4L3KA

Crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
b'MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein UreE
publication title Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study.
pubmed doi rcsb
source organism Sporosarcina pasteurii
molecule tags Chaperone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4l3kA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 4l3kA02
1NLTA 3TJAA 2QLDA 1GMUA 3LA0A 2B26A 4L3KA 3TJ8A 1GMWA 2Q2GA 1EARA 3TJ9A 1EB0A 1C3GA 3NY0A 1XAOA 3AGZA 3I38A 1GMVA 2HFVA 3AGYA 3NXZA 3LZ8A 4J80A 3L9ZA 1GMWD 3AGXA
chains in the Genus database with same CATH superfamily
3ENWA 1PC4A 3G6VA 1RT5A 3HVAA 2DCLA 1RT1B 2LQ8A 1QUVA 1WOPA 2LXUA 5AXKA 3ZTRA 4KGKA 2F3JA 2V4JA 5ETKA 3VAMA 1J5OA 3UD4P 3R8YA 1EP4B 1MMDA 2MKJA 2V8GA 4CM2A 1NEEA 2EPIA 4I2QA 4RNMA 2CJYB 2DJWA 3BSCA 3D54A 3DFEA 4CLTA 1G1XA 2XS2A 2V4QA 2UXDJ 3H5XA 5F8GA 3TZXA 2XBPA 4ZJQA 2HLUA 3HVTB 2DEIA 3PIPQ 3AD7C 1DZ5A 2ILZA 4USKA 2R7SA 4A46A 1LWCA 4ATNA 5B0FA 4I6YA 1BQNA 3M9OB 4M5JA 3AQPA 4CLWA 2HQFA 2E66A 2XYPB 2QMUB 3EXYA 2HQIA 5BJRA 5F3ZA 3Q8RB 1MWZA 4KYZA 3QO9B 1IBLJ 5GVQA 4DL3A 1PJ5A 2HBQB 1YJ9S 1R8PA 2JLGA 1I94F 4XPCA 3HHNB 5ETPA 2C3YA 2P8IA 3TZWA 3X1LB 3GSDA 2OKQA 3DHWC 1PC5A 1RWPB 3G96A 3TUJC 2YX4A 1VBKA 4WZMA 1S9EA 1Q8LA 1X9WA 1M1HA 2M8DB 2VKZG 2KN4A 4EO6A 1EIYB 2YX7A 2IM3A 4WFZA 1T7PA 3NOCA 3TYTA 1RT6A 1XR6A 4YQWA 2Y1RI 4B3MF 5DZ6A 1WSRA 4MMOA 4LIRA 2MKIA 4Q2LA 4YMEA 1B64A 4LFCF 4LR7A 2F4FA 3ELHA 2YNHB 4ZPDA 4RBVA 3MM8A 5KOXA 3KJVA 4F3OA 1M5SA 2ZBCA 1RHJB 1WNEA 1RSCA 5ETMA 4DSFA 2AYBA 3WIUA 3C6TB 2PD1A 8RUCA 4K4VA 2HHWA 4C9DA 2B7BB 1VQPS 4PWDA 4RBUA 2FJAB 3GONA 4K4TA 4OI3A 1H98A 1MG7A 3GFZA 1TV6A 3PJXA 3MEDB 2ZKUA 3HMJG 4FF3A 4ID8A 1CJVA 4X62F 2YXLA 1S99A 1Z4UA 2NPFA 4OZ3A 4DV1F 1HWJA 1DQAA 1RTZA 1WI8A 3NLCA 1PIEA 2FY8A 2VFUA 2QLFB 2OPQA 4WIQA 3HVRA 2H48B 3KG1A 4KFBB 1RHUB 1KFDA 4XDCA 5G4DA 2J0QD 2O66A 2WSFC 5E41A 3RJMB 5LJ5Y 1U02A 1PYTA 2HVHA 1T9YA 3AD8C 3FRYA 5GMDA 1XWLA 2VKRA 2HKEA 3HLUA 5HATA 2AT1B 3JQKA 1YIJS 4PCQA 2CVEA 3ZXWA 1ZM9A 1RWUA 1P8GA 2CNKB 4U67Q 1JIHA 1HNVB 3DYAB 3A3NB 2MZ1A 4K50A 1IVZA 3J7A1 1U09A 2CJXB 2MLYA 2ZWPA 3D1HA 4DFKA 1AFJA 1PBAA 4DL0C 3DM2B 3IFEA 3GQCA 3IWLA 1N56A 4B3RJ 2BV3A 1S0MA 3EYZA 2HS0A 4MKVA 4ED1A 2P6SA 1HHQA 1VI7A 3D0GE 2VASA 4S0MA 2AJQA 3LW5C 3W64A 4TYAA 4UTGA 4PPZA 1VBZA 3QLHA 4ZVSB 2F4VF 4USTA 4BLGA 1FE0A 5K8NA 3RB3A 1VCTA 3R6LB 1SKSA 2OEMA 5EUHA 3GTYX 2HZVA 2CQPA 4L75A 5HVFA 1HYSA 2HNZB 3SEOA 5M2RA 1TKZA 4DX7A 1UKUA 1U48A 4ZJLA 3TX0A 1CQMA 1ZETA 1VS3A 1BLUA 5LOQA 3VVTA 4NXNF 5L38A 3UN2A 4CLZA 5IT9Y 2RKIB 3KXDA 2GJ2A 1SIWB 1B0PA 1RAEB 2H4YB 3NXZA 4ECSA 3T1AA 2J7UA 1SI9A 3MR7A 3IO1A 1Q79A 2L3MA 2HHHJ 4XPEA 3EJMA 4G1QB 3I0SB 5D15A 5HJXA 1TR0A 1SKRA 4UQGA 2M2BA 1TL3A 1IM4A 4C8LA 5CZVA 4QR0A 2IVFB 5J1NA 2HYIB 1R89A 2JZ8A 5IS2A 3DMJA 3VV2B 1JLAA 1HR0J 2QLXA 5ETOA 1UVMA 2ACMA 2E9RX 3JAMU 1RTHA 1JXEA 4OHZA 1TL1B 4PQAA 2EK6A 4AD6A 2I2YA 1F5AA 3MM9B 4I56A 5F8NA 3NWRA 1M0SA 3HSJA 1NPKA 4U7UK 4ES3A 2BE2B 1FRXA 1I1GA 3GJTB 3VGUA 1WC0A 3RRKA 2YTCA 3M6WA 3V6JA 1GMUA 4OLPA 4M5DB 2R7VA 4JYAF 4WFXA 4I2PB 5D0HA 4C7QA 3DN9A 3U02A 1QSSA 2ZITA 2DKOB 4QQBA 2L08A 2HG4A 3V5RA 3RGIA 2M0GB 2DH9A 3QIPA 4B9SA 4QR1A 4PXDA 5BXIA 3M2VB 2NSBA 4DR1F 3U27A 5KFRA 5D78A 5D4OA 2R8IA 3CD7A 5KT3A 1S1WA 3ZTSA 2ZVIA 3IR6B 2D69A 1ZM4A 4F7VA 2F9DA 5CXTA 1U26A 1K8AT 3MEEB 3J81U 2J9EA 1X0PA 3EXCX 3KLIA 4EZ9A 3GILA 4F0KA 2IVMA 2KJVA 3VWSA 2KVQE 4DPUA 4JUZA 3M9NB 2DGOA 1SB6A 3M9MB 2WTFA 5L1KA 4B9MA 4NYPA 2QLWA 4BHQA 4TY8B 4OYXA 2OO4A 3C6EC 2WAQD 3D1QA 1KQSR 1SUQA 2BEFA 3UNYA 2RDJA 1G7CB 3M8WA 3KHRA 4FNHA 4IG0B 2PEHA 2R42A 3TAQA 2BW7A 3HF5A 1FJ7A 4NLQA 1SJFA 3DDIA 2M88A 3PX4A 1AT1B 1S4FA 2D74B 1BWEA 1JLFB 2CIMA 1HNIA 1PJ6A 3ADAC 2DO4A 1JKHA 3QWPA 2I6WA 2XS7A 5KFNA 3Q23A 3IC1A 4YB7A 4FKXA 3AHPA 3AGZA 3H7HB 1LWEA 2FB0A 3S6EA 5JUMA 3THPA 4PRFA 3KK1A 4I7FA 2VPXB 3IRXA 1YZ7A 2QC3A 1RT2A 3TO8A 4DBQA 2KZZA 1TVRA 1KLMB 2Z2ZA 5ETSA 5D0RA 4Y28C 4R25A 2LKZA 3AJDA 3LGHA 2YWKA 2MQQA 1URNA 2NSCA 1N5SA 1RYSA 1QTMA 1IKVB 1MN9A 3TJAA 4F26A 3NGKA 3T19A 4NYZA 4DXLA 1N34F 1E6VB 2YKOA 3CUNA 3CB4A 2CQGA 2EFPA 4X65J 4RR5A 3GFXA 3F0NA 1RCXB 1NCLA 2NYHA 4DV5F 1QAXA 5L1IA 1WSVA 5ETRA 4MK9A 1H72C 1RAHB 2YKNB 3JSRA 2E1CA 3OD2A 4C97A 4EBEA 4ZVTB 2ALZA 3OXFA 2QE5A 3G8TA 4YOEA 2O01C 3RRHA 4FBTA 2IMOA 2DGXA 1VISA 5T41A 1S1TA 3M2RA 2ZJPQ 1KTQA 2MQ8A 4NL5A 4B17A 3O8WA 3R6GB 2RU9A 4M5LA 3EDQB 4UOHA 2ZE2B 1C0UA 3FEXB 3DI6A 3E01B 2JNJA 4FYYB 1YBUA 3PO4A 2CQ3A 4C8KA 4DS5A 2XZWA 4O4RA 4QYRA 3PKYA 3UN3A 2QL7B 4CLKA 4CTAB 1LFWA 2JJ4D 2RNEA 1RU2A 3J7ZT 3DLEA 2DB1A 1WG4A 4NLVA 5J2PA 2WVDA 2H1YA 5KG7A 4LF6F 2GQ2A 2PFFB 4GO7X 5HMXA 4PZVA 4F02A 4DUYF 2GMLA 3AODA 3L9ZA 1NJXA 1JK9B 3S8SA 3A1YG 2QIFA 4C8OA 2UV8G 3L3CA 4F25A 1WKJA 2AJ4A 2OPSB 2LXIA 1ZA1B 2UUTA 2J76E 1RTJB 4ZIWA 2GO9A 2XTJP 4F8RA 5L9XA 3RZAA 3MMCA 3HKWA 4IFVA 3C15A 5HROA 2MY7A 4DV7J 1K1QA 2VICA 1HFEL 3RR7A 1QY7A 1KRPA 4R0EA 4OYWA 1RT4A 3GV7B 4IOAQ 3B4MA 3V6KA 3QRQA 2MZTA 1IN0A 1F3VA 3FVYA 3TNVA 1LK5A 4CT9A 5D0GA 3HZEA 4DMZA 1KVJA 1XNRJ 3PYGA 1Q82T 2J9DE 5IFMA 1RT5B 4I67A 2MZRA 3PFOA 4Q44A 3R5BA 2HK2A 2DNMA 4X66F 1O51A 2QTWA 3K8WA 2PE8A 1TU0B 4DR5F 1UEKA 2QSFA 3B6BA 1LNQA 5KFLA 4ECQA 2QL5B 2IRXA 4QWBA 4BBYA 1ZAVA 1I51B 1EKRA 3P8BB 2BBEA 3MR5A 4DL2A 2VG5A 1M1GA 1PYOB 4RNFA 2OD4A 3IXQA 4IH5A 5GAEU 4JI7J 3NCPA 1FXLA 1S0NA 2QYCA 4M63A 1BQNB 1U45A 3THVA 1R0AA 1SC6A 3RW7A 3N9UC 2R8KA 1DTQA 3D6HB 4OI1A 3OTOF 4CLLA 3SXLA 2B6AA 3K58A 3GWCA 3H98A 2ODXA 3SDEA 2GHWA 2V2QA 1F9FA 4CH0S 1R8AA 3DOLA 1NHKL 4I6AA 1VQMS 3RTVA 3PR4A 4PUOA 4OX6A 1VIXA 2K8GA 3IG1B 1FNMA 1FJGJ 3S01A 5L46A 3KHHA 2XMWA 5LMUJ 4DSLA 5F8IA 4CRJA 3FEZA 2CZ9A 4KB7A 2QJ3A 3P4UB 1DFDA 2ZD1A 3SQOP 1IKWA 2E7VA 1RT6B 3QGIA 3FSIA 2PMWA 4ZKAA 4OZ1A 1F6TA 2RT3A 3GCXP 5E3RA 4WFYA 1SL2A 1OY9A 1X8DA 1TKDA 3AJ1A 4N7TA 4BC7A 1TUWA 4OZJA 3H2LA 3ZZRA 3MDFA 4ES2A 4CLYA 4ANDA 2MQPA 2BX6A 3LAKA 3KJVB 1IWGA 3KK3A 4O4GA 1PAUB 3TOQA 2OTLS 2BQRA 2HRYA 4KPYA 4X4NA 1VRUA 1WG5A 2WVCA 3CMAS 2P5VA 1H3DA 1RJJA 2CJQA 2NUUG 4DR6J 2HFZA 4LQ9A 2GA7A 2RQKA 4QW9A 1HWKA 2DGWA 1DURA 1Y3JA 5IWAF 4V19X 4PWDB 3D6TB 3CJ2A 3HHEA 4WPAA 2R7UA 2WBRA 3HHDA 3W7BA 1F3FA 3LP1A 4O0NA 4W98A 1T11A 1QD1A 2J6SA 2FD2A 3PO5A 1X4HA 5IQ6A 3NRBA 4LBPA 4EEYA 4YY3J 4EK2A 2HRUA 3CVKA 3J80Y 1CJVB 5GAHI 3VALA 1ZH5A 3GIKA 4M5IA 1VQYA 1VHFA 4ELTA 1U1KA 2OSQA 4ED6A 3H5UA 3ILLA 1VRQC 2YQ0A 1XN9A 2V8DA 4JI5J 1PKUA 1F2HA 5ITHA 1TKTA 4PG4A 3OUYB 3G6YA 1GQEA 4CDIA 1T0TV 1W25A 5HBMA 4UUXA 1V5VA 2EFQA 4KPCA 4UZBA 1Y3KA 4O3RA 1HI0P 3GSIA 2YKMA 1RHKB 2B3TB 1YITS 4RO0A 4MH8A 1O0PA 1HD1A 2HS4A 5IQQA 2G13A 1XJWB 2B0GA 1VBYA 4Z37A 1WUUA 1KR4A 5DS7A 1TUVA 3ZTPA 4DV4J 4OYMA 1RHMB 5EHHA 4OZ2A 5B0EA 2DO0A 2IDEA 3PZPA 1UW9A 1I5OB 3ZFVA 3UWTA 3K5NA 2ZBPA 2X3GA 1VFJA 1U25A 3GCWP 3QLHB 4HHJA 4NLUA 2J0SD 5A2QU 4ZPCA 5HQMA 2VH7A 2ABYA 2DBBA 2EW9A 1VQKS 1R8BA 1WTFA 1UEVA 2XNQA 1BC6A 1TTHB 1HYSB 1KLNA 2APOA 3NAHA 5F41A 2J9DA 1TKZB 5LSRA 4P71A 2M9KA 3BO2A 5M2PA 4ZMMA 4QR2A 1Q5VA 5EGYA 5KFCA 3L7PA 1RLDA 2F8HA 2MHNA 4Z2XA 4IQMA 3SI8A 1V5IB 2POKA 3OR1A 2KFZA 4C98A 4DQIA 4KJIA 2F9JA 2BZ2A 2N3LA 2A6OA 2UVUA 4FNIA 5E3PA 1MLAA 1U0SA 4ZP6A 1HI1A 3OFEA 1PG5B 2JEIA 4XDDA 5IZHA 3GLJA 4DU7A 3D4JA 1EB0A 1NB2A 5EX3A 5FIIA 1TL3B 2VOOA 2PGCA 1UWBB 3FKBA 3HD1A 1K44A 1SH0A 2YH0A 3DMJB 2RILA 3GV5B 2DXEA 3OL7A 1VC5A 1JLAB 3VTIA 1RAIB 2E7WA 1VBXA 3G2XA 3CJ0A 4ZDNA 1T3OA 2CKWA 3Q2SC 4X64J 3U1LA 2R4FA 5ETLA 4CO4A 3HHLD 3CXCR 3GIMA 2DNNA 3POTA 3FRZA 3SSRA 1XERA 1XMQF 3WDOA 2PEBA 1NK7A 2F7VA 2OUGA 1FDBA 4J91A 4CQ1A 3DGVA 3MXHP 4LREA 1GT8A 2GMJA 4RZRA 1AZSA 1FVQA 3QIPB 4RPFA 4FF4A 3OLBA 4FPRA 1PJ7A 2GW8A 3HCXA 2ZBIA 1ITPA 1S1WB 3CD0A 1IUJA 5E7OB 1KDNA 5A8KA 1XBWA 1Q95G 1JMTA 1YRTA 2X1GA 3KLIB 1V3ZA 3H90A 1WORA 3W2WB 3BSNA 1UJ6A 1R27B 3N6LA 1H73A 1F5BA 2VPWB 3D1OA 1LKZA 4EWTA 2H5JB 1MROA 1WC3A 2EK1A 4I0WA 3BN4A 3R2DJ 2W9CA 1SUQB 1RISA 3RB4A 3CJSA 3I5CA 3PW5A 3TZZA 3JSMA 2HHTA 1W7WA 1WF0A 1R43A 2CPYA 4NLRA 2IRYA 3LPEA 2CQCA 2ADCA 1GX5A 1WJ9A 4RU9A 4Y2MA 4ENOA 4FYXB 1JKHB 3QGPA 4PEOA 1S6PA 2YQ3A 2C22A 1R0CB 2KHCA 2W4DA 4ZA1A 2D9PA 4MYUA 5ETQA 3HVWA 1LWEB 1OWXA 3JQJA 2YKPA 1WF2A 4K2XA 3CJ4A 5D4NA 4I7FB 4ITSA 4O23A 1RTIA 4JI8F 3TUZC 5H9FK 1X7VA 3MM5A 4I4BA 2CNNB 1OY6A 1NDPA 4PKDB 2HMIB 4IG3A 4F4WA 3M6XA 1TVRB 2ZOFA 4Q45A 1M90T 1R3NA 1X4BA 3KLEB 1TAQA 4P7TA 2JLEA 2V67A 5ADZA 5D0EA 3ENQA 4CYUB 5KFIA 4B3MJ 3D66A 1HQ2A 2KI2A 2A10A 2QG9B 4QYZJ 1CJTB 1Y10A 4LRAA 4JI6J 3QT7A 5IXUA 4TYBA 4H4MA 5I3PA 2HFVA 4HHUA 2PDAA 3H40A 2WHOA 5FDLA 2XHCA 1FA0A 1TL7B 3PEJA 4YDDB 2HZAA 2CQDA 1WG1A 3W5YA 4ECXA 1KOOA 2MPUA 3H25A 4J9LA 2Z58B 2BW2A 3MCMA 4J9VA 1JLGB 1Q8IA 2OMOA 4PWWA 1DQ8A 3CCUS 2WOMA 3H4DA 3SCJE 1S1TB 2FUG9 4IFYA 1VC6A 2K7KA 2C2EA 1N54B 2B9EA 3N01A 1C0UB 1WELA 1REVA 1C3GA 4X62J 2VB6A 4PR6A 3TANA 2AHOB 3N4WA 4B3TF 4QBUA 4FS2A 1CVJA 1YX2A 4DV1J 4Y2CA 4TY9A 5D4LA 1RWOB 2AZ3A 3A4TA 1NO8A 2BVZA 2LA4A 1EARA 4NZ6A 2GHVC 3K2YA 2EVZA 5AXNA 4JI4J 4LSNB 5J2PB 3MI7X 3JB9k 2QZ8A 3G87A 2HVIA 4LF2A 4WK3A 4CZCA 2ZJQQ 1FKAF 1HR0F 3MHYA 4XO0A 2BJ9A 4RWWA 2QL9B 3KLFB 2M8HA 2O1PA 1X5OA 4CT8A 4E0DA 4IDKA 2ZZTA 1CEZA 1EAYC 4K4WA 4MKBA 5KFWA 3PX6A 1H2TZ 4Y3CA 4WP3A 4I1TA 2IM0A 3E3XA 1NXIA 4UY8T 3MMCB 4IFVB 5KFHA 3C15B 5HROB 1NK5A 1UFWA 2DGVA 4M5NA 2P9EA 5J2MA 1FRHA 1RT4B 2DNZA 2DHSA 1L3TA 4TU8A 2GIQA 4ZLPA 1X5PA 3CDUA 2QEXS 4JI1F 3N0VA 4F50A 3BGFA 5E2QA 3DOMA 2YVSA 3G4SS 4EUVA 2QO3A 1RLCL 4IO1A 2VFSA 2F4VJ 4ZP7A 4FN5A 3JYTA 3KWMA 1KVIA 3SV4A 4C11A 2GQCA 1LOUA 4TQRA 4G65A 1HQUA 4USIA 3FBEA 1FERA 5K14A 4FYWB 2XO6A 5KG4A 2BMBA 2BUNA 1BQXA 3G9CA 2HHSA 4EBCA 2CUYA 3QJPA 3QBCA 3AOCA 2PI5A 3QT6A 1C1BB 4OQJA 5CYQA 1X4CA 2Z2MA 3CJKA 2EC0A 2MMYA 1C0TB 4DX5A 3K17A 3BO3A 4ZCLA 4NLOA 1BQMA 2LECA 2RDIA 3I87A 1IKXA 2VG5B 3PDNA 1VLOA 1LW0A 1S79A 2J7KA 2PA3A 3MUVP 3C8YA 1SC1B 4C8MA 3DRSA 3PTWA 3DLKA 3V2UC 5A8RA 3T1YF 4ZCMA 4ZHRA 1WACA 3W5XA 1R0AB 1AUDA 2HQGA 3C19A 4P2MA 1DTQB 1DLOA 1F1BB 3SMZA 3AXMA 2B6AB 2V0NA 1S6UA 4X4OA 4MYTA 