4L3KA

Crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study.
pubmed doi rcsb
source organism Sporosarcina pasteurii
molecule tags Chaperone
molecule keywords Urease accessory protein UreE
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4l3kA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 4l3kA02
3LA0A 1NLTA 1C3GA 2QLDA 3L9ZA 1EB0A 3I38A 3AGYA 1EARA 1GMUA 3TJ8A 2Q2GA 2HFVA 1GMWA 4L3KA 3TJAA 4J80A 1XAOA 3TJ9A 1GMWD 3NXZA 3AGZA 3NY0A 1GMVA 2B26A 3LZ8A 3AGXA
chains in the Genus database with same CATH superfamily
1FTRA 3Q2TC 1AROP 2BACA 2KM8C 3CPWR 2QZ8A 4DQIA 2KYXA 4QYZK 1UMJA 4RW4B 3G9CA 2HURA 3BO4A 3QT5A 4M5JA 2E1RA 3T6BA 4ZLNA 4PRFA 4Z2XA 4KHMA 4NA2A 1V3ZA 1OPIA 2OEKA 4RWXA 2I2YA 3HX9A 4C7QA 4HH0A 3CCJS 2HQGA 3CJSA 4WTYA 2MKYA 2EEYA 5CCLA 5L1KA 4O3NA 2NPFA 1H73A 3GR1A 6AT1B 1QTNB 2MQQA 2BQRA 2R3VA 1RT5B 3U02A 3KNAA 4K0KJ 4PWDA 3LP0B 4A8WA 2HNDB 2W8LA 4I69A 2YVSA 3EGVA 4P72A 2CPZA 4DX8H 4YB1P 4Y2MA 1RTJA 2D1CA 5HVHA 4I6AA 2CZVC 2NXCA 2QIFA 2QG9B 1GFWB 1W26A 1NO8A 1SJFA 4I68A 2HQDA 1S10A 3I96A 3ADAC 1LXNA 1YJWS 4F50A 4NRUA 3BN7A 2NXUA 2KVIA 3OFHA 2PA8D 3KLVA 1TKZA 2H5IB 4NI2A 3UVJA 4Z7CA 2GVZA 4JP8A 1LOUA 3M6WA 3UWTA 3P3DA 1ZA2B 2AWZA 3N0VA 1HIYA 3VGUA 2Z2LA 3RAMA 4N5SA 2OPRB 3FEXB 1RBOB 1UVIA 4ZVEA 4K5SA 2FVCA 1U1KA 3KMQA 5DQGA 1L5UA 2YWWA 4WJBA 3LPEA 2P9EA 3ZNJ1 1NK4A 1X4AA 4WZMA 2BE7D 4ES2A 1R8BA 2GZOA 3UDLA 1TL7B 1N33J 4DU8A 1OWXA 4WFNQ 2OPSB 4IH5A 4DX5A 2AGQA 1C0UB 4ZCIA 3AGYA 2JZ5A 3TI0A 4RNFA 3A12A 1VBYA 4W92B 1SKUB 3C46A 3CIZA 1T9VA 3DOKB 1UWAA 2ZH9A 3HJVA 5J2MA 3GLJA 3CDWA 2HHHJ 3N6NA 4OJ1A 2YKMB 2AW0A 3PTWA 4DUZJ 1HNWF 3R97A 5GMEA 1QVFR 2QMWA 1TK0A 4L74A 2W2PP 4B3OA 2OTLS 3UCZP 4TLRA 1FRMA 4YUDA 2BE2B 3R9LA 4A47A 5KFNA 4RUCA 5D3GA 3FCVA 2GIQA 2OPQB 4ZITA 5BJRA 1MSWD 1TP7A 2D7SA 3SSRA 4TQRA 3R1LA 4CCHA 1DBDA 1VJWA 1L3TA 4CLZA 2Y0SD 3EVMA 1HWIA 4N76A 5DO2A 2PT0A 3W9JA 1PILA 2VD3A 2YPZA 1RT3A 4LFCJ 3QO9B 2RKIA 2G2ZA 2YNHA 3IWXA 3FSXA 1BC6A 2HHXA 2W25A 3A1YG 2JRSA 3AD7C 3I0RB 3A8KA 1F3FA 4UF4A 1I94J 5BR8F 3DI6B 1Q8KA 3QNWB 5ETMA 1N5YA 3W2WB 1KDNA 2DNRA 1HQEA 3S1TA 5F8JA 4KYZA 1FKOB 1QUVA 5L1IA 4UQTA 4NXNJ 2XB2D 4AUKA 5LMNJ 4YMEA 1P9QC 2G1HA 1K47A 2RSQA 5F9LA 5F9NA 3M8PB 5JVHQ 3CD5A 2R7WA 2Q1LA 3DCAA 5C42B 4IRKA 2EI5A 3IFEA 5HATA 5D15A 1B0PA 2VPYB 2NQPA 4EUVA 3EVOA 3H5YA 3TANA 3TAMB 3GR0A 1HD1A 1HHTP 4F4WA 9ATCB 1YZ7A 2JC0A 1QSLA 2RHSB 5H9FJ 4LIWA 1MMLA 2ACYA 2DD8S 2IM3A 2G0JA 4OI4A 4S0MA 3PJ9A 1G4CA 2CPYA 2P9CA 2QLWA 2VICA 2E9TA 3GSIA 4A8XA 2XY6A 2V68A 1UVMA 4JV5F 1A7GE 2K2PA 3QLHA 4J9KA 3W3SA 2VOPA 1HWKA 2QMUB 3OL8A 4QIFA 3MM6B 3QFHA 3KG4A 4OI0A 3BREA 3E8OA 3AB4B 2KVQE 4PAAA 4F25A 2V4JA 2XGPA 2GJIA 2P6SA 3AH6A 3VAMA 4U6PA 4LVNP 1XNQF 2HNYB 3RU0A 3VVTA 3C19A 1WF1A 3G82B 4O3PA 3BGLA 3JXOA 3I31A 3NRBA 1T95A 3U7JA 1GMVA 3DOMA 2OPPA 3WZ0A 3SQOP 4RR5A 5DGBA 1VS3A 2DNHA 1Y5IB 1WHYA 2MJNA 4M5IA 4PYDA 1T3OA 5KFOA 1Z2LA 2WHOA 2CQ0A 3KLIB 1D9AA 1F2HA 1RBLA 2DNZA 3GB0A 1T7PA 2XY7A 2DGOA 1UZDA 1L3UA 1RCOB 4RUBA 4DR1F 3R6GB 4FN5A 5IC6B 3RAXA 4DCJB 1TK8A 2EFOA 2YNHB 1RT1A 2KJWA 3Q89A 5HAOA 2LECA 5DM7Q 2HMIB 4ZVFA 2X3GA 4DFMA 2F8EX 3NGKA 3DHWC 5KFAA 2VQEF 5B0DA 2V2ZA 1NK9A 1J5EF 5K8MA 3Q8RB 2W7PA 4X65F 1MN7A 3AJDA 1K1SA 5A6PA 3BDEA 1YJVA 1RGVA 1SUQA 3IXQA 3N28A 1VBKA 4RZRA 3H59A 2BXJA 3ELHA 2W2OP 3AGZA 3T9ZA 4D3GA 5HROB 5HROA 1ACMB 2ZNYA 3CDAA 2A2CA 2F63A 3DRPA 4X62J 1SUQB 2DEIA 4PZVA 2WW4A 5E3CA 1RZMA 2CNLB 3VQTA 5C42A 3QIPB 4C98A 4KQZA 2KKHA 4U9RA 1JXVA 4UUXA 4X64F 1S0NA 4NCGA 3QPIA 3UPFA 1DRZA 1HW8A 2IAJB 3DOKA 2A3JA 3SBMA 2KM8B 2VBZA 1WF2A 3CF5Q 4A8YA 2L48A 1X0FA 2Y0BB 5DLFA 4HHJA 2OGUA 3W2WA 3C3LA 2DJWA 3EDQB 1F9FA 4PG7A 4GKJF 4F4KA 2BW2A 3TJ8A 4DL5A 3ZTRA 1A0OB 1HNVB 1EETA 2FD2A 1DQAA 1RLDA 3QO9A 4MKBA 3VGSA 4P9SA 2J5AA 4KGKA 1CQMA 3FC9A 5DG9A 2YNIB 2HGMA 1BE4A 2VFTA 4ICLA 4UUWA 2PI4A 1T9TA 3PRBA 4NLGA 1RT4A 2OFGX 1MNEA 1UPPA 3HHKA 2CQHA 3NY0A 1RTHB 2DPIA 4F04B 1VQ9S 2VV5A 2OPQA 2HNYA 4AL7A 1V5IB 4IUFA 5KG4A 3CO0P 1SL2A 4ZJLA 3D0HE 1JLBB 1FX4A 1UEVA 3GIJA 3JTOA 3NS6A 4KRWA 1IM4A 2HAFA 2ZWOA 3CJKA 4CLLA 2D9PA 5ETOA 1VLOA 5U47A 5EDWA 3KJNB 4CH7A 2CNNB 2ZHBA 5AXNA 4DV7F 4DSJA 2ZZNA 2RH3A 4LR9A 1S72S 4QCLA 4QIVA 1WHWA 4ZPVR 2V34A 4U96A 5CD4A 5IT9U 1Y10A 1Y00A 1Z2ZA 3DLEB 4H4OB 7FD1A 3BKFA 4CI0B 3NWRA 1GXLA 2ZM6F 1EHWA 2JJ4D 2QL7B 2DKOB 1D3WA 3WQPA 3D4JA 3MR6A 5A0YA 3KKFA 1JJ2R 3OTDA 3VGVA 4CYUA 4L6V3 1OY6A 5AJ3F 3M8SA 2XZTB 3FUYA 4DR1J 2V4JB 4EZ9A 4H54A 5A8KA 3HT3A 2BM1A 2MTLA 2O66A 1FNXH 3G96A 1IQZA 3UFCX 4CQ1A 4NI2B 3UVJB 1G2EA 2DGTA 2W01A 1H7XA 4R8UA 3QLHB 1U45A 2HPUA 4NLQA 3ZO7A 5HP1B 4KBIA 1JLFB 1FDDA 2FQQB 1M0SA 1FJ7A 4LIRA 4XAKA 2Z30B 4FXWA 4OLOA 3SEOA 2BW7A 4MJKA 2WRMA 4PXDA 2NXJA 3TQ1A 2HIYA 2W2QP 3V4MA 1VRUA 2RS2A 3C16A 1WC0A 1QM9A 4DU7A 1RXOB 3EM1A 4DV5F 1SVDA 2LVWA 3MAQA 1CVJA 4CLTA 4K50A 3A13A 2XG8A 4QBUA 4U95A 1B99A 5ETNA 2HNDA 3CJ2A 3O5TB 5K5MA 2XULA 2K7KA 2DXDA 4YEAA 2ZJRQ 4OYXA 2UV8A 4OV1A 4OQJA 3JYTB 3PKMA 2DO0A 1J5OB 1U26A 1XR6A 4M5GA 3BYRA 1T94A 2FHMA 1FNOA 3TARA 1VJQA 3K8WA 4JUZA 4CO1A 2VA3A 3H25A 1IKVB 2KJVA 1VRTB 2N3LA 3D6FB 3I0RA 3BQ2A 3PRDA 4X4QA 2BZ2A 2GX8A 3IGNA 1NK7A 4IRDA 4RNMA 4AL5A 1T8EA 3KDOA 4ZVTB 4RNHA 4UQGA 1S7HA 4K0KF 3BSOA 5I3PA 2V8DA 5LMNF 4WYWA 2HQCA 4IYQA 2C3PA 4QIEA 2QLXA 4KIAA 4OHXA 4DZDA 5E5NA 4GC7A 5BR8J 2FVQA 1SBRA 3GV8B 3QAUA 3W64A 3M4XA 5GADU 3OJSA 3M9NB 3AGXA 3SCJE 3HF5A 5D6GA 2VA2A 4DJBA 5IV3A 4FPIA 4NE9C 4GO5X 3DGPB 1Q81T 1YRXA 1RWMB 2NYHA 2JHEA 4MIWA 3FSIA 4OYZA 2YXLA 4IH6A 2HHSA 2LQ8A 4ZPTR 1HWJA 3BSNA 1B70B 1U2CA 1U02A 4O4RA 2HK3A 3O1LA 1NU4A 4JI7F 5M2RA 3R5JB 2BKNA 2IM1A 3AJ1A 4ER8A 1U1RA 4WZQA 2DNPA 1VIXA 4ECVA 3K5NA 4MIBA 2MDAA 1UPMB 3CJ8A 2NS1B 4DUZF 3D1OA 5SZTA 5HI7A 1Q95G 2UUAF 2HHHF 2LEAA 3T19A 2KXHA 1SI9A 3AY0A 4BBYA 4LF9J 2ZDPA 4HVZA 1Y9OA 5BYRA 4B3RJ 1JLQB 2ROEA 5KTQA 4PQUB 4U8YA 3GSDA 2JLFA 3KXDA 4EZ6A 2ZH2A 1FXRA 2V67A 2R7QA 3SCLE 5F0WA 2UUAJ 1TZ0A 1RHMB 2WONA 1DLOB 3FEYB 3IBFB 3KLFB 5AXKA 2EC0A 1IJFB 2D41A 1H7WA 2XMTA 3H7HB 4Q2LA 1DQ9A 1EARA 3RW7A 1S1UB 3OTEA 4ITSA 4O3OA 5K8PA 2XYPB 4RW4A 2C28A 1LWEB 4P6QA 1H38A 3QSIA 1TL3B 2G0CA 1M1GA 1Y3KA 3M30B 2ROGA 4P71A 3NAHA 5BYQA 1XEZA 2BE9B 3EDRB 4RW6B 5HJYA 5KT4A 1TMJA 4MYUA 3DU5A 4DR7F 1RT2B 3ZTQA 1QAIA 1PSDA 4E98A 2PSZA 1JLGA 2V2KA 3V4IA 2MZSA 1MMDA 1NZAA 3BF4A 1AUSL 2EKNA 5C24B 5AJ3J 1Y5LB 4F67A 1TR0A 2Y1RI 4KO0B 4Y3CA 1DZ5A 2F5GA 2AF6A 1RWWB 5ETRA 3ZZZA 1QSSA 4LF5F 1F9EB 1OYEA 3R7SB 3NL0A 1UW4A 1YJTA 3DMJB 3SFUA 3GIRA 3O8WA 3THTA 4OX9J 1Q5VA 2V94A 5F8GA 1MG7A 2Y3YA 3HSJA 4P2FA 3D28A 2HFUA 3OV7A 1Q0NA 2DNOA 3TAQA 3RW6A 1NUEA 2EC2A 4DQRA 2KG1A 1U1LA 3DLLQ 3EPIA 4FYDA 1FFWB 3IRXA 1IUJA 1ZM2A 2BYCA 3MECB 1OY9A 5JUMA 3MCMA 5IV4A 1RT7B 2J9CA 3W9IA 1PC5A 5HMZA 4AL6A 2RMLA 5KFCA 2CADA 2UP1A 4B3TJ 1YJUA 5ETSA 5F8LA 2KB2A 3EVWA 3ONQA 4KPCA 4N47A 3ILJA 1HKAA 2HS3A 4WBFA 1N36J 4ID5A 4H4KC 1YK9A 2R2RA 1FDBA 4OI2A 3ILOA 3MEKA 2AEMA 2P2CB 2Q79A 3CJ3A 3P45B 4GMKA 4J9SA 3FFIA 1K8AT 2WVDA 2UXDJ 2B5JB 1VQ4S 1RT2A 2JDJA 3AD8C 3DC2A 4OYOA 3MM5A 1JLAA 2QEXS 4TU7A 2QTWA 4ZP7A 1FJCA 5KG1A 2ZEJA 1X5SA 2R7XA 2V63A 3GJRB 1XR5A 2ZJPQ 4IOBA 1NDLA 2FZGB 2H1YA 5IOLA 5JXSA 1JJCB 1M5PC 2PEBA 2ZITA 2HQIA 3QT8A 4O44A 3KLHB 3CTRA 1VQPS 4WP9A 3NNCA 3AQOA 4EO8A 1BQMA 2LU1A 4LSLA 3HDSA 3VVUA 1IWAA 4CTAB 3CJRA 5F3TA 3TA2A 4EFAC 4L73A 2IVMA 2LQ5A 2ZKTA 3M8QA 