBA 5EGYA 3PJ9A 3DGPA 4M5HA 4QCLA 4G1QB 4ZK7M 1U7LA 1FNXH 1N52B 2M9KA 3TARA 3GJQB 1GXTA 3GIMA 4KC5A 4DR4F 1U47A 1S97A 4QYRA 1XMQJ 2KXFA 1XTZA 1YVFA 4EZ6A 3UCUP 4M5MA 5DDPC 1VBYA 1VC6A 2ILYA 1CJVB 2AJ4A 4WWSA 3M6XA 3K58A 1SJRA 2GS8A 1U26A 2RU9A 4GC7A 1TK5A 4JV2A 4PCQA 1IKXB 1Y5IB 3PJWA 2IA6A 3V6JA 3V2UC 2OSRA 2VV5A 1MROA 1AW0A 3TNVA 4NLDA 2J6SA 1I6JA 1QTNB 3ETOA 4IRCA 2P5VA 2OPSB 2DNNA 2B26A 2GIFA 3L7UA 1Y7PA 2DHGA 2BYCA 4A8QA 3A13A 5K8NA 4CIOA 2MLYA 3IBWA 2FLOA 3RJMB 4F36A 1C2PA 4K8RA 2H1YA 5B0CA 2ZH9A 3P3DA 3D67A 1NO8A 3QFWA 2I5JA 4KGZB 5CH7B 2ADBA 3PNIA 4IDKB 2LQ8A 3K5OA 1MN9A 4LT6A 1P9QC 5L8RC 3DLGB 2CG4A 2HQFA 2Y8WA 1IBMJ 4ZJOA 1Q8LA 3FSYA 5I4MA 3HKWA 5FIIA 3TX0A 4U8VA 1DJ0A 2EFVA 1IBLJ 4A8XA 1SC4B 1KDNA 1FEHA 2L9DA 3CMAS 5L46A 1TK0A 2DTJA 5CHCB 3JQKA 2BKPA 3U1LA 4KPYA 3GJRB 3KHGA 2KXHA 5E3PA 4FXWA 5AE3A 2M4MA 4FPIA 3ZZTA 1UEUA 3BR9A 3CMQA 3JSMA 4URSA 2RB7A 3OVAA 1S6QA 3ONQA 2B3TB 3MTJA 4LRCA 3DXSX 4DX5A 2VA2A 7AT1B 2FZCB 4DV0J 3C6UB 1RQ0A 3RAMA 2ZNYA 2W7AA 3KUGA 3SQOP 2JC1A 3V81A 1IKVB 2GNKA 1VHFA 3UVJB 1TVRB 2HFNA 4EWTA 3PIOQ 5IOLA 4I2PA 3TUZC 3CO0P 3ENQA 4K0KF 5K9FA 3NNHA 4PQAA 5EN1A 2D3OR 4IR1A 1CSJA 3M1VB 2BA9A 4HL9A 2N82B 1S0MA 1U6ZA 3L4BC 2YBVA 1AUDA 1WJ9A 4MH8A 2B9XA 2AJQA 3TAPA 4LIWA 5K20B 3HVWA 3AFGA 2B6AA 4PG8A 3BYPA 3C66A 3W61A 1WEYA 3SV4A 3IR5B 3CMES 2Z2LA 3LWLA 1S9FA 1C4AA 4MTPA 2VOPA 2PO4A 1ZETA 1C0UA 3V4IA 1DTTB 1WSRA 1U1OA 5BXIA 1BY9A 4Q0BA 1APSA 3AB4B 4A46A 1U0SA 1F6TA 4R8UB 1S4FA 1C0TB 3KG0A 4DUYJ 3BEGB 2J9DA 3H2VE 4JI2F 4OL8A 2ZNZA 1RBAA 2ZVIA 2HFOA 2AW0A 3OJSA 2Z0GA 3EVMA 2KU7A 1IXKA 4ZCLA 4DZ6A 2C3UA 3S6EA 3O3LA 7FDRA 1UPMB 3DLHA 1TL5A 2PD1A 1SC3B 3KJNB 2RSQA 5D3GA 4ICLA 4PAAA 5IV3A 1NRKA 3C6TA 4YDDB
chains in the Genus database with same CATH topology
1GMWA 3TJ8A 3NXZA 3LZ8A 3AGXA 3AGYA 3AGZA 1C3GA 3LA0A 3L9ZA 1XAOA 1NLTA 1GMWD 3NY0A 4L3KA 2QLDA 2HFVA 2Q2GA 1EB0A 4J80A 2B26A 1GMUA 3I38A 1EARA 3TJ9A 1GMVA 3TJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMW A;  3TJ8 A;  3NXZ A;  3LZ8 A;  3AGX A;  3AGY A;  3AGZ A;  1C3G A;  3LA0 A;  3L9Z A;  1XAO A;  1NLT A;  1GMW D;  3NY0 A;  4L3K A;  2QLD A;  2HFV A;  2Q2G A;  1EB0 A;  4J80 A;  2B26 A;  1GMU A;  3I38 A;  1EAR A;  3TJ9 A;  1GMV A;  3TJA A; 
#chains in the Genus database with same CATH topology
 1OIA A;  5KFT A;  3CIZ A;  1RWU A;  3EMT A;  4PXB A;  1UTA A;  4NCG A;  1VQL S;  3NMA A;  2BJ3 A;  4C3K A;  3BSC A;  3D9B A;  1LFP A;  3KFW X;  1EQM A;  4MKA A;  1S1X B;  2Q1L A;  3JTN A;  4Y2I A;  5K8M A;  3UN2 A;  2XHC A;  3IS9 A;  1NU4 A;  2V68 A;  4I56 A;  4OJ1 A;  4ZA1 A;  4FP9 A;  1GX5 A;  1HFE L;  2DBB A;  4DJB A;  5IWA J;  3NS5 A;  2IVM A;  3CJ5 A;  2OH2 A;  5H9E J;  4LFC J;  5C42 B;  2Y0B B;  4IO1 A;  3QPI A;  2M0G B;  4K2J A;  2D3U A;  1ZM3 A;  4PXC A;  2AJ1 A;  2IAJ B;  3E3X A;  1M1K T;  2AU0 A;  1DTQ A;  1M90 T;  2QA4 G;  2QLB B;  4CO2 A;  3EPG A;  1G3O A;  4ZVU B;  2QLW A;  3FRY A;  2U1A A;  3ILI A;  4NPO A;  5I3U A;  1RU2 A;  3BKF A;  4KQZ A;  5I42 A;  5GAE U;  1SJ1 A;  3CNQ P;  1VQ4 S;  4IFV B;  5B0A A;  4GRS A;  3MM5 B;  2VFU A;  3H5U A;  4KV8 A;  2MQQ A;  2ALY B;  5AT1 B;  2N7Y A;  1CC7 A;  3UR3 C;  1ACM B;  3M8P B;  3IC1 A;  1IJE B;  3R27 A;  3OR1 B;  3PKM A;  4NXM J;  3J7Y U;  1RWW B;  5LMN J;  4G1I A;  3ZC4 A;  3IRX B;  4L76 A;  1J5E J;  2ZWP A;  2AMC B;  5KFN A;  4PG7 A;  3M8W A;  3OUY B;  2GVD A;  2DYA A;  1UWB B;  2KHD A;  1NDP A;  4DFM A;  3MM6 B;  2JFK A;  5DQG A;  4K4W A;  3KHH A;  4DN0 A;  4PG4 A;  3CCM S;  3CJR A;  3T1H J;  4CLF A;  4V19 J;  2GV1 A;  5D15 A;  1NKC A;  5G0R A;  2UUA J;  4MIB A;  2AYB A;  4Z37 A;  4J9N A;  2CKW A;  4F26 A;  1IKY B;  5IM0 B;  2K3I A;  3AHP A;  3SCK E;  4K4Y A;  2F65 A;  2AGQ A;  3LAL A;  2IM1 A;  2QLJ B;  3EGZ A;  1U1N A;  3DOM A;  2XLK A;  1U1K A;  3EXC X;  4O4R A;  3VHQ A;  4NLG A;  4ZLN A;  1F5C A;  4B3M J;  4ZPA A;  3OTC A;  4OV1 A;  4NYO A;  4AE5 A;  3KLF A;  3O5T B;  4GMK A;  5DO2 A;  4C0H A;  1ZOT A;  1HMV B;  2DPJ A;  1PIL A;  1WWH A;  1CUL B;  2VKZ G;  3MWB A;  2K3K A;  2JFD A;  1UVK A;  3GE9 A;  2ATC B;  1EB0 A;  2Z2Y B;  4DR7 F;  1S48 A;  1TEL A;  2CPI A;  3UCG A;  1FWL A;  2AT1 B;  2AJF E;  3PW2 A;  3D2W A;  2YNG B;  4JYA J;  2W9A A;  2PE8 A;  1M5H A;  4R5P A;  4RZR A;  3W9J A;  3UPF A;  2QA1 A;  3CJ8 A;  3HLU A;  3UN3 A;  2VG7 B;  1D9D A;  4I6W A;  2XYH B;  2LXF A;  5CQG A;  2UXD F;  1K1Q A;  2UXB J;  2I9S A;  1XNQ F;  5KFF A;  1QJH A;  3G2X A;  3VVT A;  2KFN A;  4ZVT B;  1X5T A;  3MMC A;  3J81 U;  1HD0 A;  1IQZ A;  2OTL S;  1GTH A;  1VDH A;  1RTH A;  2CQ0 A;  2JRR A;  3K7R A;  3CDB A;  3BR8 A;  1LEO A;  3AQP A;  3C2P A;  1MLA A;  2V63 A;  3ZZ0 A;  1UA0 A;  2J0Q D;  5ETP A;  4KRW A;  5KFJ A;  4F4A A;  4LSN B;  4B17 A;  3CC4 S;  4M5N A;  1RAD B;  2ZBR A;  3BGO P;  4JI8 J;  4F4K A;  1U45 A;  4PUO B;  6AT1 B;  2RE1 A;  3RBZ A;  2ABY A;  1RKJ A;  2C28 A;  3W3S A;  1HIY A;  5B08 A;  2CA9 A;  1WC4 A;  3BSA A;  3QT5 A;  5C5J A;  9ATC B;  2LU2 A;  1S1V B;  3VF0 B;  2MZR A;  3R3T A;  4C4W A;  1S6O A;  5HO4 A;  3WDO A;  3QMQ A;  3BQ2 A;  2V2Q A;  1JLG A;  3DU6 A;  3SFU A;  3AD7 C;  4CM0 A;  3CW2 C;  3RRK A;  3H8Y A;  1E6V B;  3KK3 A;  1I1G A;  4DV3 F;  3RG6 A;  2HLU A;  4ED8 A;  1KLM B;  2J0W A;  2XTJ P;  3D6M B;  1RLD A;  1FHT A;  4BCA A;  2ZFH A;  1HLW A;  2NPI A;  2ZH6 A;  4B9T A;  4P2X A;  1KQF B;  1RTD A;  2B51 A;  3Q2T C;  1EKR A;  3KK1 A;  4DR4 J;  2MXY A;  1GK8 A;  2YKN B;  5IC4 B;  1RBL A;  4J9M A;  4YY3 J;  2CWX A;  5CYM A;  1H2V Z;  2MQ8 A;  4TQR A;  4WP3 A;  1S9E A;  4QR1 A;  5KFS A;  3UR0 A;  3C16 B;  1ZBT A;  1WOP A;  4CT9 A;  2CNO B;  1T7P A;  3WX4 A;  4NA1 A;  2C2D A;  4C98 A;  5L39 A;  5LXR A;  3SZ2 A;  4CLW A;  1Q86 T;  4DV5 F;  4ZP8 A;  3NWR A;  2F5G A;  1S4E A;  1W2B R;  4O3O A;  4DR1 F;  1SKS A;  2YTC A;  1RTI B;  2GJI A;  2EBG A;  4KH1 B;  2RJZ A;  1RT2 A;  4NYP A;  1FK9 B;  2OO4 A;  2WON B;  4RPF A;  1C3G A;  5HMZ A;  1WDT A;  2W2O P;  3R7N B;  4EMD A;  3R1L A;  3ZZO A;  2E5L F;  3BS9 A;  1TL7 A;  1HNW F;  3R6L B;  2AJ2 A;  2ZH8 A;  1ZM2 A;  4JB8 B;  4RW6 B;  2J6T A;  2EK6 A;  1CEZ A;  1KFD A;  4ZOS A;  4U95 A;  4B9L A;  3NCR A;  2CZ4 A;  1UFK