3CE8A 4DSEA 5H9EJ 1MSWD 3QRRA 1EETB 1SVDA 4PUOB 4RNHA 2RQ4A 3R5CA 3MUTP 3W9JA 3UO0A 2C42A 4K2JA 2WRMA 1VQ8S 2HLTA 3EUNA 5HN0A 3JSBA 1UVKA 2ZD1B 1RABB 3GB0A 4JYAJ 3OFHA 2C1EB 2FHJD 3GJSB 1Z2LA 2XMUA 3O1LA 3HFKA 4HACA 1FKOA 1JQGA 4I68A 4DFMA 1LQ9A 2JVMA 3L7OA 4GRSA 4Y0FA 4DR1J 4C8NA 1XR7A 2FLOA 1GAOA 3LPYA 2FC8A 1RWWB 4NRTA 3BGRA 4N5SA 3KK3B 4O4GB 1VRUB 2KL8A 2KG0A 5KFMA 3M30A 3NY0A 1YSJA 2H54B 3LP2A 5T7LA 4K4YA 2M4MA 5CYMB 3PJ9A 3MPDA 4RW9A 1OQ6A 3LP1B 1HD0A 4UW2A 4ED4A 2XY5A 5C5JA 2EWHA 1FWKA 1RBAA 1ZTWA 4HKQA 5H1SV 3NNAA 3CCQS 1AA1B 3TEHB 1OS5A 4GMKA 3T9NA 3DU5A 3EPIA 2IMWP 1L3KA 5MAOA 3HSGA 3I0RA 4WYLA 2V8PA 2MJUA 4LF1A 2ZEJA 4CWBA 3PW7A 4HTIA 2FJEB 3ZZTA 2ZH2A 3PYEA 4DSKA 2WVFA 3OHBA 3HHLA 1X4FA 1TKTB 3BBBA 3F73A 1NBEB 2AIRB 4KGXB 1S97A 1LK7A 2HGNA 4KIAA 3RRGA 3W9HA 3D28A 3O5TB 2G9OA 2GJFA 3JAMY 2BABA 3AAWB 1T03A 1VQ5S 5ETVA 1S6OA 4C0HA 2ZZMA 4UT4A 2V4RA 4ICLA 1SJRA 4O3NA 4LSZB 5GMKa 3OHAA 4MKAA 1H7XA 5DDQC 3VR1A 2XYGB 3MCOA 4NPOA 2DNHA 2VBZA 2F63A 5JVGQ 4O3QA 2K1RB 2VFRA 4KHRA 5IT4A 3CCVS 4DV7F 3BGOP 3IM9A 4FXDA 1OSCA 3IN5A 4RW7A 2D41A 4ZLNA 2P9GA 3CJ5A 4CO2A 1HBNB 3BO4A 3M4XA 4RLEA 1KKHA 1FEHA 5E33A 5DDPC 3WC0A 3QFHA 2DD8S 1NM2A 2DNLA 3CW2C 2IA0A 1HWLA 1SC4B 3TUIC 1JJCB 1YHQS 1XNRF 4DV5J 4OV6A 3NBPA 1QAJA 5KG6A 2HGLA 6FD1A 3H5YA 3J81Y 4KH0B 2FHOB 1O8BA 4DS4A 1NZ8A 1IBMF 4ZLJA 3P6YC 2NS1B 3ISND 1H38A 3Q22A 1ZZNA 4BC9A 1J27A 3DLHA 1SXLA 2LYVA 3GJQB 3UD3P 3OR1B 3AB4B 1VQ9S 2OHDA 3M32B 4BWJA 2K06A 2JEGA 4LJMA 4A8OA 2LA6A 4A8WA 2W2PP 3SCLE 1S48A 3MZIA 2HBYB 3ZO7A 4DJBA 1KONA 1U1MA 4NCAA 1N6QA 2FZKB 4DUYJ 3LF0A 2Y1JA 2IHR1 3W60A 4PG5A 4NLWA 3PHEA 3WIVA 1QVGR 3MM7A 1A0OB 3TJ8A 3TQEA 2XZTB 2Q1LA 2M5YA 5B0BA 3BREA 1LW2B 2MTLA 4IO9Q 4AL6A 3IGVA 3W61A 1UETA 2CZ4A 2ASLA 3VAHA 4C8YA 4NA3A 2XQCA 5KAKA 2NXEA 3JTOA 2LQBA 4OLOA 2HS3A 3QWUA 3RBXA 3LGMA 3SYZA 4H4OA 2FIUA 5E5NA 3AQOA 5KFQA 1OIAA 1VLYA 4G1PA 5HK4A 2IJFA 1RUSA 4Q0BA 4KSEB 2C2OB 3ONQA 2R2RA 1AZSB 2CPHA 4OI2A 1ICEB 2CPJA 4DCPB 1DAXA 2DNKA 1S0VA 3EGZA 2B4UA 3HPOA 3NEKA 2DK2A 2Q3PA 2CWXA 3ILOA 2VF3A 3KOAA 2HURA 1KD1T 1FTCA 4B9TA 2YBVA 5DJBA 5A8KB 4N56A 3KUEA 2W9BA 5KFSA 3UCZP 1H2UX 3M8RA 1X5SA 3NGTA 3NS5A 4EI2A 1V6HA 4X66J 1Q81T 3LWMA 2CRLA 4DR5J 3GYXB 1K0TA 4X4QA 4AYBD 2XMKA 3DLLQ 1QDUB 5EN1A 2A18A 4KKOA 2W9CB 3A13A 1TKXA 5B0GA 2X7IA 1LXJA 2WB1D 2YPYA 2P6TA 3GU0A 2VL1A 2OFGX 1JLCA 2B8QA 2RU3A 2RIJA 5DQGA 4LFAF 3EVMA 1RHQB 3OTEA 7FDRA 2VFTA 1JJ4A 3TUPA 1RKJA 1KN6A 4UY85 4AT1B 2M7SA 3MPVA 2XLKA 1S6PB 1X60A 2V34A 3BJYA 3R97A 3TW0A 1NHVA 2G1DA 2VG7A 2XO7A 3THTA 2DT9A 3BR8A 4DL7A 3CEDA 2N7YA 2CPEA 2NZCA 1QAYA 4DR4F 4DCOB 1RTIB 1TELA 3MM5B 2XLJA 3K57A 4DPTA 4IG3B 3CCLS 4NE9C 4EMDA 3W63A 5AXMA 2AJ1A 1YI2S 2XGQA 2A1BA 5C24A 1RGVA 1YJUA 3T5JA 2P2CB 2WW4A 5BYRA 1XQIA 1RT7A 1FX2A 2PT0A 4J9QA 1RT3A 1Z2ZA 1IWAA 1M5OC 5FDLB 3V6DA 3UFCX 4DQPA 3QRPA 2AEMA 5IM0A 1QSLA 3ENVA 3MGJA 3PX0A 2O5DA 3M8SA 2LP4A 4DG1B 2Y9HA 1E6YA 4LBIA 4DL5A 5LM7E 1MNEA 3AJ2A 4CIOA 2RJZA 1UVNA 1S1UA 1LWFA 2FHMA 3W8PA 1U2CA 3N5BA 4L76A 2U2FA 4K5SA 5GAGU 2HPUA 3R2CJ 4IFYB 4GKJJ 1B7FA 1JXVA 1N33F 2C2NA 1RWNB 3GYNA 3KDNA 2W2MP 4A8SA 4IR9A 2E5JA 2N3OA 2AJFE 1NSQA 5DM7Q 4DR7J 5A8WB 2OAUA 5MLCV 4MIBA 4DPXA 4JBCA 3FZ2A 3ET6A 3KUHA 1JXLA 2VG6A 4WBFA 3F56A 2XLIA 2RS8A 3OL9A 2AD9A 1VK8A 1FD8A 1U2RA 3CCRS 5DRKA 4RBTA 4IH6A 4TKTA 3QZ8A 4AQYF 4NLTA 3MD1A 1HQEA 2FHJA 5F8HA 1VJWA 3BBCA 2MKKA 1SH3A 5C25A 2NYIA 1S49A 4CCHA 1BE4A 1SJQA 2IBKA 4OV1A 3BQ1A 3D5MA 5KG3A 3TAMA 2KFYA 3CIMA 3MUMP 3MAQA 4IDKB 4WZQA 4CI0B 2JFKA 1IKYB 2QYGA 1F5CA 3ZZZA 1CJKB 5HMZA 1S4EA 2CFXA 1VK3A 1IM6A 4KO0B 2BOPA 4BCAA 1VRTA 3GIRA 3FCVA 1GFWB 5J2MB 5LJ3Y 1QM9A 1WKKA 4URGA 4WKRA 3IWXA 1Q16B 3NGSA 4YB6A 3DOMB 2VQFF 4QWEA 1FI4A 2IJNA 1MW7A 2ZNYA 2MYFA 3W3SA 4ZVRB 3TP2A 1SJ3P 1UPPA 1IBKF 3JYTB 3FK4A 4OHWA 3CJQA 2P9CA 3LGNA 2KG1A 2ZH4A 2VJVA 4WWSA 5K14B 5SUHA 1VHIA 4DN0A 3BEGB 4A8QA 3R9LA 2IYIA 2KZMA 2FPHX 1NK4A 5K9FA 2EBGA 5CYQB 5AXLA 1B70B 3CJKB 4U95A 3M8QB 4L6V3 4ECUA 1S76D 2ZH5A 5KFAA 4L74A 4ZPAA 3PFEA 3RBZA 3O44A 1RWKB 4P74A 1PO6A 1IKXB 2YNFA 3TRGA 3DRRA 1LW0B 2HHQA 2DXFA 5D8HB 4DL6A 4LF8J 2CVIA 3NGUA 4C3MA 2A0FB 1GEHA 4DI6A 3DLKB 2G2YA 5A8RB 5H9EK 4ZHRB 4DV6F 1CPZA 1L3UA 4JV0A 4WU2A 2DNRA 1DLOB 4TNOA 1M5KC 2UUBF 1DTTA 4DLGA 3KDOA 2AGQA 3JS9A 5LXYA 4OHYA 1CBKA 3VAIA 2A2DA 3PY8A 2AMCB 4QOTA 1A6LA 1HHSA 3QSIA 3ZZOA 2BKNA 3MMAA 4ID5B 2BYCA 3QATA 3KHLA 3BB5A 3O3LA 4NYOA 1B0VA 3EICA 1XMQJ 3EVWA 1JNZB 3Q0AA 4DN9A 1TZ0A 5DO2A 2Y3YA 3OV7A 2MZQA 4HEA9 3KFWX 1Q0NA 1FXRA 1M1KT 2VBYA 1S0OA 2D9OA 1FKOB 2D3OR 3G71S 4FVMA 2Z4PA 2LDIA 4LF5F 3CO0P 2KXNB 3NMRA 4Y2KA 3TA1A 4P72A 2B8PA 1IBCB 2MQMA 1NK6A 4JI6F 2MQLA 3DGPA 4AFFA 2HQCA 1RTDA 3VAKA 2V2VA 1L3VA 2HWIA 4CP5A 3BGRB 2GJIA 2AP6A 3I82A 1FEEA 4ES1A 1ZAWA 3V4IA 2UUWA 3ETOA 2VHGA 4DQQA 5A2QY 3VGVA 3BSAA 3BR9A 2HRTA 3DOKB 1UFKA 5T7LB 1U1LA 3AKOB 2A3JA 2EI5A 3H8YA 1U6BA 4RW9B 2ZOMA 1X9SA 1FJCA 3QT8A 5KT2A 4OFZA 4C2MA 3QJLA 1HBOA 3HHLC 2ASYA 3Q86A 3I0RB 5CQGA 2OSRA 3MAAA 1C4CA 2EG2A 2BM0A 2A2CA 2GGPB 3FGVA 2UVVA 2BA9A 3HHLB 7FD1A 2AGPA 1UPMB 2B9WA 5CD4A 1Y4ZB 4HDGA 2ZH8A 3FSXA 2DNQA 4J9PA 3DHXA 2DR7A 1FE4A 1U47A 4FZVA 2JOQA 1YLXA 3AA9A 4GC6A 3QO9A 2BKPA 4JI4F 1J2VA 4DWIA 4DDFA 4J90A 4KRWA 2DR8A 1T03B 4TVAB 4LMZA 2R7RA 3QAUA 4JI8J 1RKIA 4J80A 2MKYA 3CIZA 1V3RA 4LRDA 4ICLB 2DH7A 2FY1A 4ZITA 4UZCA 5F0WA 2O67A 5G0RA 3LO3A 4KE5A 4RKUC 3E8OA 2CPZA 3IWNC 1VMBA 2OPPB 3UCGA 3MOJB 3W1YC 3SBMA 1NUEA 3CDBA 3HI9A 4RW7B 4YR0A 5ETNA 2EKYA 2GVDA 2I9SA 1IR0A 4Y6IA 2DHHA 4ED3A 4P75A 3UPFA 2YNHA 1FNXH 3SFUA 4F4AA 2UXCJ 4KC5A 4X4VA 4DFPA 1P27B 4K0KF 2GVZA 3B8HA 4XAKA 2LU1A 5RUBA 4OIXA 1OPIA 3KNGA 3NBPB 4OZ5A 2UU9F 3CT9A 3LP0A 4EBDA 5L8RC 5GAEI 4L3KA 3ETMA 1TK0A 6FDRA 4F36A 3K5LA 1K0VA 4ED8A 5JMNA 2BJEA 1RYRA 3A8JA 4V19J 4ECYA 2LQJA 2E7XA 1QTNB 4B3TJ 2B9XA 3D0IE 1SIZA 1B0TA 2XSFA 3R5DA 4ZN3A 4HT5A 4CNYA 4J9NA 5K8MA 2CDQA 5JJBA 1R8HA 4TLRA 4ELUA 3NG8A 4ZN1A 1TFWA 4CLFA 2W7PA 2ADBA 3KJFB 3X3UA 1WC5A 4UOCA 1RWXB 3D9BA 3PRBA 4IOCQ 1N52B 2E1PA 3LANA 2V68A 1JWWA 3D67A 3MM7B 4F4YA 3ZTQA 3DYAA 2BQ3A 3QNWB 4Y34A 1FWLA 2EC2A 4KAIA 3SSSA 2XGPA 1DRZA 5K8PA 3OTDA 2Z0GA 4PXEA 1QLNA 1HW9A 4DUTA 2GAGC 1GNKA 3CJ3A 1Q8BA 1NU4A 1LEOA 3OR2A 3KLHB 3I6PA 4JI1J 4ZPBA 3HX9A 2KXHA 2EG1A 5KT4A 4DR2F 4P2XA 3EMTA 1FFGB 2BANA 1IQZA 3RB6A 2XI2A 4O3PA 2V9WA 2GQQA 4OJ3A 2NR0A 4HLBA 4OL8A 2E9TA 3CCES 3UCUP 2ZH3A 3PM9A 3K5OA 2QFIA 5FD1A 1U6ZA 3WBZA 2W2NP 2HNZA 1ZAXA 3CD6S 4DV2F 2K3KA 3U1NA 1WEYA 1NSAA 2E29A 3IS9A 3SQGB 3N79A 5JVHQ 4ED0A 1PILA 3EDRB 2XMJA 4J9SA 5IT0A 2I38A 5L1JA 2DPJA 2RKIA 4NWBA 1NSKL 3TI0A 3PW4A 1SKUB 1HIYA 1HL6A 1K73T 1TKXB 2W7AA 2ZC3A 4O3SA 4ERDA 5LXRA 1RCOB 3QGGA 4DPWA 3MPUB 3NL0A 2NXNA 1XR5A 1JLCB 2Y0BB 4A47A 3I0SA 1GK8A 1MN7A 4E98A 2DGUA 3Q8UA 3T1YJ 2RF2A 2AEJA 1ZPWX 3MEGA 1RAJA 3J7YU 4X4RA 2JEFA 2E1AA 2ILYA 2V6AA 1U1OA 2VG7B 1U49A 4QIGA 1TL1A 3OLAA 3S1TA 1T05A 3MM9A 4N41A 2XMAA 4EU0A 3CJ8A 4ZCIA 4NA2A 3ZTOA 2BE2A 1ROFA 5CZXA 1RAGB 2FVCA 4KHPJ 4D3GA 3FMBA 3LH2S 5CD4H 5DGAA 3BGLA 2YKAA 4L73A 3PKMA 2FHKA 4I2PA 5AJ3F 5C24B 1EX8A 1WTBA 3AH6A 4F4ZA 4M5KA 4W4MA 3UDLA 4RU2A 3M6UA 1H74A 1LXNA 1NZAA 3RW6A 3OXGA 3W8GA 3OFFA 3HSZA 4LF7F 2DR9A 2JZ5A 1RI7A 1NJIT 2I8EA 4QIWD 2ZHOA 5IM0B 3FCHA 3EGNA 3W5ZA 1U2FA 2Y1IA 2YPZA 3B78A 3MEEA 1E6YB 3QPIA 1Q53A 4FF1A 4QIVA 3I56S 4RW6A 2HIYA 5DG9A 4K8RA 3OTCA 1APSA 3F44A 1R6YA 2M3DA 1Q78A 1FRMA 2IM1A 1S1UB 1LWFB 3BQ2A 2MKHA 4TY8A 1X4AA 4Y2AA 2C2MB 2XZDB 3WQPA 1VR6A 4WTOB 3Q83A 2CXEA 1P9QC 4OX7A 1NLKL 2V5HG 3K5MA 3KK2B 4IG0A 3CMES 3FEYB 2J0XA 3ET6B 4LFBF 2IBOA 1UAWA 2VG6B 3T5KA 1WHVA 2DITA 1JJ2R 4I6WA 5B0AA 2V8HA 1IQTA 3QQCD 1HBUA 5A6WA 1DY3A 1S9GA 5AE1A 1HQEB 4IH7A 2G1HA 1UZDA 3JSYA 3FDSA 1C1CA 4OZ0A 4OI0A 1UJ5A 1K1SA 4YEAA 2CPDA 3NNCA 3TAMB 3DCAA 5F8LA 4ZVFA 1Y7PA 4CNZA 3KTQA 2HGMA 2KXFA 4U6PA 4P73A 1T95A 2XS5A 2IJRA 1TAUA 4XIUA 3AGYA 2M52A 3T5LA 1NHUA 1WEXA 1NRKA 5DETA 2RE1A 3F41A 2B26A 4P2FA 2UVRA 4RWXA 4O3OA 5I3QA 3IGNA 1IKVA 2OP5A 2CADA 1HBMB 2YNGA 1YJTA 2R7XA 1FNOA 2N4CA 3GV8B 2ALYB 9ATCB 4ZK7M 2R7OA 2E5GA 4ED5A 3I4HX 2L48A 2HNDB 4A8YA 2OEKA 2EXUA 1Q7LB 2FZCB 3GJRB 1ELOA 2NXUA 1RAOA 2X51A 3OVAA 4CLPA 4DOZA 1KNZA 3KLGA 2NLWA 3ITHA 2LQ9A 1Y9OA 3OSNA 4MK7A 4GKKF 4B08A 1Q1KA 3MWBA 4FXVA 4YP3A 3KG0A 4X84A 5HO4A 3D68A 3BZQA 2B43A 3D0HE 2LXFA 1IBMJ 1N32F 2JX2A 4WIIA 4PXCA 1WC4A 2CZVC 2NPIA 2QX0A 4B3SJ 4YDXA 1KQFB 4NA1A 4NLDA 2J5AA 4PAAA 2V4JB 2IY5B 2U1AA 2ZE2A 3I5BA 1J5OB 2KU7A 3FFIA 1KC8T 2GHPA 2YNFB 2CQBA 2DGSA 3NS6A 3DRRB 4I2QB 1BWVA 3FBBA 1GXTA 2N4DA 5KFVA 5EX0A 2OGUA 1OY8A 2W1BA 3GIJA 2L9WA 1Y5IB 3EPGA 3HT3A 1TK5A 2RHSB 3KMSA 1UJ4A 2OD6A 3CPWR 2JVOA 1PGZA 1LWCB 2QMWA 4NZ0A 4U9RA 2L9NA 2DH8A 4RJVA 3B82A 2FLNA 3T6BA 3BF4A 4MK8A 4CO5A 2ZBRA 5D4PA 3L09A 1BGXT 4NI2A 5KFBA 3MFIA 1UMJA 4PPDA 1G4CA 1HMVA 3P5TL 1UW4A 3PIOQ 4HL9A 4JV2A 3M8YA 3TARA 2NUHA 3KG4A 1B99A 3NS7B 3MMAB 2OMLA 2CJ9A 3ZNJ1 3W65A 1U4BA 2ZUAA 1O5JA 3C6UA 4OX9F 2BQUA 3I31A 1AFIA 4WJBA 2GZOA 2JDJA 2JC1A 2W01A 1S9EB 1M5PC 4B02A 2CQ0A 4R8UA 3ISNC 4DFJA 1RBLA 3SCKE 4QCLA 2Y8WA 1H6KX 3AGXA 2ZHAA 1ULRA 2HW3A 2KM8C 2HWHA 4K5RA 3DGPB 1UVIA 4UOFA 1D09B 4LR8A 5IC6B 4HDHA 1RTDB 1R7IA 2C3PA 1PSDA 1YBAA 2LMIA 4CO0A 1RU1A 2KM8B 3MM8B 3D7SB 4KHMA 3V4IB 1YK9A 1R6VA 1AW0A 3AFGA 2HBZB 5HP1A 2FLLA 1EHWA 1FWPA 2RHQB 3MCSA 4J7CA 1VQLS 3QIDA 3EX7B 1NLTA 2DIUA 4OYBA 5J1PA 3MOZA 1Y11A 1I6JA 2AWZA 3PNIA 2B9YA 3AT1B 4KH1B 1TV6B 4GKJF 3OL6A 1HBOB 2BACA 1Y5LB 3Q8YA 3QFWA 3MAAB 2D1CA 4DR7F 1XEZA 3PVXA 1CQNA 2XB2D 2HNYA 4LFAJ 1YJWS 3B4DA 3W2VA 2OPQB 3GR0A 2IDLA 3CDAA 4F0MA 4FXWA 4WFNQ 3TQ1A 1FK9A 1IR2A 3UDEA 3L4BC 1NSPA 4C6AA 4FF2A 3FQKA 1LWXA 3T6JA 2Z8QA 3CJTA 4KGZB 5BYSA 4XK8C 3MMBA 2DCUB 1ZS6A 3IG1A 4DR4J 2B7CB 1NMEB 1YKWA 1VQ7S 3CF5Q 1RB0A 3NP5A 4NZ7A 1FX4A 5G0RB 2AJ2A 2V50A 4ZOSA 3RU0A 2OPRA 3LTOA 2R2UA 4LRBA 5HVGA 2UUCF 3D3CJ 3I9V9 4DZDA 3BPSP 3TVYA 2ASDA 3MAHA 2GVDB 2ERRA 2VBXA 3K8VA 3R5GA 4WXWA 4Q2MA 2F40A 4NEYA 2HHXA 1HHTP 3CDWA 4U7UD 3V6HA 4WP8A 1JX4A 1AROP 4WK1A 3CC2S 2ZDPA 3TR5A 2W2QP 2E5IA 2LDYA 