1R7IA 4OYMA 2DNGA 2ZZTA 3Q83A 4AXIA 2QGFB 2W24A 4K4ZA 4EBEA 3QFWA 5C2CA 1S0MA 2LYVA 4X64J 3KHRA 1HHSA 2MMYA 5IZHA 4PWUA 1KC8T 1H72C 5E3RA 4X62F 4MTPA 2F3JA 3QMQA 3SV4A 4R0JA 1SCJB 1R0BG 2I5JA 5I3QA 4DDFA 3P6YC 5CXTA 1H2UX 2E1PA 3DDIA 4JI4J 1URNA 3DLJA 4X4NA 3G71S 1NKBA 2CJBA 4RW9A 1FA0A 5L1JA 1CEZA 4QU7A 1VQNS 5IT0A 1SJ4P 2U1AA 1KNZA 1H0HB 2GMLA 4TXSA 1VI7A 4UTGA 3AJ2A 5LXYA 4N8OA 4ZP6A 2XC9A 3JS9A 2H5EA 2B9XA 2E5IA 4ALZA 2HIQA 1KKHA 3MMAA 4HHUA 5KT5A 1OJ4A 3AHPA 3IR6B 4HTIA 2UV8G 2BJ9A 4A8QA 3GP9A 3N5BA 4DG1A 1HNZJ 4KPYA 3CJ0A 1EB0A 3FVYA 2KHDA 1NEEA 3UI3A 1IKYB 3EMTA 5IM0B 4B9SA 4CLSA 1B0TA 2VDIA 2WSFC 1LW0A 4PG6A 2DPJA 1IKWB 1FK9A 4TY9A 3KJVA 1RTHA 2UVWA 4ZPAA 1HQ2A 4EO6A 3CVKA 1N6QA 1QVGR 5IS2A 2MZQA 1PC4A 4ICLB 2HRTA 3MD3A 2B9WA 2LQBA 4LR7A 4DV0F 4ECSA 1X60A 4DUYF 1ZPVA 1X5OA 4OYIA 1Q86T 2YQ1A 4O3QA 1EX8A 1XAOA 2M8HA 4C3KA 4J5OA 2LKZA 1S49A 4LF4J 1WOOA 1EETB 1FRJA 1TUWA 2JX2A 4HT7A 3NXZA 2HVZA 2PMWA 1B3TA 4NCAA 4ANDA 2HFNA 2YNFA 4GVBB 1TAUA 1ZYQA 1RWPB 3IA0A 1QAJA 1DQ8A 4JI4F 1KR4A 1R8PA 1Q8BA 2J9DA 2FJEB 3AA9A 2WCXA 3TA0A 2ZBPA 1D9DA 2FJVA 2DEJA 1TKTA 2HWIA 1KBRA 4KO0A 1ZH5A 5L38A 1F1BB 4OZ5A 5KG7A 2CA9A 2E5JA 1OO0B 1Y3JA 1NJXA 4X4TA 2R7OA 4WFYA 4IFYB 4I2PB 4LBPA 4L75A 3D1QA 1PYTA 2BRLA 3CD7A 2GAGC 4TNOA 5A2QY 3K5MA 4JI5F 1JWWA 4ZVGA 2CAJA 2ZD1A 3B6BA 2L08A 1GMWA 1YKWA 2W9BB 2ZH6A 3M1VA 3CW2C 1I51B 1NPKA 3DLKA 2OSRA 4RW9B 4DSEA 1UEKA 3GPAA 3ZC4A 1I94F 4LF6F 3DU6A 1FE4A 2M7SA 2AJQA 2CQPA 1LWEA 3IAM9 1NXIA 3TWZA 4AQYF 3QJLA 4HI1A 2G1DA 4C0BA 3RRKA 4FXVA 4K4SA 1XJWB 1S6UA 2WAQD 5T7LB 4K4WA 2CVEA 4LSNA 3H2LA 2D3ZA 1GEHA 2GCFA 2HVEA 4OJ3A 2HEKA 3ISNC 3C5XC 3KLIA 3OPKA 1NJIT 1BY9A 3MEGB 4ED6A 1ZTWA 1NKEA 2X1BA 5M2PA 2HGLA 2BQ3A 3NS5A 2KYZA 3FBCA 1NPRA 2AMCB 3MOZA 3IC1A 5B09A 4J9VA 2FTRA 3D1HA 3FJ2A 1H98A 3C6TB 3U1MA 4ZPCA 1GK8A 3PM9A 4CTAA 2OELA 4EI2A 3MM9B 4NYOA 4OYWA 1GQEA 1LKZA 1BQMB 2RUSA 3H5SA 5GVQA 5B0CA 2JL9A 4FDFA 3RBZA 3UN2A 4Z37A 1DAXA 4X65J 4B3MJ 2ODXA 1XC9A 3KK1A 3KLHA 2FC9A 3SCKE 3MEDA 4NA3A 3PZPA 2FLNA 3D7SB 1ICEB 1VMBA 3M8WA 4I2QB 2LXFA 1NB2A 3GZ7A 3UD3P 4TY8B 8RUCA 3OLAA 5A8WB 2JWNA 3MM5B 4O3SA 2VH7A 5EGYA 2XI3A 4WK3A 1QAYA 1ZBTA 1N5TA 1E6VB 3EICA 4AE5A 1ZOTA 4MK8A 2DNLA 3PFOA 1IR2A 4DQSA 4U67Q 1IBLF 4HYKA 1CULA 1NAQA 3ZZUA 4Q5VA 1WD6A 1CJTA 3DOLB 2PFDA 3R8YA 4FF2A 1U1NA 4OZ2A 3CE8A 2KZMA 1KVIA 4ZLLA 3EWGA 1N52B 2M2BA 4DFKA 1TVRA 5J2NB 2KT5A 4J9MA 2Z58B 2F65A 1KQSR 1MWZA 3DRXA 2JEFA 4DLEA 2KT3A 1NLKL 3TJ9A 3DI6A 3M9OB 4M8LA 4M94A 1PBAA 2WTFA 4KKOB 3OLBA 1HBOA 1ZPWX 2P8IA 1HD0A 1KLMB 4DV2J 2CQ1A 1IKVA 3CO9A 2HHTA 3G6XA 1RT3B 4I6YA 1G7CB 1U6ZA 2YWFA 3ZZTA 2N4CA 1SJ3P 3J7Z5 3IWNC 1P6TA 4LF1A 3DM2B 3I5CA 3EPGA 2EFPA 3HT0A 4WKYA 4DXLA 1N8RT 2YKPA 5GAGI 5DDQC 3H40A 1WDTA 3S7RA 4ATNA 1X4CA 3BYPA 2E5HA 4K59A 1JLEB 4JI8F 1WC6A 3Q22A 1D8YA 1NK8A 1WG5A 4W98A 1GMUA 5HLFB 1SL0A 1RJJA 1BD6A 4NXNF 5HBMA 1N88A 4PG8A 3CB4A 1YG0A 3AT1B 1U1QA 1WELA 3KHGA 4C11B 3OJUA 3S6EA 1TKXA 2XNRA 3CJ5A 4OX7A 2GQQA 3TVZA 2HFSA 1FERA 2E44A 3OFGA 2CPXA 2XCAA 1RT1B 4LRFA 3UD5A 3PW7A 4LRAA 1NJZA 1Q4RA 1UFWA 4MK9A 2AGOA 1VQ8S 4PR6A 2ALYB 3SSSA 4DR2F 1DLOA 1SH2A 1ZA1B 2IVYA 4ED0A 2HZVA 1TL1A 3OR1B 3KUEA 4QR2A 4EBDA 2FUG9 1N36F 1NZ8A 4DPWA 4DV6J 4R25A 4EMDA 4ZK7M 2UUCF 2I0XA 3LP2A 1XERA 3OR1A 4AT1B 1U6FA 3G82A 3SZ2A 4G3IA 3PR5B 2OPRA 3V6JA 3UCUP 3CCWA 2XZDB 1LXJA 4HEA9 3KUGA 2L3MA 3PYFA 4KV8A 5F0UA 1DHMA 3D5MA 3W66A 4AFFA 2V8HA 2GGPB 2GQCA 2HNZB 1WHXA 2VG7A 5HVGA 4B3SJ 2HHVA 4RW7B 5KT7A 2R8KA 2QYGA 3HSZA 4KHPF 4ZLJA 2UUBF 3TAPA 2EXUA 3IS9A 1IR1A 1QUPA 2CWKA 4P73A 1C4AA 4YQWA 4DV3F 4WFBQ 2VKZG 4JV2A 4CNYA 1FI4A 2K3KA 4Y34A 3J81j 4MYTA 3GJSB 2DK2A 3GE9A 4NX9A 3PACA 2QMXA 5CQGA 5D0HA 4UZBA 2PO4A 3MCOA 1E6YA 1KRPA 4DR4J 1LFWA 1JLEA 1SH3A 4DPOA 2GIRA 4FYVB 4I4BA 3VCDA 3F73A 1NDPA 4ECWA 3KG0A 3VAFA 2CJXB 2A6OA 1T0TV 1VK3A 3FGVA 2QT7A 2RDIA 3T6JA 4PYAA 1CJVB 1HNXF 2LQ9A 1RAOA 1N5YB 4CO2A 2CQDA 2OKQA 1LNQA 3SCIE 4F0HA 4P7VA 3IRWP 3VWSA 1B7YB 4ZCKA 1JJ4A 3J7YI 2ASYA 3M2UB 1HWUA 3NWGA 1RI7A 8AT1B 4NMLA 2HS4A 3D66A 3ENWA 4MFBB 3TVYA 4AD6A 2EKYA 5D0RA 1C2PA 2M8DB 1SPBP 1PGZA 2OIHA 1YDLA 4PCQA 4C0OC 2OUGA 4C11A 4ECRA 2RILA 1VQ7S 4IR1A 1WTBA 1SL1A 3B82A 3IWLA 4QWCA 3DOLA 1YZ6A 2QL5B 5GAHI 2ZZMA 4EEYA 2BJ8A 2XEXA 5D78A 5IQ6A 1CC8A 5HLFA 1S6OA 1EKSA 1WACA 2VUGA 3V81A 4OHWA 4B3RF 3CJ4A 3BGFA 5K14B 4JI0F 2ZM6J 1AB8A 2MKJA 2P6TA 3L7PA 1N32F 5FJ4A 3LWMA 2R7RA 2H9ZA 4M5DB 5I42B 4QQBA 2UVVA 4XTTA 3GIKA 3MEEB 3H5XA 3EZUA 3D6TB 3D6HB 1JLFA 1XR7A 3M8ZA 2JVMA 1IBMF 4JI0J 2B26A 1UCNA 4X84A 1RAFB 2Q6CA 4RUHA 2JEJA 4B9NA 4JI7J 1DFDA 3LAMA 3PRVA 4DV7J 1X4GA 4K4YA 4CO0A 2AGPA 1H2TZ 1TL7A 1S97A 3PO4A 1QD1A 2ZHAA 5A8KB 3KHHA 5F41A 3OTOF 2QA1A 3VTIA 1VQ5S 2QYCA 2RU9A 1EQ0A 5KG0A 3H98A 4NLTA 4BWJA 4CNZA 4CYUB 3SSQA 3MR3A 2BANA 3RJMB 2CUYA 3C6TA 5GAEU 4AQYJ 5IC4B 3Q8PB 4M5LA 3PX4A 2XLKA 4P52A 3KDNA 2JOQA 3DOMB 2SXLA 1TL1B 4NOHA 3EX7B 1UETA 2HFVA 3MEGA 4Y2IA 3N6MA 5KFLA 5J1EA 1CULB 4DX6A 2GMJA 3LAKA 5T7LA 1NHKL 2V0NA 3KJFB 3CCSS 1NK0A 3MAAB 1OMSA 4FS1A 3W1YC 2QSWA 1M5HA 1UJ5A 2VDHA 1F2GA 2J0QD 1TTHB 4KY3A 2C3MA 2XMJA 2EWHA 2VU5A 4OMFG 3HI9A 3K2YA 4TY8A 2GMHA 4ZLPA 4ZPBA 2G0IA 3Q23A 2ZJQQ 3M1VB 5KFYA 2OJ3A 4B9UA 4DR4F 2KHCA 1GNKA 2J8SA 1SJQA 1BLUA 2IC3B 3ET6B 4K4TA 4DR3J 4C9DA 2QN6B 1YBUA 3T1YJ 4ZOSA 2BR0A 1LWXA 4JV1A 3QT6A 3CIMA 4YB7A 3WIVA 3FKBA 2MZ1A 2DR7A 1RKIA 1RU1A 2G2YA 3O3LA 3DRSB 1S7IA 3QGPA 3Q0AA 4KJIA 4WXOA 2BBEA 2MZTA 2FDNA 2H54B 2PI5A 4RBVA 1VQYA 3AB2B 4CLWA 4QR1A 3QJPA 2YNIA 2HK2A 4J9RA 1RWUA 2QL9B 4FXDA 2HHWA 1ZM3A 3AXKA 4Q0BB 5E3PA 1FHTA 3O44A 2YTCA 1FE0A 3KMSA 3TUIC 3IR5B 1KLMA 7FDRA 1UW9A 3HJFA 2CKWA 4QOTA 3UNGC 4O4GB 2V8PA 2RKIB 4USIA 4Y6IA 3E51A 2FJDB 4ELUA 2ZKUA 2VBXA 4DPUA 3BH7B 4NLXA 3W5ZA 3JSRA 1LWCB 2UXCF 1BQXA 3JAMU 1K0VA 4MKAA 3OTBA 2HZAA 1HBMA 1FK9B 1SV5B 2BUNA 4KGVB 5IWAF 3IO1A 1ELOA 2WVEA 2YKQA 3G4SS 2MSSA 2BE2A 3CCVS 4YHHF 1TFWA 1T9UA 4B3OB 5KFEA 2QA4G 2DRAA 2XWXA 3T5LA 2CZ9A 2E7WA 1ZZNA 4EBCA 4Y0FA 2N4DA 2R2UA 2PMHA 4YFUA 2H4YB 2MZJA 1SJ1A 2RDJA 3Q8QB 4RW8B 2VPXB 2DITA 3N9UC 5KFXA 4X4UA 2IMOA 4K7QA 2Z2MA 1MU2B 3H2UB 1SC4B 3JQKA 2RDDA 1V3SA 3R5AA 4WP3A 5DZ7A 3UDVA 2HGNA 2R2TA 1VC0A 4KH1B 3PY8A 4ZN1A 3NBPB 1M1KT 3H0PA 2R4FA 2VG6A 3ZXWA 4JI2F 5GADI 3CULA 3OHAA 2CQ3A 3PW4A 1R8AA 4CT8A 1APSA 2LEPA 4UT4A 2F8MA 3ETOA 2GFFA 2MLZA 4FYXB 3AD9C 4GC6A 5B7WA 5IM0A 3OL9A 1VQOS 4LSNB 2FPHX 5LMUF 4DUYJ 1OS5A 2DH8A 2UU9F 4UOFA 1WDDA 5EWGA 1ULRA 3RB4A 4DSLA 4ZVPB 1JK9B 2QX0A 3HZGA 1ZAWA 4KGXB 3MGJA 3K89A 2NZ4A 4ZVHA 4ED7A 5HMYA 4C8MA 1X31C 1WWHA 2RS8A 4LF7J 1CG2A 3MDFA 1HBUA 5DS7A 3SQGA 2KXNB 4HKQA 3C14A 2AHOB 3RBXA 1FXLA 1GH8A 4CLYA 2X1AA 1SIZA 2QC3A 3GMGA 3TEHB 4ANEA 1VC6A 3MM9A 1O5JA 4X4OA 2C2EA 3IBCB 5HSPA 2V2QA 4ED3A 1R31A 3SMZA 1G6BA 2BX6A 3HVWA 1FKPB 3THPA 1XBWA 1XWLA 3RR8A 4QPXA 3ILIA 2YH1A 1FKOA 2BJ1A 2GIFA 2COLA 2HWTA 4IG0B 1N5QA 3JSBA 4OZ0A 2MEWA 1RAIB 4GVBA 1V5VA 3G6VA 2ZVIA 3F0NA 4XK8C 2XS2A 3NAIA 1PYOB 2F7VA 3T1YF 3K7RA 2RT3A 2M70A 3MECA 1UFKA 1WEYA 2AT1B 2CNKB 2DNNA 2W2MP 2HSEB 3H90A 4LSLB 2WVCA 4CO5A 3CMQA 4F26A 3CGIA 3R3TA 2EPIA 4TU9A 5GMDA 2MLYA 4WP8A 1KFSA 2FIUA 3OUYB 3FBEA 5BXIA 3B54A 1K1QA 2MHNA 3MZIA 1NH7A 3UD4P 2QJ3A 3M6VA 4FYYB 1LEOA 5CCMA 2DO4A 2K1RB 1D0EA 2AJ1A 3M2RA 1PAEX 1T3NA 4DG1B 3G6ES 4FP9A 1OPZA 4J9UE 1FF2A 2CJYB 3BH6B 4IKAA 4EYIB 4IG3A 4RU2A 4LF2A 2W9CA 