A;  2WZ1 A;  2KI2 A;  4Q2M A;  5H9E K;  3PZP A;  4NLP A;  4F4W A;  1M1H A;  1DY3 A;  2NLW A;  2DNM A;  3LP0 A;  4I6A A;  2M5Y A;  4KT0 C;  4ZVQ B;  3IRW P;  4EU0 A;  1X4C A;  3SBM A;  1YRX A;  1FA0 A;  4LQ3 A;  5CCM A;  2JVM A;  2VPX B;  3Q22 A;  5FLX U;  1X0F A;  1NK6 A;  4N76 A;  3WZ0 A;  2XO7 A;  1KD1 T;  3CUN A;  2UV8 G;  3FEX B;  3PCO B;  4IG0 A;  3H5Y A;  3MM7 B;  4BC9 A;  2WSF C;  2XB2 D;  3UD5 A;  1YZ6 A;  3LP1 B;  1ZTT A;  4ZVG A;  4ECX A;  2OD4 A;  3KJV A;  1NK4 A;  3I32 A;  2ZDO A;  3A3O B;  4NEZ A;  5IV4 A;  3UFC X;  3HO1 A;  4UOF A;  1BQM A;  1R0A B;  3LUY A;  3S7R A;  2EK1 A;  1V3Z A;  2PN6 A;  2RU3 A;  2FJA B;  3EGN A;  2E29 A;  2UV8 A;  4TQS A;  3W66 A;  1UJ5 A;  4KY3 A;  2FHO B;  5A8K B;  2A3J A;  4FNI A;  1SVD A;  4DWI A;  2Y9H A;  1T05 A;  2GGP B;  1YJR A;  1UPP A;  1GTE A;  2BJ7 A;  1M5O C;  3A8K A;  1NBE B;  2K1R A;  3ULH A;  1SUQ B;  1Q78 A;  3HHN B;  1VI7 A;  2ASJ A;  2E9R X;  2NUU G;  4AXI A;  3MPY A;  3EDQ B;  1GH8 A;  5IFM A;  1U0H B;  3M2R A;  1HA1 A;  2C2E A;  1Z2L A;  2M88 A;  1VRU B;  1DQA A;  3GZ7 A;  3OFG A;  1ZH5 A;  4HI1 A;  4CO3 A;  2PI5 A;  4DR6 F;  3W65 A;  1G1X A;  2B7B B;  3THV A;  3DRS A;  4EI2 A;  1Q53 A;  4WCE Q;  3UDL A;  3D1Q A;  1RBO B;  3AOB A;  2QYG A;  3LO3 A;  2BOA A;  3EZ5 A;  4GKK F;  3BN4 A;  3QNW B;  3C15 A;  4WXW A;  3RR8 A;  2UXC F;  4KJI A;  2FQQ B;  1S9G B;  1GQE A;  2X1F A;  4DX7 A;  2ZJQ Q;  3VGT A;  1L3T A;  3ET6 A;  1TFY A;  1FKA F;  3LP2 B;  3EGW B;  2ZHB A;  2CZ9 A;  1YJT A;  1NH8 A;  2JHE A;  1FDD A;  1T9T A;  3V6H A;  3I38 A;  1OPZ A;  2DGU A;  2CPX A;  4X4T A;  2VD3 A;  4DOZ A;  5HBM A;  1FWK A;  4YB7 A;  2JNJ A;  4LF2 A;  1I51 B;  2YX1 A;  4DPX A;  4Z2X A;  4F8R A;  3IWN C;  1JLB B;  1S49 A;  2B9Y A;  2XHW A;  2JWN A;  1RT3 B;  2VBZ A;  1RLC L;  3TOQ A;  4LR8 A;  1KVI A;  4S0M A;  1S57 A;  2V94 A;  3WIU A;  4O4G A;  1HPZ A;  4QU7 A;  1JNZ B;  3MMB B;  3GFY A;  4QPT A;  5A2Q Y;  2P8I A;  4IG3 A;  2V6A A;  3W2V A;  3NAH A;  4J9O A;  1NH7 A;  3EVO A;  3I5A A;  3DLK A;  5DET A;  2JVO A;  5KFW A;  1ARO P;  5ETN A;  1VC5 A;  1ZM4 A;  2HMI A;  2FGC A;  4NLT A;  4WE1 B;  3HUL A;  1H38 A;  2HRY A;  3G4S S;  1LWC B;  2MY8 A;  2JOQ A;  4ZJQ A;  2OFG X;  2QL7 B;  3DRR A;  2EFP A;  3MAH A;  4M63 A;  1Q8K A;  4X84 A;  1XNR F;  3KMS A;  1QLN A;  3KNA A;  1WOS A;  4QIF A;  1VRQ C;  5HJY A;  1U1M A;  4F0M A;  2GVZ A;  1N5Y A;  1S77 D;  4QZV B;  2YXL A;  2KZZ A;  4FN5 A;  1VBX A;  1SQF A;  4LRB A;  3JS9 A;  1FTR A;  1RSC A;  4DL0 C;  4H4O B;  5GMD A;  1FFW B;  3LPE A;  5ADZ A;  5B7W A;  2LQ9 A;  2N3O A;  4ECU A;  4F3Q A;  3ZZY A;  3PYD A;  2VJV A;  2IC3 A;  1SKU B;  3RYL A;  2QMW A;  2Q2G A;  4ECR A;  4LF9 F;  2XS2 A;  1ZZN A;  4BS2 A;  1NUE A;  1DLO A;  5K8P A;  4J90 A;  3UNY A;  2XZD B;  1X7V A;  4M5G A;  1H98 A;  2OAU A;  1AB8 A;  4RX6 A;  3CCV S;  3KHR A;  2WVF A;  2OEJ A;  2E1A A;  2IY5 B;  4L3K A;  3T6B A;  4WFN Q;  4USJ C;  5LMU J;  3MR3 A;  4CQ1 A;  5DLG A;  4O0I A;  2MGZ A;  2YNF A;  3RBX A;  1F5B A;  1Q7L B;  1WKJ A;  4IRK A;  2V69 A;  5DDR C;  5LSL A;  4J91 A;  1VQM S;  2UXD J;  4DV4 J;  4DZD A;  4MFB A;  2OPQ A;  5GAG I;  3Q89 A;  5JMN A;  3NWG A;  4ZP7 A;  5HAT A;  4OQJ A;  2B8P A;  4DPO A;  4H4K C;  2ZJR Q;  4CLP A;  2L9N A;  3OTO F;  3SEO A;  2R8I A;  1R43 A;  2Z4P A;  4ED7 A;  4ZVS B;  4C8Z A;  4LFA J;  4TNO A;  5HLF B;  3OHB A;  5AE1 A;  3IAM 9;  2GJ2 A;  4RU2 A;  3ZTR A;  1WNE A;  1KQG B;  3HT3 A;  1PAE X;  3TQE A;  3TRG A;  1TFW A;  1KOH A;  2H54 B;  1LQ9 A;  2Q43 A;  8ATC B;  3CE8 A;  1GXU A;  4CO5 A;  4YB1 P;  1HBU A;  5A6P A;  1S79 A;  1JKH B;  2QGF B;  1RWP B;  2HQD A;  3H20 A;  3OL8 A;  1HNV A;  2FZK B;  5EDW A;  4OX6 A;  1VQ5 S;  2DD8 S;  2PFF B;  1GMW A;  2ZKT A;  2WAQ D;  2PA3 A;  4NML A;  3KLI B;  5KFC A;  2V2Z A;  1H7W A;  1EQ0 A;  4HAC A;  3TAM B;  2C2K B;  2RRN A;  1C4C A;  3TQ1 A;  4FYX B;  1LW2 A;  1DUR A;  2AGO A;  2IA0 A;  4I6Y A;  1SJF A;  1B0V A;  4OYW A;  1BGX T;  3DDI A;  3DGP B;  3LH2 S;  1NJI T;  4XPC A;  3H4D A;  1RWK B;  3ENW A;  1FXD A;  2CVE A;  1HWJ A;  2JZ5 A;  1U2R A;  3QJP A;  4J9S A;  4N77 A;  3OLB A;  1IR0 A;  3BSN A;  1XN9 A;  1CLF A;  3P8B B;  2KT2 A;  1S0N A;  3KTQ A;  3BGR B;  2B9E A;  2BE7 D;  1T9U A;  2DT9 A;  2BQU A;  2V8H A;  2FLL A;  2C3Y A;  3KLH A;  1QVG R;  2QFJ A;  2VG5 A;  3LGM A;  5LM7 E;  2J7K A;  1YX2 A;  3MCM A;  2FJB B;  3HHL B;  4A8Y A;  1LV5 A;  4LF6 F;  2CUY A;  2XGP A;  5ETQ A;  3W8G A;  1UVJ A;  3W9I A;  3NS7 B;  5F8L A;  1UEK A;  2FPH X;  3I5B A;  3JB9 k;  2DNZ A;  4AQY F;  4ZVE A;  3PRD A;  2KTQ A;  3DRX A;  5LSR A;  4DU7 A;  5F8I A;  2RQK A;  1VQ9 S;  4Y65 A;  1U6F A;  3Q23 A;  1YHQ S;  4ZP9 A;  2DRA A;  1GMV A;  2COL A;  5KFE A;  3X3U A;  4RNF A;  3AGY A;  2MZJ A;  2FVS A;  4DV5 J;  1RU1 A;  2LKZ A;  1VQP S;  3ZFV A;  5IT9 Y;  4Q44 A;  3QJL A;  2I5J B;  2VH7 A;  4QWC A;  1YLX A;  2UP1 A;  4CYU A;  3WX8 A;  4UUW A;  2YQ3 A;  4JI3 J;  3HJF A;  2MEW A;  5CYQ A;  2FDN A;  3R5D A;  1WTB A;  4YOE A;  3NNC A;  5L1K A;  2IDE A;  3T5J A;  3SCL E;  2Z56 B;  2VJU A;  1FRK A;  2ZBP A;  2DXD A;  3RBE A;  4L3N A;  2HVZ A;  3MOJ B;  2A10 A;  4WBF A;  2E5J A;  3M2V A;  1TK8 A;  3OW2 R;  1EET B;  3TAN A;  3RGI A;  1F3V A;  1Y11 A;  4TY8 A;  4UOH A;  3PO4 A;  1R3N A;  3N0V A;  3IA0 A;  4QWA A;  3V6D B;  3VWS A;  4DF4 A;  4KR0 B;  3KG4 A;  2E1M C;  4WK3 A;  1S1U A;  4BC7 A;  3KG1 A;  1VIX A;  1KN6 A;  1WHY A;  2ZC3 A;  3GV5 B;  4J9P A;  3NRB A;  2HAI A;  4JI0 F;  4QW8 A;  2MDA A;  4TLQ A;  4CNZ A;  1KHV A;  5BR8 F;  4I2P B;  2YWE A;  4WIQ A;  2H5J B;  2BAN A;  3EJM A;  4ZS6 A;  1Q4R A;  1HD1 A;  4KPC A;  4YP3 A;  1UKU A;  1F0X A;  4EUV A;  4B9N A;  3OXF A;  5U47 A;  3CJK A;  5D0R A;  4P71 A;  4OHV A;  3I9Z A;  1R6Y A;  1YG0 A;  4W98 A;  3A12 A;  4KKO B;  1H0H B;  2W8K A;  4FXV A;  3J80 Y;  3Q8U A;  5KG5 A;  2FIU A;  3POT A;  2AYE A;  4DPT A;  2ZM6 F;  1T3N A;  2GHV C;  2IJR A;  2ILZ A;  3C8Y A;  2DIS A;  2CJA A;  4DQP A;  1VLY A;  1S1W A;  2AGP A;  2W7P A;  3T5L A;  2DNQ A;  2C1E B;  1N88 A;  5JUM A;  3V4I B;  3TJA A;  2E9Z A;  1EZZ B;  4YDX A;  3BO3 A;  2V8D A;  5F8H A;  2XYG B;  1UET A;  1FWP