4FYVB 3PG9A 4Q43A 2GVZB 2WONA 3DC2A 3JXOA 1GX6A 4YR2A 1WHYA 3LP0B 1D3WA 1DJ0A 3H2VE 5I42A 1X4EA 1RWMB 1XNQF 2FDNA 3IBFB 2VPZB 4KGMA 2UUAF 2HHVA 3BH6B 1OPZA 4QIEA 1JLQA 3QSYB 1D8YA 4FPIA 4KTQA 1B3TA 1N5YA 2PSZA 3P49B 4P7VA 1MMNA 3IAM9 2XCPA 1N33J 1OO0B 3ILIA 4NASA 4ILMA 5U47A 3VVUA 4C3KA 2F8EX 4E2FB 2Q79A 2OEJA 4HTJA 1TQLA 1SQGA 1JLBA 4TU9A 1TP7A 4QPXA 3KUGA 1YWXA 1JB0C 1F9EB 4LF8F 3OUYA 2VU5A 2DNYA 4R0JA 4LUBA 1N5VA 2CPIA 4AQYJ 1EZZB 3LOUA 3MURP 1T9UA 1CS4A 2DGTA 4N76A 1RK8A 3C14A 2ZC4A 1B4SA 3I32A 1YRUA 4HI2A 3DDNA 1RTHB 4UF4A 3GG0A 4DF4A 1RA6A 2AYMA 5IV4A 2DY1A 2HFNA 2DR5A 3KNAA 3T1HF 2I0XA 4PYDA 1SL0A 4F2RA 2B56A 1SKWA 1VQSA 2HFSA 2LU2A 3OTBA 1AXQA 4EYIB 3OR2B 3H5SA 4CM0A 4RUAA 2WBMA 2VQFJ 1CSJA 2E1RA 2BDPA 2UP1A 1WEZA 1FRJA 2IPOB 3J7AN 2BANB 4JV5F 3FQLA 1MMLA 4LF9F 2XYHB 4MAKA 3UE2A 4ZVQB 2BJ1A 1X4DA 1IBKJ 2GAHC 4N8OA 1D0EA 4USWA 1VOMA 3T41A 1BY9A 1M5VC 3I4PA 3IBCB 4RW4A 3TZYA 1HNXF 3G6XA 3W62A 2DIVA 4ELVA 5DQHA 1T9XA 3VZHA 2ZM6F 2OELA 3M1VA 3KJQB 3IS9B 2GO8A 1NJWA 4DU8A 2HFOA 1KP6A 2GC8A 5B7WA 3NAIA 5HVHA 2ZZNA 4BWMA 2FLPA 2XNRA 2V94A 4BDPA 3AXKA 5I3UA 3TJ9A 4B3OA 3L7UA 4EGLA 4HH1A 2WZ1A 3MCNA 3VGSA 5F9LA 1VQ6S 2RF2B 3UVJA 4DV6J 1UWBA 3MEGB 3DLGA 4JI2F 3CNQP 3HZGA 2UUBJ 1HNIB 4QWAA 3N6MA 5D77A 3MPYA 2XEXA 1T05B 1N5TA 1S6QA 5CAAA 1SPBP 3PHTA 2VPYB 2E44A 4R5PA 3KK1B 3RBEA 2W2OP 3KJNB 3VQTA 2JC0A 1DHMA 3T3FA 1WHWA 3T9ZA 4J9KA 1G6BA 4I69A 5LMNJ 3IRXB 1S1XA 5E3QA 5GADU 2CAJA 4NLSA 1RT2B 2V9KA 3PW0A 4DSJA 3RBDA 3V81A 2OFHX 3OL8A 1IR1A 2RUSA 3RYLA 4GVBA 1D9FA 1HNZJ 2QRRA 4LF5J 3BKUA 1KQKA 1CG2A 2CQIA 4FP9A 3DLBA 3OQ2A 3DRXA 4QW8A 4TQSA 3ULHA 3IA0A 3CWJA 2NREA 2UXCF 3WZ0A 3DNCA 4WYWA 4DV3F 1BMQB 1F9HA 4Y65A 2ZNZA 2MHEA 3P96A 4RW6B 3W2WA 2PI4A 2XWYA 1TUGB 2PN6A 1RZMA 2XY7A 3H2UB 4DV0F 4FYDA 2J6UA 5DDOC 2ZH6A 1SBRA 1LV5A 2DHGA 2KKHA 3BDPA 4KR0B 3LWLA 5B0CA 2QT7A 3M2RB 4P2SA 4ZP8A 2JLFA 2VQEF 2HVDA 3IRWP 8AT1B 4CO3A 1KTVA 2KYZA 4LRFA 1OMSA 3DI6B 1GXLA 1BUXA 1FRKA 3CDEA 2CPFA 4F0HA 1HBUB 1MU2A 2HVZA 3GR1A 2BRLA 1S9GB 1MWQA 2Y0SD 1H7WA 1TK8A 5A0YA 1VQ4S 3DLEB 3H59A 2JRRA 3VZIA 4OX8A 3Q8PB 1C1CB 2AGOA 4YB5A 2RRBA 1KBRA 1OSDA 1SV5A 2RS2A 3AA8A 1UP1A 1WI6A 2GFFA 4WP9A 4QJVA 2PMZD 2RRNA 5HAOA 3T5HA 2HMIA 3M8PA 2XCAA 3IMQJ 2ROEA 2DHXA 1U1PA 1S7IA 1G2EA 1CJUA 3KLEA 3A8EA 1D9DA 3EE3A 4ZJOA 1O6XA 5H9FJ 4NLPA 4CYUA 4NMXA 2WW8A 2H3EB 1KSPA 1CJTA 2YNGB 4USUA 2ACYA 4K4SA 2HSEB 1WDTA 5A6PA 1FVSA 3JTPA 4WFAQ 1J5EJ 3PR5B 2RDDA 3BQ0A 2FJXA 2C2DA 3IR7B 4NXMJ 1TL7A 3NGRA 2MKSA 4AL5A 4K0KJ 3CULA 5FLXU 3KLGB 3ITHB 2UU9J 1JLGA 3QT5A 4P6QA 5LL6d 3UR0A 4ED7A 3NCRA 1S57A 5DDRC 4ZVHA 1P6TA 2QA4S 4NX9A 3FC9A 4LRCA 4J9RA 1R0BG 1UL3A 3E2EA 2YNIA 1XTZA 2R2TA 2G0CA 2FVPA 4PQUA 4C4WA 3FFIB 2JHEA 4G3IA 3SV3A 4C8ZA 2OLWA 1WDDA 4LSLA 1NAQA 1EQMA 2PA8D 7AT1B 4HHHA 2YX1A 4HT7A 2JRSA 5D3GA 4M95A 2F8MA 5KFPA 4LSNA 2Z30B 1YRXA 1S5ZA 2B4PA 2H4WB 3WHIA 5AE2A 3OVSA 3BYPA 4IQXA 2RB7A 4DX8H 4A8MP 1D8ZA 5KFXA 2GIRA 1NK0A 2E1MC 4NI2B 4JI3F 2XG8A 5F9NA 3KLFA 1HMVB 3SSQA 2DHAA 3SDEB 1YJVA 2KRRA 1N0VC 1FFWB 1NK9A 4TN2A 3DOLB 4J9OA 2BR0A 3BYRA 4OZNA 2HK3A 4V1Ak 4A4JA 3GIIA 4KT0C 1U6FA 3TAPA 1XK8A 3AY0A 3C6UB 1QJHA 3BDEA 2H5EA 4H4KA 1RAAB 5DM6Q 4KHPF 2HIQA 4U96A 1Z1ZA 4R8UB 4RUCA 3PJWA 2EFNA 1IKWB 3Q24A 2DGQA 1VJQA 2PFDA 1T9VA 4DF8A 4ZLLA 4EZ6A 2WSEC 3FUYA 1NDCA 4DR2J 1I3OB 3C66A 5KG0A 2N7CA 5GAGI 4USVA 2QLDA 1KWMA 2PMHA 4ETZA 5C42A 1HA1A 1Q7YT 3OFGA 3EM1A 1H2VZ 1FKPA 2AW0A 3DXSX 4DR3J 1S1VA 2K2PA 5HP1B 1OYDA 4DV2J 1EKSA 1C1BA 5KFEA 1N36F 5AE3A 4ED2A 2Z2YB 5E0OA 4OHXA 1C0TA 2UXBJ 5DLFA 2HEKA 2E5HA 2R7QA 4I64A 5C2GA 1YZ6A 3GE9A 3BV8A 1NJZA 2PC6A 1HARA 3A8KA 4YHHJ 2VV5A 2XY6A 4QU6A 1UTAA 2QLJB 4B9VA 4PG7A 2HNYB 1M5HA 1RDRA 4B9NA 1QVFR 2DNGA 2E5LF 4O44A 3W2VB 3CGIA 4E8UA 1NDKA 5CHCB 5DGBA 1NJYA 1CC8A 4HI1A 2ZH9A 1FDDA 3B54A 1FK9B 2G2OA 2PO4A 1NKEA 1FXDA 4IOBA 5L9NA 1ZZFA 3G86A 5HBMB 4IKAA 4PXBA 5LT5A 5J2QA 3HJFA 1EETA 3MMBB 2HBRB 4N8NA 3LZ8A 2J8SA 2YKMB 2FJBB 1Q5YA 4LF4F 1UZHA 1ZA2B 2DRBA 5AJ3J 2OPRB 2LFVA 3VQSA 5KTQA 1T3NA 3MF5A 3Q8VA 2WB4A 2R2SA 5CH7B 1S77D 4IRKA 2BRKA 2KH9A 2VDIA 3HFVA 2DY9A 3N6NA 5CCLA 4F4KA 3NOGA 2YWWA 1XMOJ 4N77A 4LF7J 1GH8A 2YWFA 3CJRA 2VONA 2FJWA 4KBIA 1QE1A 2H51B 2WONB 4ECZA 1Y00A 5I42B 2Q6CA 4ZPVR 1JLQB 4K7QA 5CYMA 2OH2A 3CO9A 2FGCA 2QMXA 2ZH1A 1NK8A 3TVZA 1N5YB 1C4AA 4AXIA 4B3SF 2GCFA 3AOBA 1SQFA 1S10A 1YDLA 4K4XA 1A9NB 2XSJA 4Z7CA 2CJBA 1GXUA 1VIOA 3MPWA 4GO5X 5HMWA 4NEZA 3U7JA 4DL4A 4AL7A 4ZVGA 3BGUA 3I5AA 4C0BA 4LFBJ 1JLBB 3CMQA 2ZVSA 2ASJA 1X9MA 5HMYA 1AB8A 3KLVA 4USHA 3FJ2A 4LR9A 1ZYQA 3FBFA 2WCXA 1UA0A 1IJEB 4WU3A 2LLZA 4M94A 4PWUA 1CS4B 2V8VA 3U1MA 4MKYA 3OJUA 4DPYA 2RAQA 3C14B 4ER8A 1WOSA 4NLGA 5DG8A 1S72S 1ZBTA 1N5QA 2QSWA 2WSCC 2B5JA 3MEKA 1HPZA 4IUFA 4MFBA 3PRDA 3SZ2A 3POTB 1HKAA 2DISA 2K1RA 3TA0A 2ZUGA 5D6GA 3AB2B 1DARA 2I5JA 2IC3A 2R3VA 2VOPA 2HWTA 3FCWA 3PEHA 2B4OA 1WOOA 1FFSB 1HBNA 1N48A 4JI0F 2NXJA 3P3DA 3HO1A 5F3TA 1U1RA 4CH1A 2YQ1A 1GTHA 2GNKA 1SJ4P 4CLSA 1HW8A 1BD6A 2YWGA 5EDWA 2HVEA 1N0UA 1P1TA 4DZ6A 4ZIVA 4GKKJ 4RW4B 3UDVA 2KT3A 4OYZA 1FRLA 3O2IA 4YR3A 1UCNA 1N32J 5B09A 3M1VB 3W66A 5EWEA 4DPOA 4OZLA 2EFGA 4F3MA 3EGVA 3NWGA 4M1KA 2X1AA 1WHXA 1MROB 4JB8B 1KVKA 4PABA 2E9ZA 3ISZA 1YJRA 2C2ZB 4DUZJ 2UXDF 1IJFB 4FVCA 5I3UB 2C3OA 3M32A 4AE5A 4B3OB 2ATCB 2NCKL 4YUDA 3AD9C 1RWVB 3JSMB 5L1LA 1ZPVA 3LQVA 3PYFA 1HNWJ 3CC7S 3RUBL 3TX8A 1U0HA 2FGOA 3UVJB 4IR1A 1W2BR 3HM9A 1PCAA 2C2RA 3C5XC 3R7SB 2J8AA 3DKDA 3DLGB 4KV8A 2MGZA 4GVLA 5KT5A 5C2CA 3HJVA 4JV1A 1IBLF 2BKOA 1S6QB 3L95X 5HANA 3HDSA 2A6MA 4R5PB 3R3TA 3OJSA 1NKBA 5K20B 3IBWA 1TL4A 1LW2A 1WC6A 2IM2A 8ATCB 3HD2A 1S1XB 1V3SA 4OX9J 1HWUA 1U8WA 4OHVA 2N82B 5HLFA 3ICLA 3ENAA 5BR8J 4QYZK 2R7WA 3H42A 3V81B 3RR8A 4OI6A 5GMEA 2IAJA 3FZBA 4GVBB 2JH3A 2K3IA 2QA2A 1OQ3A 2ZBQA 1X0FA 2DRAA 2HFUA 1UEUA 4URSA 3HSDA 4L72B 1ACMB 3M2UA 4IRDA 2LEBA 4H4MB 5KT6A 3IAS9 2IIHA 2Q43A 4DHVA 1X4GA 2CQ4A 5HI7A 1W26A 1XC9A 4W92B 2FQQB 2XM3A 3RG6A 4X4PA 1YG0A 4HYKA 2BJ3A 3MR3A 4DQRA 3DRPA 1D1UA 2W8KA 2IYGA 2VFVA 3J7Z5 4RNOA 4OJHA 3BM7A 4B9LA 2CWKA 5KFZA 2WOMB 5IT9U 2MEWA 4LVOP 3I38A 1CULA 2GX8A 2YH1A 1REVB 2QA4G 4JP8A 4YFUA 1RAFB 4D3HA 2EFVA 2ZFHA 2W25A 1OYEA 1UVJA 3PCOB 1MU2B 4RX6A 5J2NA 2KB2A 4QWCA 2AKWB 4EYHB 2DXDA 5A0YB 3BS9A 1AUSL 2BJ8A 1I94J 3EZ5A 2RSQA 2BOAA 3M7VA 2CA9A 4P52A 1SV5B 5IV3A 4WTYA 2BJDA 3I9ZA 1WKLA 3G82A 3M8PB 3OVBA 1FHTA 2BXJA 3DRYA 2CDRB 4WE1A 4RW8A 1QAIA 4DSIA 4XTTA 1CJUB 3R1LA 4MIAA 4FBUA 3KKFA 1REGX 3D3BJ 1HI8A 3MECA 3PACA 1NKCA 4NRUA 3C3LA 1HLWA 2OI2A 2UUCJ 1RA7A 4HH0A 2LVWA 2JFDA 1G3OA 5J1EA 4RUHA 4B3RF 4LFCJ 3UD5A 4ZS6A 1T02A 3I55S 5IOLA 3PV8A 5F0UA 2LEPA 2HAFA 3KYLA 5DLGA 2Y8YA 1JLEA 4URQU 2MLZA 4YN3B 2EBEA 2CQ2A 4DG1A 2F65A 4KY3A 3V4MA 3D6MB 3K0JA 3HULA 3D2WA 4ZVEA 4NCBA 4LVNP 2RMLA 2PIIA 4PYAA 3MTKA 2J9CA 5T14A 3C2PA 4C11B 1XNQJ 2XI3A 2CJAA 2UUAJ 1HQUB 5HQLA 4OJGA 4LT6A 2VUGA 3AOAA 5L39A 2YNIB 4ANEA 2IFXA 3J7YI 3MTJA 1FF2A 4WXOA 3UI3A 4PQUB 4LBHA 3BN7A 4MTPA 1Q4RA 5A8WA 4P10A 1VGYA 4QWDA 2KO1A 1BQMB 3MD3A 4L3NA 1TL5A 3UQSA 2NXCA 1BXNA 2RD5C 1L3SA 2KJWA 4LSLB 3C16A 1KHVA 3HHKA 3UW1A 4M5MA 1PAEX 2SXLA 2HHHF 1UFLA 4N47A 5KOWA 3DRSB 5D3GB 3TA2A 1FESA 1UVLA 2F5GA 1UA1A 3MFHA 2DRDA 1KOHA 5GAHU 1WC1A 4O0IA 2FC9A 1RQ0A 3G8SA 4W90B 3K7RA 3KHGA 4H4KC 2GMHA 2CPXA 3FNNA 5KFYA 1IKYA 2GS8A 1U24A 1CJKA 2QN6B 4OYOA 3GFYA 1URRA 4KO0A 2VODA 1IXKA 1Y5NB 2CQHA 4ILLA 2H65B 5LMNF 3T1HJ 1VQNS 4NCGA 1FDNA 1WWHA 5K5MA 2XC9A 3PYDA 1KFSA 5KFJA 2JL9A 2L9DA 2ZKTA 3EZOA 2M70A 3MM6A 2KRBA 4HACB 4X4SA 1HNZF 3M05A 1BHNA 2AQ4A 4JV5J 3MR2A 4LF9J 5KT7A 3OT9A 2Z57B 3G8QA 1JNRB 5C42B 2MDAA 4Q5VA 5LSOA 3OXLA 1WD6A 5EWFA 2R7TA 3DDKA 1HNXJ 1FKPB 4RNNA 2W4PA 1S1VB 3QAEA 1FTRA 5CABA 4OYIA 3US5A 3M30B 5E3CA 2ZM6J 1RT1A 4P9SA 3MR6A 3LP2B 4OYAA 4J9MA 1R31A 1RBOB 2HHUA 3M8QA 4NXNJ 4X4TA 5KFFA 5F8JA 2KTQA 2HAIA 1DBDA 1EP4A 2QV6A 1SQEA 3SFGA 1FD2A 2DR6A 1VYAA 1GMWD 4OYPA 2D3UA 5KG2A 1N8RT 4QIFA 4NLYA 2YWEA 2ROPA 1T8EA 5HSPA 4QZVB 1T9WA 1S59A 3CD5A 3HVTA 3WC2A 2DNPA 3R5JB 2CG4A 4MJKA 3SIPB 4NLXA 4O44B 2UVWA 1ZOTA 2Q6BA 2COLA 3CSKA 3QZ7A 3LA0A 3TVKA 4JI2J 4X2BA 3ZC4A 3CCTA 4DX6A 5KFOA 1V9OA 1CLFA 3N28A 2J0WA 2AYEA 5SZTA 4TU7A 3N5FA 2DEJA 2GV1A 5J2QB 5E3AA 4ECRA 2Q2GA 3WX8A 5AT1B 2Y1LB 5KFDA 4ID5A 3GZ7A 3H20A 3LALA 2QFJA 3HKZD 4C0OC 2H9ZA 4QU7A 4C48A 3JQMA 2HQ3A 5KFTA 3NCQA 4IYQA 4F4XA 4A48A 2VJUA 2MKCA 2FVRA 3WX4A 3FSYA 5IC4B 3VF0B 1RACB 4WFBQ 1KQGB 3LUYA 2LEAA 2G0IA 3HXMA 1TFYA 4G1IA 2QGFB 3CCMS 4IRCA 2J7WA 1KEKA 4M5HA 1J5EF 2FVQA 3SCIE 2RVJA 5C7PA 2KT2A 3P45B 2W24A 1QE1B 4NXMF 1KS2A 3HFZB 2KYXA 4DV3J 4X65F 1TMMA 3FBCA 2W7OA 1WF1A 1A7GE 3K89A 3P5BP 3C6TA 1YQHA 5DQIA 1N88A 3BBFA 3D6FB 1SJ1A 2XWXA 3DOKA 5HL7Q 5M2UA 4DV0J 1Y0HA 6AT1B 3VAFA 1SCJB 2MSTA 2XMMA 1C2PA 2R8HA 2K7JA 2XULA 1GMVA 3MEDA 4C3LA 1K9MT 3UDCA 2XSJB 2VQEJ 1FJEB 3NNHA 4ZCKA 2Z2LA 3A3OB 2RUGA 3RAQA 2OJ3A 3QMQA 2GGPA 3PRVA 4ZPWR 2CG8A 1S12A 2X3DA 4KQZA 3BH7B 2XMTA 4J5OA 4KFBA 4F2SA 2AX1A 1SL1A 1FRIA 3ILJA 1YJ7A 4FKYA 1F60B 2C28A 2B51A 4EFAC 1N6QB 3BKTA 3VAGA 2G4BA 2DTJA 4B9UA 4M5GA 4DLEA 1X31C 4FS1A 2IVYA 4GC7A 5I4MA 1HNVA 4ETXA 2B5JB 2LCWA 1FT8A 1HPZB 3OSPA 4CLUA 4UUWA 4MFBB 3CCZA 3R27A 2OPPA 3LAMA 3DM2A 2I5JB 4H4OB 2IC3B 9RUBA 3H4BA 3Q2TC 5HQ8A 4PG6A 3J81j 3O6QA 2MXYA 4ILRA 4Q0BB 2AEFA 2F1FA 1N34J 4JOUA 1F2GA 4WCEQ 2VD3A 2DPIA 4J9UE 2DYAA 2UV8A 5B08A 2W9AA 2R8JA 4TLQA 1YTYA 2ATLA 2W9BB 2AU0A 5FJ4A 1PBUA 3QYYA 2VA2A 4DR3F 2MJNA 2CNOB 5EWGA 2YWHA 2X1FA 3M6VA 4DEZA 4PG8A 1NPRA 2L41A 3J80U 2UXBF 2C3MA 3GFHA 2G0JA 1XIQA 4LQ3A 2UZAA 3VHQA 4M8LA 2JWNA 4KKOB 2J6TA 3EGWB 2W8LA 4K4UA 4U7CA 3BKFA 4YHHF 4K59A 1HWIA 5KFUA 2VIHA 1U0HB 3UN5A 4G1QA 1NNDA 4JI7F 2BE9B 2KFNA 3ZZYA 2WK4A 4KV8B 4ZVOB 3R1HA 2NZ4A 4LF6J 3DXBA 4MIWA 2MZSA 2MGZB 2ZDOA 3R5AA 5KFKA 3K5PA 5BYQA 3GYGA 1MWYA 4CH7A 3GMGA 4JI3J 2I1RA 3MMJA 2EKNA 1X5TA 2BJ7A 2FTRA 4TXSA 2ZH7A 2BE7D 1XAOA 2AYGA 3RAMA 3C46A 4F04B 3RB0A 4ECWA 2IRUA 1P1LA 1FJGF 3ZZPA 5K8OA 3QJJA 1Q8KA 2DNOA 3NGDA 5LMUF 4Q8EA 2FYXA 2AJ0A 2QLBB 2VDHA 5HLFB 4KGVB 1YVFA 1U1QA 