1S1WA 4USJC 2OHDA 2CIMA 4HH1A 3GQCA 5C25B 3HULA 3JTNA 3TR5A 4X4PA 4MT1A 1OIAA 2OLWA 3PR4A 1YIJS 2B51A 2HVDA 3IBWA 3PYDA 3M30A 4FBUA 3OT9A 4YR0A 1VQMS 3IN5A 2H65B 3MPUB 3TNVA 3R1HA 4WK1A 5LM7E 1S6PA 2V9WA 2MHEA 3CDBA 2DY9A 2QFJA 2XYGB 2FJWA 1EZZB 1NSAA 2CJQA 3G8QA 5D4PA 1U7LA 4C8OA 2RF2B 2CWXA 3SDEA 3UE2A 1REGX 4WE1B 5DZ6A 4CZCA 1IKWA 5ETQA 3KLGB 2OD6A 3KJVB 2NREA 2KTQA 3B4MA 2C2NA 3PFEA 3MURP 4ILMA 2FYXA 1CS4B 3BGUA 1FVQA 2ZNZA 3HLUA 5L39A 5DDRC 4EU0A 2OMOA 3MWBA 2DHGA 2UVUA 2ZUAA 3IAS9 1IWGA 2NXNA 5EUHA 2JLGA 3RRHA 2RAQA 3VR1A 4C8ZA 4P75A 1EAYC 1U25A 3EGWB 2PIIA 3HVTA 3MM8B 4OX9F 4LQ9A 4FF4A 4ANCA 4NLSA 4ZIVA 5J2PA 2E1MC 4IH7A 3WIUA 4HL9A 1R6YA 1N54B 4F0KA 4F7VA 1HNZF 2CPJA 2UVRA 3WX4A 3MM8A 2W7OA 1RWOB 2B8PA 1N56A 3ETMA 4OFZA 4JYAJ 3AAWB 4MAKA 4IQXA 2J0SD 2DNYA 2LCWA 4Y2KA 4F2RA 3QWUA 2ZC3A 5CYMA 3IR7B 2RU3A 1HMVB 4Q8FA 1C0TB 1T03A 2WONB 2NLWA 2AZ1A 3FK4A 4PG5A 4M5NA 4CRJA 2XCPA 1I5OB 1KLNA 2MKCA 4ELVA 1UVLA 4F4YA 4J91A 1WORA 2R8GA 1JQGA 3I6PA 1M5SA 3W63A 1SJRA 5T41A 4ECUA 3M32B 3I4HX 2E7VA 2FGCA 3T1HF 4JI1J 4FF3A 2KXFA 1SKRA 5DQHA 1CSJA 2EFGA 1XMQF 4KGMA 3GTYX 3AKOB 2ZFHA 3TZWA 4CO4A 4ILLA 5A2QU 3BJYA 1O0PA 2DXEA 4N77A 3NGSA 4DLGA 1WKJA 1VRTA 4F3MA 2LU2A 3D3BJ 1S1XA 2E7XA 4LRCA 3X3UA 5A8RA 3ENVA 4TQSA 2R2SA 3TRGA 5KFGA 3T1HJ 4H4MB 1U8SA 4YY3F 1S12A 3GONA 3FZ2A 2AZ3A 2B56A 5HMWA 1V9OA 5KOWA 2MKIA 2HRYA 3FDSA 4B3SF 2KFNA 3C6EC 4M63A 4NEYA 4M5DA 2KL8A 2XTJP 5C24A 2CJKA 3Q2SC 1S6QA 3FNNA 1S6QB 5AXMA 4DX7A 2E5LF 5LJ5Y 3LWLA 3GIMA 3ITHB 5J1NA 3FMWA 2YBVA 3N4WA 2MQNA 4GKKJ 5IFMA 8ATCB 1U0HB 4QW9A 1AUDA 1KTQA 3OD2A 3MOJB 1RTZA 1HBMB 1SV5A 4MKVA 4WFXA 2BABA 2XMKA 1UA1A 4JYAF 1CJKA 4I7FB 4QYZJ 1LWCA 3OTOJ 1S1XB 1BXNA 3NLCA 4LUBA 4F4ZA 4RU9A 3OUYA 1JMTA 2ZBRA 4KH0B 3UN5A 2NXEA 3C6UA 1LW2A 3L95X 1YWXA 2ZE2B 3R5CA 2BQUA 1TL5A 2HZCA 2KRBA 2WOMA 3ISND 3NG8A 3PEJA 3TVKA 1H6KX 2A6MA 1S79A 1KD1T 4LFBJ 3AOCA 2MY7A 4NLPA 1EIYB 4URSA 3D68A 3GG1A 3KLFA 1WC3A 3C15A 4I0WA 4NPOA 2AQ4A 5ETVA 4DMZA 1RDRA 6FD1A 1V6HA 5IT4A 3P5BP 3RB3A 5K9FA 4I67A 1W25A 2BMBA 1C0TA 2KDOA 1WJ9A 4PKDB 2E29A 2MQMA 4LT6A 3BO2A 1S1VA 5CYMB 4USKA 1WHVA 1HFEL 3FCWA 3L4BC 4JI8J 2BRKA 2BEFA 3CT9A 2DHHA 3JQMA 1Z4UA 2P9GA 2QO3A 3TUJC 2HBQB 3QGGA 1YQHA 3TO8A 3W5XA 3B8HA 5B0FA 1ZM4A 5C7PA 2F8HA 3FMBA 3HHEA 3C14B 2B9YA 1FRKA 1WC5A 1I3OB 2DIUA 2IC3A 3DDNA 4G1PA 3DRYA 1U48A 2DGXA 2OEMA 3I9ZA 3M2VA 5J2PB 5DG7A 2WZ1A 2W2NP 3VV2B 2VB6A 1C1BB 5KFSA 4CM2A 3DLBA 1C4CA 2HHQA 1JKHA 2J7KA 4L76A 4NCBA 4ZP8A 2FB0A 4F4AA 2XO7A 3AXMA 4DUTA 3NS7B 2Y8YA 3TUPA 2HNZA 2VG7B 2MGZA 3KK3B 3D2WA 4I6WA 4KT0C 2FHJD 4PXCA 2V9KA 3HKWA 1D9FA 3QAEA 5J1EB 3VAKA 2FJBB 1UWBB 3HPOA 1L3VA 3LW5C 4ELTA 1I6JA 2WB4A 4IDKB 1ROFA 4USMA 5GMKa 3GFHA 1T9YA 3IG1B 1GXTA 2M88A 2CPDA 4HACA 4Y65A 2G9OA 1YBAA 2NPIA 1NDCA 1LK5A 1MMNA 4X66J 5KFFA 1KP6A 2MKHA 4ZN3A 3I55S 1FFSB 1RTDB 3P8BB 1HHQA 1KQKA 2IBKA 5DQIA 3R7NB 2NR0A 4ZHRA 3PG9A 2J6SA 3BKTA 2UUTA 4H4OA 2CDQA 2YX7A 3HSGA 2UU9J 2XMMA 2B0GA 3I82A 2Y1LB 2POKA 5LXRA 2LP4A 2EFNA 3UR3C 1BWVA 2V4RA 4B9TA 3C8YA 1RAHB 3PEHA 2NZCA 1QE1B 2X51A 4WYLA 1OSDA 3L7OA 5KFQA 3V6DB 2OD4A 5THWA 3CJKB 3MD1A 4ZDNA 2DVIA 2MQOA 5B0AA 1GTHA 2IDLA 2XI2A 2FJXA 4FZVA 2J7UA 3VAJA 2D3UA 2M5YA 4QIWD 4F0MA 2WSCC 3NCRA 4TVAB 3CCMS 4K4XA 1VGYA 3BM7A 2OAUA 1S9EB 2O3DA 3H42A 5HJXA 1WSRA 4K8RA 5F3ZA 5KFPA 2EK6A 1UEUA 3QSYB 3BGRA 4UZCA 1HNIB 1NSKL 3MCNA 1RWXB 3BR8A 5HL7Q 3DM2A 2C2RA 2BVZA 2AD9A 4ZJOA 4B08A 1TU0B 5H1SV 3THVA 1F5BA 3CCES 4NXMF 5HP1A 1YJNS 1KQGB 4E2FB 1Y0HA 2DCLA 2DGSA 5CAAA 1RA6A 4J9OA 3SYZA 1YHQS 2IIHA 2AIRB 1Z1ZA 2LA4A 1XNRF 2XY5A 2F1FA 4C0HA 3EZOA 2JFKA 5RUBA 4OZ3A 3TZYA 2MXYA 3P49B 3SXLA 1RHQB 5KFHA 5LMUJ 1U1PA 4ECYA 4ED8A 1AZSB 1NJYA 3I0SA 3JYTA 2GJ2A 1SH0A 2XSJB 4ZCMA 5JVGQ 4JI5J 5A0YB 2ZH5A 2HFOA 2VC0A 5F8MA 2DGQA 3DRSA 1S0VA 1VCTA 4CLUA 4NMXA 4ES3A 2XQCA 1RP5A 2F9JA 3GJTB 1YX2A 1X7VA 5KFBA 2Z57B 3DYAB 5I3UB 4DOZA 3C16B 4HI2A 5L46A 4TLQA 4NEZA 2EFVA 2E1CA 1HBUB 3SQGB 4Q8EA 2YKAA 1VLYA 3BKUA 2AP6A 2C3UA 3D0IE 1ZS6A 3NCQA 2YQ3A 4DV2F 1RWVB 3P5TL 4DL0C 1F0XA 1G3OA 3MAAA 2IY5B 4WFZA 3OHBA 1PO6A 2DBBA 2M4MA 3CCZA 1RHJB 2M52A 3BO3A 2FLPA 4YR3A 1KN6A 2HFZA 2CZ4A 5KT2A 1SKSA 3NEKA 1PCAA 3W65A 1YSJA 2ACMA 2KO1A 2W7AA 4USHA 1IBLJ 4X2BA 2CJ9A 2CQGA 4FKXA 3OXLA 3GCXP 3A3NB 4J90A 1AXQA 2BKOA 2X1GA 3IM9A 4G1QA 5HK4A 1RKJA 2JH3A 4DL3A 1X4BA 4M5KA 2NUUG 4LBIA 2FHKA 4RW8A 3DRRA 3I5AA 5DG8A 2CYYA 1VK8A 4ZPDA 2KH9A 4BS2A 1RAJA 1KS2A 3ICLA 1HNWJ 2R9LA 1TK5A 1W2IA 4Q45A 3E2EA 2RQKA 2CJAA 3FBBA 4NCGB 3T1AA 1S76D 4J80A 2W9BA 1U2FA 1OQ3A 4OI6A 2CFXA 1UVKA 4FNIA 1KVKA 3UNYA 9RUBA 2AU0A 1J2VA 1FD8A 4ZCLA 3TAMA 3U1NA 1A9NB 2UUWA 2FHJA 4I1TA 4C2MA 2QSFA 4P2SA 1BUXA 2AJFE 4L72B 3HHLC 4DN9A 4DQPA 1MROB 4NASA 2V50A 4DI6A 5KFKA 3GFYA 2BJDA 4DSFA 1TKTB 2IJNA 3GFZA 2XO6A 4WKRA 1CLFA 3GCWP 3PYEA 3M05A 2J6UA 3NGDA 3CDEA 4LF7F 1HI0P 4JI6F 4UY8T 2HMIA 2MSTA 1S48A 2BM0A 3FZBA 3BBFA 4IO1A 5ADZA 2YNFB 3M2UA 4DR5J 4A8OA 2CDRB 2OH2A 5D8HB 1NK6A 3OTCA 1JXLA 2V69A 2IPOB 3IMQJ 3TX0A 2YWEA 5HN0A 2QE5A 2XNQA 4MMOA 2IAJA 2IRYA 2YWKA 4NL5A 2MQLA 1MROA 3QIDA 3BGRB 3GWCA 3J81U 3CMAS 5HO4A 5E33A 3DXBA 2VZ9A 4V19X 2F40A 4XPEA 4XDDA 4NA1A 4NLUA 1TKZB 3P4UB 4NXMJ 3MUTP 3ZTPA 4PPDA 3WX8A 1JKHB 1MN9A 2JFDA 1BQNB 1JXEA 4DV4F 1RTIB 3K5OA 5E41A 1MWQA 2W4DA 1HLWA 4PABA 2Y1IA 4DV4J 3M2VB 3MEDB 1MW7A 4BHQA 3K57A 2WSEC 1HW9A 1RTJB 3KK1B 4HDHA 1Q78A 3UQSA 3V2UC 1VHIA 5ETPA 3TZXA 3J80U 4ID8A 4LJMA 2HKEA 3HHDA 4P2MA 2DH7A 4IFVA 4QPTA 1HPZA 5GAGU 3CC4S 1SIWB 2DHAA 2I5JB 4OI3A 5AXLA 2GW8A 1O6XA 3LP2B 2K3IA 2LA6A 4ZKAA 1RTDA 3N5FA 2WVFA 3W9HA 2H3EB 2X3DA 3I4PA 4QWEA 2CQCA 2Z8QA 1AT1B 3AA8A 3FBFA 2VG5A 3LP1B 2N7YA 3UDCA 3ZZ0A 1HI1A 2YKNA 1UWBA 5L9NA 1PG5B 2ZBCA 3BB5A 1N34J 1VQ6S 5B0GA 2R8HA 3NNAA 4BLGA 1ZAXA 1T05B 2E5LJ 5D0EA 2CPIA 5F8IA 2FC8A 5IQQA 1TKXB 3PVXA 1SC6A 5I42A 2QA4S 5MAOA 1XNQJ 4FYWB 2AYEA 2JVOA 3BSAA 4G65A 3O2IA 2FVSA 3RZAA 1WTFA 2AKWB 1JLAB 1S9EA 1BGXT 1WOSA 1RHUB 4I2PA 1KHWA 3G8TA 2AEFA 2GS8A 5IXUA 3W60A 1QJHA 1XMOJ 2HS0A 2WVBA 1T11A 3DFEA 5J2MB 3L3CA 2XSJA 1RABB 2ATCB 1GAOA 2Q66A 2HRUA 4LF6J 1HQEB 2YKOA 3DKDA 2ASLA 2CQ2A 3LGHA 3TYTA 4CDIA 1RAGB 2FJAB 1IXKA 1NMEB 2UXBF 3MM7B 1FWKA 5LL6d 3H5UA 4ED5A 2XBPA 2AYBA 1YRTA 2B4UA 4I56A 3QJJA 5A6WA 4U7UD 1F3VA 1KHVA 1QY7A 1RB0A 1RHKB 2EBGA 3LF0A 3OR2B 1SKWA 1HNIA 4ZJQA 2GV1A 2MPUA 2MKSA 3EGZA 2UXBJ 3N01A 1XNRJ 2XSFA 2HWHA 1URRA 4RNNA 5D3GB 2DR6A 5HQMA 2D3OR 1Q16B 3N79A 4LFBF 1REVB 3QGHA 1HMVA 2MY8A 2HG4A 2VL1A 4DEZA 2WK4A 3A3PB 2IM0A 3MMAB 2ADBA 4N7TA 3MFHA 5CABA 4NLWA 2QLJB 2IBOA 1WC1A 1B7FA 1KFDA 3H4DA 5GAEI 5A8WA 3E3XA 2XLIA 2KT2A 2D69A 3KG1A 3NGTA 4I2QA 4QYRA 1K73T 4IR9A 2A18A 2ZWPA 5CZVA 2ZH4A 4NZ7A 1RHRB 2GHPA 3OBIA 1U1OA 2M0GB 2IA6A 3HVTB 2IJRA 4URGA 1S9GA 2C42A 4C4WA 1UJ6A 4ERDA 2FVPA 1Y11A 2ZHOA 1HL6A 4U7CA 4YY3J 3W2VB 3K17A 1LQ9A 2VFUA 3QZ8A 1U47A 2B7CB 1TQLA 1FEEA 2WW8A 1L3KA 1YJ7A 2YY3A 4KC5A 1CJUB 4OJHA 1CJUA 2ADCA 4WIQA 1XMOF 1W2BR 3PO5A 4IDKA 3HZEA 4QIGA 5ETKA 5KFJA 2R7SA 1RQ0A 4ZVQB 3ZFVA 3M8QB 3M8YA 3W2VA 1X9WA 4K4UA 2JRRA 4YR2A 4DV5J 2MGZB 3KK3A 1Q82T 1Q8IA 2GVDB 2YWHA 3T5HA 1HR0J 4GKKF 4LSZB 2BV3A 1D1UA 4X66F 3BQ1A 1F5CA 3MPWA 2XS5A 1LW2B 2X1FA 1WC4A 2W1BA 3DLGA 4TN2A 4RNOA 2V8GA 5E2QA 1VYAA 3KUHA 5ITHA 4OJGA 4OHYA 1UTAA 1A6LA 1R8HA 1KEKA 2I6WA 2C2OB 5LJ3Y 4DL4A 1U0HA 2RQMA 3TP2A 1S77D 5C25A 3J7YU 3HK2A 