A;  3SDE A;  3I0S A;  4Q45 A;  2DGS A;  2IJF A;  1VCT A;  3CO9 A;  4FBU A;  1RHK B;  4X4S A;  3OR2 B;  1RAG B;  1NDL A;  2H65 B;  3G96 A;  2YNI A;  4Y28 C;  1YIJ S;  4DV7 F;  1T3O A;  3W2W A;  5HRO A;  4FYY B;  1CJK B;  5KG0 A;  2R8J A;  4OZJ A;  5GAH U;  1Y3K A;  4K59 A;  2XCA A;  5M2P A;  3U1M A;  1TV6 B;  1YBT A;  4ICL B;  4RW4 A;  1RT4 B;  2F63 A;  3C6T B;  3M32 A;  1XEZ A;  1NB2 A;  2FLP A;  3D6T B;  2BQ3 A;  3MAA A;  4ED3 A;  5IXU A;  2GO9 A;  1FI4 A;  1SI9 A;  1RWN B;  2F9D A;  4NCG B;  2OTJ S;  4GKK J;  4K4X A;  3T9Z A;  1JLF A;  2MY7 A;  1HNI B;  1JNR B;  3EXY A;  3K2Y A;  1KLN A;  2G4B A;  1MML A;  2VG6 B;  2ZOF A;  4U96 A;  1XER A;  4W4M A;  4NLS A;  2R7V A;  1J27 A;  3MM8 B;  2ZZN A;  2A2C A;  1NK7 A;  2ZH2 A;  4YHH J;  5KT3 A;  1HNZ J;  1YKW A;  1DTQ B;  2VIC A;  1YZ7 A;  4P75 A;  4CLY A;  2Y1J A;  4B9U A;  5I42 B;  3CDA A;  4ELU A;  4FYD A;  4WFX A;  3PIP Q;  2CAD A;  2HFV A;  4M8L A;  4HKQ A;  1JJ2 R;  1YQH A;  2DNY A;  2WVB A;  4WFB Q;  2AEF A;  4AT1 B;  3FSI A;  3SV3 A;  1DHM A;  2UU9 F;  1XJW B;  2QLF B;  4OYZ A;  1XAO A;  2FHJ D;  1RT5 B;  2IFX A;  2VOO A;  2VB6 A;  4KYZ A;  4FYV B;  3ZTO A;  1UJ6 A;  4A8O A;  4NAS A;  2JX2 A;  2WTF A;  1S1T B;  4J5O A;  3ISZ A;  2R9L A;  1HI8 A;  1WD6 A;  1LWE B;  2VFT A;  1C1C A;  4KE5 A;  2MKH A;  3QO9 A;  3HSZ A;  1RWO B;  5F3T A;  3CF5 Q;  1XNR J;  4IH7 A;  1CJU B;  1WG1 A;  1FXR A;  4NLW A;  3WIV A;  4D3G A;  4DS5 A;  3C14 A;  2ATL A;  5DG7 A;  3QWU A;  5ETV A;  5J2N A;  2EFO A;  3DOM B;  3LTO A;  1YTY A;  3DGV A;  1JJH A;  1JJ4 A;  3EUN A;  5BYR A;  2CQH A;  2X3G A;  3DKD A;  1VIS A;  1UVI A;  3CCJ S;  2CQ4 A;  4CLL A;  2HVD A;  1MSW D;  4YQW A;  2RVJ A;  4ECW A;  3PR4 A;  3MAQ A;  2B4V A;  3CGI A;  3HZG A;  4D3H A;  1NXI A;  4QU6 A;  2Q79 A;  2M8D B;  1PGZ A;  2PII A;  1DBD A;  3WHI A;  1IJF B;  3MCN A;  4YN3 B;  2ZVS A;  1ZTW A;  3GP9 A;  2ZZM A;  1N0U A;  2PEH A;  2WOM A;  4KGM A;  4UW2 A;  3ZTP A;  4WU2 A;  4ZPT R;  3QSI A;  3KK2 B;  2QZ8 A;  4LF9 J;  4BBY A;  4R0J A;  3UCZ P;  3BRE A;  4U8Y A;  3NS6 A;  4O3Q A;  3MEE B;  2G13 A;  2I8E A;  4G6V B;  3AJ2 A;  3S01 A;  5ETR A;  2ZC4 A;  4PWD B;  4WKR A;  1YBU A;  1CPZ A;  1DAX A;  1EP4 A;  4RBU A;  3O44 A;  4A8M P;  3BH6 B;  3EWG A;  3CCR S;  3B6B A;  1MNE A;  3THP A;  1TP7 A;  4H4K A;  2GAH C;  2BE9 B;  5A8R B;  1GFW B;  4AND A;  1JLA A;  2BAC A;  4PYD A;  2GAG C;  2QSW A;  4RNN A;  3MR7 A;  3DMJ B;  4NA2 A;  4DL5 A;  3D28 A;  2XSJ A;  4NI2 A;  3MMC B;  3T6J A;  2DGV A;  2BKN A;  2HEK A;  3UN5 A;  3DLJ A;  1S10 A;  3M8Q B;  2B5J A;  3IBC B;  4C11 A;  3GSD A;  3ZZU A;  2XY6 A;  4USH A;  2HHS A;  2A6O A;  3HHL D;  5D77 A;  1YI2 S;  1H73 A;  1XMO F;  5KT4 A;  4IOA Q;  1VQS A;  1EAY C;  3O2I A;  2HK3 A;  5DDO C;  5F0W A;  3N6N A;  2MLX A;  3FBE A;  1VQ7 S;  1RT7 B;  4DL6 A;  3RR7 A;  1A0O B;  3HDS A;  2R2U A;  3IP0 A;  2MTL A;  2B0G A;  3FBB A;  2MQP A;  3E01 B;  4PQU B;  4F4Y A;  3FJ2 A;  2QMX A;  4ED4 A;  3GYX B;  3I0R A;  2BJD A;  2BM1 A;  1J5O A;  1NHK L;  3BBC A;  1NDK A;  3R9L A;  3E8O A;  3VCD A;  5KG6 A;  3MOZ A;  2Q66 A;  2RDI A;  2R8H A;  2YKP A;  3LAK A;  3VAK A;  3NXZ A;  1QSY A;  4H4M B;  2K8G A;  1OJ4 A;  2KKH A;  4DLE A;  2Q3P A;  4O3S A;  1IN0 A;  9RUB A;  3I55 S;  3NGR A;  5AXK A;  3MMA B;  2JJ4 D;  2HHH F;  2WW4 A;  2Z30 B;  4KB7 A;  3H4B A;  4DV6 J;  4QOT A;  3HXM A;  3DRY A;  1L3S A;  3TP2 A;  3R1H A;  1HBO A;  3B82 A;  2V67 A;  1P6T A;  1B99 A;  2W9C B;  4OI0 A;  3CDE A;  4U6P A;  2CRL A;  3L95 X;  4MYU A;  1LKZ A;  2KO1 A;  4O44 A;  1Z4U A;  2J9D E;  5EX3 A;  1AFJ A;  4ZLJ A;  4ALZ A;  2J7U A;  5CYM B;  1SV5 A;  5CD4 A;  2DH8 A;  1RHQ B;  1LK5 A;  5E3C A;  5LOQ A;  2XNR A;  2GZO A;  3MUM P;  2A1B A;  1FXL A;  4ZVR B;  3AOA A;  5K8O A;  3TZZ A;  4IYQ A;  5ETT A;  4PXD A;  1SH0 A;  2ZEJ A;  2DHA A;  5A2Q U;  4NE9 C;  1FKP B;  1IUJ A;  4RW8 A;  5L1L A;  2VFS A;  4Q2L A;  1H7X A;  4CH7 A;  2DCU B;  1IR2 A;  5JVG Q;  1ITP A;  3SXL A;  1IKW A;  1RKI A;  4DF8 A;  3BGU A;  1FNO A;  4ZVF A;  1TL3 A;  1Q5V A;  4ED1 A;  4X4Q A;  2ROE A;  3G71 S;  2IHR 1;  4WII A;  2LCW A;  1T03 A;  2HHU A;  5C24 B;  3H25 A;  1DFD A;  1T0T V;  3FBC A;  3TJ8 A;  1SBR A;  5B09 A;  1HBN A;  4NRT A;  4R25 A;  2CQB A;  3HJV A;  3TVZ A;  5CAB A;  4EBE A;  4X2B A;  3LAM A;  2EW9 A;  3MPD A;  3LP0 B;  2Y3Y A;  5KFP A;  2IM3 A;  2KH9 A;  5IZH A;  1SJQ A;  4ZVO B;  4KAI A;  1N56 A;  2W24 A;  3UDE A;  1NB7 A;  3AB2 B;  4I2Q A;  2EPI A;  1E6Y B;  4L72 B;  1IR1 A;  3GV8 B;  2CJ9 A;  4AL6 A;  3DRP A;  4ZLL A;  4P72 A;  4PRF A;  3HSD A;  3CT9 A;  1IBK F;  2F7V A;  1Y4Z B;  1HHT P;  5H9F K;  4WFZ A;  4KIA A;  2DVI A;  4ZPW R;  4QR0 A;  1K47 A;  4P2F A;  3LWM A;  2DIU A;  4IH5 A;  4ZMM A;  2RIL A;  4W90 B;  3JQM A;  3MUR P;  5J1P A;  1L3U A;  1H6K X;  1SCJ B;  1N33 F;  3NGD A;  1T9Y A;  3L7P A;  3AOD A;  1NDC A;  4RNM A;  2X7I A;  3BV8 A;  1P8G A;  3MDF A;  2ZD1 B;  3D6F B;  3G6X A;  3H42 A;  3KXD A;  1N5Q A;  1CJV A;  1PG5 B;  4JI0 J;  2DH9 A;  1S76 D;  3B78 A;  4DFK A;  2G0I A;  2W9B A;  3EGV A;  4RKU C;  5BR8 J;  2N7C A;  5B0D A;  4QW9 A;  1H3D A;  4Y2M A;  3EPI A;  2WK4 A;  4N56 A;  2HW3 A;  1V6H A;  4PPZ A;  1IKX A;  1R8H A;  2HS4 A;  4ECT A;  1N8R T;  3OHA A;  4EK2 A;  4JI5 F;  4HHJ A;  4V1A k;  3JYT A;  5AXL A;  1ROF A;  3QIP A;  1REG X;  5JXS A;  3N6L A;  3UD4 P;  1WC1 A;  5KFB A;  2E1P A;  2CQ3 A;  1T05 B;  2OFH X;  3PM9 A;  2NR0 A;  2ZM6 J;  4FPR A;  4HDG A;  1NAQ A;  3A8J A;  1VRT A;  3ZNU A;  1IWA A;  1LK7 A;  2W2M P;  1NPK A;  5DRK A;  4OHW A;  2YNH B;  4PR6 A;  4UY8 T;  2NXU A;  3LA0 A;  3DI6 A;  2NUH A;  2POK A;  3M2U A;  2EFQ A;  3CDU A;  3MTK A;  2XGQ A;  3PY8 A;  3HPO A;  3HZE A;  1ULR A;  5KFI A;  2HBZ B;  3FBF A;  3DRS B;  2HK2 A;  3PRV A;  2D7S A;  3DLG A;  1KS2 A;  1SQG A;  1RHJ B;  1REV A;  4DV7 J;  2FTR A;  2N3L A;  5DZ7 A;  3ZNJ 1;  1HW8 A;  3PW0 A;  2VAS A;  2KYX A;  4QR2 A;  1F5A A;  4M5D A;  5MLC V;  2EEY A;  2XYP B;  2HHP A;  2K7K A;  3UE2 A;  1KON A;  3T3F A;  4DL2 A;  3U02 A;  1LWF B;  1KEK A;  1WOR A;  1OSC A;  1XWL A;  2PMW A;  5HBM B;  4JBC A;  1U4B A;  1CS4 B;  4JUZ A;  2ZJP Q;  