4M5DA 2IAJB 1F0XA 3ZZ0A 1R8CA 2OIHA 3KLHA 4ANCA 4A8KA 2Q66A 2FJDB 2FZGB 2RQMA 3M2UB 3NMAA 3ZNUA 1RT7B 3M2VA 1RT3B 2GIFA 1FCAA 4ZP9A 1XMOF 5KG1A 3V6DB 5F8MA 3M8ZA 1N4LA 2MQOA 1B7YB 2V69A 4WKYA 5FLXY 4RL1A 3EVOA 3DRPB 2EFOA 4J37A 1T94A 1U1NA 4DR6F 1N36J 1CC7A 2JSXA 3SQGA 3CCSS 3CC4S 3CCJS 2KVIA 3A3PB 5DZ7A 3HK2A 1RP5A 1RADB 1LFPA 1H0HB 4YY3F 2WVEA 3HP6A 2LQ5A 2CNLB 5ETTA 3RAXA 2KDOA 4FDFA 1CULB 1Q86T 3VCDA 3UR3C 4A8FA 4OJ1A 3R7NB 2B4VA 2G2ZA 3A8IA 2E5LJ 4DCJB 2NQPA 3QGHA 4JI5F 2YKQA 3OTOJ 5J2NB 1JLFA 3EZUA 2IA6A 1NPPA 1XMBA 1RE1B 2ZOGA 2V2ZA 1AYEA 1EQ0A 1DQ9A 1YJNS 2RRAA 1JJHA 2JEJA 3IR5B 3TEGA 4U8YA 5A76A 2W4CA 5C25B 1T9TA 3CTRA 1NDLA 3IM8A 2C2KB 1TMJA 3EWGA 2ZHBA 3UNGC 3G82B 2C3UA 4ECTA 1KHWA 3GP9A 4X4UA 4WE1B 4RW8B 2MLXA 1S9FA 3OPKA 5DG7A 4LF4J 1KLMA 3MECB 1SH2A 2R8GA 1VRTB 1U8SA 4G6VB 2FVSA 4OMFG 2V2KA 4AUKA 5J1EB 4Y2IA 3R7BB 4DV4F 1P9YA 5CA5A 1YGYA 1RXOB 2ROGA 2OTJS 4YB1P 4UQTA 4DQSA 3BPDA 3Q89A 3PXGa 1JLEB 2HHPA 1U7LA 5B0DA 5JXSA 2VA3A 1E6VA 3I96A 5LSLA 2D7SA 3NKYA 4YS2A 1GMWA 4USJC 3DLJA 2VC1A 2CQ1A 4U8VA 2Z56B 4HR2A 2YKNA 2MB0B 3A12A 3GPAA 5IWAJ 1SC3B 4RUBA 1ZTTA 2VBWA 3FMWA 2AF6A 3OBIA 2ZJRQ 2MZJA 4ZVUB 5KG5A 4BS2A 3JTNA 4Q7AA 4CO1A 1D9AA 3TWZA 1W2IA 4Z7YA 2R9LA 1ZM2A 1UWAA 3BSOA 2H5IB 3KK2A 4ECVA 2ZWOA 2XMVA 4QPTA 4ZVPB 3E01A 2O3DA 4EO8A 2MY8A 3W9IA 1ZM3A 3C16B 4DUZF 4A8XA 2AV5A 3GG1A 2D3O1 1FO1A 4OI4A 4UOGA 3VGTA 3KMQA 4CTAA 1HNWF 4ALZA 5HJYA 1S7HA 2DVIA 2YY3A 1NH7A 1VDHA 1NH8A 5GADI 2WVBA 4K4ZA 3VAJA 3ZZUA 1RHRB 2VZ9A 1VQOS 3S7RA 1DTTB 4LIWA 2KT5A 1K47A 2HZCA 4Y00A 1L5UA 2BM1A 2MQNA 2V63A 2JVRA 4F3QA 2OPSA 1QUPA 3Q8SB 4NOHA 4X64F 2CJKA 2EEYA 4NMLA 1VC0A 1QSYA 2QA1A 3E51A 3H0PA 1RTJA 4MT1A 1EJ7L 2RQCA 3PW2A 4NCGB 3CCWA 2RH3A 5BR8F 1HBMA 5CYJA 1YBTA 2XHWA 5KFGA 1FDAA 3OW2R 3IP0A 3MM6B 1PYSB 4JI0J 5CCMA 2CYYA 3K59A 2HNDA 4AXJA 2KHDA 2MSSA 2VC0A 3Q8QB 3DU6A 4ZPTR 2X1BA 4H54A 4HVZA 3HT0A 1OJ4A 2AX0A 1GTEA 2HQDA 3G6ES 4F67A 1NB7A 4USMA 5THWA 4WF9Q 4Q8FA 2FJVA 2AZ1A 2D3ZA
chains in the Genus database with same CATH topology
1NLTA 3TJAA 2QLDA 1GMUA 3LA0A 2B26A 4L3KA 3TJ8A 1GMWA 2Q2GA 1EARA 3TJ9A 1EB0A 1C3GA 3NY0A 1XAOA 3AGZA 3I38A 1GMVA 2HFVA 3AGYA 3NXZA 3LZ8A 4J80A 3L9ZA 1GMWD 3AGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLT A;  3TJA A;  2QLD A;  1GMU A;  3LA0 A;  2B26 A;  4L3K A;  3TJ8 A;  1GMW A;  2Q2G A;  1EAR A;  3TJ9 A;  1EB0 A;  1C3G A;  3NY0 A;  1XAO A;  3AGZ A;  3I38 A;  1GMV A;  2HFV A;  3AGY A;  3NXZ A;  3LZ8 A;  4J80 A;  3L9Z A;  1GMW D;  3AGX A; 
#chains in the Genus database with same CATH topology
 3ENW A;  1PC4 A;  3G6V A;  1RT5 A;  3HVA A;  2DCL A;  1RT1 B;  2LQ8 A;  1QUV A;  1WOP A;  2LXU A;  5AXK A;  3ZTR A;  4KGK A;  2F3J A;  2V4J A;  5ETK A;  3VAM A;  1J5O A;  3UD4 P;  3R8Y A;  1EP4 B;  1MMD A;  2MKJ A;  2V8G A;  4CM2 A;  1NEE A;  2EPI A;  4I2Q A;  4RNM A;  2CJY B;  2DJW A;  3BSC A;  3D54 A;  3DFE A;  4CLT A;  1G1X A;  2XS2 A;  2V4Q A;  2UXD J;  3H5X A;  5F8G A;  3TZX A;  2XBP A;  4ZJQ A;  2HLU A;  3HVT B;  2DEI A;  3PIP Q;  3AD7 C;  1DZ5 A;  2ILZ A;  4USK A;  2R7S A;  4A46 A;  1LWC A;  4ATN A;  5B0F A;  4I6Y A;  1BQN A;  3M9O B;  4M5J A;  3AQP A;  4CLW A;  2HQF A;  2E66 A;  2XYP B;  2QMU B;  3EXY A;  2HQI A;  5BJR A;  5F3Z A;  3Q8R B;  1MWZ A;  4KYZ A;  3QO9 B;  1IBL J;  5GVQ A;  4DL3 A;  1PJ5 A;  2HBQ B;  1YJ9 S;  1R8P A;  2JLG A;  1I94 F;  4XPC A;  3HHN B;  5ETP A;  2C3Y A;  2P8I A;  3TZW A;  3X1L B;  3GSD A;  2OKQ A;  3DHW C;  1PC5 A;  1RWP B;  3G96 A;  3TUJ C;  2YX4 A;  1VBK A;  4WZM A;  1S9E A;  1Q8L A;  1X9W A;  1M1H A;  2M8D B;  2VKZ G;  2KN4 A;  4EO6 A;  1EIY B;  2YX7 A;  2IM3 A;  4WFZ A;  1T7P A;  3NOC A;  3TYT A;  1RT6 A;  1XR6 A;  4YQW A;  2Y1R I;  4B3M F;  5DZ6 A;  1WSR A;  4MMO A;  4LIR A;  2MKI A;  4Q2L A;  4YME A;  1B64 A;  4LFC F;  4LR7 A;  2F4F A;  3ELH A;  2YNH B;  4ZPD A;  4RBV A;  3MM8 A;  5KOX A;  3KJV A;  4F3O A;  1M5S A;  2ZBC A;  1RHJ B;  1WNE A;  1RSC A;  5ETM A;  4DSF A;  2AYB A;  3WIU A;  3C6T B;  2PD1 A;  8RUC A;  4K4V A;  2HHW A;  4C9D A;  2B7B B;  1VQP S;  4PWD A;  4RBU A;  2FJA B;  3GON A;  4K4T A;  4OI3 A;  1H98 A;  1MG7 A;  3GFZ A;  1TV6 A;  3PJX A;  3MED B;  2ZKU A;  3HMJ G;  4FF3 A;  4ID8 A;  1CJV A;  4X62 F;  2YXL A;  1S99 A;  1Z4U A;  2NPF A;  4OZ3 A;  4DV1 F;  1HWJ A;  1DQA A;  1RTZ A;  1WI8 A;  3NLC A;  1PIE A;  2FY8 A;  2VFU A;  2QLF B;  2OPQ A;  4WIQ A;  3HVR A;  2H48 B;  3KG1 A;  4KFB B;  1RHU B;  1KFD A;  4XDC A;  5G4D A;  2J0Q D;  2O66 A;  2WSF C;  5E41 A;  3RJM B;  5LJ5 Y;  1U02 A;  1PYT A;  2HVH A;  1T9Y A;  3AD8 C;  3FRY A;  5GMD A;  1XWL A;  2VKR A;  2HKE A;  3HLU A;  5HAT A;  2AT1 B;  3JQK A;  1YIJ S;  4PCQ A;  2CVE A;  3ZXW A;  1ZM9 A;  1RWU A;  1P8G A;  2CNK B;  4U67 Q;  1JIH A;  1HNV B;  3DYA B;  3A3N B;  2MZ1 A;  4K50 A;  1IVZ A;  3J7A 1;  1U09 A;  2CJX B;  2MLY A;  2ZWP A;  3D1H A;  4DFK A;  1AFJ A;  1PBA A;  4DL0 C;  3DM2 B;  3IFE A;  3GQC A;  3IWL A;  1N56 A;  4B3R J;  2BV3 A;  1S0M A;  3EYZ A;  2HS0 A;  4MKV A;  4ED1 A;  2P6S A;  1HHQ A;  1VI7 A;  3D0G E;  2VAS A;  4S0M A;  2AJQ A;  3LW5 C;  3W64 A;  4TYA A;  4UTG A;  4PPZ A;  1VBZ A;  3QLH A;  4ZVS B;  2F4V F;  4UST A;  4BLG A;  1FE0 A;  5K8N A;  3RB3 A;  1VCT A;  3R6L B;  1SKS A;  2OEM A;  5EUH A;  3GTY X;  2HZV A;  2CQP A;  4L75 A;  5HVF A;  1HYS A;  2HNZ B;  3SEO A;  5M2R A;  1TKZ A;  4DX7 A;  1UKU A;  1U48 A;  4ZJL A;  3TX0 A;  1CQM A;  1ZET A;  1VS3 A;  1BLU A;  5LOQ A;  3VVT A;  4NXN F;  5L38 A;  3UN2 A;  4CLZ A;  5IT9 Y;  2RKI B;  3KXD A;  2GJ2 A;  1SIW B;  1B0P A;  1RAE B;  2H4Y B;  3NXZ A;  4ECS A;  3T1A A;  2J7U A;  1SI9 A;  3MR7 A;  3IO1 A;  1Q79 A;  2L3M A;  2HHH J;  4XPE A;  3EJM A;  4G1Q B;  3I0S B;  5D15 A;  5HJX A;  1TR0 A;  1SKR A;  4UQG A;  2M2B A;  1TL3 A;  1IM4 A;  4C8L A;  5CZV A;  4QR0 A;  2IVF B;  5J1N A;  2HYI B;  1R89 A;  2JZ8 A;  5IS2 A;  3DMJ A;  3VV2 B;  1JLA A;  1HR0 J;  2QLX A;  5ETO A;  1UVM A;  2ACM A;  2E9R X;  3JAM U;  1RTH A;  1JXE A;  4OHZ A;  1TL1 B;  4PQA A;  2EK6 A;  4AD6 A;  2I2Y A;  1F5A A;  3MM9 B;  4I56 A;  5F8N A;  3NWR A;  1M0S A;  3HSJ A;  1NPK A;  4U7U K;  4ES3 A;  2BE2 B;  1FRX A;  1I1G A;  3GJT B;  3VGU A;  1WC0 A;  3RRK A;  2YTC A;  3M6W A;  3V6J A;  1GMU A;  4OLP A;  4M5D B;  2R7V A;  4JYA F;  4WFX A;  4I2P B;  5D0H A;  4C7Q A;  3DN9 A;  3U02 A;  1QSS A;  2ZIT A;  2DKO B;  4QQB A;  2L08 A;  2HG4 A;  3V5R A;  3RGI A;  2M0G B;  2DH9 A;  3QIP A;  4B9S A;  4QR1 A;  4PXD A;  5BXI A;  3M2V B;  2NSB A;  4DR1 F;  3U27 A;  5KFR A;  5D78 A;  5D4O A;  2R8I A;  3CD7 A;  5KT3 A;  1S1W A;  3ZTS A;  2ZVI A;  3IR6 B;  2D69 A;  1ZM4 A;  4F7V A;  2F9D A;  5CXT A;  1U26 A;  1K8A T;  3MEE B;  3J81 U;  2J9E A;  1X0P A;  3EXC X;  3KLI A;  4EZ9 A;  3GIL A;  4F0K A;  2IVM A;  2KJV A;  3VWS A;  2KVQ E;  4DPU A;  4JUZ A;  3M9N B;  2DGO A;  1SB6 A;  3M9M B;  2WTF A;  5L1K A;  4B9M A;  4NYP A;  2QLW A;  4BHQ A;  4TY8 B;  4OYX A;  2OO4 A;  3C6E C;  2WAQ D;  3D1Q A;  1KQS R;  1SUQ A;  2BEF A;  3UNY A;  2RDJ A;  1G7C B;  3M8W A;  3KHR A;  4FNH A;  4IG0 B;  2PEH A;  2R42 A;  3TAQ A;  2BW7 A;  3HF5 A;  1FJ7 A;  4NLQ A;  1SJF A;  3DDI A;  2M88 A;  3PX4 A;  1AT1 B;  1S4F A;  2D74 B;  1BWE A;  1JLF B;  2CIM A;  1HNI A;  1PJ6 A;  3ADA C;  2DO4 A;  1JKH A;  3QWP A;  2I6W A;  2XS7 A;  5KFN A;  3Q23 A;  3IC1 A;  4YB7 A;  4FKX A;  3AHP A;  3AGZ A;  3H7H B;  1LWE A;  2FB0 A;  3S6E A;  5JUM A;  3THP A;  4PRF A;  3KK1 A;  4I7F A;  2VPX B;  3IRX A;  1YZ7 A;  2QC3 A;  1RT2 A;  3TO8 A;  4DBQ A;  2KZZ A;  1TVR A;  1KLM B;  2Z2Z A;  5ETS A;  5D0R A;  4Y28 C;  4R25 A;  2LKZ A;  3AJD A;  3LGH A;  2YWK A;  2MQQ A;  1URN A;  2NSC A;  1N5S A;  1RYS A;  1QTM A;  1IKV B;  1MN9 A;  3TJA A;  4F26 A;  3NGK A;  3T19 A;  4NYZ A;  4DXL A;  1N34 F;  1E6V B;  2YKO A;  3CUN A;  3CB4 A;  2CQG A;  2EFP A;  4X65 J;  4RR5 A;  3GFX A;  3F0N A;  1RCX B;  1NCL A;  2NYH A;  4DV5 F;  1QAX A;  5L1I A;  1WSV A;  5ETR A;  4MK9 A;  1H72 C;  1RAH B;  2YKN B;  3JSR A;  2E1C A;  3OD2 A;  4C97 A;  4EBE A;  4ZVT B;  2ALZ A;  3OXF A;  2QE5 A;  3G8T A;  4YOE A;  2O01 C;  3RRH A;  4FBT A;  2IMO A;  2DGX A;  1VIS A;  5T41 A;  1S1T A;  3M2R A;  2ZJP Q;  1KTQ A;  2MQ8 A;  4NL5 A;  4B17 A;  3O8W A;  3R6G B;  2RU9 A;  4M5L A;  3EDQ B;  4UOH A;  2ZE2 B;  1C0U A;  3FEX B;  3DI6 A;  3E01 B;  2JNJ A;  4FYY B;  1YBU A;  3PO4 A;  2CQ3 A;  4C8K A;  4DS5 A;  2XZW A;  4O4R A;  4QYR A;  3PKY A;  3UN3 A;  2QL7 B;  4CLK A;  4CTA B;  1LFW A;  2JJ4 D;  2RNE A;  1RU2 A;  3J7Z T;  3DLE A;  2DB1 A;  1WG4 A;  4NLV A;  5J2P A;  2WVD A;  2H1Y A;  5KG7 A;  4LF6 F;  2GQ2 A;  2PFF B;  4GO7 X;  5HMX A;  4PZV A;  4F02 A;  4DUY F;  2GML A;  3AOD A;  3L9Z A;  1NJX A;  1JK9 B;  3S8S A;  3A1Y G;  2QIF A;  4C8O A;  2UV8 G;  3L3C A;  4F25 A;  1WKJ A;  2AJ4 A;  2OPS B;  2LXI A;  1ZA1 B;  2UUT A;  2J76 E;  1RTJ B;  4ZIW A;  2GO9 A;  2XTJ P;  4F8R A;  5L9X A;  3RZA A;  3MMC A;  3HKW A;  4IFV A;  3C15 A;  5HRO A;  2MY7 A;  4DV7 J;  1K1Q A;  2VIC A;  1HFE L;  3RR7 A;  1QY7 A;  1KRP A;  4R0E A;  4OYW A;  1RT4 A;  3GV7 B;  4IOA Q;  3B4M A;  3V6K A;  3QRQ A;  2MZT A;  1IN0 A;  1F3V A;  3FVY A;  3TNV A;  1LK5 A;  4CT9 A;  5D0G A;  3HZE A;  4DMZ A;  1KVJ A;  1XNR J;  3PYG A;  1Q82 T;  2J9D E;  5IFM A;  1RT5 B;  4I67 A;  2MZR A;  3PFO A;  4Q44 A;  3R5B A;  2HK2 A;  2DNM A;  4X66 F;  1O51 A;  2QTW A;  3K8W A;  2PE8 A;  1TU0 B;  4DR5 F;  1UEK A;  2QSF A;  3B6B A;  1LNQ A;  5KFL A;  4ECQ A;  2QL5 B;  2IRX A;  4QWB A;  4BBY A;  1ZAV A;  1I51 B;  1EKR A;  3P8B B;  2BBE A;  3MR5 A;  4DL2 A;  2VG5 A;  1M1G A;  1PYO B;  4RNF A;  2OD4 A;  3IXQ A;  4IH5 A;  5GAE U;  4JI7 J;  3NCP A;  1FXL A;  1S0N A;  2QYC A;  4M63 A;  1BQN B;  1U45 A;  3THV A;  1R0A A;  1SC6 A;  3RW7 A;  3N9U C;  2R8K A;  1DTQ A;  3D6H B;  4OI1 A;  3OTO F;  4CLL A;  3SXL A;  2B6A A;  3K58 A;  3GWC A;  3H98 A;  2ODX A;  3SDE A;  2GHW A;  2V2Q A;  1F9F A;  4CH0 S;  1R8A A;  3DOL A;  1NHK L;  4I6A A;  1VQM S;  