4DN0A 2J7WA 2AJ0A 1LK7A 4EK2A 4Y2CA 4IG3B 4TYAA 2C3OA 4I64A 1XQIA 2I1RA 4IFYA 3LQVA 3LP0A 3G6YA 2DNKA 1FD2A 3DGPA 5KFIA 4JI1F 1XIQA 4OIXA 3M2RB 3OL7A 1TKDA 4C8LA 1N5SA 1IJEB 3FSYA 3DLHA 2VODA 2AV5A 2XMWA 3FRZA 3QGIA 2GHWA 2AYMA 1IBKF 3K58A 1H2VZ 1R0CB 2VF3A 4X4SA 4DV3J 3JB9k 3CMES 2YQ0A 2M3DA 2KRRA 2B6AB 4ZS6A 1T9WA 4Q44A 1NK5A 3DNCA 4YS2A 1K0TA 3M6UA 2IHR1 4BC9A 4L3KA 1SQFA 4LRDA 2ZH8A 3F41A 3R5BA 5KFRA 1GXUA 1B0VA 1HQUB 5DLGA 4EYHB 2ATLA 1VC5A 1VQKS 1YJRA 1OY8A 2DISA 5LSRA 1R8CA 2H4WB 2LQJA 5ETTA 3BZQA 4B3MF 2QLFB 2AEJA 5K20B 1N6QB 1CJKB 4I7FA 1Y4ZB 1EP4B 2A1BA 3E01B 2CG4A 1FT8A 4IG0A 4RBTA 4D3HA 4WFAQ 3I38A 2KN4A 2V6AA 4RBUA 3ZNUA 5K8OA 2XYHB 2C22A 2ILZA 2R7VA 4ILRA 1WG4A 4KE5A 1J27A 1DTQB 1WI8A 5KFUA 1PBUA 1DURA 4XDCA 3V4IB 1JLGB 5DETA 1S1TA 2HYIB 2G4BA 1HWLA 1R6VA 1CC7A 4YP3A 5EWFA 3CXCR 2A10A 3D9BA 1OQ6A 4RKUC 5DDPC 5A8RB 3PX6A 4E0DA 4ZP9A 1UVJA 3QQCD 1G1XA 4QWBA 1RSCA 2HHUA 2R42A 4K5RA 1FRIA 2B4OA 4ZVSB 4OX8A 3QBCA 2O5DA 2U2FA 4K2JA 4ES1A 4DR5F 4Q43A 5BYSA 1T05A 2E1AA 4PQAA 4Q2MA 2BOAA 3A8IA 3QYYA 4DPYA 1P27B 1PJ6A 1UJ4A 4NYPA 4JI6J 2HBZB 1N0VC 2YNGB 4YN3B 3EXYA 2YKNB 5KG2A 3Q24A 2ZOMA 1NLTA 2QFIA 3OVAA 2VG5B 3LP1A 4B02A 1U1MA 1FESA 3PKYA 2C3YA 3PV8A 1M5OC 3HVAA 2B4PA 2CQ4A 3JAMY 5F8HA 2VJUA 1U6BA 1FKPA 2AX1A 4OI1A 2JC1A 4FNHA 4DFJA 3Q8SB 1TMMA 1S99A 3JTPA 3NOGA 2HQ3A 4FVMA 2BOPA 1FVSA 1RUSA 2WBRA 1J5EJ 3DLKB 4KR0B 3BDPA 1GX5A 5E3QA 3K59A 1X5TA 1FDNA 3HHLD 3OFFA 3D0GE 2ZD1B 3D3CJ 4QW8A 3VQSA 3VZHA 1BQNA 2C2DA 2PMZD 2AYGA 1RT6A 2I8EA 1QSYA 1S1WB 4C3LA 1RA7A 5J2QA 2EG2A 3CJTA 5C5JA 1FWLA 2Z56B 4PXBA 2IDEA 2HVHA 2KI2A 1VBZA 4H4KA 4DV1F 2K1RA 2BDPA 3SI8A 3EUNA 2X7IA 4G1IA 4PEOA 3CJQA 1VFJA 3UCGA 4DV1J 2B9EA 2VQFF 2RQCA 4NLOA 2RIJA 3TW0A 2VG6B 2Z2YB 4OYBA 2F4VJ 3ENAA 2J6TA 3KWMA 3WHIA 1P1TA 3KK2A 4O4GA 1B64A 2R8JA 1HNVA 3MF5A 1MU2A 3RGIA 3PW5A 2GA7A 1N48A 1X4DA 2B7BB 3OXGA 5D4LA 1D8ZA 2XM3A 4RO0A 2B6AA 2FVRA 1TV6A 2VHGA 2IJFA 3BBCA 4EGLA 5KG5A 3CC7S 2O67A 5KFMA 2C1EB 3A4TA 3LA0A 1T02A 1SXLA 1YJ9S 2VONA 1R0AB 3W61A 3OL6A 4CLFA 1K9MT 3QIPA 3PJWA 3OW2R 3UDEA 2L9WA 3T41A 5LT5A 1RYRA 1S4EA 1NSQA 3I56S 1SB6A 2CQIA 2I38A 3LGMA 4JB8B 4ETXA 5CA5A 4GVLA 4ECTA 2DR8A 3V5RA 3QZ7A 1XN9A 3MCSA 3PNIA 4BDPA 2HAIA 5D4NA 1FJGJ 2IVFB 5CYJA 1OYDA 2NSBA 4DZ6A 1QAXA 3MFIA 4AYBD 3PDNA 1FRHA 4PWWA 2CQBA 3D6MB 4M1KA 4JI2J 2F4FA 4JI3J 4LF8J 1S1UA 3CCTA 1ZZFA 3EGNA 4DWIA 2XMUA 1VOMA 5FD1A 4M5MA 2GAHC 5HVFA 2RRAA 2R7UA 4Y2AA 5A76A 2PDAA 4G1QB 3TA1A 2W4PA 4RL1A 4BWMA 5D0GA 4J9LA 3CCQS 4ECZA 4ED2A 4DHVA 5DDOC 3CCLS 1PYSB 1RWNB 1RADB 1IR0A 3MMJA 3HHLB 2ABYA 1Q7YT 3PW2A 1ITPA 5L8RC 3W5YA 1IBMJ 3GJQB 4OHVA 4OZJA 4O0IA 5KG6A 5CH7B 2DRBA 2M9KA 1TUGB 4K4VA 3NMAA 1JIHA 1KTVA 3CNQP 5F8NA 1S9GB 1IKXA 2DCUB 3NP5A 4TYBA 4O3RA 3MUMP 2DTJA 3HKZD 2NSCA 2Z4PA 4OHZA 4R5PB 4A48A 1Q53A 3CD0A 4A8SA 1BWEA 4C3MA 3ILLA 1X4EA 2YX4A 1KWMA 2B4VA 2C2ZB 3EYZA 4DF4A 3NNHA 1R89A 2CVIA 2DY1A 5FDLB 4BCAA 5IWAJ 2XLJA 1Q79A 3OFEA 4DV0J 1IQTA 1RBAA 1WKLA 3KJQB 2W8KA 4ED1A 2KFYA 5E7OB 1FNMA 3MUVP 3MEEA 1NHUA 2B3TB 2IM2A 5KG3A 3H8YA 4F2SA 3FFIB 5K8NA 2L9NA 1K44A 3KFWX 2LFVA 2NUHA 1C3GA 1RLCL 4GRSA 3ZZYA 2OI2A 5DGAA 4C8YA 4P7TA 4P74A 5K14A 4DR3F 4ID5B 3DYAA 2JZ8A 4F4XA 1BMQB 1X9SA 1YBTA 1FXDA 5L9XA 2XWYA 5T14A 4N56A 4LRBA 3E01A 3VALA 4Y00A 1CPZA 3GYGA 4KB7A 2KG0A 3V6KA 1YGYA 4A8MP 5ETLA 3HP6A 2BANB 5L1LA 2L9DA 2G2OA 3NBPA 5DM6Q 3M6XA 3VAGA 3WDOA 5AE1A 4NLYA 4R0EA 1B4SA 1PKUA 2JSXA 2RE1A 3BEGB 2ZDOA 1NSPA 4MFBA 3M9MB 4IOCQ 4CO3A 1XK8A 3BR9A 4JV5J 2A2DA 1U4BA 1JLCB 2IMWP 1FWPA 1FCAA 1DARA 1NH8A 2VFSA 3HD1A 3KTQA 4U7UK 3C66A 3SFGA 1R3NA 3T9NA 3P96A 3U1LA 3MPDA 1NHVA 2XZWA 3ZZRA 5CD4H 3LUYA 2E66A 2XMAA 1F5AA 3F56A 1U0SA 1HYSB 3NMRA 2RVJA 3BQ0A 2MQ8A 2FZCB 3TZZA 4RUAA 3PX0A 3QRQA 1Y5NB 3DRPB 3PCOB 4DR6F 4LFAJ 1EKRA 2JEIA 5JJBA 2DR5A 3DXSX 5IT9Y 2Q2GA 2HW3A 3BSCA 1EQMA 2RHQB 3PHTA 4A46A 4UOGA 1VRUB 3PXGa 3ET6A 4QU6A 4DSKA 3WC0A 3HVRA 3F44A 2BKPA 1W7WA 5EN1A 2CG8A 1VR6A 3IS9B 2F9DA 1N32J 1IBCB 1JB0C 2EG1A 1TELA 2RB7A 2YX1A 5J1PA 4TU8A 2N82B 2XS7A 4R8UB 2Y8WA 2GVDA 1HBNA 2RNEA 3RAQA 4M95A 1RISA 1X8DA 3LZ8A 3TJAA 2J76E 2EW9A 3OSPA 2UXDF 1R27B 4NLVA 4KV8B 2UXCJ 2XHCA 3MMCB 5I4MA 1CJVA 1M5KC 2ALZA 3HM9A 4EWTA 5KFZA 4LBHA 3ZTOA 1VISA 2OPPB 2ZBIA 3R27A 4J9QA 4DL2A 3OVBA 5KFDA 2DHXA 4WU3A 4HACB 3D67A 3MMCA 1HPZB 1NNDA 4JV0A 1LV5A 2DRDA 1AW0A 2GVZB 3OQ2A 4URQU 3IGVA 2KZZA 1FTCA 4OYPA 2ILYA 2NYIA 4CWBA 2DGVA 5KT6A 4DR6J 1RTIA 2VFRA 4A8FA 2GNKA 3LANA 3FRYA 4CLKA 5HQ8A 3JSMA 1UL3A 2VFVA 3RB6A 4QWAA 4HR2A 2FY1A 4B9MA 4NLRA 3VZIA 2LMIA 2QLDA 4F36A 2ZH1A 3A3OB 3MAHA 5KFWA 3CUNA 3V81B 3ZZPA 5GAHU 1ZM9A 2GJFA 2NCKL 1REVA 3ZTSA 3M8RA 3CC2S 3X1LB 1NRKA 1YVFA 3BV8A 4WTOB 1M1HA 1S5ZA 2QRRA 3M8PA 1QTMA 4UY85 1S1VB 2IYGA 1RT4B 2N7CA 1HNXJ 4CM0A 3A8JA 2V5HG 2JNJA 7AT1B 4LR8A 3HO1A 5CZXA 1P9YA 2BJ3A 4FBTA 3PJXA 3BPSP 3CDUA 2Y9HA 2E9ZA 1VHFA 3MM7A 3CCRS 4YOEA 1JLCA 2H5JB 1HBNB 2LXUA 2UUCJ 1H74A 4W4MA 4ZA1A 1NCLA 1WUUA 2K06A 2VIHA 1TFYA 4HHHA 2CPEA 4X4VA 3C6UB 2XHWA 4NRTA 4ZPWR 3H4BA 5SUHA 1PAUB 1S57A 2VPZB 4HLBA 3U27A 1QLNA 3J7ZT 3R6LB 3GG0A 2QV6A 3S8SA 4ECXA 1CJTB 3AOBA 1Y7PA 3J7AN 1E6YB 3V6HA 1MLAA 4G6VB 4FS2A 3OVSA 2EK1A 1N0UA 4OV6A 3RR7A 3ITHA 1X0PA 2B43A 3EXCX 3DHXA 4DBQA 5EWEA 1Q8LA 4CIOA 3RBEA 1RCXB 2IYIA 1X9MA 2IRUA 2BA9A 2PGCA 2ZBQA 1MWYA 3HFZB 2MB0B 1WNEA 4IQMA 2BJEA 3ULHA 1HYSA 3S01A 1U8WA 2HBYB 3TOQA 5AT1B 1JNZB 2AJ2A 2J9DE 5FIIA 2O01C 4H4MA 2VJVA 4N41A 1BHNA 4IOAQ 1L3SA 1UVNA 4HDGA 3MMBA 3I5BA 2B8QA 3I9V9 3W7BA 4NZ6A 2QLBB 4CH1A 1F9HA 4DR2J 2JLEA 4U8VA 3PYGA 4IRCA 4F8RA 1X4FA 1D09B 3ENQA 3ZZOA 1WG1A 4YDDB 4DCOB 1CQNA 2I9SA 3MTKA 5HANA 3HXMA 2D74B 3FEZA 3I87A 2R8IA 2LXIA 2VBYA 4DL7A 3G86A 3H2VE 3W8GA 4CT9A 1NJWA 2J9EA 2D9OA 3AODA 3MR5A 2YH0A 5B08A 4V19J 1FJGF 3CSKA 3MI7X 1KVJA 4IFVB 1T03B 4WCEQ 4DQQA 4N8NA 3DLEA 2MQPA 2HLTA 4WU2A 1WEXA 4ECQA 5JMNA 3DGVA 4CLPA 3H20A 4B9VA 1JJHA 3I32A 2ZUGA 3JSMB 4KTQA 3QRRA 1NDKA 3B78A 3NOCA 2EFQA 4QJVA 3C2PA 4WIIA 2RD5C 2MYFA 2WBMA 3OXFA 5KOXA 3BGOP 4J7CA 3PIPQ 4NWBA 4GKJJ 1C1BA 3EE3A 3FCHA 4LREA 3T5KA 1AYEA 1S4FA 4CH0S 1AFIA 4RW7A 4YB6A 2PN6A 3VHQA 1JLBA 4UOCA 5HBMB 2GGPA 4OZLA 3SV3A 4PUOA 1VBXA 4F3OA 4KHPJ 2VKRA 4R5PA 4A8KA 2PA3A 4B9LA 1QDUB 4XPCA 5H9FK 1IKXB 5FLXU 3OSNA 4DFPA 4GO7X 2DR9A 4WF9Q 4OX6A 4XIUA 2UUBJ 4LF4F 3NGRA 4BC7A 3DDKA 2G13A 4WWSA 4NYZA 4YDXA 6FDRA 3MPVA 3N6LA 3RTVA 4UOHA 3GILA 3KLGA 4WE1A 2BJ7A 1FX2A 2J0WA 2DT9A 5AE3A 1M5VC 4OZ1A 3TEGA 2EVZA 2VPWB 4L3NA 4M5HA 5H9EJ 1YTYA 1IN0A 2RQ4A 3KHLA 1UKUA 3LGNA 2ZC4A 4DV6F 5LOQA 3BPDA 1N34F 5EHHA 1TVRB 3HCXA 5J2NA 3R7BB 1AFJA 4O0NA 5E3AA 2QA2A 2ZVSA 5D4OA 5KFTA 1KOOA 2FY8A 3K8VA 4Y28C 3NKYA 4HT5A 2CRLA 1DTTB 5B0EA 1DY3A 1HARA 1FDAA 3RB0A 2W4CA 4WPAA 5LSLA 3GV7B 3GYNA 1N33F 2ZOGA 4KGZB 1RE1B 2W9CB 3BBBA 3Q86A 3L7UA 1YITS 3SIPB 1JNRB 4ZMMA 2PFFB 2Q3PA 3VGTA 2EBEA 4F3QA 4F02A 5AE2A 1FRLA 2D3O1 1IM6A 4C8NA 5LSOA 3K5PA 4V1Ak 2ROPA 4IO9Q 1R0AA 4NZ0A 4J9PA 2FGOA 5KAKA 2C2MB 4RJVA 3GV5B 3DRRB 3A8EA 3TUZC 1WI6A 3MR7A 1RYSA 4MH8A 1VQSA 4LFAF 3G2XA 4K2XA 1HBOB 1UP1A 2P5VA 2OPSA 4KKOA 3G8SA 2PC6A 3GU0A 2CXEA 3RG6A 1RU2A 3HHNB 1WF0A 2W9AA 4FF1A 5B0BA 3KK2B 2OSQA 2K8GA 3M32A 1XTZA 1U2RA 4JBCA 3R5DA 4OZNA 5EX0A 4DPTA 4LF8F 1UAWA 1VIOA 3QATA 2ASDA 4FPRA 2OFHX 2XMVA 3KNGA 4KHRA 4LVOP 2HQFA 3HHLA 1O8BA 3LH2S 3Q8VA 4DL6A 1LW0B 5C2GA 4USWA 3HSDA 2PEHA 