2PGC A;  2HGM A;  2HZC A;  2NRE A;  2QL5 B;  4E2F B;  4UT4 A;  4GKJ F;  2NPF A;  3JAM Y;  3NBP A;  4DQR A;  3R5G A;  3VZI A;  4CLZ A;  1N4L A;  2DR8 A;  3C6U A;  2APO A;  2FY1 A;  1BQN B;  3ICL A;  4QPX A;  2XEX A;  3HP6 A;  1NKE A;  1WG5 A;  4ZVP B;  3KDO A;  1HPZ B;  1Y00 A;  2I0X A;  1IKV A;  5AJ3 J;  2GIR A;  1KVJ A;  3GCX P;  1TVR A;  2XC9 A;  2DR9 A;  3W2V B;  3G6E S;  4JI6 J;  1Z1Z A;  5D4L A;  4JI4 F;  3W62 A;  3GIJ A;  4U7C A;  3DLK B;  2V0N A;  4DCO B;  2HQI A;  3M1V A;  1WI6 A;  2HQC A;  1NK9 A;  1BD6 A;  1FF2 A;  4LBH A;  4U67 Q;  2I2Y A;  2ASD A;  3R6G B;  3D1H A;  4F04 B;  2FHK A;  4X62 F;  2JEG A;  4USK A;  1WHX A;  3ISN D;  4V19 X;  4RNO A;  4ED2 A;  4CTA A;  2J7W A;  2GVZ B;  3N4W A;  5RUB A;  3HHK A;  1DTT A;  5IT9 U;  2BJ8 A;  4LF5 F;  1TMM A;  2XS7 A;  2DXE A;  5EWE A;  2JSX A;  4ECQ A;  2VA3 A;  1C0T A;  3UDC A;  1S12 A;  1U02 A;  2KVI A;  2HVI A;  2R7R A;  2KZM A;  2HWT A;  1KWM A;  2EFN A;  5KG2 A;  3FGV A;  4CO1 A;  1ZA2 B;  5CAA A;  1QD1 A;  1HBM A;  3RAX A;  2ZIT A;  1H2T Z;  4J37 A;  5KOX A;  2P9C A;  4A8S A;  4OMF G;  2VFR A;  1FD2 A;  2OEL A;  1D0E A;  4XDC A;  4NLY A;  4QYZ J;  4ZKA A;  4ZCI A;  4MK7 A;  3BDE A;  4AXJ A;  1RB0 A;  1TUW A;  5KOW A;  5B0G A;  3X1L B;  1SL2 A;  1TU0 B;  5HVF A;  4OLO A;  5GME A;  1TL1 B;  2UUC F;  2N4D A;  2ZKU A;  1RI7 A;  2XMV A;  2IRU A;  4KBI A;  1W7W A;  5THW A;  5CA5 A;  4P9S A;  4ZCK A;  2YNF B;  1PC4 A;  3D54 A;  1GEH A;  5HMY A;  5C42 A;  1GT8 A;  3GON A;  2RQM A;  2VQF J;  4LF8 F;  3MEC B;  1JIH A;  1HWK A;  3HT0 A;  2NZC A;  4DCP B;  2HHX A;  3MR2 A;  2RT3 A;  2OPQ B;  4M5L A;  1FFS B;  4KO0 B;  3PG9 A;  3D0H E;  1N5S A;  1FJ7 A;  1UVL A;  3RU0 A;  2R7Q A;  4IFV A;  3MM5 A;  2W25 A;  3NGK A;  3N9U C;  1N32 F;  1MMN A;  3AA8 A;  1RDR A;  3ILO A;  3Q24 A;  2XNQ A;  3ZZP A;  3M8P A;  1AXQ A;  3BN7 A;  5KFY A;  4F25 A;  4WXO A;  3OR1 A;  5D78 A;  1TL4 A;  3QGG A;  4DI6 A;  3D0I E;  3SSS A;  1JLQ B;  3TA0 A;  5LJ5 Y;  3ELH A;  4LSL A;  1JMT A;  1HBU B;  4N47 A;  4CT8 A;  4ETX A;  3OUY A;  1WF1 A;  3IR6 B;  3IO1 A;  2UUB J;  3VGS A;  4LMZ A;  4DSJ A;  3UI3 A;  1O51 A;  3MM6 A;  3CED A;  3R97 A;  3E2E A;  2ZH3 A;  3KJF B;  3OSN A;  3T1Y F;  1IKY A;  3HVT B;  3OT9 A;  1I94 F;  1VYA A;  3WBZ A;  5IM0 A;  4E98 A;  2CNK B;  4PYA A;  4CH1 A;  4HHU A;  1QM9 A;  5ITH A;  3JTP A;  4EZ9 A;  4OYM A;  2AYG A;  1VJW A;  1D1U A;  2V5H G;  2CPD A;  1UVM A;  3FFI B;  1C1B A;  4MT1 A;  4LRE A;  5F3Z A;  1HMV A;  2LLZ A;  2UVV A;  4ZIW A;  2XMW A;  2HHH J;  4DR3 F;  5FDL B;  1B70 B;  3ZXW A;  4F4Z A;  3AQO A;  4USI A;  1CUL A;  4TKT A;  1KTQ A;  1RXO B;  2CPF A;  2IJN A;  1FDA A;  2IVF B;  1ZS6 A;  4ECS A;  3GJS B;  4JV0 A;  5HAN A;  1N36 F;  3MR5 A;  1OY8 A;  1U1P A;  1MU2 B;  3MI7 X;  2YNG A;  1B7Y B;  3AT1 B;  4HDH A;  4Q8E A;  3A8I A;  3J7Z T;  2RRA A;  1NK0 A;  2R2R A;  3TUI C;  3VV2 B;  2G1D A;  1RAI B;  4MIW A;  3FEZ A;  2MHE A;  3M6U A;  1ZM9 A;  1SJ4 P;  1RAH B;  1YRU A;  1HWL A;  4LVN P;  2AQ4 A;  1XQI A;  1FES A;  3TZX A;  2V8P A;  3HMJ G;  3MM9 A;  8RUC A;  2WW8 A;  2OPR B;  2BRL A;  2HSE B;  4BHQ A;  4NRU A;  2L41 A;  3Q2S C;  4USW A;  5DM7 Q;  3FCH A;  2IYG A;  4ID8 A;  4CYU B;  1TKD A;  4DLG A;  3MD3 A;  5CYQ B;  3N6M A;  3HFZ B;  1NSA A;  1O0P A;  3GYG A;  4YB6 A;  2XI2 A;  4PUO A;  2AEJ A;  2J8A A;  3J81 j;  5J2P B;  1WC0 A;  3BSO A;  5KFD A;  4NL5 A;  2RKI A;  4CO0 A;  4RLE A;  1HWU A;  4DBQ A;  2CXE A;  1N34 J;  2FD2 A;  1S1V A;  3M2V B;  4AUK A;  3EVW A;  3CJT A;  2JLE A;  3FKB A;  4Y2K A;  5F8J A;  2MJN A;  1GAO A;  5EHH A;  3BKT A;  3Q8P B;  2Q6C A;  2XWX A;  1BC6 A;  1QDU B;  4F4X A;  1XMQ F;  2VQE F;  4F67 A;  1KLM A;  3LOU A;  2NXN A;  5KFM A;  2QEX S;  2R4F A;  2VDI A;  4JI7 F;  5AXN A;  3R5C A;  1HL6 A;  5HJX A;  1QTM A;  2QFI A;  4O0N A;  2Y1R I;  1U8W A;  3D3B J;  2BAN B;  4RU9 A;  3DCA A;  2KJV A;  4DSK A;  3CPW R;  2ZH7 A;  3FZ2 A;  3ITH A;  4KHP J;  2RDD A;  1Y5N B;  2YKN A;  3G8S A;  1SC1 B;  3HF5 A;  4K4Z A;  2QC3 A;  3DYA B;  4X64 J;  1U2C A;  4Y2C A;  5DJB A;  2HBR B;  2NSC A;  2RNE A;  1VBK A;  1S6U A;  3EE3 A;  3POT B;  3F0N A;  1WC5 A;  2F1F A;  4OZ1 A;  4B3O B;  2HPU A;  1S1W B;  2R2T A;  2GW8 A;  1UFL A;  1EKS A;  2PC6 A;  2VDH A;  4OIX A;  1RTI A;  3I87 A;  3IGV A;  1R89 A;  3VTI A;  1QUV A;  4QYZ K;  3HHL C;  2DCL A;  3MF5 A;  1FK9 A;  1NLK L;  2DY9 A;  4MKY A;  2WON A;  2MKS A;  3DFE A;  4FF4 A;  2K7J A;  2CQG A;  3H0P A;  1WKL A;  5DLF A;  1LW0 A;  5J1E B;  2QIF A;  5IT4 A;  1HQE B;  3ILJ A;  3W2W B;  1IBM F;  2KG0 A;  1RTZ A;  4RW6 A;  1OO0 B;  3K59 A;  4YFU A;  1Q82 T;  1IBL F;  2R7S A;  1D9F A;  2J9C A;  3UWT A;  2CQI A;  2L9W A;  1VQK S;  1WF0 A;  2OEK A;  2Y1I A;  3G82 B;  3KMQ A;  3RW6 A;  4NEY A;  2AYM A;  4P10 A;  3M32 B;  3CD5 A;  2WBR A;  2E44 A;  3HHD A;  3C6E C;  1X9S A;  4NCA A;  3KUH A;  1DQ8 A;  4DPU A;  3M8R A;  4C48 A;  1JLF B;  1N6Q B;  4PPD A;  3W8P A;  2W4D A;  2DNK A;  4NLX A;  1QAY A;  4PEO A;  4DR5 J;  3SSQ A;  3H90 A;  4OI2 A;  4JV5 J;  4DSF A;  4DV1 J;  1S72 S;  1LOU A;  2XMM A;  1RHM B;  5CZV A;  4LRF A;  4UZC A;  1LWX A;  4B3R J;  4M5K A;  1RGV A;  2NZ4 A;  2OEM A;  4XDD A;  3HHE A;  4EBC A;  2C42 A;  2JVR A;  3K0J A;  3K8W A;  1UW9 A;  2JC0 A;  1X8D A;  2I38 A;  3MM7 A;  3CCZ A;  2YKM B;  1NPP A;  2H3E B;  1NME B;  1XBW A;  4I7F B;  2MSS A;  3LP1 A;  2LVW A;  5C25 B;  2C2Z B;  3O8W A;  3VZH A;  2YWF A;  2ZWO A;  3GMG A;  2GA7 A;  1P9Y A;  4C8K A;  1FD8 A;  2CQ2 A;  4MMO A;  2XCP A;  1SJ3 P;  4J9R A;  3MCS A;  3SFG A;  1R0A A;  5K14 A;  2GHW A;  4Y00 A;  3P5B P;  4HT7 A;  1CVJ A;  3QFH A;  2Y8Y A;  4P7T A;  3FQL A;  1DZ5 A;  3FQK A;  2HIY A;  4PG5 A;  1C1C B;  4PXE A;  2HNY A;  3SQG A;  2V2V A;  3QO9 B;  2RS8 A;  4DUY F;  4DSL A;  4NLV A;  4K5R A;  4UF4 A;  2XG8 A;  2GMH A;  1FRH A;  2E5I A;  3D4J A;  3C14 B;  2VFV A;  4FVC A;  1SUQ A;  1QSL A;  1T95 A;  2W8L A;  3RB4 A;  1JXL A;  2NXC A;  2OJ3 A;  3C46 A;  2HND A;  2XY7 A;  4I69 A;  1U0H A;  2G0C A;  3IR7 B;  1CC8 A;  3TVK A;  2CPY A;  4LF5 J;  4P2S A;  2WCX A;  2RQ4 A;  5KT5 A;  4CH0 S;  1GNK A;  4NWB A;  4C8M A;  4GO5 X;  3W64 A;  