3RTV A;  3PR4 A;  4PUO A;  4OX6 A;  1VIX A;  2K8G A;  3IG1 B;  1FNM A;  1FJG J;  3S01 A;  5L46 A;  3KHH A;  2XMW A;  5LMU J;  4DSL A;  5F8I A;  4CRJ A;  3FEZ A;  2CZ9 A;  4KB7 A;  2QJ3 A;  3P4U B;  1DFD A;  2ZD1 A;  3SQO P;  1IKW A;  2E7V A;  1RT6 B;  3QGI A;  3FSI A;  2PMW A;  4ZKA A;  4OZ1 A;  1F6T A;  2RT3 A;  3GCX P;  5E3R A;  4WFY A;  1SL2 A;  1OY9 A;  1X8D A;  1TKD A;  3AJ1 A;  4N7T A;  4BC7 A;  1TUW A;  4OZJ A;  3H2L A;  3ZZR A;  3MDF A;  4ES2 A;  4CLY A;  4AND A;  2MQP A;  2BX6 A;  3LAK A;  3KJV B;  1IWG A;  3KK3 A;  4O4G A;  1PAU B;  3TOQ A;  2OTL S;  2BQR A;  2HRY A;  4KPY A;  4X4N A;  1VRU A;  1WG5 A;  2WVC A;  3CMA S;  2P5V A;  1H3D A;  1RJJ A;  2CJQ A;  2NUU G;  4DR6 J;  2HFZ A;  4LQ9 A;  2GA7 A;  2RQK A;  4QW9 A;  1HWK A;  2DGW A;  1DUR A;  1Y3J A;  5IWA F;  4V19 X;  4PWD B;  3D6T B;  3CJ2 A;  3HHE A;  4WPA A;  2R7U A;  2WBR A;  3HHD A;  3W7B A;  1F3F A;  3LP1 A;  4O0N A;  4W98 A;  1T11 A;  1QD1 A;  2J6S A;  2FD2 A;  3PO5 A;  1X4H A;  5IQ6 A;  3NRB A;  4LBP A;  4EEY A;  4YY3 J;  4EK2 A;  2HRU A;  3CVK A;  3J80 Y;  1CJV B;  5GAH I;  3VAL A;  1ZH5 A;  3GIK A;  4M5I A;  1VQY A;  1VHF A;  4ELT A;  1U1K A;  2OSQ A;  4ED6 A;  3H5U A;  3ILL A;  1VRQ C;  2YQ0 A;  1XN9 A;  2V8D A;  4JI5 J;  1PKU A;  1F2H A;  5ITH A;  1TKT A;  4PG4 A;  3OUY B;  3G6Y A;  1GQE A;  4CDI A;  1T0T V;  1W25 A;  5HBM A;  4UUX A;  1V5V A;  2EFQ A;  4KPC A;  4UZB A;  1Y3K A;  4O3R A;  1HI0 P;  3GSI A;  2YKM A;  1RHK B;  2B3T B;  1YIT S;  4RO0 A;  4MH8 A;  1O0P A;  1HD1 A;  2HS4 A;  5IQQ A;  2G13 A;  1XJW B;  2B0G A;  1VBY A;  4Z37 A;  1WUU A;  1KR4 A;  5DS7 A;  1TUV A;  3ZTP A;  4DV4 J;  4OYM A;  1RHM B;  5EHH A;  4OZ2 A;  5B0E A;  2DO0 A;  2IDE A;  3PZP A;  1UW9 A;  1I5O B;  3ZFV A;  3UWT A;  3K5N A;  2ZBP A;  2X3G A;  1VFJ A;  1U25 A;  3GCW P;  3QLH B;  4HHJ A;  4NLU A;  2J0S D;  5A2Q U;  4ZPC A;  5HQM A;  2VH7 A;  2ABY A;  2DBB A;  2EW9 A;  1VQK S;  1R8B A;  1WTF A;  1UEV A;  2XNQ A;  1BC6 A;  1TTH B;  1HYS B;  1KLN A;  2APO A;  3NAH A;  5F41 A;  2J9D A;  1TKZ B;  5LSR A;  4P71 A;  2M9K A;  3BO2 A;  5M2P A;  4ZMM A;  4QR2 A;  1Q5V A;  5EGY A;  5KFC A;  3L7P A;  1RLD A;  2F8H A;  2MHN A;  4Z2X A;  4IQM A;  3SI8 A;  1V5I B;  2POK A;  3OR1 A;  2KFZ A;  4C98 A;  4DQI A;  4KJI A;  2F9J A;  2BZ2 A;  2N3L A;  2A6O A;  2UVU A;  4FNI A;  5E3P A;  1MLA A;  1U0S A;  4ZP6 A;  1HI1 A;  3OFE A;  1PG5 B;  2JEI A;  4XDD A;  5IZH A;  3GLJ A;  4DU7 A;  3D4J A;  1EB0 A;  1NB2 A;  5EX3 A;  5FII A;  1TL3 B;  2VOO A;  2PGC A;  1UWB B;  3FKB A;  3HD1 A;  1K44 A;  1SH0 A;  2YH0 A;  3DMJ B;  2RIL A;  3GV5 B;  2DXE A;  3OL7 A;  1VC5 A;  1JLA B;  3VTI A;  1RAI B;  2E7W A;  1VBX A;  3G2X A;  3CJ0 A;  4ZDN A;  1T3O A;  2CKW A;  3Q2S C;  4X64 J;  3U1L A;  2R4F A;  5ETL A;  4CO4 A;  3HHL D;  3CXC R;  3GIM A;  2DNN A;  3POT A;  3FRZ A;  3SSR A;  1XER A;  1XMQ F;  3WDO A;  2PEB A;  1NK7 A;  2F7V A;  2OUG A;  1FDB A;  4J91 A;  4CQ1 A;  3DGV A;  3MXH P;  4LRE A;  1GT8 A;  2GMJ A;  4RZR A;  1AZS A;  1FVQ A;  3QIP B;  4RPF A;  4FF4 A;  3OLB A;  4FPR A;  1PJ7 A;  2GW8 A;  3HCX A;  2ZBI A;  1ITP A;  1S1W B;  3CD0 A;  1IUJ A;  5E7O B;  1KDN A;  5A8K A;  1XBW A;  1Q95 G;  1JMT A;  1YRT A;  2X1G A;  3KLI B;  1V3Z A;  3H90 A;  1WOR A;  3W2W B;  3BSN A;  1UJ6 A;  1R27 B;  3N6L A;  1H73 A;  1F5B A;  2VPW B;  3D1O A;  1LKZ A;  4EWT A;  2H5J B;  1MRO A;  1WC3 A;  2EK1 A;  4I0W A;  3BN4 A;  3R2D J;  2W9C A;  1SUQ B;  1RIS A;  3RB4 A;  3CJS A;  3I5C A;  3PW5 A;  3TZZ A;  3JSM A;  2HHT A;  1W7W A;  1WF0 A;  1R43 A;  2CPY A;  4NLR A;  2IRY A;  3LPE A;  2CQC A;  2ADC A;  1GX5 A;  1WJ9 A;  4RU9 A;  4Y2M A;  4ENO A;  4FYX B;  1JKH B;  3QGP A;  4PEO A;  1S6P A;  2YQ3 A;  2C22 A;  1R0C B;  2KHC A;  2W4D A;  4ZA1 A;  2D9P A;  4MYU A;  5ETQ A;  3HVW A;  1LWE B;  1OWX A;  3JQJ A;  2YKP A;  1WF2 A;  4K2X A;  3CJ4 A;  5D4N A;  4I7F B;  4ITS A;  4O23 A;  1RTI A;  4JI8 F;  3TUZ C;  5H9F K;  1X7V A;  3MM5 A;  4I4B A;  2CNN B;  1OY6 A;  1NDP A;  4PKD B;  2HMI B;  4IG3 A;  4F4W A;  3M6X A;  1TVR B;  2ZOF A;  4Q45 A;  1M90 T;  1R3N A;  1X4B A;  3KLE B;  1TAQ A;  4P7T A;  2JLE A;  2V67 A;  5ADZ A;  5D0E A;  3ENQ A;  4CYU B;  5KFI A;  4B3M J;  3D66 A;  1HQ2 A;  2KI2 A;  2A10 A;  2QG9 B;  4QYZ J;  1CJT B;  1Y10 A;  4LRA A;  4JI6 J;  3QT7 A;  5IXU A;  4TYB A;  4H4M A;  5I3P A;  2HFV A;  4HHU A;  2PDA A;  3H40 A;  2WHO A;  5FDL A;  2XHC A;  1FA0 A;  1TL7 B;  3PEJ A;  4YDD B;  2HZA A;  2CQD A;  1WG1 A;  3W5Y A;  4ECX A;  1KOO A;  2MPU A;  3H25 A;  4J9L A;  2Z58 B;  2BW2 A;  3MCM A;  4J9V A;  1JLG B;  1Q8I A;  2OMO A;  4PWW A;  1DQ8 A;  3CCU S;  2WOM A;  3H4D A;  3SCJ E;  1S1T B;  2FUG 9;  4IFY A;  1VC6 A;  2K7K A;  2C2E A;  1N54 B;  2B9E A;  3N01 A;  1C0U B;  1WEL A;  1REV A;  1C3G A;  4X62 J;  2VB6 A;  4PR6 A;  3TAN A;  2AHO B;  3N4W A;  4B3T F;  4QBU A;  4FS2 A;  1CVJ A;  1YX2 A;  4DV1 J;  4Y2C A;  4TY9 A;  5D4L A;  1RWO B;  2AZ3 A;  3A4T A;  1NO8 A;  2BVZ A;  2LA4 A;  1EAR A;  4NZ6 A;  2GHV C;  3K2Y A;  2EVZ A;  5AXN A;  4JI4 J;  4LSN B;  5J2P B;  3MI7 X;  3JB9 k;  2QZ8 A;  3G87 A;  2HVI A;  4LF2 A;  4WK3 A;  4CZC A;  2ZJQ Q;  1FKA F;  1HR0 F;  3MHY A;  4XO0 A;  2BJ9 A;  4RWW A;  2QL9 B;  3KLF B;  2M8H A;  2O1P A;  1X5O A;  4CT8 A;  4E0D A;  4IDK A;  2ZZT A;  1CEZ A;  1EAY C;  4K4W A;  4MKB A;  5KFW A;  3PX6 A;  1H2T Z;  4Y3C A;  4WP3 A;  4I1T A;  2IM0 A;  3E3X A;  1NXI A;  4UY8 T;  3MMC B;  4IFV B;  5KFH A;  3C15 B;  5HRO B;  1NK5 A;  1UFW A;  2DGV A;  4M5N A;  2P9E A;  5J2M A;  1FRH A;  1RT4 B;  2DNZ A;  2DHS A;  1L3T A;  4TU8 A;  2GIQ A;  4ZLP A;  1X5P A;  3CDU A;  2QEX S;  4JI1 F;  3N0V A;  4F50 A;  3BGF A;  5E2Q A;  3DOM A;  2YVS A;  3G4S S;  4EUV A;  2QO3 A;  1RLC L;  4IO1 A;  2VFS A;  2F4V J;  4ZP7 A;  4FN5 A;  3JYT A;  3KWM A;  1KVI A;  3SV4 A;  4C11 A;  2GQC A;  1LOU A;  4TQR A;  4G65 A;  1HQU A;  4USI A;  3FBE A;  1FER A;  5K14 A;  4FYW B;  2XO6 A;  5KG4 A;  2BMB A;  2BUN A;  1BQX A;  3G9C A;  2HHS A;  4EBC A;  2CUY A;  3QJP A;  3QBC A;  3AOC A;  2PI5 A;  3QT6 A;  1C1B B;  4OQJ A;  5CYQ A;  1X4C A;  2Z2M A;  3CJK A;  2EC0 A;  2MMY A;  1C0T B;  4DX5 A;  3K17 A;  3BO3 A;  4ZCL A;  4NLO A;  1BQM A;  2LEC A;  2RDI A;  3I87 A;  1IKX A;  2VG5 B;  3PDN A;  1VLO A;  1LW0 A;  1S79 A;  2J7K A;  2PA3 A;  3MUV P;  3C8Y A;  1SC1 B;  4C8M A;  3DRS A;  3PTW A;  3DLK A;  3V2U C;  5A8R A;  3T1Y F;  4ZCM A;  4ZHR A;  1WAC A;  3W5X A;  1R0A B;  1AUD A;  2HQG A;  3C19 A;  4P2M A;  1DTQ B;  1DLO A;  1F1B B;  3SMZ A;  3AXM A;  2B6A B;  2V0N A;  1S6U A;  4X4O A;  4MYT A;  3CE8 A;  4DSE A;  5H9E J;  1MSW D;  3QRR A;  1EET B;  1SVD A;  4PUO B;  4RNH A;  2RQ4 A;  3R5C A;  3MUT P;  3W9J A;  3UO0 A;  2C42 A;  4K2J A;  2WRM A;  1VQ8 S;  2HLT A;  3EUN A;  5HN0 A;  3JSB A;  1UVK A;  2ZD1 B;  1RAB B;  3GB0 A;  4JYA J;  3OFH A;  2C1E B;  2FHJ D;  3GJS B;  1Z2L A;  2XMU A;  3O1L A;  3HFK A;  4HAC A;  1FKO A;  1JQG A;  4I68 A;  4DFM A;  1LQ9 A;  2JVM A;  3L7O A;  4GRS A;  4Y0F A;  4DR1 J;  4C8N A;  1XR7 A;  2FLO A;  1GAO A;  3LPY A;  2FC8 A;  1RWW B;  4NRT A;  3BGR A;  4N5S A;  3KK3 B;  4O4G B;  1VRU B;  2KL8 A;  2KG0 A;  5KFM A;  3M30 A;  3NY0 A;  1YSJ A;  2H54 B;  3LP2 A;  5T7L A;  4K4Y A;  2M4M A;  5CYM B;  3PJ9 A;  3MPD A;  4RW9 A;  1OQ6 A;  3LP1 B;  1HD0 A;  4UW2 A;  4ED4 A;  2XY5 A;  5C5J A;  2EWH A;  1FWK A;  1RBA A;  1ZTW A;  4HKQ A;  5H1S V;  3NNA A;  3CCQ S;  1AA1 B;  3TEH B;  1OS5 A;  4GMK A;  3T9N A;  3DU5 A;  3EPI A;  2IMW P;  1L3K A;  5MAO A;  3HSG A;  3I0R A;  4WYL A;  2V8P A;  2MJU A;  4LF1 A;  2ZEJ A;  4CWB A;  3PW7 A;  4HTI A;  2FJE B;  3ZZT A;  2ZH2 A;  3PYE A;  4DSK A;  2WVF A;  3OHB A;  3HHL A;  1X4F A;  1TKT B;  3BBB A;  3F73 A;  1NBE B;  2AIR B;  4KGX B;  1S97 A;  1LK7 A;  2HGN A;  4KIA A;  3RRG A;  3W9H A;  3D28 A;  3O5T B;  2G9O A;  2GJF A;  3JAM Y;  2BAB A;  3AAW B;  1T03 A;  1VQ5 S;  5ETV A;  1S6O A;  4C0H A;  2ZZM A;  4UT4 A;  2V4R A;  4ICL A;  1SJR A;  4O3N A;  4LSZ B;  5GMK a;  3OHA A;  4MKA A;  1H7X A;  5DDQ C;  3VR1 A;  2XYG B;  3MCO A;  4NPO A;  2DNH A;  2VBZ A;  2F63 A;  5JVG Q;  4O3Q A;  2K1R B;  2VFR A;  4KHR A;  5IT4 A;  3CCV S;  4DV7 F;  3BGO P;  3IM9 A;  4FXD A;  1OSC A;  3IN5 A;  4RW7 A;  2D41 A;  4ZLN A;  2P9G A;  3CJ5 A;  4CO2 A;  1HBN B;  3BO4 A;  3M4X A;  4RLE A;  1KKH A;  1FEH A;  5E33 A;  5DDP C;  3WC0 A;  3QFH A;  2DD8 S;  1NM2 A;  2DNL A;  3CW2 C;  2IA0 A;  1HWL A;  1SC4 B;  3TUI C;  1JJC B;  1YHQ S;  1XNR F;  4DV5 J;  4OV6 A;  3NBP A;  1QAJ A;  5KG6 A;  2HGL A;  6FD1 A;  3H5Y A;  3J81 Y;  4KH0 B;  2FHO B;  1O8B A;  4DS4 A;  1NZ8 A;  1IBM F;  4ZLJ A;  3P6Y C;  2NS1 B;  3ISN D;  1H38 A;  3Q22 A;  1ZZN A;  4BC9 A;  1J27 A;  3DLH A;  1SXL A;  2LYV A;  3GJQ B;  3UD3 P;  3OR1 B;  3AB4 B;  1VQ9 S;  2OHD A;  3M32 B;  4BWJ A;  2K06 A;  2JEG A;  4LJM A;  4A8O A;  2LA6 A;  4A8W A;  2W2P P;  3SCL E;  1S48 A;  3MZI A;  2HBY B;  3ZO7 A;  4DJB A;  1KON A;  1U1M A;  4NCA A;  1N6Q A;  2FZK B;  4DUY J;  3LF0 A;  2Y1J A;  2IHR 1;  3W60 A;  4PG5 A;  4NLW A;  3PHE A;  3WIV A;  1QVG R;  3MM7 A;  1A0O B;  3TJ8 A;  3TQE A;  2XZT B;  2Q1L A;  2M5Y A;  5B0B A;  3BRE A;  1LW2 B;  2MTL A;  4IO9 Q;  4AL6 A;  3IGV A;  3W61 A;  1UET A;  2CZ4 A;  2ASL A;  3VAH A;  4C8Y A;  4NA3 A;  2XQC A;  5KAK A;  2NXE A;  3JTO A;  2LQB A;  4OLO A;  2HS3 A;  3QWU A;  3RBX A;  3LGM A;  3SYZ A;  4H4O A;  2FIU A;  5E5N A;  3AQO A;  5KFQ A;  1OIA A;  1VLY A;  4G1P A;  5HK4 A;  2IJF A;  1RUS A;  4Q0B A;  4KSE B;  2C2O B;  3ONQ A;  2R2R A;  1AZS B;  2CPH A;  4OI2 A;  1ICE B;  2CPJ A;  4DCP B;  1DAX A;  2DNK A;  1S0V A;  3EGZ A;  2B4U A;  3HPO A;  3NEK A;  2DK2 A;  2Q3P A;  2CWX A;  3ILO A;  2VF3 A;  3KOA A;  2HUR A;  1KD1 T;  1FTC A;  4B9T A;  2YBV A;  5DJB A;  5A8K B;  4N56 A;  3KUE A;  2W9B A;  5KFS A;  3UCZ P;  1H2U X;  3M8R A;  1X5S A;  3NGT A;  3NS5 A;  4EI2 A;  1V6H A;  4X66 J;  1Q81 T;  3LWM A;  2CRL A;  4DR5 J;  3GYX B;  1K0T A;  4X4Q