2A0FB 1IVZA 1NPPA 1HA1A 3UW1A 1F6TA 2LEBA 1Q5YA 2IA0A 2YNGA 5M2UA 1GTEA 1H3DA 3MM6A 1S0OA 3US5A 1E6VA 2MZRA 3KYLA 2F4VF 1UA0A 1KOHA 1VRQC 2UZAA 2GHVC 2AJ4A 2CNOB 3AFGA 5FDLA 5G0RA 4WXWA 3K0JA 2CPHA 4MIAA 3J81Y 2HVIA 4LQ3A 3R5GA 5G0RB 2APOA 1ZAVA 3HD2A 2OTJS 1GX6A 5I3UA 2FZKB 2B5JA 4FKYA 4USVA 4RPFA 4ENOA 1PJ5A 3J80Y 2FHOB 1PIEA 1DTQA 3BN4A 2ERRA 1VQLS 1I1GA 1N4LA 3T3FA 1RAAB 1CBKA 3I0SB 1AZSA 4ZVOB 2Q43A 3ISZA 3JSYA 1AA1B 2AX0A 2CPFA 5G4DA 3VF0B 2VQFJ 3B4DA 1TV6B 1PJ7A 2RF2A 3SDEB 3MHYA 1UFLA 2Y1JA 1SQGA 2RRBA 4DF8A 1ZETA 1C1CA 5CYQA 1P8GA 2VQEJ 1IBKJ 1EJ7L 1WKKA 1KSPA 3HMJG 1O51A 4O23A 3IRXB 2ZH7A 4RWWA 1U24A 2DGUA 2Z0GA 2LLZA 5E0OA 4P2XA 4B17A 3TQEA 1RK8A 4QZVB 2DNQA 2DGWA 4ZIWA 3HFVA 4DS5A 1R43A 1TAQA 2DH9A 2VASA 3NGUA 4TKTA 3EJMA 3UO0A 2XGQA 2RRNA 2L41A 1IKYA 2H51B 4W90B 4JI3F 1LFPA 4DCPB 1S9FA 1V3RA 3LPYA 2R7TA 2YKMA 3PW0A 2OEJA 3AQPA 3MTJA 1U49A 1SC1B 3HFKA 2DB1A 1HR0F 4PPZA 1YI2S 3W62A 1QE1A 3V6DA 3T5JA 1YRUA 5DJBA 2KFZA 1SQEA 1EP4A 2DYAA 5DRKA 4QWDA 4OYAA 4RW6A 3Q8UA 1M90T 5D77A 1RT7A 1C0UA 3NCPA 4C8KA 4KSEB 1KQFB 1TL3A 1KONA 4P10A 4C48A 1TUVA 2YWGA 3DN9A 3IP0A 4USTA 2DXFA 1FRXA 4ZHRB 5FLXY 2J0XA 1XMBA 1TL4A 2PD1A 2RUGA 3JQJA 4USUA 1C1CB 4QR0A 5CYQB 3POTB 3G87A 4Q0BA 2O1PA 3TX8A 2Q6BA 4DS4A 3KOAA 3RYLA 3IG1A 5KFVA 2E5GA 1VDHA 4A4JA 2OMLA 3RUBL 2ZH3A 1NB7A 2V2VA 2ASJA 2GO8A 4YHHJ 2FLOA 2JEGA 3CD6S 4ZVRB 4LMZA 3WBZA 5H9EK 2IRXA 4KFBA 4MK7A 5J2QB 3Q8YA 3GFXA 1RT6B 3VAIA 5HQLA 3RBDA 4O44B 4Z7YA 4J37A 4NLDA 2HBRB 3R2DJ 4LFCF 3LALA 4PUOB 4ED4A 1LWFA 1UZHA 1LWFB 3KLEB 3KLEA 4PG4A 2ZOFA 3VAHA 3R2CJ 2DHSA 2MLXA 3DLGB 1FEHA 2OP5A 4B3TF 1N5VA 2C2KB 2WB1D 2DNMA 3D54A 3AOAA 3IM8A 3EZ5A 3QRPA 3FQLA 2GC8A 2IFXA 3QT7A 3UN3A 2HHPA 1S59A 2J8AA 1GT8A 1X5PA 4KFBB 3J7A1 3PIOQ 3GYXB 2PE8A 1NM2A 3PHEA 3M7VA 1RT5A 2GQ2A 3MR2A 1F60B 3K5LA 2LDYA 1CS4A 1NBEB 4PWDB 2GO9A 5MLCV 3LTOA 2JVRA 2VOOA 2DIVA 2E9RX 3GIIA 3LO3A 4DSIA 1WOPA 4AXJA 4C6AA 3C15B 4RX6A 3CWJA 4PXEA 3POTA 1WSVA 4PQUA 1SC3B 1JLQA 3RRGA 1DJ0A 2H48B 2KU7A 3BS9A 3OR2A 4LF5J 3MXHP 1HQUA 1WEZA 2V8VA 2WOMB 4CP5A 1FO1A 1RWKB 2Z2ZA 1S6PB 4ZVUB 1FFGB 4C97A 1NKCA 1FJEB 2ZE2A 4HTJA 1ZTTA 4MKYA 3L9ZA 2V4QA 2N3OA 4KAIA 5HMXA 2YPYA 3WC2A 4FVCA 1T9XA 1YLXA 2RJZA 1U09A 1XMQJ 1JX4A 1HI8A 3MMBB 4YB5A 2HLUA 4DR7J 3FQKA 3DMJA 5EX3A 2MKKA 1J5OA 4Q7AA 3MPYA 3O6QA 3L09A 1P1LA 4J9NA 3QWPA 1RAEB 2OO4A 3UR0A 3W8PA 5KT3A 4ETZA 4LF9F 1S1TB 1OSCA 4OL8A 2LDIA 3CEDA 5CHCB 4UW2A 2FLLA 4XO0A 4X4RA 4RLEA 2VC1A 1GMWD 4JOUA 1Q1KA 3LOUA 4DPXA 1Q7LB 1X4HA 2MJUA 4E8UA 3CCUS 1DTTA 2VBWA 4OLPA 1FKAF 1RACB 2K7JA
chains in the Genus database with same CATH topology
3LA0A 1NLTA 1C3GA 2QLDA 3L9ZA 1EB0A 3I38A 3AGYA 1EARA 1GMUA 3TJ8A 2Q2GA 2HFVA 1GMWA 4L3KA 3TJAA 4J80A 1XAOA 3TJ9A 1GMWD 3NXZA 3AGZA 3NY0A 1GMVA 2B26A 3LZ8A 3AGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA0 A;  1NLT A;  1C3G A;  2QLD A;  3L9Z A;  1EB0 A;  3I38 A;  3AGY A;  1EAR A;  1GMU A;  3TJ8 A;  2Q2G A;  2HFV A;  1GMW A;  4L3K A;  3TJA A;  4J80 A;  1XAO A;  3TJ9 A;  1GMW D;  3NXZ A;  3AGZ A;  3NY0 A;  1GMV A;  2B26 A;  3LZ8 A;  3AGX A; 
#chains in the Genus database with same CATH topology
 1FTR A;  3Q2T C;  1ARO P;  2BAC A;  2KM8 C;  3CPW R;  2QZ8 A;  4DQI A;  2KYX A;  4QYZ K;  1UMJ A;  4RW4 B;  3G9C A;  2HUR A;  3BO4 A;  3QT5 A;  4M5J A;  2E1R A;  3T6B A;  4ZLN A;  4PRF A;  4Z2X A;  4KHM A;  4NA2 A;  1V3Z A;  1OPI A;  2OEK A;  4RWX A;  2I2Y A;  3HX9 A;  4C7Q A;  4HH0 A;  3CCJ S;  2HQG A;  3CJS A;  4WTY A;  2MKY A;  2EEY A;  5CCL A;  5L1K A;  4O3N A;  2NPF A;  1H73 A;  3GR1 A;  6AT1 B;  1QTN B;  2MQQ A;  2BQR A;  2R3V A;  1RT5 B;  3U02 A;  3KNA A;  4K0K J;  4PWD A;  3LP0 B;  4A8W A;  2HND B;  2W8L A;  4I69 A;  2YVS A;  3EGV A;  4P72 A;  2CPZ A;  4DX8 H;  4YB1 P;  4Y2M A;  1RTJ A;  2D1C A;  5HVH A;  4I6A A;  2CZV C;  2NXC A;  2QIF A;  2QG9 B;  1GFW B;  1W26 A;  1NO8 A;  1SJF A;  4I68 A;  2HQD A;  1S10 A;  3I96 A;  3ADA C;  1LXN A;  1YJW S;  4F50 A;  4NRU A;  3BN7 A;  2NXU A;  2KVI A;  3OFH A;  2PA8 D;  3KLV A;  1TKZ A;  2H5I B;  4NI2 A;  3UVJ A;  4Z7C A;  2GVZ A;  4JP8 A;  1LOU A;  3M6W A;  3UWT A;  3P3D A;  1ZA2 B;  2AWZ A;  3N0V A;  1HIY A;  3VGU A;  2Z2L A;  3RAM A;  4N5S A;  2OPR B;  3FEX B;  1RBO B;  1UVI A;  4ZVE A;  4K5S A;  2FVC A;  1U1K A;  3KMQ A;  5DQG A;  1L5U A;  2YWW A;  4WJB A;  3LPE A;  2P9E A;  3ZNJ 1;  1NK4 A;  1X4A A;  4WZM A;  2BE7 D;  4ES2 A;  1R8B A;  2GZO A;  3UDL A;  1TL7 B;  1N33 J;  4DU8 A;  1OWX A;  4WFN Q;  2OPS B;  4IH5 A;  4DX5 A;  2AGQ A;  1C0U B;  4ZCI A;  3AGY A;  2JZ5 A;  3TI0 A;  4RNF A;  3A12 A;  1VBY A;  4W92 B;  1SKU B;  3C46 A;  3CIZ A;  1T9V A;  3DOK B;  1UWA A;  2ZH9 A;  3HJV A;  5J2M A;  3GLJ A;  3CDW A;  2HHH J;  3N6N A;  4OJ1 A;  2YKM B;  2AW0 A;  3PTW A;  4DUZ J;  1HNW F;  3R97 A;  5GME A;  1QVF R;  2QMW A;  1TK0 A;  4L74 A;  2W2P P;  4B3O A;  2OTL S;  3UCZ P;  4TLR A;  1FRM A;  4YUD A;  2BE2 B;  3R9L A;  4A47 A;  5KFN A;  4RUC A;  5D3G A;  3FCV A;  2GIQ A;  2OPQ B;  4ZIT A;  5BJR A;  1MSW D;  1TP7 A;  2D7S A;  3SSR A;  4TQR A;  3R1L A;  4CCH A;  1DBD A;  1VJW A;  1L3T A;  4CLZ A;  2Y0S D;  3EVM A;  1HWI A;  4N76 A;  5DO2 A;  2PT0 A;  3W9J A;  1PIL A;  2VD3 A;  2YPZ A;  1RT3 A;  4LFC J;  3QO9 B;  2RKI A;  2G2Z A;  2YNH A;  3IWX A;  3FSX A;  1BC6 A;  2HHX A;  2W25 A;  3A1Y G;  2JRS A;  3AD7 C;  3I0R B;  3A8K A;  1F3F A;  4UF4 A;  1I94 J;  5BR8 F;  3DI6 B;  1Q8K A;  3QNW B;  5ETM A;  1N5Y A;  3W2W B;  1KDN A;  2DNR A;  1HQE A;  3S1T A;  5F8J A;  4KYZ A;  1FKO B;  1QUV A;  5L1I A;  4UQT A;  4NXN J;  2XB2 D;  4AUK A;  5LMN J;  4YME A;  1P9Q C;  2G1H A;  1K47 A;  2RSQ A;  5F9L A;  5F9N A;  3M8P B;  5JVH Q;  3CD5 A;  2R7W A;  2Q1L A;  3DCA A;  5C42 B;  4IRK A;  2EI5 A;  3IFE A;  5HAT A;  5D15 A;  1B0P A;  2VPY B;  2NQP A;  4EUV A;  3EVO A;  3H5Y A;  3TAN A;  3TAM B;  3GR0 A;  1HD1 A;  1HHT P;  4F4W A;  9ATC B;  1YZ7 A;  2JC0 A;  1QSL A;  2RHS B;  5H9F J;  4LIW A;  1MML A;  2ACY A;  2DD8 S;  2IM3 A;  2G0J A;  4OI4 A;  4S0M A;  3PJ9 A;  1G4C A;  2CPY A;  2P9C A;  2QLW A;  2VIC A;  2E9T A;  3GSI A;  4A8X A;  2XY6 A;  2V68 A;  1UVM A;  4JV5 F;  1A7G E;  2K2P A;  3QLH A;  4J9K A;  3W3S A;  2VOP A;  1HWK A;  2QMU B;  3OL8 A;  4QIF A;  3MM6 B;  3QFH A;  3KG4 A;  4OI0 A;  3BRE A;  3E8O A;  3AB4 B;  2KVQ E;  4PAA A;  4F25 A;  2V4J A;  2XGP A;  2GJI A;  2P6S A;  3AH6 A;  3VAM A;  4U6P A;  4LVN P;  1XNQ F;  2HNY B;  3RU0 A;  3VVT A;  3C19 A;  1WF1 A;  3G82 B;  4O3P A;  3BGL A;  3JXO A;  3I31 A;  3NRB A;  1T95 A;  3U7J A;  1GMV A;  3DOM A;  2OPP A;  3WZ0 A;  3SQO P;  4RR5 A;  5DGB A;  1VS3 A;  2DNH A;  1Y5I B;  1WHY A;  2MJN A;  4M5I A;  4PYD A;  1T3O A;  5KFO A;  1Z2L A;  2WHO A;  2CQ0 A;  3KLI B;  1D9A A;  1F2H A;  1RBL A;  2DNZ A;  3GB0 A;  1T7P A;  2XY7 A;  2DGO A;  1UZD A;  1L3U A;  1RCO B;  4RUB A;  4DR1 F;  3R6G B;  4FN5 A;  5IC6 B;  3RAX A;  4DCJ B;  1TK8 A;  2EFO A;  2YNH B;  1RT1 A;  2KJW A;  3Q89 A;  5HAO A;  2LEC A;  5DM7 Q;  2HMI B;  4ZVF A;  2X3G A;  4DFM A;  2F8E X;  3NGK A;  3DHW C;  5KFA A;  2VQE F;  5B0D A;  2V2Z A;  1NK9 A;  1J5E F;  5K8M A;  3Q8R B;  2W7P A;  4X65 F;  1MN7 A;  3AJD A;  1K1S A;  5A6P A;  3BDE A;  1YJV A;  1RGV A;  1SUQ A;  3IXQ A;  3N28 A;  1VBK A;  4RZR A;  3H59 A;  2BXJ A;  3ELH A;  2W2O P;  3AGZ A;  