2B4P A;  2MQN A;  4M5I A;  4Y6I A;  3PV8 A;  4OZ3 A;  2D1C A;  4URG A;  1GMW D;  3AH6 A;  4XO0 A;  4ZIV A;  3NCP A;  3PDN A;  3P4U B;  2DO0 A;  2QLX A;  3GJT B;  4P7V A;  4P6Q A;  2QT7 A;  2DGT A;  2WVD A;  4G65 A;  5K5M A;  1R31 A;  2PMH A;  1HYS A;  5IWA F;  4GVL A;  4LFC F;  1M1G A;  4DDF A;  2ASL A;  3OTB A;  2O5D A;  5HN0 A;  1URR A;  1F9E B;  4ID5 B;  3L7O A;  3DDN A;  1JLA B;  2NXJ A;  4KHR A;  4IO9 Q;  2V4Q A;  2UUC J;  2RDJ A;  1YJ9 S;  2DPI A;  1JLB A;  2BAB A;  3IG1 A;  1UEV A;  4JV1 A;  1FJC A;  3TWZ A;  4ZHR B;  3PR5 B;  3D68 A;  4C11 B;  3N01 A;  3RB0 A;  1RA6 A;  2MZ1 A;  2XLJ A;  5LMN F;  1PBA A;  1J5E F;  3A1Y G;  4EGL A;  5T14 A;  4DG1 A;  5D0E A;  3R7B B;  3MUV P;  1KQS R;  3D7S B;  3UD3 P;  1W26 A;  1WKK A;  2B56 A;  4XAK A;  3M30 A;  3EZU A;  1N32 J;  3T5K A;  3T1H F;  4DL4 A;  3MPU B;  2UUA F;  2W4P A;  2PDA A;  1NJW A;  3DHX A;  2CPE A;  2D74 B;  5A8W B;  3I5C A;  3AXM A;  2P6T A;  1B4S A;  5F8M A;  4IQM A;  3MZI A;  1S0O A;  2X1A A;  1LNQ A;  3PVX A;  2IM0 A;  1PC5 A;  3DLE B;  3HVA A;  2XQC A;  2KHC A;  2E1C A;  1X4A A;  3M05 A;  4XTT A;  4OYP A;  4DHV A;  2IMO A;  2J76 E;  4TU9 A;  2BMB A;  2KG1 A;  2V4J A;  3B4D A;  1F9H A;  4HHH A;  4ANE A;  1U8S A;  3AGX A;  5FLX Y;  4YEA A;  2BE2 B;  1MWQ A;  5ETS A;  2BUN A;  1HBO B;  5GAE I;  1NKB A;  4RBT A;  4HEA 9;  4ED0 A;  3GG0 A;  4CNY A;  3BF4 A;  2BJ9 A;  4JYA F;  4DN9 A;  5FJ4 A;  4C3L A;  3WC2 A;  3PW4 A;  3J7Y I;  4OYO A;  1M5K C;  3AJ1 A;  1G6B A;  1EJ7 L;  5KFL A;  4MKB A;  5E3Q A;  2WBM A;  4LR7 A;  3OTE A;  2PEB A;  4ANC A;  2PT0 A;  2VPY B;  1CQN A;  4GO7 X;  1CJT A;  3A3N B;  4ECV A;  2IPO B;  4OX9 F;  2Z8Q A;  3RZA A;  2FHJ A;  2JEI A;  2OMO A;  2AJ0 A;  3ZTS A;  3OXG A;  2MQL A;  2P6S A;  5F9L A;  4TN2 A;  5ETK A;  1RCO B;  4CM2 A;  3DXB A;  4JI1 F;  3W5Z A;  4X65 F;  4RW8 B;  2AV5 A;  5D6G A;  4L75 A;  2H4Y B;  3NG8 A;  2W4C A;  2YH1 A;  3QLH A;  2VBW A;  3L9Z A;  3ZZZ A;  4K0K J;  1IKW B;  1UZD A;  2EC0 A;  3KHL A;  2RUG A;  3RW7 A;  3NL0 A;  1TL3 B;  1CG2 A;  3TR5 A;  2IRX A;  1T03 B;  4RO0 A;  4F3M A;  5HQ8 A;  3TVY A;  1U1L A;  2DNP A;  2R7X A;  4LBP A;  1YRT A;  5HLF A;  1VK3 A;  2DNG A;  2LQJ A;  3GTY X;  3ISN C;  1ZPV A;  1HBN B;  1JJC B;  1S6P A;  3ENV A;  1SC6 A;  3PJX A;  3CCL S;  1JKH A;  2B4U A;  2FJV A;  1UCN A;  1YWX A;  2MHN A;  1P27 B;  1M5S A;  1OS5 A;  3IM9 A;  1N48 A;  3KLI A;  2HFS A;  2MMY A;  2P9E A;  4P52 A;  4OHX A;  3DRP B;  4QIV A;  4TXS A;  2X51 A;  3GIR A;  2ZE2 A;  3I56 S;  4JI2 J;  4WFY A;  5SZT A;  2CQ1 A;  3NEK A;  1UZH A;  3CUL A;  2LA6 A;  5A0Y B;  4B9M A;  3TZY A;  2CPH A;  2M7S A;  3VAI A;  5HMW A;  4KH0 B;  1RT6 B;  4RW7 B;  1RT1 A;  2J6U A;  2BXJ A;  3H7H B;  5DQI A;  2JZ8 A;  1MW7 A;  1TR0 A;  3AD9 C;  2E7V A;  4ED5 A;  4C3M A;  6FDR A;  3H5S A;  2VQE J;  3T5H A;  5L1J A;  3BGR A;  4MK8 A;  4YY3 F;  3CCE S;  2DGW A;  4JI7 J;  3KLG B;  3PYF A;  4URQ U;  3DHW C;  2W9B B;  2F40 A;  4O3N A;  3HHL A;  5CD4 H;  3BQ1 A;  3IBF B;  1VC0 A;  2UZA A;  2IYI A;  4OJH A;  2XMT A;  2DB1 A;  4CWB A;  4TYA A;  3JYT B;  2ADC A;  2W2N P;  3QIP B;  3KLE A;  4AFF A;  4ES1 A;  1O6X A;  3LAN A;  1S99 A;  1KR4 A;  2XMU A;  3H5X A;  2RQC A;  5ETL A;  3WC0 A;  4CZC A;  1JLE B;  5HI7 A;  3HKZ D;  2M52 A;  4C9D A;  4RUH A;  1EX8 A;  1QSS A;  4EFA C;  4GVB A;  4IR9 A;  1VRT B;  3M6V A;  2QYC A;  3NKY A;  4K4V A;  4LF4 F;  1ICE B;  1UVN A;  5L1I A;  1PBU A;  3QT6 A;  2DGX A;  3DI6 B;  2BX6 A;  3M2U B;  4WF9 Q;  4CLK A;  1RIS A;  4X66 F;  1X5P A;  1TKT B;  3W9H A;  2CJX B;  3NOC A;  2FLN A;  1Q7Y T;  4FKY A;  2BRK A;  1O5J A;  2PA8 D;  1RTJ B;  1REV B;  2HWI A;  2OPP A;  4HH1 A;  2YWW A;  5I3Q A;  1D3W A;  4KSE B;  4WZM A;  4PKD B;  3OVB A;  5J2M A;  1FEE A;  4I68 A;  4M5D B;  2YQ1 A;  4YB5 A;  2GQ2 A;  4RJV A;  1JLC A;  2DR6 A;  1SIZ A;  4J9K A;  3AJD A;  1F9F A;  4XIU A;  4KGV B;  1V9O A;  4OLP A;  2V2K A;  3R5J B;  2XMJ A;  3ZZR A;  2WB1 D;  1EET A;  2HNZ B;  1TKX A;  2EFG A;  3FRZ A;  3CDW A;  3KDN A;  3GLJ A;  3NBP B;  2CZV C;  2BJ1 A;  4IFY B;  3DM2 B;  1GX6 A;  3CCT A;  3V6D A;  1HQU A;  2YKA A;  4LF1 A;  5I3P A;  3HFV A;  2C2N A;  5CCL A;  3C19 A;  2GFF A;  3PAC A;  3NAI A;  3PYE A;  3CCU S;  1NJX A;  4F0K A;  2FVQ A;  1I3O B;  4DUZ F;  5E33 A;  4LIR A;  4DR7 J;  1SH3 A;  2EG2 A;  2A2D A;  4FKX A;  1TKZ B;  3QID A;  4CI0 B;  2LEB A;  4OYX A;  2A0F B;  4NLQ A;  2ZH4 A;  5SUH A;  4J80 A;  4NCB A;  2HUR A;  3CJS A;  3TA2 A;  3RBD A;  5E5N A;  2U2F A;  1H2U X;  2EWH A;  1LFW A;  1PYO B;  2EG1 A;  3LPY A;  2KYZ A;  4DUT A;  4KKO A;  4QQB A;  4TYB A;  2LP4 A;  1XNQ J;  1T9V A;  3DOK A;  1TUG B;  2WB4 A;  3EM1 A;  2HFZ A;  3PO5 A;  1FE0 A;  3K5P A;  3JQJ A;  3H2L A;  1S0V A;  2IDL A;  1R8A A;  4CTA B;  1AFI A;  2YWG A;  2CYY A;  2OI2 A;  4CDI A;  2QO3 A;  2AX1 A;  3BZQ A;  1F1B B;  4DQI A;  3JSR A;  1WEX A;  1WHW A;  4KTQ A;  1GXL A;  1XK8 A;  1AT1 B;  2PSZ A;  4ATN A;  5DZ6 A;  4NZ6 A;  3H59 A;  3ADA C;  4IOC Q;  4NMX A;  3MFI A;  3OR2 A;  2HQ3 A;  5DG8 A;  2V50 A;  1KQK A;  3MFH A;  3E51 A;  2D3Z A;  3SYZ A;  1HBM B;  2RML A;  2X1B A;  4X4P A;  1CJK A;  2VIH A;  4JOU A;  3TEH B;  3GB0 A;  1OQ3 A;  1SL0 A;  1Q16 B;  1OQ6 A;  1TV6 A;  1RT4 A;  3M8Z A;  3J7A N;  3PHT A;  2YKQ A;  1NSQ A;  1KHW A;  2QG9 B;  5T7L A;  1CQM A;  2Y0S D;  1K0T A;  2R2S A;  4CLU A;  2EVZ A;  3MEK A;  1HNI A;  2MKK A;  3NP5 A;  1PKU A;  1G2E A;  3HCX A;  4DV3 J;  2F8H A;  2R7O A;  4CLT A;  5LL6 d;  3TW0 A;  2VG6 A;  4A48 A;  4YR2 A;  2KFY A;  2G9O A;  2YQ0 A;  1NZ8 A;  3MM8 A;  1J2V A;  2KM8 C;  1TMJ A;  4BLG A;  5HSP A;  2KDO A;  2V9K A;  3KOA A;  3BDP A;  2JLG A;  2JEJ A;  1RYS A;  3MEG A;  1ZAV A;  1MRO B;  1P1L A;  1T02 A;  2E7X A;  2AEM A;  4X4R A;  2VOD A;  2W01 A;  2OKQ A;  2BJE A;  4OZ2 A;  1RWM B;  5CYJ A;  2B9W A;  2X1G A;  2NQP A;  5E0O A;  4OHY A;  4FXD A;  1YK9 A;  1RT5 A;  4LSL B;  1TTH B;  1RWX B;  1OYE A;  1WSV A;  4FS1 A;  1S1T A;  2BEF A;  2I6W A;  2JH3 A;  1Y9O A;  4DR1 J;  1PJ6 A;  5LSO A;  3R2D J;  2H51 B;  1LWE A;  3F56 A;  2CJK A;  3IWL A;  1X4G A;  4FF2 A;  2VL1 A;  2O67 A;  3GFH A;  1CJU A;  1Y10 A;  3FNN