A;  4AYB D;  2XMK A;  3DLL Q;  1QDU B;  5EN1 A;  2A18 A;  4KKO A;  2W9C B;  3A13 A;  1TKX A;  5B0G A;  2X7I A;  1LXJ A;  2WB1 D;  2YPY A;  2P6T A;  3GU0 A;  2VL1 A;  2OFG X;  1JLC A;  2B8Q A;  2RU3 A;  2RIJ A;  5DQG A;  4LFA F;  3EVM A;  1RHQ B;  3OTE A;  7FDR A;  2VFT A;  1JJ4 A;  3TUP A;  1RKJ A;  1KN6 A;  4UY8 5;  4AT1 B;  2M7S A;  3MPV A;  2XLK A;  1S6P B;  1X60 A;  2V34 A;  3BJY A;  3R97 A;  3TW0 A;  1NHV A;  2G1D A;  2VG7 A;  2XO7 A;  3THT A;  2DT9 A;  3BR8 A;  4DL7 A;  3CED A;  2N7Y A;  2CPE A;  2NZC A;  1QAY A;  4DR4 F;  4DCO B;  1RTI B;  1TEL A;  3MM5 B;  2XLJ A;  3K57 A;  4DPT A;  4IG3 B;  3CCL S;  4NE9 C;  4EMD A;  3W63 A;  5AXM A;  2AJ1 A;  1YI2 S;  2XGQ A;  2A1B A;  5C24 A;  1RGV A;  1YJU A;  3T5J A;  2P2C B;  2WW4 A;  5BYR A;  1XQI A;  1RT7 A;  1FX2 A;  2PT0 A;  4J9Q A;  1RT3 A;  1Z2Z A;  1IWA A;  1M5O C;  5FDL B;  3V6D A;  3UFC X;  4DQP A;  3QRP A;  2AEM A;  5IM0 A;  1QSL A;  3ENV A;  3MGJ A;  3PX0 A;  2O5D A;  3M8S A;  2LP4 A;  4DG1 B;  2Y9H A;  1E6Y A;  4LBI A;  4DL5 A;  5LM7 E;  1MNE A;  3AJ2 A;  4CIO A;  2RJZ A;  1UVN A;  1S1U A;  1LWF A;  2FHM A;  3W8P A;  1U2C A;  3N5B A;  4L76 A;  2U2F A;  4K5S A;  5GAG U;  2HPU A;  3R2C J;  4IFY B;  4GKJ J;  1B7F A;  1JXV A;  1N33 F;  2C2N A;  1RWN B;  3GYN A;  3KDN A;  2W2M P;  4A8S A;  4IR9 A;  2E5J A;  2N3O A;  2AJF E;  1NSQ A;  5DM7 Q;  4DR7 J;  5A8W B;  2OAU A;  5MLC V;  4MIB A;  4DPX A;  4JBC A;  3FZ2 A;  3ET6 A;  3KUH A;  1JXL A;  2VG6 A;  4WBF A;  3F56 A;  2XLI A;  2RS8 A;  3OL9 A;  2AD9 A;  1VK8 A;  1FD8 A;  1U2R A;  3CCR S;  5DRK A;  4RBT A;  4IH6 A;  4TKT A;  3QZ8 A;  4AQY F;  4NLT A;  3MD1 A;  1HQE A;  2FHJ A;  5F8H A;  1VJW A;  3BBC A;  2MKK A;  1SH3 A;  5C25 A;  2NYI A;  1S49 A;  4CCH A;  1BE4 A;  1SJQ A;  2IBK A;  4OV1 A;  3BQ1 A;  3D5M A;  5KG3 A;  3TAM A;  2KFY A;  3CIM A;  3MUM P;  3MAQ A;  4IDK B;  4WZQ A;  4CI0 B;  2JFK A;  1IKY B;  2QYG A;  1F5C A;  3ZZZ A;  1CJK B;  5HMZ A;  1S4E A;  2CFX A;  1VK3 A;  1IM6 A;  4KO0 B;  2BOP A;  4BCA A;  1VRT A;  3GIR A;  3FCV A;  1GFW B;  5J2M B;  5LJ3 Y;  1QM9 A;  1WKK A;  4URG A;  4WKR A;  3IWX A;  1Q16 B;  3NGS A;  4YB6 A;  3DOM B;  2VQF F;  4QWE A;  1FI4 A;  2IJN A;  1MW7 A;  2ZNY A;  2MYF A;  3W3S A;  4ZVR B;  3TP2 A;  1SJ3 P;  1UPP A;  1IBK F;  3JYT B;  3FK4 A;  4OHW A;  3CJQ A;  2P9C A;  3LGN A;  2KG1 A;  2ZH4 A;  2VJV A;  4WWS A;  5K14 B;  5SUH A;  1VHI A;  4DN0 A;  3BEG B;  4A8Q A;  3R9L A;  2IYI A;  2KZM A;  2FPH X;  1NK4 A;  5K9F A;  2EBG A;  5CYQ B;  5AXL A;  1B70 B;  3CJK B;  4U95 A;  3M8Q B;  4L6V 3;  4ECU A;  1S76 D;  2ZH5 A;  5KFA A;  4L74 A;  4ZPA A;  3PFE A;  3RBZ A;  3O44 A;  1RWK B;  4P74 A;  1PO6 A;  1IKX B;  2YNF A;  3TRG A;  3DRR A;  1LW0 B;  2HHQ A;  2DXF A;  5D8H B;  4DL6 A;  4LF8 J;  2CVI A;  3NGU A;  4C3M A;  2A0F B;  1GEH A;  4DI6 A;  3DLK B;  2G2Y A;  5A8R B;  5H9E K;  4ZHR B;  4DV6 F;  1CPZ A;  1L3U A;  4JV0 A;  4WU2 A;  2DNR A;  1DLO B;  4TNO A;  1M5K C;  2UUB F;  1DTT A;  4DLG A;  3KDO A;  2AGQ A;  3JS9 A;  5LXY A;  4OHY A;  1CBK A;  3VAI A;  2A2D A;  3PY8 A;  2AMC B;  4QOT A;  1A6L A;  1HHS A;  3QSI A;  3ZZO A;  2BKN A;  3MMA A;  4ID5 B;  2BYC A;  3QAT A;  3KHL A;  3BB5 A;  3O3L A;  4NYO A;  1B0V A;  3EIC A;  1XMQ J;  3EVW A;  1JNZ B;  3Q0A A;  4DN9 A;  1TZ0 A;  5DO2 A;  2Y3Y A;  3OV7 A;  2MZQ A;  4HEA 9;  3KFW X;  1Q0N A;  1FXR A;  1M1K T;  2VBY A;  1S0O A;  2D9O A;  1FKO B;  2D3O R;  3G71 S;  4FVM A;  2Z4P A;  2LDI A;  4LF5 F;  3CO0 P;  2KXN B;  3NMR A;  4Y2K A;  3TA1 A;  4P72 A;  2B8P A;  1IBC B;  2MQM A;  1NK6 A;  4JI6 F;  2MQL A;  3DGP A;  4AFF A;  2HQC A;  1RTD A;  3VAK A;  2V2V A;  1L3V A;  2HWI A;  4CP5 A;  3BGR B;  2GJI A;  2AP6 A;  3I82 A;  1FEE A;  4ES1 A;  1ZAW A;  3V4I A;  2UUW A;  3ETO A;  2VHG A;  4DQQ A;  5A2Q Y;  3VGV A;  3BSA A;  3BR9 A;  2HRT A;  3DOK B;  1UFK A;  5T7L B;  1U1L A;  3AKO B;  2A3J A;  2EI5 A;  3H8Y A;  1U6B A;  4RW9 B;  2ZOM A;  1X9S A;  1FJC A;  3QT8 A;  5KT2 A;  4OFZ A;  4C2M A;  3QJL A;  1HBO A;  3HHL C;  2ASY A;  3Q86 A;  3I0R B;  5CQG A;  2OSR A;  3MAA A;  1C4C A;  2EG2 A;  2BM0 A;  2A2C A;  2GGP B;  3FGV A;  2UVV A;  2BA9 A;  3HHL B;  7FD1 A;  2AGP A;  1UPM B;  2B9W A;  5CD4 A;  1Y4Z B;  4HDG A;  2ZH8 A;  3FSX A;  2DNQ A;  4J9P A;  3DHX A;  2DR7 A;  1FE4 A;  1U47 A;  4FZV A;  2JOQ A;  1YLX A;  3AA9 A;  4GC6 A;  3QO9 A;  2BKP A;  4JI4 F;  1J2V A;  4DWI A;  4DDF A;  4J90 A;  4KRW A;  2DR8 A;  1T03 B;  4TVA B;  4LMZ A;  2R7R A;  3QAU A;  4JI8 J;  1RKI A;  4J80 A;  2MKY A;  3CIZ A;  1V3R A;  4LRD A;  4ICL B;  2DH7 A;  2FY1 A;  4ZIT A;  4UZC A;  5F0W A;  2O67 A;  5G0R A;  3LO3 A;  4KE5 A;  4RKU C;  3E8O A;  2CPZ A;  3IWN C;  1VMB A;  2OPP B;  3UCG A;  3MOJ B;  3W1Y C;  3SBM A;  1NUE A;  3CDB A;  3HI9 A;  4RW7 B;  4YR0 A;  5ETN A;  2EKY A;  2GVD A;  2I9S A;  1IR0 A;  4Y6I A;  2DHH A;  4ED3 A;  4P75 A;  3UPF A;  2YNH A;  1FNX H;  3SFU A;  4F4A A;  2UXC J;  4KC5 A;  4X4V A;  4DFP A;  1P27 B;  4K0K F;  2GVZ A;  3B8H A;  4XAK A;  2LU1 A;  5RUB A;  4OIX A;  1OPI A;  3KNG A;  3NBP B;  4OZ5 A;  2UU9 F;  3CT9 A;  3LP0 A;  4EBD A;  5L8R C;  5GAE I;  4L3K A;  3ETM A;  1TK0 A;  6FDR A;  4F36 A;  3K5L A;  1K0V A;  4ED8 A;  5JMN A;  2BJE A;  1RYR A;  3A8J A;  4V19 J;  4ECY A;  2LQJ A;  2E7X A;  1QTN B;  4B3T J;  2B9X A;  3D0I E;  1SIZ A;  1B0T A;  2XSF A;  3R5D A;  4ZN3 A;  4HT5 A;  4CNY A;  4J9N A;  5K8M A;  2CDQ A;  5JJB A;  1R8H A;  4TLR A;  4ELU A;  3NG8 A;  4ZN1 A;  1TFW A;  4CLF A;  2W7P A;  2ADB A;  3KJF B;  3X3U A;  1WC5 A;  4UOC A;  1RWX B;  3D9B A;  3PRB A;  4IOC Q;  1N52 B;  2E1P A;  3LAN A;  2V68 A;  1JWW A;  3D67 A;  3MM7 B;  4F4Y A;  3ZTQ A;  3DYA A;  2BQ3 A;  3QNW B;  4Y34 A;  1FWL A;  2EC2 A;  4KAI A;  3SSS A;  2XGP A;  1DRZ A;  5K8P A;  3OTD A;  2Z0G A;  4PXE A;  1QLN A;  1HW9 A;  4DUT A;  2GAG C;  1GNK A;  3CJ3 A;  1Q8B A;  1NU4 A;  1LEO A;  3OR2 A;  3KLH B;  3I6P A;  4JI1 J;  4ZPB A;  3HX9 A;  2KXH A;  2EG1 A;  5KT4 A;  4DR2 F;  4P2X A;  3EMT A;  1FFG B;  2BAN A;  1IQZ A;  3RB6 A;  2XI2 A;  4O3P A;  2V9W A;  2GQQ A;  4OJ3 A;  2NR0 A;  4HLB A;  4OL8 A;  2E9T A;  3CCE S;  3UCU P;  2ZH3 A;  3PM9 A;  3K5O A;  2QFI A;  5FD1 A;  1U6Z A;  3WBZ A;  2W2N P;  2HNZ A;  1ZAX A;  3CD6 S;  4DV2 F;  2K3K A;  3U1N A;  1WEY A;  1NSA A;  2E29 A;  3IS9 A;  3SQG B;  3N79 A;  5JVH Q;  4ED0 A;  1PIL A;  3EDR B;  2XMJ A;  4J9S A;  5IT0 A;  2I38 A;  5L1J A;  2DPJ A;  2RKI A;  4NWB A;  1NSK L;  3TI0 A;  3PW4 A;  1SKU B;  1HIY A;  1HL6 A;  1K73 T;  1TKX B;  2W7A A;  2ZC3 A;  4O3S A;  4ERD A;  5LXR A;  1RCO B;  3QGG A;  4DPW A;  3MPU B;  3NL0 A;  2NXN A;  1XR5 A;  1JLC B;  2Y0B B;  4A47 A;  3I0S A;  1GK8 A;  1MN7 A;  4E98 A;  2DGU A;  3Q8U A;  3T1Y J;  2RF2 A;  2AEJ A;  1ZPW X;  3MEG A;  1RAJ A;  3J7Y U;  4X4R A;  2JEF A;  2E1A A;  2ILY A;  2V6A A;  1U1O A;  2VG7 B;  1U49 A;  4QIG A;  1TL1 A;  3OLA A;  3S1T A;  1T05 A;  3MM9 A;  4N41 A;  2XMA A;  4EU0 A;  3CJ8 A;  4ZCI A;  4NA2 A;  3ZTO A;  2BE2 A;  1ROF A;  5CZX A;  1RAG B;  2FVC A;  4KHP J;  4D3G A;  3FMB A;  3LH2 S;  5CD4 H;  5DGA A;  3BGL A;  2YKA A;  4L73 A;  3PKM A;  2FHK A;  4I2P A;  5AJ3 F;  5C24 B;  1EX8 A;  1WTB A;  3AH6 A;  4F4Z A;  4M5K A;  4W4M A;  3UDL A;  4RU2 A;  3M6U A;  1H74 A;  1LXN A;  1NZA A;  3RW6 A;  3OXG A;  3W8G A;  3OFF A;  3HSZ A;  4LF7 F;  2DR9 A;  2JZ5 A;  1RI7 A;  1NJI T;  2I8E A;  4QIW D;  2ZHO A;  5IM0 B;  3FCH A;  3EGN A;  3W5Z A;  1U2F A;  2Y1I A;  2YPZ A;  3B78 A;  3MEE A;  1E6Y B;  3QPI A;  1Q53 A;  4FF1 A;  4QIV A;  3I56 S;  4RW6 A;  2HIY A;  5DG9 A;  4K8R A;  3OTC A;  1APS A;  3F44 A;  1R6Y A;  2M3D A;  1Q78 A;  1FRM A;  2IM1 A;  1S1U B;  1LWF B;  3BQ2 A;  2MKH A;  4TY8 A;  1X4A A;  4Y2A A;  2C2M B;  2XZD B;  3WQP A;  1VR6 A;  4WTO B;  3Q83 A;  2CXE A;  1P9Q C;  4OX7 A;  1NLK L;  2V5H G;  3K5M A;  3KK2 B;  4IG0 A;  3CME S;  3FEY B;  2J0X A;  3ET6 B;  4LFB F;  2IBO A;  1UAW A;  2VG6 B;  3T5K A;  1WHV A;  2DIT A;  1JJ2 R;  4I6W A;  5B0A A;  2V8H A;  1IQT A;  3QQC D;  1HBU A;  5A6W A;  1DY3 A;  1S9G A;  5AE1 A;  1HQE B;  4IH7 A;  2G1H A;  1UZD A;  3JSY A;  3FDS A;  1C1C A;  4OZ0 A;  4OI0 A;  1UJ5 A;  1K1S A;  4YEA A;  2CPD A;  3NNC A;  3TAM B;  3DCA A;  5F8L A;  4ZVF A;  1Y7P A;  4CNZ A;  3KTQ A;  2HGM A;  2KXF A;  4U6P A;  4P73 A;  1T95 A;  2XS5 A;  2IJR A;  1TAU A;  4XIU A;  3AGY A;  2M52 A;  3T5L A;  1NHU A;  1WEX A;  1NRK A;  5DET A;  2RE1 A;  3F41 A;  2B26 A;  4P2F A;  2UVR A;  4RWX A;  4O3O A;  5I3Q A;  3IGN A;  1IKV A;  2OP5 A;  2CAD A;  1HBM B;  2YNG A;  1YJT A;  2R7X A;  1FNO A;  2N4C A;  3GV8 B;  2ALY B;  9ATC B;  4ZK7 M;  2R7O A;  2E5G A;  4ED5 A;  3I4H X;  2L48 A;  2HND B;  4A8Y A;  2OEK A;  2EXU A;  1Q7L B;  2FZC B;  3GJR B;  1ELO A;  2NXU A;  1RAO A;  2X51 A;  3OVA A;  4CLP A;  4DOZ A;  1KNZ A;  3KLG A;  2NLW A;  3ITH A;  2LQ9 A;  1Y9O A;  3OSN A;  4MK7 A;  4GKK F;  4B08 A;  1Q1K A;  3MWB A;  4FXV A;  4YP3 A;  3KG0 A;  4X84 A;  5HO4 A;  3D68 A;  3BZQ A;  2B43 A;  3D0H E;  2LXF A;  1IBM J;  1N32 F;  2JX2 A;  4WII A;  4PXC A;  1WC4 A;  2CZV C;  2NPI A;  2QX0 A;  4B3S J;  4YDX A;  1KQF B;  4NA1 A;  4NLD A;  2J5A A;  4PAA A;  2V4J B;  2IY5 B;  2U1A A;  2ZE2 A;  3I5B A;  1J5O B;  2KU7 A;  3FFI A;  1KC8 T;  2GHP A;  2YNF B;  2CQB A;  2DGS A;  3NS6 A;  3DRR B;  4I2Q B;  1BWV A;  3FBB A;  1GXT A;  2N4D A;  5KFV A;  5EX0 A;  2OGU A;  1OY8 A;  2W1B A;  3GIJ A;  2L9W A;  1Y5I B;  3EPG A;  3HT3 A;  1TK5 A;  2RHS B;  3KMS A;  1UJ4 A;  2OD6 A;  3CPW R;  2JVO A;  1PGZ A;  1LWC B;  2QMW A;  4NZ0 A;  4U9R A;  2L9N A;  2DH8 A;  4RJV A;  3B82 A;  2FLN A;  3T6B A;  3BF4 A;  4MK8 A;  4CO5 A;  2ZBR A;  5D4P A;  3L09 A;  1BGX T;  4NI2 A;  5KFB A;  3MFI A;  1UMJ A;  4PPD A;  1G4C A;  1HMV A;  3P5T L;  1UW4 A;  3PIO Q;  4HL9 A;  4JV2 A;  3M8Y A;  3TAR A;  2NUH A;  3KG4 A;  1B99 A;  3NS7 B;  3MMA B;  2OML A;  2CJ9 A;  3ZNJ 1;  3W65 A;  1U4B A;  2ZUA A;  1O5J A;  3C6U A;  4OX9 F;  2BQU A;  3I31 