3T9Z A;  4D3G A;  5HRO B;  5HRO A;  1ACM B;  2ZNY A;  3CDA A;  2A2C A;  2F63 A;  3DRP A;  4X62 J;  1SUQ B;  2DEI A;  4PZV A;  2WW4 A;  5E3C A;  1RZM A;  2CNL B;  3VQT A;  5C42 A;  3QIP B;  4C98 A;  4KQZ A;  2KKH A;  4U9R A;  1JXV A;  4UUX A;  4X64 F;  1S0N A;  4NCG A;  3QPI A;  3UPF A;  1DRZ A;  1HW8 A;  2IAJ B;  3DOK A;  2A3J A;  3SBM A;  2KM8 B;  2VBZ A;  1WF2 A;  3CF5 Q;  4A8Y A;  2L48 A;  1X0F A;  2Y0B B;  5DLF A;  4HHJ A;  2OGU A;  3W2W A;  3C3L A;  2DJW A;  3EDQ B;  1F9F A;  4PG7 A;  4GKJ F;  4F4K A;  2BW2 A;  3TJ8 A;  4DL5 A;  3ZTR A;  1A0O B;  1HNV B;  1EET A;  2FD2 A;  1DQA A;  1RLD A;  3QO9 A;  4MKB A;  3VGS A;  4P9S A;  2J5A A;  4KGK A;  1CQM A;  3FC9 A;  5DG9 A;  2YNI B;  2HGM A;  1BE4 A;  2VFT A;  4ICL A;  4UUW A;  2PI4 A;  1T9T A;  3PRB A;  4NLG A;  1RT4 A;  2OFG X;  1MNE A;  1UPP A;  3HHK A;  2CQH A;  3NY0 A;  1RTH B;  2DPI A;  4F04 B;  1VQ9 S;  2VV5 A;  2OPQ A;  2HNY A;  4AL7 A;  1V5I B;  4IUF A;  5KG4 A;  3CO0 P;  1SL2 A;  4ZJL A;  3D0H E;  1JLB B;  1FX4 A;  1UEV A;  3GIJ A;  3JTO A;  3NS6 A;  4KRW A;  1IM4 A;  2HAF A;  2ZWO A;  3CJK A;  4CLL A;  2D9P A;  5ETO A;  1VLO A;  5U47 A;  5EDW A;  3KJN B;  4CH7 A;  2CNN B;  2ZHB A;  5AXN A;  4DV7 F;  4DSJ A;  2ZZN A;  2RH3 A;  4LR9 A;  1S72 S;  4QCL A;  4QIV A;  1WHW A;  4ZPV R;  2V34 A;  4U96 A;  5CD4 A;  5IT9 U;  1Y10 A;  1Y00 A;  1Z2Z A;  3DLE B;  4H4O B;  7FD1 A;  3BKF A;  4CI0 B;  3NWR A;  1GXL A;  2ZM6 F;  1EHW A;  2JJ4 D;  2QL7 B;  2DKO B;  1D3W A;  3WQP A;  3D4J A;  3MR6 A;  5A0Y A;  3KKF A;  1JJ2 R;  3OTD A;  3VGV A;  4CYU A;  4L6V 3;  1OY6 A;  5AJ3 F;  3M8S A;  2XZT B;  3FUY A;  4DR1 J;  2V4J B;  4EZ9 A;  4H54 A;  5A8K A;  3HT3 A;  2BM1 A;  2MTL A;  2O66 A;  1FNX H;  3G96 A;  1IQZ A;  3UFC X;  4CQ1 A;  4NI2 B;  3UVJ B;  1G2E A;  2DGT A;  2W01 A;  1H7X A;  4R8U A;  3QLH B;  1U45 A;  2HPU A;  4NLQ A;  3ZO7 A;  5HP1 B;  4KBI A;  1JLF B;  1FDD A;  2FQQ B;  1M0S A;  1FJ7 A;  4LIR A;  4XAK A;  2Z30 B;  4FXW A;  4OLO A;  3SEO A;  2BW7 A;  4MJK A;  2WRM A;  4PXD A;  2NXJ A;  3TQ1 A;  2HIY A;  2W2Q P;  3V4M A;  1VRU A;  2RS2 A;  3C16 A;  1WC0 A;  1QM9 A;  4DU7 A;  1RXO B;  3EM1 A;  4DV5 F;  1SVD A;  2LVW A;  3MAQ A;  1CVJ A;  4CLT A;  4K50 A;  3A13 A;  2XG8 A;  4QBU A;  4U95 A;  1B99 A;  5ETN A;  2HND A;  3CJ2 A;  3O5T B;  5K5M A;  2XUL A;  2K7K A;  2DXD A;  4YEA A;  2ZJR Q;  4OYX A;  2UV8 A;  4OV1 A;  4OQJ A;  3JYT B;  3PKM A;  2DO0 A;  1J5O B;  1U26 A;  1XR6 A;  4M5G A;  3BYR A;  1T94 A;  2FHM A;  1FNO A;  3TAR A;  1VJQ A;  3K8W A;  4JUZ A;  4CO1 A;  2VA3 A;  3H25 A;  1IKV B;  2KJV A;  1VRT B;  2N3L A;  3D6F B;  3I0R A;  3BQ2 A;  3PRD A;  4X4Q A;  2BZ2 A;  2GX8 A;  3IGN A;  1NK7 A;  4IRD A;  4RNM A;  4AL5 A;  1T8E A;  3KDO A;  4ZVT B;  4RNH A;  4UQG A;  1S7H A;  4K0K F;  3BSO A;  5I3P A;  2V8D A;  5LMN F;  4WYW A;  2HQC A;  4IYQ A;  2C3P A;  4QIE A;  2QLX A;  4KIA A;  4OHX A;  4DZD A;  5E5N A;  4GC7 A;  5BR8 J;  2FVQ A;  1SBR A;  3GV8 B;  3QAU A;  3W64 A;  3M4X A;  5GAD U;  3OJS A;  3M9N B;  3AGX A;  3SCJ E;  3HF5 A;  5D6G A;  2VA2 A;  4DJB A;  5IV3 A;  4FPI A;  4NE9 C;  4GO5 X;  3DGP B;  1Q81 T;  1YRX A;  1RWM B;  2NYH A;  2JHE A;  4MIW A;  3FSI A;  4OYZ A;  2YXL A;  4IH6 A;  2HHS A;  2LQ8 A;  4ZPT R;  1HWJ A;  3BSN A;  1B70 B;  1U2C A;  1U02 A;  4O4R A;  2HK3 A;  3O1L A;  1NU4 A;  4JI7 F;  5M2R A;  3R5J B;  2BKN A;  2IM1 A;  3AJ1 A;  4ER8 A;  1U1R A;  4WZQ A;  2DNP A;  1VIX A;  4ECV A;  3K5N A;  4MIB A;  2MDA A;  1UPM B;  3CJ8 A;  2NS1 B;  4DUZ F;  3D1O A;  5SZT A;  5HI7 A;  1Q95 G;  2UUA F;  2HHH F;  2LEA A;  3T19 A;  2KXH A;  1SI9 A;  3AY0 A;  4BBY A;  4LF9 J;  2ZDP A;  4HVZ A;  1Y9O A;  5BYR A;  4B3R J;  1JLQ B;  2ROE A;  5KTQ A;  4PQU B;  4U8Y A;  3GSD A;  2JLF A;  3KXD A;  4EZ6 A;  2ZH2 A;  1FXR A;  2V67 A;  2R7Q A;  3SCL E;  5F0W A;  2UUA J;  1TZ0 A;  1RHM B;  2WON A;  1DLO B;  3FEY B;  3IBF B;  3KLF B;  5AXK A;  2EC0 A;  1IJF B;  2D41 A;  1H7W A;  2XMT A;  3H7H B;  4Q2L A;  1DQ9 A;  1EAR A;  3RW7 A;  1S1U B;  3OTE A;  4ITS A;  4O3O A;  5K8P A;  2XYP B;  4RW4 A;  2C28 A;  1LWE B;  4P6Q A;  1H38 A;  3QSI A;  1TL3 B;  2G0C A;  1M1G A;  1Y3K A;  3M30 B;  2ROG A;  4P71 A;  3NAH A;  5BYQ A;  1XEZ A;  2BE9 B;  3EDR B;  4RW6 B;  5HJY A;  5KT4 A;  1TMJ A;  4MYU A;  3DU5 A;  4DR7 F;  1RT2 B;  3ZTQ A;  1QAI A;  1PSD A;  4E98 A;  2PSZ A;  1JLG A;  2V2K A;  3V4I A;  2MZS A;  1MMD A;  1NZA A;  3BF4 A;  1AUS L;  2EKN A;  5C24 B;  5AJ3 J;  1Y5L B;  4F67 A;  1TR0 A;  2Y1R I;  4KO0 B;  4Y3C A;  1DZ5 A;  2F5G A;  2AF6 A;  1RWW B;  5ETR A;  3ZZZ A;  1QSS A;  4LF5 F;  1F9E B;  1OYE A;  3R7S B;  3NL0 A;  1UW4 A;  1YJT A;  3DMJ B;  3SFU A;  3GIR A;  3O8W A;  3THT A;  4OX9 J;  1Q5V A;  2V94 A;  5F8G A;  1MG7 A;  2Y3Y A;  3HSJ A;  4P2F A;  3D28 A;  2HFU A;  3OV7 A;  1Q0N A;  2DNO A;  3TAQ A;  3RW6 A;  1NUE A;  2EC2 A;  4DQR A;  2KG1 A;  1U1L A;  3DLL Q;  3EPI A;  4FYD A;  1FFW B;  3IRX A;  1IUJ A;  1ZM2 A;  2BYC A;  3MEC B;  1OY9 A;  5JUM A;  3MCM A;  5IV4 A;  1RT7 B;  2J9C A;  3W9I A;  1PC5 A;  5HMZ A;  4AL6 A;  2RML A;  5KFC A;  2CAD A;  2UP1 A;  4B3T J;  1YJU A;  5ETS A;  5F8L A;  2KB2 A;  3EVW A;  3ONQ A;  4KPC A;  4N47 A;  3ILJ A;  1HKA A;  2HS3 A;  4WBF A;  1N36 J;  4ID5 A;  4H4K C;  1YK9 A;  2R2R A;  1FDB A;  4OI2 A;  3ILO A;  3MEK A;  2AEM A;  2P2C B;  2Q79 A;  3CJ3 A;  3P45 B;  4GMK A;  4J9S A;  3FFI A;  1K8A T;  2WVD A;  2UXD J;  2B5J B;  1VQ4 S;  1RT2 A;  2JDJ A;  3AD8 C;  3DC2 A;  4OYO A;  3MM5 A;  1JLA A;  2QEX S;  4TU7 A;  2QTW A;  4ZP7 A;  1FJC A;  5KG1 A;  2ZEJ A;  1X5S A;  2R7X A;  2V63 A;  3GJR B;  1XR5 A;  2ZJP Q;  4IOB A;  1NDL A;  2FZG B;  2H1Y A;  5IOL A;  5JXS A;  1JJC B;  1M5P C;  2PEB A;  2ZIT A;  2HQI A;  3QT8 A;  4O44 A;  3KLH B;  3CTR A;  1VQP S;  4WP9 A;  3NNC A;  3AQO A;  4EO8 A;  1BQM A;  2LU1 A;  4LSL A;  3HDS A;  3VVU A;  1IWA A;  4CTA B;  3CJR A;  5F3T A;  3TA2 A;  4EFA C;  4L73 A;  2IVM A;  2LQ5 A;  2ZKT A;  3M8Q A;  1R7I A;  4OYM A;  2DNG A;  2ZZT A;  3Q83 A;  4AXI A;  2QGF B;  2W24 A;  4K4Z A;  4EBE A;  3QFW A;  5C2C A;  1S0M A;  2LYV A;  4X64 J;  3KHR A;  1HHS A;  2MMY A;  5IZH A;  4PWU A;  1KC8 T;  1H72 C;  5E3R A;  4X62 F;  4MTP A;  2F3J A;  3QMQ A;  3SV4 A;  4R0J A;  1SCJ B;  1R0B G;  2I5J A;  5I3Q A;  4DDF A;  3P6Y C;  5CXT A;  1H2U X;  2E1P A;  3DDI A;  4JI4 J;  1URN A;  3DLJ A;  4X4N A;  3G71 S;  1NKB A;  2CJB A;  4RW9 A;  1FA0 A;  5L1J A;  1CEZ A;  4QU7 A;  1VQN S;  5IT0 A;  1SJ4 P;  2U1A A;  1KNZ A;  1H0H B;  2GML A;  4TXS A;  1VI7 A;  4UTG A;  3AJ2 A;  5LXY A;  4N8O A;  4ZP6 A;  2XC9 A;  3JS9 A;  2H5E A;  2B9X A;  2E5I A;  4ALZ A;  2HIQ A;  1KKH A;  3MMA A;  4HHU A;  5KT5 A;  1OJ4 A;  3AHP A;  3IR6 B;  4HTI A;  2UV8 G;  2BJ9 A;  4A8Q A;  3GP9 A;  3N5B A;  4DG1 A;  1HNZ J;  4KPY A;  3CJ0 A;  1EB0 A;  3FVY A;  2KHD A;  1NEE A;  3UI3 A;  1IKY B;  3EMT A;  5IM0 B;  4B9S A;  4CLS A;  1B0T A;  2VDI A;  2WSF C;  1LW0 A;  4PG6 A;  2DPJ A;  1IKW B;  1FK9 A;  4TY9 A;  3KJV A;  1RTH A;  2UVW A;  4ZPA A;  1HQ2 A;  4EO6 A;  3CVK A;  1N6Q A;  1QVG R;  5IS2 A;  2MZQ A;  1PC4 A;  4ICL B;  2HRT A;  3MD3 A;  2B9W A;  2LQB A;  4LR7 A;  4DV0 F;  4ECS A;  1X60 A;  4DUY F;  1ZPV A;  1X5O A;  4OYI A;  1Q86 T;  2YQ1 A;  4O3Q A;  1EX8 A;  1XAO A;  2M8H A;  4C3K A;  4J5O