A;  1WTF A;  1QVF R;  4ERD A;  1RJJ A;  3M8S A;  3VQT A;  3P49 B;  3CC7 S;  1MWZ A;  4RBV A;  4WTY A;  2E5L J;  1WAC A;  1HNW J;  2LQ5 A;  4XPE A;  1IM4 A;  4FZV A;  4RWW A;  2XSF A;  4IKA A;  1TQL A;  2NSB A;  2VC0 A;  1FNM A;  1C1B B;  4I4B A;  4Y34 A;  4C8O A;  2DNL A;  1YSJ A;  4DQQ A;  2DRD A;  3QZ8 A;  3R7S B;  2MKI A;  1RAC B;  1T94 A;  5IC6 B;  2V8G A;  2SXL A;  2RIJ A;  3JSM B;  6FD1 A;  1S6Q B;  1VOM A;  3VAM A;  3IM8 A;  3D0G E;  3KK2 A;  1NLT A;  2QV6 A;  3MEE A;  5LMU F;  1QAJ A;  3PXG a;  3V81 B;  4PWD A;  1OY6 A;  4HLB A;  1FO1 A;  1YJV A;  2FJD B;  2GJF A;  2ERR A;  3M4X A;  4OYI A;  1FER A;  5A8R A;  4DV4 F;  3IAS 9;  1SXL A;  5IT0 A;  4ECZ A;  3THT A;  1YIT S;  2DHH A;  2CWK A;  3DMJ A;  4ETZ A;  4X4V A;  4OX9 J;  4PWW A;  1IVZ A;  5F41 A;  3MM9 B;  5KG3 A;  3M8Q A;  2G2O A;  3GIK A;  4LFA F;  2B6A B;  4JI1 J;  2VUG A;  2HLT A;  4X65 J;  1R0B G;  2HBQ B;  2V34 A;  2JEF A;  3OV7 A;  3KJQ B;  1VMB A;  1Q8B A;  3MMJ A;  1VLO A;  3W1Y C;  1VQ6 S;  2DNH A;  4IQX A;  2HAF A;  3GCW P;  1C0U B;  3TZW A;  1RT7 A;  3OSP A;  4B9S A;  4Q0B B;  1N0V C;  1HKA A;  1RAO A;  1S59 A;  4C8N A;  5HP1 A;  2RF2 A;  3ENA A;  4RR5 A;  1Z2Z A;  2KVQ E;  3E01 A;  2RAQ A;  3I31 A;  4PQU A;  2RKI B;  5J2Q A;  1AZS A;  1UP1 A;  2J8S A;  5D8H B;  1ZYQ A;  2R7W A;  2MYF A;  1FVQ A;  4NZ7 A;  4H4M A;  3GII A;  4WP8 A;  2XMA A;  1KOO A;  1A7G E;  5D3G B;  1NPR A;  4FS2 A;  1FT8 A;  1WOO A;  4DR6 J;  2B7C B;  3MMA A;  2ASY A;  3G6Y A;  1RCX B;  2GIQ A;  1Y3J A;  2A18 A;  2YWK A;  3RAQ A;  4YR0 A;  2DEI A;  2DY1 A;  2UXC J;  5L9X A;  4KGX B;  2W9C A;  4E8U A;  2QRR A;  2CPZ A;  3O6Q A;  3K89 A;  5FD1 A;  3R5A A;  1KP6 A;  3IS9 B;  4HR2 A;  2XUL A;  2XLI A;  4BDP A;  2DO4 A;  3UO0 A;  2F8M A;  3BB5 A;  3ITH B;  3QBC A;  1HR0 F;  5KFO A;  1X0P A;  4RNH A;  1Q79 A;  1YDL A;  4I67 A;  2HRU A;  2ZDP A;  1YJU A;  3IFE A;  4IH6 A;  3DOL A;  1VHI A;  2Y1L B;  2ZOM A;  1KC8 T;  1RAA B;  5I3U B;  2J9E A;  5DGA A;  2V4R A;  2VF3 A;  3OJU A;  2DNO A;  4ITS A;  3W60 A;  2VKR A;  4KV8 B;  3O1L A;  4KGK A;  2BQR A;  3N28 A;  2RH3 A;  2CDQ A;  1FKP A;  2RRB A;  1N54 B;  3QRP A;  3QJJ A;  1EIY B;  2FZG B;  4HVZ A;  2DR7 A;  4JI3 F;  1FRI A;  2O3D A;  4UOC A;  2GVD B;  2DH7 A;  1LW0 B;  4A4J A;  3RB6 A;  3IWX A;  2CVI A;  4B3T F;  5C24 A;  1DRZ A;  4LF4 J;  4OV6 A;  2DXF A;  2DR5 A;  4CP5 A;  2I1R A;  3FSX A;  5G0R B;  2JRS A;  3CJ3 A;  2MQO A;  2QL9 B;  4X66 J;  2WVC A;  4QIW D;  4X4O A;  3D3C J;  4NLU A;  5A76 A;  5GAG U;  3PW5 A;  2XM3 A;  3KLF B;  1FDN A;  1E6Y A;  1WC3 A;  5MAO A;  2FJW A;  4N5S A;  4LJM A;  2D9P A;  4DPY A;  2H5I B;  4ZN1 A;  1TZ0 A;  1GMU A;  4ELT A;  4HI2 A;  3BO4 A;  2KN4 A;  3CCS S;  1R0C B;  2C22 A;  3SCI E;  2OP5 A;  2F9J A;  5AE2 A;  2CJQ A;  2NCK L;  5KFZ A;  1X9W A;  5KFH A;  2B8Q A;  4R5P B;  2UVW A;  2RS2 A;  4UQG A;  3Q86 A;  4CCH A;  4P74 A;  3W5X A;  2ZD1 A;  3FMW A;  4B02 A;  4RW9 A;  3TX8 A;  2YPZ A;  1KSP A;  3CVK A;  4DUZ J;  1OYD A;  4PZV A;  2W2Q P;  3OBI A;  3JTO A;  5K14 B;  2CJY B;  4L6V 3;  3CJ0 A;  2OLW A;  1WUU A;  2DRB A;  2OML A;  3LGH A;  1D9A A;  1JXV A;  3HSG A;  4DU8 A;  3B54 A;  1RTH B;  1NSK L;  3H2U B;  3NGU A;  1L5U A;  1QE1 A;  3BBB A;  2VU5 A;  2HNY B;  3SQG B;  1XMB A;  3K5L A;  3HVR A;  1TAU A;  3K5M A;  1FKO A;  1U49 A;  2M70 A;  4USM A;  4I0W A;  1D8Z A;  4EYI B;  2MZT A;  3M6W A;  3OTO J;  2F4V F;  2HND B;  3VAL A;  1FRJ A;  4R0E A;  4RUA A;  1OWX A;  4CLS A;  3CD6 S;  2YNH A;  1BLU A;  4UY8 5;  1RA7 A;  2CFX A;  5DGB A;  2ZUG A;  3TEG A;  1MMD A;  2J5A A;  3QAE A;  1KBR A;  3T9N A;  2B43 A;  2HHV A;  4O23 A;  4ILM A;  2M3D A;  3AXK A;  3V6K A;  1JLG B;  1V3S A;  2WSC C;  3H98 A;  3I4H X;  3D66 A;  1RK8 A;  1SKR A;  3DN9 A;  4LBI A;  1RZM A;  1Y5L B;  2OUG A;  3MED A;  3KK3 B;  4C2M A;  3TYT A;  3P96 A;  4DL7 A;  5CXT A;  1R7I A;  2LYV A;  4ZPB A;  3VGU A;  2BOP A;  4WKY A;  2DHS A;  4N8N A;  3PYG A;  3I96 A;  1HYS B;  1AYE A;  1LWF A;  3LF0 A;  2ODX A;  2P2C B;  1K8A T;  2JLF A;  3PX4 A;  2A6M A;  1BHN A;  2M8H A;  3IGN A;  3P45 B;  4WYL A;  1VQO S;  4OI3 A;  4OFZ A;  1CS4 A;  2HFU A;  4YHH F;  3MHY A;  1HNZ F;  2AF6 A;  5DQH A;  4N41 A;  4OX7 A;  1RTD B;  5M2R A;  2H5E A;  1BWE A;  4WFA Q;  3KK1 B;  5C2G A;  3IG1 B;  1YGY A;  2JDJ A;  4ZCM A;  4LR9 A;  5KFG A;  4HTI A;  1S7H A;  1BQN A;  5B0B A;  2NXE A;  4IOB A;  3KNG A;  2HQG A;  2MKY A;  3R2C J;  2HHQ A;  1QUP A;  4PG6 A;  3QGI A;  4QWD A;  1S9E B;  3B4M A;  2FVR A;  3UQS A;  4IRD A;  1RAF B;  1U1R A;  3VGV A;  2J0X A;  3F73 A;  3Q83 A;  1Q1K A;  3CD7 A;  1UJ4 A;  2OGU A;  1FRL A;  3HX9 A;  4DG1 B;  3BYR A;  3FDS A;  4KFB A;  3RRH A;  4LF6 J;  5GAH I;  1SL1 A;  4A8W A;  2B4O A;  2BVZ A;  1NJY A;  1QAI A;  3MUT P;  4ED6 A;  1ELO A;  2MZQ A;  3M30 B;  4AQY J;  2PFD A;  1WDD A;  4XK8 C;  1RT2 B;  2UVR A;  2AX0 A;  3BGL A;  2IMW P;  1VFJ A;  3NGT A;  1PJ5 A;  1EAR A;  1FDB A;  2ACM A;  2R8K A;  4X4N A;  4F0H A;  5LJ3 Y;  5HQL A;  1HAR A;  3VQS A;  1TL7 B;  5KG7 A;  2CQD A;  3QT7 A;  3LW5 C;  1FX4 A;  1VQN S;  4ES3 A;  1A9N B;  5B0E A;  2GX8 A;  5KG1 A;  4BWJ A;  3K5N A;  3Q8Y A;  2K06 A;  3RB3 A;  2V4J B;  3OFF A;  1YJ7 A;  1X60 A;  2F3J A;  3FZB A;  1OY9 A;  1URN A;  1Y0H A;  3MGJ A;  1HHS A;  1FJG F;  2ACY A;  2L08 A;  1RP5 A;  3OQ2 A;  5KFR A;  1K73 T;  5BYQ A;  4A47 A;  2EBE A;  5F9N A;  2O01 C;  3JSB A;  1VK8 A;  3QWP A;  3FMB A;  3L09 A;  1R27 B;  1R6V A;  4F7V A;  4E0D A;  1JX4 A;  1PAU B;  1X4B A;  5D0H A;  4IG0 B;  2R8G A;  1V5I B;  3H40 A;  2XO6 A;  3DU5 A;  1TL1 A;  4G1Q A;  1NEE A;  4O3P A;  1CJT B;  1SH2 A;  3M8Y A;  1TUV A;  3G87 A;  4J9V A;  3BJY A;  3KJV B;  4NX9 A;  5KTQ A;  3BPD A;  4ZJL A;  3ZO7 A;  2QN6 B;  1BQM B;  1PCA A;  1LXJ A;  3DDK A;  3MEC A;  5HL7 Q;  3QLH B;  1Q0N A;  4MYT A;  4MKV A;  4AL7 A;  4BWM A;  4KO0 A;  1UA1 A;  1U25 A;  3QAU A;  1R8P A;  1XC9 A;  2E1R A;  2ZUA A;  5CZX A;  2DKO B;  3AOC A;  1SPB P;  2R7T A;  2ZOG A;  3GR1 A;  3MCO A;  2Z57 B;  7FD1 A;  3IMQ J;  2CNN B;  2C3M A;  2ZHA A;  2ZHO A;  2AP6 A;  2QJ3 A;  1N5V A;  4WJB A;  2DEJ A;  2ALZ A;  2OPS A;  2K1R B;  4J9L A;  