A;  1AFI A;  4WJB A;  2GZO A;  2JDJ A;  2JC1 A;  2W01 A;  1S9E B;  1M5P C;  4B02 A;  2CQ0 A;  4R8U A;  3ISN C;  4DFJ A;  1RBL A;  3SCK E;  4QCL A;  2Y8W A;  1H6K X;  3AGX A;  2ZHA A;  1ULR A;  2HW3 A;  2KM8 C;  2HWH A;  4K5R A;  3DGP B;  1UVI A;  4UOF A;  1D09 B;  4LR8 A;  5IC6 B;  4HDH A;  1RTD B;  1R7I A;  2C3P A;  1PSD A;  1YBA A;  2LMI A;  4CO0 A;  1RU1 A;  2KM8 B;  3MM8 B;  3D7S B;  4KHM A;  3V4I B;  1YK9 A;  1R6V A;  1AW0 A;  3AFG A;  2HBZ B;  5HP1 A;  2FLL A;  1EHW A;  1FWP A;  2RHQ B;  3MCS A;  4J7C A;  1VQL S;  3QID A;  3EX7 B;  1NLT A;  2DIU A;  4OYB A;  5J1P A;  3MOZ A;  1Y11 A;  1I6J A;  2AWZ A;  3PNI A;  2B9Y A;  3AT1 B;  4KH1 B;  1TV6 B;  4GKJ F;  3OL6 A;  1HBO B;  2BAC A;  1Y5L B;  3Q8Y A;  3QFW A;  3MAA B;  2D1C A;  4DR7 F;  1XEZ A;  3PVX A;  1CQN A;  2XB2 D;  2HNY A;  4LFA J;  1YJW S;  3B4D A;  3W2V A;  2OPQ B;  3GR0 A;  2IDL A;  3CDA A;  4F0M A;  4FXW A;  4WFN Q;  3TQ1 A;  1FK9 A;  1IR2 A;  3UDE A;  3L4B C;  1NSP A;  4C6A A;  4FF2 A;  3FQK A;  1LWX A;  3T6J A;  2Z8Q A;  3CJT A;  4KGZ B;  5BYS A;  4XK8 C;  3MMB A;  2DCU B;  1ZS6 A;  3IG1 A;  4DR4 J;  2B7C B;  1NME B;  1YKW A;  1VQ7 S;  3CF5 Q;  1RB0 A;  3NP5 A;  4NZ7 A;  1FX4 A;  5G0R B;  2AJ2 A;  2V50 A;  4ZOS A;  3RU0 A;  2OPR A;  3LTO A;  2R2U A;  4LRB A;  5HVG A;  2UUC F;  3D3C J;  3I9V 9;  4DZD A;  3BPS P;  3TVY A;  2ASD A;  3MAH A;  2GVD B;  2ERR A;  2VBX A;  3K8V A;  3R5G A;  4WXW A;  4Q2M A;  2F40 A;  4NEY A;  2HHX A;  1HHT P;  3CDW A;  4U7U D;  3V6H A;  4WP8 A;  1JX4 A;  1ARO P;  4WK1 A;  3CC2 S;  2ZDP A;  3TR5 A;  2W2Q P;  2E5I A;  2LDY A;  4FYV B;  3PG9 A;  4Q43 A;  2GVZ B;  2WON A;  3DC2 A;  3JXO A;  1GX6 A;  4YR2 A;  1WHY A;  3LP0 B;  1D3W A;  1DJ0 A;  3H2V E;  5I42 A;  1X4E A;  1RWM B;  1XNQ F;  2FDN A;  3IBF B;  2VPZ B;  4KGM A;  2UUA F;  2HHV A;  3BH6 B;  1OPZ A;  4QIE A;  1JLQ A;  3QSY B;  1D8Y A;  4FPI A;  4KTQ A;  1B3T A;  1N5Y A;  2PSZ A;  3P49 B;  4P7V A;  1MMN A;  3IAM 9;  2XCP A;  1N33 J;  1OO0 B;  3ILI A;  4NAS A;  4ILM A;  5U47 A;  3VVU A;  4C3K A;  2F8E X;  4E2F B;  2Q79 A;  2OEJ A;  4HTJ A;  1TQL A;  1SQG A;  1JLB A;  4TU9 A;  1TP7 A;  4QPX A;  3KUG A;  1YWX A;  1JB0 C;  1F9E B;  4LF8 F;  3OUY A;  2VU5 A;  2DNY A;  4R0J A;  4LUB A;  1N5V A;  2CPI A;  4AQY J;  1EZZ B;  3LOU A;  3MUR P;  1T9U A;  1CS4 A;  2DGT A;  4N76 A;  1RK8 A;  3C14 A;  2ZC4 A;  1B4S A;  3I32 A;  1YRU A;  4HI2 A;  3DDN A;  1RTH B;  4UF4 A;  3GG0 A;  4DF4 A;  1RA6 A;  2AYM A;  5IV4 A;  2DY1 A;  2HFN A;  2DR5 A;  3KNA A;  3T1H F;  2I0X A;  4PYD A;  1SL0 A;  4F2R A;  2B56 A;  1SKW A;  1VQS A;  2HFS A;  2LU2 A;  3OTB A;  1AXQ A;  4EYI B;  3OR2 B;  3H5S A;  4CM0 A;  4RUA A;  2WBM A;  2VQF J;  1CSJ A;  2E1R A;  2BDP A;  2UP1 A;  1WEZ A;  1FRJ A;  2IPO B;  3J7A N;  2BAN B;  4JV5 F;  3FQL A;  1MML A;  4LF9 F;  2XYH B;  4MAK A;  3UE2 A;  4ZVQ B;  2BJ1 A;  1X4D A;  1IBK J;  2GAH C;  4N8O A;  1D0E A;  4USW A;  1VOM A;  3T41 A;  1BY9 A;  1M5V C;  3I4P A;  3IBC B;  4RW4 A;  3TZY A;  1HNX F;  3G6X A;  3W62 A;  2DIV A;  4ELV A;  5DQH A;  1T9X A;  3VZH A;  2ZM6 F;  2OEL A;  3M1V A;  3KJQ B;  3IS9 B;  2GO8 A;  1NJW A;  4DU8 A;  2HFO A;  1KP6 A;  2GC8 A;  5B7W A;  3NAI A;  5HVH A;  2ZZN A;  4BWM A;  2FLP A;  2XNR A;  2V94 A;  4BDP A;  3AXK A;  5I3U A;  3TJ9 A;  4B3O A;  3L7U A;  4EGL A;  4HH1 A;  2WZ1 A;  3MCN A;  3VGS A;  5F9L A;  1VQ6 S;  2RF2 B;  3UVJ A;  4DV6 J;  1UWB A;  3MEG B;  3DLG A;  4JI2 F;  3CNQ P;  3HZG A;  2UUB J;  1HNI B;  4QWA A;  3N6M A;  5D77 A;  3MPY A;  2XEX A;  1T05 B;  1N5T A;  1S6Q A;  5CAA A;  1SPB P;  3PHT A;  2VPY B;  2E44 A;  4R5P A;  3KK1 B;  3RBE A;  2W2O P;  3KJN B;  3VQT A;  2JC0 A;  1DHM A;  3T3F A;  1WHW A;  3T9Z A;  4J9K A;  1G6B A;  4I69 A;  5LMN J;  3IRX B;  1S1X A;  5E3Q A;  5GAD U;  2CAJ A;  4NLS A;  1RT2 B;  2V9K A;  3PW0 A;  4DSJ A;  3RBD A;  3V81 A;  2OFH X;  3OL8 A;  1IR1 A;  2RUS A;  3RYL A;  4GVB A;  1D9F A;  1HNZ J;  2QRR A;  4LF5 J;  3BKU A;  1KQK A;  1CG2 A;  2CQI A;  4FP9 A;  3DLB A;  3OQ2 A;  3DRX A;  4QW8 A;  4TQS A;  3ULH A;  3IA0 A;  3CWJ A;  2NRE A;  2UXC F;  3WZ0 A;  3DNC A;  4WYW A;  4DV3 F;  1BMQ B;  1F9H A;  4Y65 A;  2ZNZ A;  2MHE A;  3P96 A;  4RW6 B;  3W2W A;  2PI4 A;  2XWY A;  1TUG B;  2PN6 A;  1RZM A;  2XY7 A;  3H2U B;  4DV0 F;  4FYD A;  2J6U A;  5DDO C;  2ZH6 A;  1SBR A;  1LV5 A;  2DHG A;  2KKH A;  3BDP A;  4KR0 B;  3LWL A;  5B0C A;  2QT7 A;  3M2R B;  4P2S A;  4ZP8 A;  2JLF A;  2VQE F;  2HVD A;  3IRW P;  8AT1 B;  4CO3 A;  1KTV A;  2KYZ A;  4LRF A;  1OMS A;  3DI6 B;  1GXL A;  1BUX A;  1FRK A;  3CDE A;  2CPF A;  4F0H A;  1HBU B;  1MU2 A;  2HVZ A;  3GR1 A;  2BRL A;  1S9G B;  1MWQ A;  2Y0S D;  1H7W A;  1TK8 A;  5A0Y A;  1VQ4 S;  3DLE B;  3H59 A;  2JRR A;  3VZI A;  4OX8 A;  3Q8P B;  1C1C B;  2AGO A;  4YB5 A;  2RRB A;  1KBR A;  1OSD A;  1SV5 A;  2RS2 A;  3AA8 A;  1UP1 A;  1WI6 A;  2GFF A;  4WP9 A;  4QJV A;  2PMZ D;  2RRN A;  5HAO A;  3T5H A;  2HMI A;  3M8P A;  2XCA A;  3IMQ J;  2ROE A;  2DHX A;  1U1P A;  1S7I A;  1G2E A;  1CJU A;  3KLE A;  3A8E A;  1D9D A;  3EE3 A;  4ZJO A;  1O6X A;  5H9F J;  4NLP A;  4CYU A;  4NMX A;  2WW8 A;  2H3E B;  1KSP A;  1CJT A;  2YNG B;  4USU A;  2ACY A;  4K4S A;  2HSE B;  1WDT A;  5A6P A;  1FVS A;  3JTP A;  4WFA Q;  1J5E J;  3PR5 B;  2RDD A;  3BQ0 A;  2FJX A;  2C2D A;  3IR7 B;  4NXM J;  1TL7 A;  3NGR A;  2MKS A;  4AL5 A;  4K0K J;  3CUL A;  5FLX U;  3KLG B;  3ITH B;  2UU9 J;  1JLG A;  3QT5 A;  4P6Q A;  5LL6 d;  3UR0 A;  4ED7 A;  3NCR A;  1S57 A;  5DDR C;  4ZVH A;  1P6T A;  2QA4 S;  4NX9 A;  3FC9 A;  4LRC A;  4J9R A;  1R0B G;  1UL3 A;  3E2E A;  2YNI A;  1XTZ A;  2R2T A;  2G0C A;  2FVP A;  4PQU A;  4C4W A;  3FFI B;  2JHE A;  4G3I A;  3SV3 A;  4C8Z A;  2OLW A;  1WDD A;  4LSL A;  1NAQ A;  1EQM A;  2PA8 D;  7AT1 B;  4HHH A;  2YX1 A;  4HT7 A;  2JRS A;  5D3G A;  4M95 A;  2F8M A;  5KFP A;  4LSN A;  2Z30 B;  1YRX A;  1S5Z A;  2B4P A;  2H4W B;  3WHI A;  5AE2 A;  3OVS A;  3BYP A;  4IQX A;  2RB7 A;  4DX8 H;  4A8M P;  1D8Z A;  5KFX A;  2GIR A;  1NK0 A;  2E1M C;  4NI2 B;  4JI3 F;  2XG8 A;  5F9N A;  3KLF A;  1HMV B;  3SSQ A;  2DHA A;  3SDE B;  1YJV A;  2KRR A;  1N0V C;  1FFW B;  1NK9 A;  4TN2 A;  3DOL B;  4J9O A;  2BR0 A;  3BYR A;  4OZN A;  2HK3 A;  4V1A k;  4A4J A;  3GII A;  4KT0 C;  1U6F A;  3TAP A;  1XK8 A;  3AY0 A;  3C6U B;  1QJH A;  3BDE A;  2H5E A;  4H4K A;  1RAA B;  5DM6 Q;  4KHP F;  2HIQ A;  4U96 A;  1Z1Z A;  4R8U B;  4RUC A;  3PJW A;  2EFN A;  1IKW B;  3Q24 A;  2DGQ A;  1VJQ A;  2PFD A;  1T9V A;  4DF8 A;  4ZLL A;  4EZ6 A;  2WSE C;  3FUY A;  1NDC A;  4DR2 J;  1I3O B;  3C66 A;  5KG0 A;  2N7C A;  5GAG I;  4USV A;  2QLD A;  1KWM A;  2PMH A;  4ETZ A;  5C42 A;  1HA1 A;  1Q7Y T;  3OFG A;  3EM1 A;  1H2V Z;  1FKP A;  2AW0 A;  3DXS X;  4DR3 J;  1S1V A;  2K2P A;  5HP1 B;  1OYD A;  4DV2 J;  1EKS A;  1C1B A;  5KFE A;  1N36 F;  5AE3 A;  4ED2 A;  2Z2Y B;  5E0O A;  4OHX A;  1C0T A;  2UXB J;  5DLF A;  2HEK A;  2E5H A;  2R7Q A;  4I64 A;  5C2G A;  1YZ6 A;  3GE9 A;  3BV8 A;  1NJZ A;  2PC6 A;  1HAR A;  3A8K A;  4YHH J;  2VV5 A;  2XY6 A;  4QU6 A;  1UTA A;  2QLJ B;  4B9V A;  4PG7 A;  2HNY B;  1M5H A;  1RDR A;  4B9N A;  1QVF R;  2DNG A;  2E5L F;  4O44 A;  3W2V B;  3CGI A;  4E8U A;  1NDK A;  5CHC B;  5DGB A;  1NJY A;  1CC8 A;  4HI1 A;  2ZH9 A;  1FDD A;  3B54 A;  1FK9 B;  2G2O A;  2PO4 A;  1NKE A;  1FXD A;  4IOB A;  5L9N A;  1ZZF A;  3G86 A;  5HBM B;  4IKA A;  4PXB A;  5LT5 A;  5J2Q A;  3HJF A;  1EET A;  3MMB B;  2HBR B;  4N8N A;  3LZ8 A;  2J8S A;  2YKM B;  2FJB B;  1Q5Y A;  4LF4 F;  1UZH A;  1ZA2 B;  2DRB A;  5AJ3 J;  2OPR B;  2LFV A;  3VQS A;  5KTQ A;  1T3N A;  3MF5 A;  3Q8V A;  2WB4 A;  2R2S A;  5CH7 B;  1S77 D;  4IRK A;  2BRK A;  2KH9 A;  2VDI A;  3HFV A;  2DY9 A;  3N6N A;  5CCL A;  4F4K A;  3NOG A;  2YWW A;  1XMO J;  4N77 A;  4LF7 J;  1GH8 A;  2YWF A;  3CJR A;  2VON A;  2FJW A;  4KBI A;  1QE1 A;  2H51 B;  2WON B;  4ECZ A;  1Y00 A;  5I42 B;  2Q6C A;  4ZPV R;  1JLQ B;  4K7Q A;  5CYM A;  2OH2 A;  3CO9 A;  2FGC A;  2QMX A;  2ZH1 A;  1NK8 A;  3TVZ A;  1N5Y B;  1C4A A;  4AXI A;  4B3S F;  2GCF A;  3AOB A;  1SQF A;  1S10 A;  1YDL A;  4K4X A;  1A9N B;  2XSJ A;  4Z7C A;  2CJB A;  1GXU A;  1VIO A;  3MPW A;  4GO5 X;  5HMW A;  4NEZ A;  3U7J A;  4DL4 A;  4AL7 A;  4ZVG A;  3BGU A;  3I5A A;  4C0B A;  4LFB J;  1JLB B;  3CMQ A;  2ZVS A;  2ASJ A;  1X9M A;  5HMY A;  1AB8 A;  3KLV A;  4USH A;  3FJ2 A;  4LR9 A;  1ZYQ A;  3FBF A;  2WCX A;  1UA0 A;  1IJE B;  4WU3 A;  2LLZ A;  4M94 A;  4PWU A;  1CS4 B;  2V8V A;  3U1M A;  4MKY A;  3OJU A;  4DPY A;  2RAQ A;  3C14 B;  4ER8 A;  1WOS A;  4NLG A;  5DG8 A;  1S72 S;  1ZBT A;  1N5Q A;  2QSW A;  2WSC C;  2B5J A;  3MEK A;  1HPZ A;  4IUF A;  4MFB A;  3PRD A;  3SZ2 A;  3POT B;  1HKA A;  2DIS A;  2K1R A;  3TA0 A;  2ZUG A;  5D6G A;  3AB2 B;  1DAR A;  2I5J A;  2IC3 A;  2R3V A;  2VOP A;  2HWT A;  3FCW A;  3PEH A;  2B4O A;  1WOO A;  1FFS B;  1HBN A;  1N48 A;  4JI0 F;  2NXJ A;  3P3D A;  3HO1 A;  5F3T A;  1U1R A;  4CH1 A;  2YQ1 A;  1GTH A;  2GNK A;  1SJ4 P;  4CLS A;  1HW8 A;  1BD6 A;  2YWG A;  5EDW A;  2HVE A;  1N0U A;  1P1T A;  4DZ6 A;  4ZIV A;  4GKK J;  4RW4 B;  3UDV A;  2KT3 A;  4OYZ A;  1FRL A;  3O2I A;  4YR3 A;  1UCN A;  1N32 J;  5B09 A;  3M1V B;  3W66 A;  5EWE A;  4DPO A;  4OZL A;  2EFG A;  4F3M A;  3EGV A;  3NWG A;  4M1K A;  2X1A A;  1WHX A;  1MRO B;  4JB8 B;  1KVK A;  4PAB A;  2E9Z A;  3ISZ A;  1YJR A;  2C2Z B;  4DUZ J;  2UXD F;  1IJF B;  4FVC A;  5I3U B;  2C3O A;  3M32 A;  4AE5 A;  4B3O B;  2ATC B;  2NCK L;  4YUD A;  3AD9 C;  1RWV B;  3JSM B;  5L1L A;  1ZPV A;  3LQV A;  3PYF A;  1HNW J;  3CC7 S;  3RUB L;  3TX8 A;  1U0H A;  2FGO A;  3UVJ B;  4IR1 A;  1W2B R;  3HM9 A;  1PCA A;  2C2R A;  3C5X C;  3R7S B;  2J8A A;  3DKD A;  3DLG B;  4KV8 A;  2MGZ A;  4GVL A;  5KT5 A;  5C2C A;  3HJV A;  4JV1 A;  1IBL F;  2BKO A;  1S6Q B;  3L95 X;  5HAN A;  3HDS A;  2A6M A;  4R5P B;  3R3T A;  3OJS A;  1NKB A;  5K20 B;  3IBW A;  1TL4 A;  