A;  2LKZ A;  1S49 A;  4LF4 J;  1WOO A;  1EET B;  1FRJ A;  1TUW A;  2JX2 A;  4HT7 A;  3NXZ A;  2HVZ A;  2PMW A;  1B3T A;  4NCA A;  4AND A;  2HFN A;  2YNF A;  4GVB B;  1TAU A;  1ZYQ A;  1RWP B;  3IA0 A;  1QAJ A;  1DQ8 A;  4JI4 F;  1KR4 A;  1R8P A;  1Q8B A;  2J9D A;  2FJE B;  3AA9 A;  2WCX A;  3TA0 A;  2ZBP A;  1D9D A;  2FJV A;  2DEJ A;  1TKT A;  2HWI A;  1KBR A;  4KO0 A;  1ZH5 A;  5L38 A;  1F1B B;  4OZ5 A;  5KG7 A;  2CA9 A;  2E5J A;  1OO0 B;  1Y3J A;  1NJX A;  4X4T A;  2R7O A;  4WFY A;  4IFY B;  4I2P B;  4LBP A;  4L75 A;  3D1Q A;  1PYT A;  2BRL A;  3CD7 A;  2GAG C;  4TNO A;  5A2Q Y;  3K5M A;  4JI5 F;  1JWW A;  4ZVG A;  2CAJ A;  2ZD1 A;  3B6B A;  2L08 A;  1GMW A;  1YKW A;  2W9B B;  2ZH6 A;  3M1V A;  3CW2 C;  1I51 B;  1NPK A;  3DLK A;  2OSR A;  4RW9 B;  4DSE A;  1UEK A;  3GPA A;  3ZC4 A;  1I94 F;  4LF6 F;  3DU6 A;  1FE4 A;  2M7S A;  2AJQ A;  2CQP A;  1LWE A;  3IAM 9;  1NXI A;  3TWZ A;  4AQY F;  3QJL A;  4HI1 A;  2G1D A;  4C0B A;  3RRK A;  4FXV A;  4K4S A;  1XJW B;  1S6U A;  2WAQ D;  5T7L B;  4K4W A;  2CVE A;  4LSN A;  3H2L A;  2D3Z A;  1GEH A;  2GCF A;  2HVE A;  4OJ3 A;  2HEK A;  3ISN C;  3C5X C;  3KLI A;  3OPK A;  1NJI T;  1BY9 A;  3MEG B;  4ED6 A;  1ZTW A;  1NKE A;  2X1B A;  5M2P A;  2HGL A;  2BQ3 A;  3NS5 A;  2KYZ A;  3FBC A;  1NPR A;  2AMC B;  3MOZ A;  3IC1 A;  5B09 A;  4J9V A;  2FTR A;  3D1H A;  3FJ2 A;  1H98 A;  3C6T B;  3U1M A;  4ZPC A;  1GK8 A;  3PM9 A;  4CTA A;  2OEL A;  4EI2 A;  3MM9 B;  4NYO A;  4OYW A;  1GQE A;  1LKZ A;  1BQM B;  2RUS A;  3H5S A;  5GVQ A;  5B0C A;  2JL9 A;  4FDF A;  3RBZ A;  3UN2 A;  4Z37 A;  1DAX A;  4X65 J;  4B3M J;  2ODX A;  1XC9 A;  3KK1 A;  3KLH A;  2FC9 A;  3SCK E;  3MED A;  4NA3 A;  3PZP A;  2FLN A;  3D7S B;  1ICE B;  1VMB A;  3M8W A;  4I2Q B;  2LXF A;  1NB2 A;  3GZ7 A;  3UD3 P;  4TY8 B;  8RUC A;  3OLA A;  5A8W B;  2JWN A;  3MM5 B;  4O3S A;  2VH7 A;  5EGY A;  2XI3 A;  4WK3 A;  1QAY A;  1ZBT A;  1N5T A;  1E6V B;  3EIC A;  4AE5 A;  1ZOT A;  4MK8 A;  2DNL A;  3PFO A;  1IR2 A;  4DQS A;  4U67 Q;  1IBL F;  4HYK A;  1CUL A;  1NAQ A;  3ZZU A;  4Q5V A;  1WD6 A;  1CJT A;  3DOL B;  2PFD A;  3R8Y A;  4FF2 A;  1U1N A;  4OZ2 A;  3CE8 A;  2KZM A;  1KVI A;  4ZLL A;  3EWG A;  1N52 B;  2M2B A;  4DFK A;  1TVR A;  5J2N B;  2KT5 A;  4J9M A;  2Z58 B;  2F65 A;  1KQS R;  1MWZ A;  3DRX A;  2JEF A;  4DLE A;  2KT3 A;  1NLK L;  3TJ9 A;  3DI6 A;  3M9O B;  4M8L A;  4M94 A;  1PBA A;  2WTF A;  4KKO B;  3OLB A;  1HBO A;  1ZPW X;  2P8I A;  1HD0 A;  1KLM B;  4DV2 J;  2CQ1 A;  1IKV A;  3CO9 A;  2HHT A;  3G6X A;  1RT3 B;  4I6Y A;  1G7C B;  1U6Z A;  2YWF A;  3ZZT A;  2N4C A;  1SJ3 P;  3J7Z 5;  3IWN C;  1P6T A;  4LF1 A;  3DM2 B;  3I5C A;  3EPG A;  2EFP A;  3HT0 A;  4WKY A;  4DXL A;  1N8R T;  2YKP A;  5GAG I;  5DDQ C;  3H40 A;  1WDT A;  3S7R A;  4ATN A;  1X4C A;  3BYP A;  2E5H A;  4K59 A;  1JLE B;  4JI8 F;  1WC6 A;  3Q22 A;  1D8Y A;  1NK8 A;  1WG5 A;  4W98 A;  1GMU A;  5HLF B;  1SL0 A;  1RJJ A;  1BD6 A;  4NXN F;  5HBM A;  1N88 A;  4PG8 A;  3CB4 A;  1YG0 A;  3AT1 B;  1U1Q A;  1WEL A;  3KHG A;  4C11 B;  3OJU A;  3S6E A;  1TKX A;  2XNR A;  3CJ5 A;  4OX7 A;  2GQQ A;  3TVZ A;  2HFS A;  1FER A;  2E44 A;  3OFG A;  2CPX A;  2XCA A;  1RT1 B;  4LRF A;  3UD5 A;  3PW7 A;  4LRA A;  1NJZ A;  1Q4R A;  1UFW A;  4MK9 A;  2AGO A;  1VQ8 S;  4PR6 A;  2ALY B;  3SSS A;  4DR2 F;  1DLO A;  1SH2 A;  1ZA1 B;  2IVY A;  4ED0 A;  2HZV A;  1TL1 A;  3OR1 B;  3KUE A;  4QR2 A;  4EBD A;  2FUG 9;  1N36 F;  1NZ8 A;  4DPW A;  4DV6 J;  4R25 A;  4EMD A;  4ZK7 M;  2UUC F;  2I0X A;  3LP2 A;  1XER A;  3OR1 A;  4AT1 B;  1U6F A;  3G82 A;  3SZ2 A;  4G3I A;  3PR5 B;  2OPR A;  3V6J A;  3UCU P;  3CCW A;  2XZD B;  1LXJ A;  4HEA 9;  3KUG A;  2L3M A;  3PYF A;  4KV8 A;  5F0U A;  1DHM A;  3D5M A;  3W66 A;  4AFF A;  2V8H A;  2GGP B;  2GQC A;  2HNZ B;  1WHX A;  2VG7 A;  5HVG A;  4B3S J;  2HHV A;  4RW7 B;  5KT7 A;  2R8K A;  2QYG A;  3HSZ A;  4KHP F;  4ZLJ A;  2UUB F;  3TAP A;  2EXU A;  3IS9 A;  1IR1 A;  1QUP A;  2CWK A;  4P73 A;  1C4A A;  4YQW A;  4DV3 F;  4WFB Q;  2VKZ G;  4JV2 A;  4CNY A;  1FI4 A;  2K3K A;  4Y34 A;  3J81 j;  4MYT A;  3GJS B;  2DK2 A;  3GE9 A;  4NX9 A;  3PAC A;  2QMX A;  5CQG A;  5D0H A;  4UZB A;  2PO4 A;  3MCO A;  1E6Y A;  1KRP A;  4DR4 J;  1LFW A;  1JLE A;  1SH3 A;  4DPO A;  2GIR A;  4FYV B;  4I4B A;  3VCD A;  3F73 A;  1NDP A;  4ECW A;  3KG0 A;  3VAF A;  2CJX B;  2A6O A;  1T0T V;  1VK3 A;  3FGV A;  2QT7 A;  2RDI A;  3T6J A;  4PYA A;  1CJV B;  1HNX F;  2LQ9 A;  1RAO A;  1N5Y B;  4CO2 A;  2CQD A;  2OKQ A;  1LNQ A;  3SCI E;  4F0H A;  4P7V A;  3IRW P;  3VWS A;  1B7Y B;  4ZCK A;  1JJ4 A;  3J7Y I;  2ASY A;  3M2U B;  1HWU A;  3NWG A;  1RI7 A;  8AT1 B;  4NML A;  2HS4 A;  3D66 A;  3ENW A;  4MFB B;  3TVY A;  4AD6 A;  2EKY A;  5D0R A;  1C2P A;  2M8D B;  1SPB P;  1PGZ A;  2OIH A;  1YDL A;  4PCQ A;  4C0O C;  2OUG A;  4C11 A;  4ECR A;  2RIL A;  1VQ7 S;  4IR1 A;  1WTB A;  1SL1 A;  3B82 A;  3IWL A;  4QWC A;  3DOL A;  1YZ6 A;  2QL5 B;  5GAH I;  2ZZM A;  4EEY A;  2BJ8 A;  2XEX A;  5D78 A;  5IQ6 A;  1CC8 A;  5HLF A;  1S6O A;  1EKS A;  1WAC A;  2VUG A;  3V81 A;  4OHW A;  4B3R F;  3CJ4 A;  3BGF A;  5K14 B;  4JI0 F;  2ZM6 J;  1AB8 A;  2MKJ A;  2P6T A;  3L7P A;  1N32 F;  5FJ4 A;  3LWM A;  2R7R A;  2H9Z A;  4M5D B;  5I42 B;  4QQB A;  2UVV A;  4XTT A;  3GIK A;  3MEE B;  3H5X A;  3EZU A;  3D6T B;  3D6H B;  1JLF A;  1XR7 A;  3M8Z A;  2JVM A;  1IBM F;  4JI0 J;  2B26 A;  1UCN A;  4X84 A;  1RAF B;  2Q6C A;  4RUH A;  2JEJ A;  4B9N A;  4JI7 J;  1DFD A;  3LAM A;  3PRV A;  4DV7 J;  1X4G A;  4K4Y A;  4CO0 A;  2AGP A;  1H2T Z;  1TL7 A;  1S97 A;  3PO4 A;  1QD1 A;  2ZHA A;  5A8K B;  3KHH A;  5F41 A;  3OTO F;  2QA1 A;  3VTI A;  1VQ5 S;  2QYC A;  2RU9 A;  1EQ0 A;  5KG0 A;  3H98 A;  4NLT A;  4BWJ A;  4CNZ A;  4CYU B;  3SSQ A;  3MR3 A;  2BAN A;  3RJM B;  2CUY A;  3C6T A;  5GAE U;  4AQY J;  5IC4 B;  3Q8P B;  4M5L A;  3PX4 A;  2XLK A;  4P52 A;  3KDN A;  2JOQ A;  3DOM B;  2SXL A;  1TL1 B;  4NOH A;  3EX7 B;  1UET A;  2HFV A;  3MEG A;  4Y2I A;  3N6M A;  5KFL A;  5J1E A;  1CUL B;  4DX6 A;  2GMJ A;  3LAK A;  5T7L A;  1NHK L;  2V0N A;  3KJF B;  3CCS S;  1NK0 A;  3MAA B;  1OMS A;  4FS1 A;  3W1Y C;  2QSW A;  1M5H A;  1UJ5 A;  2VDH A;  1F2G A;  2J0Q D;  1TTH B;  4KY3 A;  2C3M A;  2XMJ A;  2EWH A;  2VU5 A;  4OMF G;  3HI9 A;  3K2Y A;  4TY8 A;  2GMH A;  4ZLP A;  4ZPB A;  2G0I A;  3Q23 A;  2ZJQ Q;  3M1V B;  5KFY A;  2OJ3 A;  4B9U A;  4DR4 F;  2KHC A;  1GNK A;  2J8S A;  1SJQ A;  1BLU A;  2IC3 B;  3ET6 B;  4K4T A;  4DR3 J;  4C9D A;  2QN6 B;  1YBU A;  3T1Y J;  4ZOS A;  2BR0 A;  1LWX A;  4JV1 A;  3QT6 A;  3CIM A;  4YB7 A;  3WIV A;  3FKB A;  2MZ1 A;  2DR7 A;  1RKI A;  1RU1 A;  2G2Y A;  3O3L A;  3DRS B;  1S7I A;  3QGP A;  3Q0A A;  4KJI A;  4WXO A;  2BBE A;  2MZT A;  2FDN A;  2H54 B;  2PI5 A;  4RBV A;  1VQY A;  3AB2 B;  4CLW A;  4QR1 A;  3QJP A;  2YNI A;  2HK2 A;  4J9R A;  1RWU A;  2QL9 B;  4FXD A;  2HHW A;  1ZM3 A;  3AXK A;  4Q0B B;  5E3P A;  1FHT A;  3O44 A;  2YTC A;  1FE0 A;  3KMS A;  3TUI C;  3IR5 B;  1KLM A;  7FDR A;  1UW9 A;  3HJF A;  2CKW A;  4QOT A;  3UNG C;  4O4G B;  2V8P A;  2RKI B;  4USI A;  4Y6I A;  3E51 A;  2FJD B;  4ELU A;  2ZKU A;  2VBX A;  4DPU A;  3BH7 B;  4NLX A;  3W5Z A;  3JSR A;  1LWC B;  2UXC F;  1BQX A;  3JAM U;  1K0V A;  4MKA