1JLQ A;  1S6P B;  1NCL A;  4K7Q A;  4M5J A;  3VAF A;  2BM0 A;  3KUE A;  4NLO A;  3QZ7 A;  5IQ6 A;  2KL8 A;  1XR5 A;  2OD6 A;  3M2R B;  1TAQ A;  2ZH5 A;  2WRM A;  4QBU A;  3FC9 A;  1AUS L;  4IDK A;  1RWV B;  5ETO A;  1G7C B;  2ZE2 B;  3HVT A;  3HSJ A;  3DC2 A;  4DV6 F;  2D41 A;  2XWY A;  3A3P B;  3C15 B;  3CTR A;  1IQT A;  4DL3 A;  1NZA A;  1RT1 B;  4B3S F;  3ET6 B;  4NOH A;  1VS3 A;  2GCF A;  3FFI A;  2ZZT A;  1UAW A;  1ZAW A;  1FTC A;  3QQC D;  1KFS A;  2HZA A;  2L3M A;  1BQX A;  4FYW B;  2FGO A;  3KWM A;  4TY9 A;  2AIR B;  4K5S A;  2EI5 A;  5FDL A;  1RE1 B;  1X5S A;  2Z2M A;  4HTJ A;  2QMU B;  3PFE A;  3R5B A;  1UMJ A;  4DMZ A;  5AXM A;  4K2X A;  1PYS B;  1MU2 A;  1SIW B;  3HD1 A;  2EC2 A;  4O4G B;  5GMK a;  4LFB F;  1HR0 J;  4ZP6 A;  3J7Z 5;  3KLE B;  3UVJ A;  4HH0 A;  2CG8 A;  1B7F A;  4IG3 B;  2OSQ A;  4Y0F A;  4NXN F;  5EWG A;  2GHP A;  2VBX A;  4UQT A;  4ZLP A;  2HG4 A;  5BJR A;  4WK1 A;  3OVS A;  3P5T L;  4EO6 A;  4UUX A;  3SCJ E;  2HMI B;  3GG1 A;  1QAX A;  1MG7 A;  1KVK A;  1UL3 A;  4GVB B;  3CCQ S;  4LF7 F;  4DR2 F;  1NK8 A;  1PYT A;  2LEA A;  4NLR A;  5HAO A;  2L48 A;  5KT2 A;  3CSK A;  4H54 A;  3DRR B;  3OLA A;  2JL9 A;  2OPR A;  1RHU B;  2HBY B;  1YJW S;  1N5T A;  5E3R A;  4OI1 A;  2UU9 J;  4RWX A;  1WHV A;  3NCQ A;  2RUS A;  2DNR A;  3VVU A;  4OJG A;  3F41 A;  4Q8F A;  1FRM A;  4FF1 A;  2LEP A;  3OFH A;  1N5Y B;  2OPP B;  4C8L A;  3W63 A;  2HYI B;  1JXE A;  5KFA A;  2YX7 A;  3OXL A;  2VPW B;  2EXU A;  5J2M B;  4B3T J;  4R8U A;  3LGN A;  1JLC B;  2ROP A;  2YVS A;  1MWY A;  4TLR A;  4A8F A;  2BBE A;  5D0G A;  5ETM A;  5J2P A;  3GYN A;  1VQ8 S;  2NYH A;  3BM7 A;  3AGZ A;  2BV3 A;  1D09 B;  2DIV A;  4DV2 F;  2IC3 B;  2P9G A;  1TKX B;  2H4W B;  3NMR A;  4TU8 A;  2FHM A;  4B9V A;  2Q6B A;  2KB2 A;  1T9W A;  3BH7 B;  1HQU B;  3TA1 A;  1DLO B;  2LA4 A;  2Z2Z A;  5T41 A;  1L3K A;  2YKO A;  3FVY A;  2D69 A;  4Z7C A;  1HQ2 A;  1T11 A;  2QA2 A;  3EDR B;  3UW1 A;  3GIL A;  3CJ2 A;  1HWI A;  3C3L A;  2GQC A;  2LXI A;  3U7J A;  3PX6 A;  5HK4 A;  2YWH A;  1S1X A;  2G0J A;  2DK2 A;  1VBZ A;  4WU3 A;  2E7W A;  4CO4 A;  1UW4 A;  2MQM A;  3VAJ A;  2MGZ B;  4F2R A;  2AKW B;  4DS4 A;  2HVE A;  4DPW A;  1M5P C;  2O66 A;  4FDF A;  2LFV A;  3DYA A;  4DEZ A;  1V5V A;  2IAJ A;  3AY0 A;  1RAE B;  4B08 A;  2FC9 A;  4MFB B;  1HNX F;  4OYB A;  3NNA A;  5KT7 A;  3DOK B;  4B3O A;  5D4N A;  2QTW A;  4LRD A;  2EKN A;  4N7T A;  4M94 A;  3J80 U;  4ZPD A;  5KAK A;  1BMQ B;  2OHD A;  2RHQ B;  1T8E A;  3IN5 A;  3IRX A;  4ZIT A;  1XMO J;  4TU7 A;  3ZTQ A;  3G6V A;  4J9U E;  1HNV B;  1XR6 A;  2CDR B;  1FFG B;  5J1E A;  1UWB A;  4ENO A;  1BWV A;  1HQE A;  2AZ1 A;  4OZ5 A;  2LQB A;  1U24 A;  4QWE A;  4EO8 A;  2HGL A;  2DJW A;  2F4V J;  2CAJ A;  3QRQ A;  2LDY A;  4C6A A;  1K1S A;  4FVM A;  1ZA1 B;  2MKJ A;  3CC2 S;  3GR0 A;  1JK9 B;  4HAC B;  3FCV A;  3G82 A;  5F8N A;  1LW2 B;  3V5R A;  3GFX A;  2HHT A;  3TI0 A;  1X4H A;  3W5Y A;  4LVO P;  5T7L B;  4DSI A;  2FYX A;  3S1T A;  1P1T A;  3RUB L;  4NA3 A;  3AAW B;  2LU1 A;  2KXN B;  3FEY B;  1N6Q A;  2MST A;  3CWJ A;  2E9T A;  4AD6 A;  1O8B A;  1WEL A;  2HS0 A;  1KRP A;  3RRG A;  2BZ2 A;  4O3R A;  3CJ4 A;  3KLH B;  4Y3C A;  2XY5 A;  5AJ3 F;  2GMJ A;  2J0S D;  3BPS P;  3BBF A;  2XZT B;  4MIA A;  2VG5 B;  4UZB A;  3PKY A;  5KT6 A;  2IRY A;  4JI6 F;  2YY3 A;  2E5G A;  3CD0 A;  4ER8 A;  2MKC A;  5HVG A;  2YKM A;  2FY8 A;  3MEG B;  4UST A;  4I7F A;  2HRT A;  3EZO A;  2D3O 1;  1V3R A;  5C25 A;  3N5F A;  1H74 A;  1HHQ A;  2VG7 A;  5H9F J;  2ZBI A;  2QSF A;  5KG4 A;  1JWW A;  3KYL A;  3PTW A;  4MAK A;  4MJK A;  3S8S A;  4PAB A;  4G1P A;  5J1N A;  5GAD U;  1FE4 A;  2CJB A;  3D5M A;  3N79 A;  1FJE B;  2HIQ A;  1NSP A;  1VIO A;  2UVU A;  2GO8 A;  3K8V A;  3SI8 A;  1IM6 A;  5EUH A;  4YR3 A;  2LDI A;  4FF3 A;  1F2G A;  3TUP A;  5HVH A;  2GML A;  2VC1 A;  1SQE A;  4LSN A;  5C7P A;  1G4C A;  4LRA A;  1FX2 A;  1L3V A;  2V9W A;  2XMK A;  2MB0 B;  2CNL B;  3QT8 A;  4DSE A;  1SKW A;  1X5O A;  3M7V A;  2RD5 C;  4USU A;  3FK4 A;  4F3O A;  3W7B A;  3T19 A;  3T1A A;  3TO8 A;  5D4O A;  3BO2 A;  1PO6 A;  2KFZ A;  4M1K A;  1Q95 G;  3PW7 A;  1W2I A;  3GWC A;  1R8B A;  4MK9 A;  2DGQ A;  1FJG J;  4Q7A A;  4TY8 B;  3NGS A;  5E41 A;  5M2U A;  5B0F A;  5IS2 A;  1E6V A;  2CQC A;  2G2Y A;  1S1U B;  1RYR A;  5KFU A;  3M9M B;  2VON A;  1IBK J;  1W25 A;  1IWG A;  3GU0 A;  1VR6 A;  1UFW A;  1S7I A;  4RUB A;  3G8Q A;  3PX0 A;  3MPW A;  2VQF F;  4ID5 A;  3QGP A;  5JVH Q;  1OPI A;  2YPY A;  2QX0 A;  5L38 A;  2ROG A;  4ZPV R;  4K4S A;  4DFJ A;  5HQM A;  2N4C A;  3K57 A;  3OL9 A;  1N33 J;  3CJK B;  4P2M A;  2GQQ A;  1KNZ A;  4ECY A;  5KFX A;  3JSY A;  4ZHR A;  3BKU A;  3LQV A;  3GQC A;  1Q8I A;  3CJQ A;  4RL1 A;  4AL5 A;  1SB6 A;  3MR6 A;  2CPJ A;  3PHE A;  3C16 A;  2AZ3 A;  5DS7 A;  3PEJ A;  3I82 A;  1R8C A;  2VHG A;  1U09 A;  1BUX A;  4AYB D;  3Q8R B;  2AD9 A;  2UUB F;  2XBP A;  4OZN A;  4YME A;  1BE4 A;  2W2P P;  4C97 A;  4JI5 J;  4TVA B;  2HS3 A;  2FUG 9;  3G8T A;  2BKO A;  2MJU A;  1D8Y A;  3SDE B;  3I0S B;  5HP1 B;  2RF2 B;  2Z58 B;  8AT1 B;  4Q43 A;  3VAH A;  5J2Q B;  1AZS B;  3GPA A;  4OZ0 A;  2YNI B;  2C2M B;  1YBA A;  5HRO B;  5A8W A;  4FBT A;  3PFO A;  1HI1 A;  2LEC A;  2BW7 A;  2NYI A;  3DLE A;  1U48 A;  1PIE A;  1U6B A;  1UWA A;  2GC8 A;  2EKY A;  2ZBQ A;  5HMX A;  4RW4 B;  4U7U K;  1AA1 B;  3MAA B;  4DXL A;  2BE2 A;  1JB0 C;  4L73 A;  3TAQ A;  5BYS A;  3WQP A;  4G3I A;  2FJE B;  5E2Q A;  1XIQ A;  2LXU A;  4B3S J;  4DV0 F;  2BDP A;  2ZH1 A;  4ILL A;  3CXC R;  3KKF A;  3M9O B;  3ILL A;  4F2S A;  3JXO A;  3L3C A;  1RAB B;  4Q5V A;  2E5H A;  1DAR A;  3VAG A;  4HYK A;  2YH0 A;  4PWU A;  3NLC A;  5G4D A;  2R7U A;  2IVY A;  1T9X A;  1WF2 A;  1RHR B;  4K4U A;  1S5Z A;  4GKJ J;  5E3A A;  3DOL B;  3G86 A;  2C2R A;  4WYW A;  3MD1 A;  1WI8 A;  1FVS A;  3J81 Y;  4W92 B;  4K4T A;  1WG4 A;  4HT5 A;  1K9M T;  3UDV A;  3A8E A;  1F60 B;  3Q8Q B;  4NZ0 A;  4WP9 A;  4ILR A;  4LFB J;  3EX7 B;  3B8H A;  4KHM A;  1OMS A;  3SIP B;  4U7U D;  4RUC A;  2C3P A;  1M0S A;  5DG9 A;  2CQP A;  4NXN J;  2F8E X;  3DLL Q;  4JI4 J;  3BQ0 A;  3K17 A;  