1LW2 A;  1WC6 A;  2IM2 A;  8ATC B;  3HD2 A;  1S1X B;  1V3S A;  4OX9 J;  1HWU A;  1U8W A;  4OHV A;  2N82 B;  5HLF A;  3ICL A;  3ENA A;  5BR8 J;  4QYZ K;  2R7W A;  3H42 A;  3V81 B;  3RR8 A;  4OI6 A;  5GME A;  2IAJ A;  3FZB A;  4GVB B;  2JH3 A;  2K3I A;  2QA2 A;  1OQ3 A;  2ZBQ A;  1X0F A;  2DRA A;  2HFU A;  1UEU A;  4URS A;  3HSD A;  4L72 B;  1ACM B;  3M2U A;  4IRD A;  2LEB A;  4H4M B;  5KT6 A;  3IAS 9;  2IIH A;  2Q43 A;  4DHV A;  1X4G A;  2CQ4 A;  5HI7 A;  1W26 A;  1XC9 A;  4W92 B;  2FQQ B;  2XM3 A;  3RG6 A;  4X4P A;  1YG0 A;  4HYK A;  2BJ3 A;  3MR3 A;  4DQR A;  3DRP A;  1D1U A;  2W8K A;  2IYG A;  2VFV A;  3J7Z 5;  4RNO A;  4OJH A;  3BM7 A;  4B9L A;  2CWK A;  5KFZ A;  2WOM B;  5IT9 U;  2MEW A;  4LVO P;  3I38 A;  1CUL A;  2GX8 A;  2YH1 A;  1REV B;  2QA4 G;  4JP8 A;  4YFU A;  1RAF B;  4D3H A;  2EFV A;  2ZFH A;  2W25 A;  1OYE A;  1UVJ A;  3PCO B;  1MU2 B;  4RX6 A;  5J2N A;  2KB2 A;  4QWC A;  2AKW B;  4EYH B;  2DXD A;  5A0Y B;  3BS9 A;  1AUS L;  2BJ8 A;  1I94 J;  3EZ5 A;  2RSQ A;  2BOA A;  3M7V A;  2CA9 A;  4P52 A;  1SV5 B;  5IV3 A;  4WTY A;  2BJD A;  3I9Z A;  1WKL A;  3G82 A;  3M8P B;  3OVB A;  1FHT A;  2BXJ A;  3DRY A;  2CDR B;  4WE1 A;  4RW8 A;  1QAI A;  4DSI A;  4XTT A;  1CJU B;  3R1L A;  4MIA A;  4FBU A;  3KKF A;  1REG X;  3D3B J;  1HI8 A;  3MEC A;  3PAC A;  1NKC A;  4NRU A;  3C3L A;  1HLW A;  2OI2 A;  2UUC J;  1RA7 A;  4HH0 A;  2LVW A;  2JFD A;  1G3O A;  5J1E A;  4RUH A;  4B3R F;  4LFC J;  3UD5 A;  4ZS6 A;  1T02 A;  3I55 S;  5IOL A;  3PV8 A;  5F0U A;  2LEP A;  2HAF A;  3KYL A;  5DLG A;  2Y8Y A;  1JLE A;  4URQ U;  2MLZ A;  4YN3 B;  2EBE A;  2CQ2 A;  4DG1 A;  2F65 A;  4KY3 A;  3V4M A;  3D6M B;  3K0J A;  3HUL A;  3D2W A;  4ZVE A;  4NCB A;  4LVN P;  2RML A;  2PII A;  4PYA A;  3MTK A;  2J9C A;  5T14 A;  3C2P A;  4C11 B;  1XNQ J;  2XI3 A;  2CJA A;  2UUA J;  1HQU B;  5HQL A;  4OJG A;  4LT6 A;  2VUG A;  3AOA A;  5L39 A;  2YNI B;  4ANE A;  2IFX A;  3J7Y I;  3MTJ A;  1FF2 A;  4WXO A;  3UI3 A;  4PQU B;  4LBH A;  3BN7 A;  4MTP A;  1Q4R A;  5A8W A;  4P10 A;  1VGY A;  4QWD A;  2KO1 A;  1BQM B;  3MD3 A;  4L3N A;  1TL5 A;  3UQS A;  2NXC A;  1BXN A;  2RD5 C;  1L3S A;  2KJW A;  4LSL B;  3C16 A;  1KHV A;  3HHK A;  3UW1 A;  4M5M A;  1PAE X;  2SXL A;  2HHH F;  1UFL A;  4N47 A;  5KOW A;  3DRS B;  5D3G B;  3TA2 A;  1FES A;  1UVL A;  2F5G A;  1UA1 A;  3MFH A;  2DRD A;  1KOH A;  5GAH U;  1WC1 A;  4O0I A;  2FC9 A;  1RQ0 A;  3G8S A;  4W90 B;  3K7R A;  3KHG A;  4H4K C;  2GMH A;  2CPX A;  3FNN A;  5KFY A;  1IKY A;  2GS8 A;  1U24 A;  1CJK A;  2QN6 B;  4OYO A;  3GFY A;  1URR A;  4KO0 A;  2VOD A;  1IXK A;  1Y5N B;  2CQH A;  4ILL A;  2H65 B;  5LMN F;  3T1H J;  1VQN S;  4NCG A;  1FDN A;  1WWH A;  5K5M A;  2XC9 A;  3PYD A;  1KFS A;  5KFJ A;  2JL9 A;  2L9D A;  2ZKT A;  3EZO A;  2M70 A;  3MM6 A;  2KRB A;  4HAC B;  4X4S A;  1HNZ F;  3M05 A;  1BHN A;  2AQ4 A;  4JV5 J;  3MR2 A;  4LF9 J;  5KT7 A;  3OT9 A;  2Z57 B;  3G8Q A;  1JNR B;  5C42 B;  2MDA A;  4Q5V A;  5LSO A;  3OXL A;  1WD6 A;  5EWF A;  2R7T A;  3DDK A;  1HNX J;  1FKP B;  4RNN A;  2W4P A;  1S1V B;  3QAE A;  1FTR A;  5CAB A;  4OYI A;  3US5 A;  3M30 B;  5E3C A;  2ZM6 J;  1RT1 A;  4P9S A;  3MR6 A;  3LP2 B;  4OYA A;  4J9M A;  1R31 A;  1RBO B;  2HHU A;  3M8Q A;  4NXN J;  4X4T A;  5KFF A;  5F8J A;  2KTQ A;  2HAI A;  1DBD A;  1EP4 A;  2QV6 A;  1SQE A;  3SFG A;  1FD2 A;  2DR6 A;  1VYA A;  1GMW D;  4OYP A;  2D3U A;  5KG2 A;  1N8R T;  4QIF A;  4NLY A;  2YWE A;  2ROP A;  1T8E A;  5HSP A;  4QZV B;  1T9W A;  1S59 A;  3CD5 A;  3HVT A;  3WC2 A;  2DNP A;  3R5J B;  2CG4 A;  4MJK A;  3SIP B;  4NLX A;  4O44 B;  2UVW A;  1ZOT A;  2Q6B A;  2COL A;  3CSK A;  3QZ7 A;  3LA0 A;  3TVK A;  4JI2 J;  4X2B A;  3ZC4 A;  3CCT A;  4DX6 A;  5KFO A;  1V9O A;  1CLF A;  3N28 A;  2J0W A;  2AYE A;  5SZT A;  4TU7 A;  3N5F A;  2DEJ A;  2GV1 A;  5J2Q B;  5E3A A;  4ECR A;  2Q2G A;  3WX8 A;  5AT1 B;  2Y1L B;  5KFD A;  4ID5 A;  3GZ7 A;  3H20 A;  3LAL A;  2QFJ A;  3HKZ D;  4C0O C;  2H9Z A;  4QU7 A;  4C48 A;  3JQM A;  2HQ3 A;  5KFT A;  3NCQ A;  4IYQ A;  4F4X A;  4A48 A;  2VJU A;  2MKC A;  2FVR A;  3WX4 A;  3FSY A;  5IC4 B;  3VF0 B;  1RAC B;  4WFB Q;  1KQG B;  3LUY A;  2LEA A;  2G0I A;  3HXM A;  1TFY A;  4G1I A;  2QGF B;  3CCM S;  4IRC A;  2J7W A;  1KEK A;  4M5H A;  1J5E F;  2FVQ A;  3SCI E;  2RVJ A;  5C7P A;  2KT2 A;  3P45 B;  2W24 A;  1QE1 B;  4NXM F;  1KS2 A;  3HFZ B;  2KYX A;  4DV3 J;  4X65 F;  1TMM A;  3FBC A;  2W7O A;  1WF1 A;  1A7G E;  3K89 A;  3P5B P;  3C6T A;  1YQH A;  5DQI A;  1N88 A;  3BBF A;  3D6F B;  1SJ1 A;  2XWX A;  3DOK A;  5HL7 Q;  5M2U A;  4DV0 J;  1Y0H A;  6AT1 B;  3VAF A;  1SCJ B;  2MST A;  2XMM A;  1C2P A;  2R8H A;  2K7J A;  2XUL A;  1GMV A;  3MED A;  4C3L A;  1K9M T;  3UDC A;  2XSJ B;  2VQE J;  1FJE B;  3NNH A;  4ZCK A;  2Z2L A;  3A3O B;  2RUG A;  3RAQ A;  2OJ3 A;  3QMQ A;  2GGP A;  3PRV A;  4ZPW R;  2CG8 A;  1S12 A;  2X3D A;  4KQZ A;  3BH7 B;  2XMT A;  4J5O A;  4KFB A;  4F2S A;  2AX1 A;  1SL1 A;  1FRI A;  3ILJ A;  1YJ7 A;  4FKY A;  1F60 B;  2C28 A;  2B51 A;  4EFA C;  1N6Q B;  3BKT A;  3VAG A;  2G4B A;  2DTJ A;  4B9U A;  4M5G A;  4DLE A;  1X31 C;  4FS1 A;  2IVY A;  4GC7 A;  5I4M A;  1HNV A;  4ETX A;  2B5J B;  2LCW A;  1FT8 A;  1HPZ B;  3OSP A;  4CLU A;  4UUW A;  4MFB B;  3CCZ A;  3R27 A;  2OPP A;  3LAM A;  3DM2 A;  2I5J B;  4H4O B;  2IC3 B;  9RUB A;  3H4B A;  3Q2T C;  5HQ8 A;  4PG6 A;  3J81 j;  3O6Q A;  2MXY A;  4ILR A;  4Q0B B;  2AEF A;  2F1F A;  1N34 J;  4JOU A;  1F2G A;  4WCE Q;  2VD3 A;  2DPI A;  4J9U E;  2DYA A;  2UV8 A;  5B08 A;  2W9A A;  2R8J A;  4TLQ A;  1YTY A;  2ATL A;  2W9B B;  2AU0 A;  5FJ4 A;  1PBU A;  3QYY A;  2VA2 A;  4DR3 F;  2MJN A;  2CNO B;  5EWG A;  2YWH A;  2X1F A;  3M6V A;  4DEZ A;  4PG8 A;  1NPR A;  2L41 A;  3J80 U;  2UXB F;  2C3M A;  3GFH A;  2G0J A;  1XIQ A;  4LQ3 A;  2UZA A;  3VHQ A;  4M8L A;  2JWN A;  4KKO B;  2J6T A;  3EGW B;  2W8L A;  4K4U A;  4U7C A;  3BKF A;  4YHH F;  4K59 A;  1HWI A;  5KFU A;  2VIH A;  1U0H B;  3UN5 A;  4G1Q A;  1NND A;  4JI7 F;  2BE9 B;  2KFN A;  3ZZY A;  2WK4 A;  4KV8 B;  4ZVO B;  3R1H A;  2NZ4 A;  4LF6 J;  3DXB A;  4MIW A;  2MZS A;  2MGZ B;  2ZDO A;  3R5A A;  5KFK A;  3K5P A;  5BYQ A;  3GYG A;  1MWY A;  4CH7 A;  3GMG A;  4JI3 J;  2I1R A;  3MMJ A;  2EKN A;  1X5T A;  2BJ7 A;  2FTR A;  4TXS A;  2ZH7 A;  2BE7 D;  1XAO A;  2AYG A;  3RAM A;  3C46 A;  4F04 B;  3RB0 A;  4ECW A;  2IRU A;  1P1L A;  1FJG F;  3ZZP A;  5K8O A;  3QJJ A;  1Q8K A;  2DNO A;  3NGD A;  5LMU F;  4Q8E A;  2FYX A;  2AJ0 A;  2QLB B;  2VDH A;  5HLF B;  4KGV B;  1YVF A;  1U1Q A;  4M5D A;  2IAJ B;  1F0X A;  3ZZ0 A;  1R8C A;  2OIH A;  3KLH A;  4ANC A;  4A8K A;  2Q66 A;  2FJD B;  2FZG B;  2RQM A;  3M2U B;  3NMA A;  3ZNU A;  1RT7 B;  3M2V A;  1RT3 B;  2GIF A;  1FCA A;  4ZP9 A;  1XMO F;  5KG1 A;  3V6D B;  5F8M A;  3M8Z A;  1N4L A;  2MQO A;  1B7Y B;  2V69 A;  4WKY A;  5FLX Y;  4RL1 A;  3EVO A;  3DRP B;  2EFO A;  4J37 A;  1T94 A;  1U1N A;  4DR6 F;  1N36 J;  1CC7 A;  2JSX A;  3SQG A;  3CCS S;  3CC4 S;  3CCJ S;  2KVI A;  3A3P B;  5DZ7 A;  3HK2 A;  1RP5 A;  1RAD B;  1LFP A;  1H0H B;  4YY3 F;  2WVE A;  3HP6 A;  2LQ5 A;  2CNL B;  5ETT A;  3RAX A;  2KDO A;  4FDF A;  1CUL B;  1Q86 T;  3VCD A;  3UR3 C;  4A8F A;  4OJ1 A;  3R7N B;  2B4V A;  2G2Z A;  3A8I A;  2E5L J;  4DCJ B;  2NQP A;  3QGH A;  4JI5 F;  2YKQ A;  3OTO J;  5J2N B;  1JLF A;  3EZU A;  2IA6 A;  1NPP A;  1XMB A;  1RE1 B;  2ZOG A;  2V2Z A;  1AYE A;  1EQ0 A;  1DQ9 A;  1YJN S;  2RRA A;  1JJH A;  2JEJ A;  3IR5 B;  3TEG A;  4U8Y A;  5A76 A;  2W4C A;  5C25 B;  1T9T A;  3CTR A;  1NDL A;  3IM8 A;  2C2K B;  1TMJ A;  3EWG A;  2ZHB A;  3UNG C;  3G82 B;  2C3U A;  4ECT A;  1KHW A;  3GP9 A;  4X4U A;  4WE1 B;  4RW8 B;  2MLX A;  1S9F A;  3OPK A;  5DG7 A;  4LF4 J;  1KLM A;  3MEC B;  1SH2 A;  2R8G A;  1VRT B;  1U8S A;  4G6V B;  2FVS A;  4OMF G;  2V2K A;  4AUK A;  5J1E B;  4Y2I A;  3R7B B;  4DV4 F;  1P9Y A;  5CA5 A;  1YGY A;  1RXO B;  2ROG A;  2OTJ S;  4YB1 P;  4UQT A;  4DQS A;  3BPD A;  3Q89 A;  3PXG a;  1JLE B;  2HHP A;  1U7L A;  5B0D A;  5JXS A;  2VA3 A;  1E6V A;  3I96 A;  5LSL A;  2D7S A;  3NKY A;  4YS2 A;  1GMW A;  4USJ C;  3DLJ A;  2VC1 A;  2CQ1 A;  4U8V A;  2Z56 B;  4HR2 A;  2YKN A;  2MB0 B;  3A12 A;  3GPA A;  5IWA J;  1SC3 B;  4RUB A;  1ZTT A;  2VBW A;  3FMW A;  2AF6 A;  3OBI A;  2ZJR Q;  2MZJ A;  4ZVU B;  5KG5 A;  4BS2 A;  3JTN A;  4Q7A A;  4CO1 A;  1D9A A;  3TWZ A;  1W2I A;  4Z7Y A;  2R9L A;  1ZM2 A;  1UWA A;  3BSO A;  2H5I B;  3KK2 A;  4ECV A;  2ZWO A;  2XMV A;  4QPT A;  4ZVP B;  3E01 A;  2O3D A;  4EO8 A;  2MY8 A;  3W9I A;  1ZM3 A;  3C16 B;  4DUZ F;  4A8X A;  2AV5 A;  3GG1 A;  2D3O 1;  1FO1 A;  4OI4 A;  4UOG A;  3VGT A;  3KMQ A;  4CTA A;  1HNW F;  4ALZ A;  5HJY A;  1S7H A;  2DVI A;  2YY3 A;  1NH7 A;  1VDH A;  1NH8 A;  5GAD I;  2WVB A;  4K4Z A;  3VAJ A;  3ZZU A;  1RHR B;  2VZ9 A;  1VQO S;  3S7R A;  1DTT B;  4LIW A;  2KT5 A;  1K47 A;  2HZC A;  4Y00 A;  1L5U A;  2BM1 A;  2MQN A;  2V63 A;  2JVR A;  4F3Q A;  2OPS A;  1QUP A;  3Q8S B;  4NOH A;  4X64 F;  2CJK A;  2EEY A;  4NML A;  1VC0 A;  1QSY A;  2QA1 A;  3E51 A;  3H0P A;  1RTJ A;  4MT1 A;  1EJ7 L;  2RQC A;  3PW2 A;  4NCG B;  3CCW A;  2RH3 A;  5BR8 F;  1HBM A;  5CYJ A;  1YBT A;  2XHW A;  5KFG A;  1FDA A;  3OW2 R;  3IP0 A;  3MM6 B;  1PYS B;  4JI0 J;  5CCM A;  2CYY A;  3K59 A;  2HND A;  4AXJ A;  2KHD A;  2MSS A;  2VC0 A;  3Q8Q B;  3DU6 A;  4ZPT R;  2X1B A;  4H54 A;  4HVZ A;  3HT0 A;  1OJ4 A;  2AX0 A;  1GTE A;  2HQD A;  3G6E S;  4F67 A;  1NB7 A;  4USM A;  5THW A;  4WF9 Q;  4Q8F A;  2FJV A;  2AZ1 A;  2D3Z A; 
#chains in the Genus database with same CATH homology
 1NLT A;  3TJA A;  2QLD A;  1GMU A;  3LA0 A;  2B26 A;  4L3K A;  3TJ8 A;  1GMW A;  2Q2G A;  1EAR A;  3TJ9 A;  1EB0 A;  1C3G A;  3NY0 A;  1XAO A;  3AGZ A;  3I38 A;  1GMV A;  2HFV A;  3AGY A;  3NXZ A;  3LZ8 A;  4J80 A;  3L9Z A;  1GMW D;  3AGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...