3TJ9 A;  1I5O B;  1NND A;  2IBK A;  4OYA A;  2C2O B;  3HM9 A;  1Q5Y A;  4DQS A;  3CCW A;  4LF7 J;  1WC6 A;  3T41 A;  4DR2 J;  3C5X C;  5A8K A;  2KJW A;  3IXQ A;  4FNH A;  5KFQ A;  1VJQ A;  1VQY A;  1X4E A;  3KLV A;  4I64 A;  2GGP A;  4X62 J;  4QIE A;  5GVQ A;  3J7A 1;  4OZL A;  5IQQ A;  4EYH B;  3D6H B;  2DHX A;  1N34 F;  4F02 A;  1LXN A;  5J2N B;  3ETM A;  4F50 A;  1XR7 A;  2VZ9 A;  3EIC A;  2H9Z A;  4DCJ B;  2R3V A;  2QLD A;  1VRU A;  3CB4 A;  5KFV A;  1YJN S;  5A6W A;  2W7O A;  1EHW A;  1Q81 T;  4N8O A;  4QJV A;  5LXY A;  1KKH A;  3LZ8 A;  2MLZ A;  4JP8 A;  5A0Y A;  2AWZ A;  1ZZF A;  2F4F A;  5GAD I;  4DV2 J;  1S9G A;  2WOM B;  4WTO B;  1RT6 A;  4RW7 A;  5H1S V;  2WHO A;  2R42 A;  2XZW A;  4ZPC A;  4P73 A;  3LP2 A;  3U27 A;  1X4F A;  1U1Q A;  1NHV A;  4QWB A;  2FVP A;  2NS1 B;  2QA4 S;  2E66 A;  4KHP F;  3R8Y A;  1HW9 A;  4C8Y A;  1EP4 B;  2O1P A;  2WSE C;  1CBK A;  1X9M A;  1U2F A;  4X64 F;  2K2P A;  2KRR A;  4RW9 B;  2IIH A;  4DFP A;  3KLG A;  2FB0 A;  1HI0 P;  4J9Q A;  3AA9 A;  4UOG A;  4LSZ B;  4DX6 A;  2HHW A;  1B0T A;  2XSJ B;  4NI2 B;  5F0U A;  2IM2 A;  3HK2 A;  2H48 B;  1RT3 A;  4K50 A;  5L9N A;  4LUB A;  3US5 A;  4OI4 A;  1X4D A;  2B5J B;  1QE1 B;  3MMB A;  1FCA A;  5DDQ C;  1K0V A;  1B64 A;  4NXM F;  2HWH A;  1KTV A;  4L74 A;  4LF8 J;  2C3O A;  1FKO B;  3OL6 A;  1JLE A;  1QY7 A;  4LQ9 A;  2WVE A;  1HNX J;  1ZAX A;  2ZBC A;  1PSD A;  3F44 A;  4WE1 A;  2OIH A;  1X31 C;  4X4U A;  1LWC A;  1H72 C;  1K44 A;  3I9V 9;  2HZV A;  2QE5 A;  3HD2 A;  4IUF A;  5JJB A;  1WEZ A;  3OL7 A;  2G2Z A;  3I0R B;  2PMZ D;  4ZVH A;  4USV A;  1TKT A;  1J5O B;  3SSR A;  2LMI A;  1ZPW X;  3V4M A;  2IBO A;  4QIG A;  2MZS A;  3FCW A;  3G9C A;  4C0B A;  1RTJ A;  2PI4 A;  3QGH A;  4B3M F;  3NY0 A;  4WZQ A;  3I4P A;  1RAJ A;  3MED B;  1FRX A;  3BGF A;  2KM8 B;  4DR5 F;  3D1O A;  3SMZ A;  4JV5 F;  4WPA A;  2XI3 A;  3QSY B;  4DV1 F;  4ES2 A;  4GC6 A;  5EWF A;  3T1Y J;  2FVC A;  4EBD A;  4H4O A;  4A8K A;  1I94 J;  2KT3 A;  2MPU A;  1F2H A;  1DQ9 A;  4B3R F;  2RHS B;  5C2C A;  2XS5 A;  1A6L A;  2CIM A;  3Q8S B;  2DGO A;  3AKO B;  3VR1 A;  2HNZ A;  3FUY A;  2W1B A;  4IFY A;  3DM2 A;  2X3D A;  5KFK A;  3UNG C;  2VBY A;  2KT5 A;  1NJZ A;  1B0P A;  1RUS A;  4U9R A;  4OJ3 A;  1JQG A;  3OFE A;  4O44 B;  4J7C A;  3DLB A;  4YS2 A;  4DR3 J;  4ELV A;  1SV5 B;  3DNC A;  2FC8 A;  1VGY A;  3AD8 C;  2UXB F;  3JAM U;  5E7O B;  3HFK A;  3Q8V A;  2UUT A;  3PEH A;  1TKZ A;  4KFB B;  4NYZ A;  1PJ7 A;  1N36 J;  2YX4 A;  5EX0 A;  4C0O C;  3MPV A;  2FJX A;  2G1H A;  3N5B A;  4CRJ A;  4I1T A;  3TUJ C;  4Y2A A;  3RTV A;  2D9O A;  2VPZ B;  4Z7Y A;  1NK5 A;  2HVH A;  2BR0 A;  3EYZ A;  3GV7 B;  3GSI A;  4UTG A;  3QAT A;  3GFZ A;  3NOG A;  4JI8 F;  4OHZ A;  4OI6 A;  1MN7 A;  1BXN A;  4DX8 H;  5DM6 Q;  3CIM A;  1B3T A;  4M95 A;  3QYY A;  4ZN3 A;  1NHU A;  3OD2 A;  2HGN A;  1IBC B;  1M5V C;  2M2B A;  5D4P A;  2AHO B;  2HKE A;  3OPK A;  4YUD A;  3MXH P;  3Q0A A;  3HI9 A;  4OX8 A;  3OTD A;  4I2Q B;  4C7Q A;  3I6P A;  5F8G A;  1F3F A;  2DIT A;  5LT5 A;  3QRR A;  3A4T A;  3TAM A;  3M9N B;  2BW2 A;  2UUW A;  3U1N A;  1NM2 A;  1OSD A;  4ZDN A;  3P6Y C;  2KRB A;  4EEY A;  2V8V A;  3PRB A;  5EGY A;  3PJ9 A;  3DGP A;  4M5H A;  4QCL A;  4G1Q B;  4ZK7 M;  1U7L A;  1FNX H;  1N52 B;  2M9K A;  3TAR A;  3GJQ B;  1GXT A;  3GIM A;  4KC5 A;  4DR4 F;  1U47 A;  1S97 A;  4QYR A;  1XMQ J;  2KXF A;  1XTZ A;  1YVF A;  4EZ6 A;  3UCU P;  4M5M A;  5DDP C;  1VBY A;  1VC6 A;  2ILY A;  1CJV B;  2AJ4 A;  4WWS A;  3M6X A;  3K58 A;  1SJR A;  2GS8 A;  1U26 A;  2RU9 A;  4GC7 A;  1TK5 A;  4JV2 A;  4PCQ A;  1IKX B;  1Y5I B;  3PJW A;  2IA6 A;  3V6J A;  3V2U C;  2OSR A;  2VV5 A;  1MRO A;  1AW0 A;  3TNV A;  4NLD A;  2J6S A;  1I6J A;  1QTN B;  3ETO A;  4IRC A;  2P5V A;  2OPS B;  2DNN A;  2B26 A;  2GIF A;  3L7U A;  1Y7P A;  2DHG A;  2BYC A;  4A8Q A;  3A13 A;  5K8N A;  4CIO A;  2MLY A;  3IBW A;  2FLO A;  3RJM B;  4F36 A;  1C2P A;  4K8R A;  2H1Y A;  5B0C A;  2ZH9 A;  3P3D A;  3D67 A;  1NO8 A;  3QFW A;  2I5J A;  4KGZ B;  5CH7 B;  2ADB A;  3PNI A;  4IDK B;  2LQ8 A;  3K5O A;  1MN9 A;  4LT6 A;  1P9Q C;  5L8R C;  3DLG B;  2CG4 A;  2HQF A;  2Y8W A;  1IBM J;  4ZJO A;  1Q8L A;  3FSY A;  5I4M A;  3HKW A;  5FII A;  3TX0 A;  4U8V A;  1DJ0 A;  2EFV A;  1IBL J;  4A8X A;  1SC4 B;  1KDN A;  1FEH A;  2L9D A;  3CMA S;  5L46 A;  1TK0 A;  2DTJ A;  5CHC B;  3JQK A;  2BKP A;  3U1L A;  4KPY A;  3GJR B;  3KHG A;  2KXH A;  5E3P A;  4FXW A;  5AE3 A;  2M4M A;  4FPI A;  3ZZT A;  1UEU A;  3BR9 A;  3CMQ A;  3JSM A;  4URS A;  2RB7 A;  3OVA A;  1S6Q A;  3ONQ A;  2B3T B;  3MTJ A;  4LRC A;  3DXS X;  4DX5 A;  2VA2 A;  7AT1 B;  2FZC B;  4DV0 J;  3C6U B;  1RQ0 A;  3RAM A;  2ZNY A;  2W7A A;  3KUG A;  3SQO P;  2JC1 A;  3V81 A;  1IKV B;  2GNK A;  1VHF A;  3UVJ B;  1TVR B;  2HFN A;  4EWT A;  3PIO Q;  5IOL A;  4I2P A;  3TUZ C;  3CO0 P;  3ENQ A;  4K0K F;  5K9F A;  3NNH A;  4PQA A;  5EN1 A;  2D3O R;  4IR1 A;  1CSJ A;  3M1V B;  2BA9 A;  4HL9 A;  2N82 B;  1S0M A;  1U6Z A;  3L4B C;  2YBV A;  1AUD A;  1WJ9 A;  4MH8 A;  2B9X A;  2AJQ A;  3TAP A;  4LIW A;  5K20 B;  3HVW A;  3AFG A;  2B6A A;  4PG8 A;  3BYP A;  3C66 A;  3W61 A;  1WEY A;  3SV4 A;  3IR5 B;  3CME S;  2Z2L A;  3LWL A;  1S9F A;  1C4A A;  4MTP A;  2VOP A;  2PO4 A;  1ZET A;  1C0U A;  3V4I A;  1DTT B;  1WSR A;  1U1O A;  5BXI A;  1BY9 A;  4Q0B A;  1APS A;  3AB4 B;  4A46 A;  1U0S A;  1F6T A;  4R8U B;  1S4F A;  1C0T B;  3KG0 A;  4DUY J;  3BEG B;  2J9D A;  3H2V E;  4JI2 F;  4OL8 A;  2ZNZ A;  1RBA A;  2ZVI A;  2HFO A;  2AW0 A;  3OJS A;  2Z0G A;  3EVM A;  2KU7 A;  1IXK A;  4ZCL A;  4DZ6 A;  2C3U A;  3S6E A;  3O3L A;  7FDR A;  1UPM B;  3DLH A;  1TL5 A;  2PD1 A;  1SC3 B;  3KJN B;  2RSQ A;  5D3G A;  4ICL A;  4PAA A;  5IV3 A;  1NRK A;  3C6T A;  4YDD B; 
#chains in the Genus database with same CATH homology
 1GMW A;  3TJ8 A;  3NXZ A;  3LZ8 A;  3AGX A;  3AGY A;  3AGZ A;  1C3G A;  3LA0 A;  3L9Z A;  1XAO A;  1NLT A;  1GMW D;  3NY0 A;  4L3K A;  2QLD A;  2HFV A;  2Q2G A;  1EB0 A;  4J80 A;  2B26 A;  1GMU A;  3I38 A;  1EAR A;  3TJ9 A;  1GMV A;  3TJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...