A;  3OTB A;  2HZA A;  1HBM A;  1FK9 B;  1SV5 B;  2BUN A;  4KGV B;  5IWA F;  3IO1 A;  1ELO A;  2WVE A;  2YKQ A;  3G4S S;  2MSS A;  2BE2 A;  3CCV S;  4YHH F;  1TFW A;  1T9U A;  4B3O B;  5KFE A;  2QA4 G;  2DRA A;  2XWX A;  3T5L A;  2CZ9 A;  2E7W A;  1ZZN A;  4EBC A;  4Y0F A;  2N4D A;  2R2U A;  2PMH A;  4YFU A;  2H4Y B;  2MZJ A;  1SJ1 A;  2RDJ A;  3Q8Q B;  4RW8 B;  2VPX B;  2DIT A;  3N9U C;  5KFX A;  4X4U A;  2IMO A;  4K7Q A;  2Z2M A;  1MU2 B;  3H2U B;  1SC4 B;  3JQK A;  2RDD A;  1V3S A;  3R5A A;  4WP3 A;  5DZ7 A;  3UDV A;  2HGN A;  2R2T A;  1VC0 A;  4KH1 B;  3PY8 A;  4ZN1 A;  3NBP B;  1M1K T;  3H0P A;  2R4F A;  2VG6 A;  3ZXW A;  4JI2 F;  5GAD I;  3CUL A;  3OHA A;  2CQ3 A;  3PW4 A;  1R8A A;  4CT8 A;  1APS A;  2LEP A;  4UT4 A;  2F8M A;  3ETO A;  2GFF A;  2MLZ A;  4FYX B;  3AD9 C;  4GC6 A;  5B7W A;  5IM0 A;  3OL9 A;  1VQO S;  4LSN B;  2FPH X;  5LMU F;  4DUY J;  1OS5 A;  2DH8 A;  2UU9 F;  4UOF A;  1WDD A;  5EWG A;  1ULR A;  3RB4 A;  4DSL A;  4ZVP B;  1JK9 B;  2QX0 A;  3HZG A;  1ZAW A;  4KGX B;  3MGJ A;  3K89 A;  2NZ4 A;  4ZVH A;  4ED7 A;  5HMY A;  4C8M A;  1X31 C;  1WWH A;  2RS8 A;  4LF7 J;  1CG2 A;  3MDF A;  1HBU A;  5DS7 A;  3SQG A;  2KXN B;  4HKQ A;  3C14 A;  2AHO B;  3RBX A;  1FXL A;  1GH8 A;  4CLY A;  2X1A A;  1SIZ A;  2QC3 A;  3GMG A;  3TEH B;  4ANE A;  1VC6 A;  3MM9 A;  1O5J A;  4X4O A;  2C2E A;  3IBC B;  5HSP A;  2V2Q A;  4ED3 A;  1R31 A;  3SMZ A;  1G6B A;  2BX6 A;  3HVW A;  1FKP B;  3THP A;  1XBW A;  1XWL A;  3RR8 A;  4QPX A;  3ILI A;  2YH1 A;  1FKO A;  2BJ1 A;  2GIF A;  2COL A;  2HWT A;  4IG0 B;  1N5Q A;  3JSB A;  4OZ0 A;  2MEW A;  1RAI B;  4GVB A;  1V5V A;  3G6V A;  2ZVI A;  3F0N A;  4XK8 C;  2XS2 A;  3NAI A;  1PYO B;  2F7V A;  3T1Y F;  3K7R A;  2RT3 A;  2M70 A;  3MEC A;  1UFK A;  1WEY A;  2AT1 B;  2CNK B;  2DNN A;  2W2M P;  2HSE B;  3H90 A;  4LSL B;  2WVC A;  4CO5 A;  3CMQ A;  4F26 A;  3CGI A;  3R3T A;  2EPI A;  4TU9 A;  5GMD A;  2MLY A;  4WP8 A;  1KFS A;  2FIU A;  3OUY B;  3FBE A;  5BXI A;  3B54 A;  1K1Q A;  2MHN A;  3MZI A;  1NH7 A;  3UD4 P;  2QJ3 A;  3M6V A;  4FYY B;  1LEO A;  5CCM A;  2DO4 A;  2K1R B;  1D0E A;  2AJ1 A;  3M2R A;  1PAE X;  1T3N A;  4DG1 B;  3G6E S;  4FP9 A;  1OPZ A;  4J9U E;  1FF2 A;  2CJY B;  3BH6 B;  4IKA A;  4EYI B;  4IG3 A;  4RU2 A;  4LF2 A;  2W9C A;  1S1W A;  4USJ C;  2OHD A;  2CIM A;  4HH1 A;  3GQC A;  5C25 B;  3HUL A;  3JTN A;  3TR5 A;  4X4P A;  4MT1 A;  1OIA A;  2OLW A;  3PR4 A;  1YIJ S;  2B51 A;  2HVD A;  3IBW A;  3PYD A;  3M30 A;  4FBU A;  3OT9 A;  4YR0 A;  1VQM S;  3IN5 A;  2H65 B;  3MPU B;  3TNV A;  3R1H A;  4WK1 A;  5LM7 E;  1S6P A;  2V9W A;  2MHE A;  3CDB A;  2DY9 A;  2QFJ A;  2XYG B;  2FJW A;  1EZZ B;  1NSA A;  2CJQ A;  3G8Q A;  5D4P A;  1U7L A;  4C8O A;  2RF2 B;  2CWX A;  3SDE A;  3UE2 A;  1REG X;  4WE1 B;  5DZ6 A;  4CZC A;  1IKW A;  5ETQ A;  3KLG B;  2OD6 A;  3KJV B;  2NRE A;  2KTQ A;  3B4M A;  2C2N A;  3PFE A;  3MUR P;  4ILM A;  2FYX A;  1CS4 B;  3BGU A;  1FVQ A;  2ZNZ A;  3HLU A;  5L39 A;  5DDR C;  4EU0 A;  2OMO A;  3MWB A;  2DHG A;  2UVU A;  2ZUA A;  3IAS 9;  1IWG A;  2NXN A;  5EUH A;  2JLG A;  3RRH A;  2RAQ A;  3VR1 A;  4C8Z A;  4P75 A;  1EAY C;  1U25 A;  3EGW B;  2PII A;  3HVT A;  3MM8 B;  4OX9 F;  4LQ9 A;  4FF4 A;  4ANC A;  4NLS A;  4ZIV A;  5J2P A;  2E1M C;  4IH7 A;  3WIU A;  4HL9 A;  1R6Y A;  1N54 B;  4F0K A;  4F7V A;  1HNZ F;  2CPJ A;  2UVR A;  3WX4 A;  3MM8 A;  2W7O A;  1RWO B;  2B8P A;  1N56 A;  3ETM A;  4OFZ A;  4JYA J;  3AAW B;  4MAK A;  4IQX A;  2J0S D;  2DNY A;  2LCW A;  4Y2K A;  4F2R A;  3QWU A;  2ZC3 A;  5CYM A;  3IR7 B;  2RU3 A;  1HMV B;  4Q8F A;  1C0T B;  1T03 A;  2WON B;  2NLW A;  2AZ1 A;  3FK4 A;  4PG5 A;  4M5N A;  4CRJ A;  2XCP A;  1I5O B;  1KLN A;  2MKC A;  4ELV A;  1UVL A;  4F4Y A;  4J91 A;  1WOR A;  2R8G A;  1JQG A;  3I6P A;  1M5S A;  3W63 A;  1SJR A;  5T41 A;  4ECU A;  3M32 B;  3I4H X;  2E7V A;  2FGC A;  3T1H F;  4JI1 J;  4FF3 A;  2KXF A;  1SKR A;  5DQH A;  1CSJ A;  2EFG A;  1XMQ F;  4KGM A;  3GTY X;  3AKO B;  2ZFH A;  3TZW A;  4CO4 A;  4ILL A;  5A2Q U;  3BJY A;  1O0P A;  2DXE A;  4N77 A;  3NGS A;  4DLG A;  1WKJ A;  1VRT A;  4F3M A;  2LU2 A;  3D3B J;  1S1X A;  2E7X A;  4LRC A;  3X3U A;  5A8R A;  3ENV A;  4TQS A;  2R2S A;  3TRG A;  5KFG A;  3T1H J;  4H4M B;  1U8S A;  4YY3 F;  1S12 A;  3GON A;  3FZ2 A;  2AZ3 A;  2B56 A;  5HMW A;  1V9O A;  5KOW A;  2MKI A;  2HRY A;  3FDS A;  4B3S F;  2KFN A;  3C6E C;  4M63 A;  4NEY A;  4M5D A;  2KL8 A;  2XTJ P;  5C24 A;  2CJK A;  3Q2S C;  1S6Q A;  3FNN A;  1S6Q B;  5AXM A;  4DX7 A;  2E5L F;  5LJ5 Y;  3LWL A;  3GIM A;  3ITH B;  5J1N A;  3FMW A;  2YBV A;  3N4W A;  2MQN A;  4GKK J;  5IFM A;  8ATC B;  1U0H B;  4QW9 A;  1AUD A;  1KTQ A;  3OD2 A;  3MOJ B;  1RTZ A;  1HBM B;  1SV5 A;  4MKV A;  4WFX A;  2BAB A;  2XMK A;  1UA1 A;  4JYA F;  1CJK A;  4I7F B;  4QYZ J;  1LWC A;  3OTO J;  1S1X B;  1BXN A;  3NLC A;  4LUB A;  4F4Z A;  4RU9 A;  3OUY A;  1JMT A;  2ZBR A;  4KH0 B;  3UN5 A;  2NXE A;  3C6U A;  1LW2 A;  3L95 X;  1YWX A;  2ZE2 B;  3R5C A;  2BQU A;  1TL5 A;  2HZC A;  2KRB A;  2WOM A;  3ISN D;  3NG8 A;  3PEJ A;  3TVK A;  1H6K X;  2A6M A;  1S79 A;  1KD1 T;  4LFB J;  3AOC A;  2MY7 A;  4NLP A;  1EIY B;  4URS A;  3D68 A;  3GG1 A;  3KLF A;  1WC3 A;  3C15 A;  4I0W A;  4NPO A;  2AQ4 A;  5ETV A;  4DMZ A;  1RDR A;  6FD1 A;  1V6H A;  5IT4 A;  3P5B P;  3RB3 A;  5K9F A;  4I67 A;  1W25 A;  2BMB A;  1C0T A;  2KDO A;  1WJ9 A;  4PKD B;  2E29 A;  2MQM A;  4LT6 A;  3BO2 A;  1S1V A;  5CYM B;  4USK A;  1WHV A;  1HFE L;  3FCW A;  3L4B C;  4JI8 J;  2BRK A;  2BEF A;  3CT9 A;  2DHH A;  3JQM A;  1Z4U A;  2P9G A;  2QO3 A;  3TUJ C;  2HBQ B;  3QGG A;  1YQH A;  3TO8 A;  3W5X A;  3B8H A;  5B0F A;  1ZM4 A;  5C7P A;  2F8H A;  3FMB A;  3HHE A;  3C14 B;  2B9Y A;  1FRK A;  1WC5 A;  1I3O B;  2DIU A;  2IC3 A;  3DDN A;  4G1P A;  3DRY A;  1U48 A;  2DGX A;  2OEM A;  3I9Z A;  3M2V A;  5J2P B;  5DG7 A;  2WZ1 A;  2W2N P;  3VV2 B;  2VB6 A;  1C1B B;  5KFS A;  4CM2 A;  3DLB A;  1C4C A;  2HHQ A;  1JKH A;  2J7K A;  4L76 A;  4NCB A;  4ZP8 A;  2FB0 A;  4F4A A;  2XO7 A;  3AXM A;  4DUT A;  3NS7 B;  2Y8Y A;  3TUP A;  2HNZ A;  2VG7 B;  2MGZ A;  3KK3 B;  3D2W A;  4I6W A;  4KT0 C;  2FHJ D;  4PXC A;  2V9K A;  3HKW A;  1D9F A;  3QAE A;  5J1E B;  3VAK A;  2FJB B;  1UWB B;  3HPO A;  1L3V A;  3LW5 C;  4ELT A;  1I6J A;  2WB4 A;  4IDK B;  1ROF A;  4USM A;  5GMK a;  3GFH A;  1T9Y A;  3IG1 B;  1GXT A;  2M88 A;  2CPD A;  4HAC A;  4Y65 A;  2G9O A;  1YBA A;  2NPI A;  1NDC A;  1LK5 A;  1MMN A;  4X66 J;  5KFF A;  1KP6 A;  2MKH A;  4ZN3 A;  3I55 S;  1FFS B;  1RTD B;  3P8B B;  1HHQ A;  1KQK A;  2IBK A;  5DQI A;  3R7N B;  2NR0 A;  4ZHR A;  3PG9 A;  2J6S A;  3BKT A;  2UUT A;  4H4O A;  2CDQ A;  2YX7 A;  3HSG A;  2UU9 J;  2XMM A;  2B0G A;  3I82 A;  2Y1L B;  2POK A;  5LXR A;  2LP4 A;  2EFN A;  3UR3 C;  1BWV A;  2V4R A;  4B9T A;  3C8Y A;  1RAH B;  3PEH A;  2NZC A;  1QE1 B;  2X51 A;  4WYL A;  1OSD A;  3L7O A;  5KFQ A;  3V6D B;  2OD4 A;  5THW A;  3CJK B;  3MD1 A;  4ZDN A;  2DVI A;  2MQO A;  5B0A A;  1GTH A;  2IDL A;  2XI2 A;  2FJX A;  4FZV A;  2J7U A;  3VAJ A;  2D3U A;  2M5Y A;  4QIW D;  4F0M A;  2WSC C;  3NCR A;  4TVA B;  3CCM S;  4K4X A;  1VGY A;  3BM7 A;  2OAU A;  1S9E B;  2O3D A;  3H42 A;  5HJX A;  1WSR A;  4K8R A;  5F3Z A;  5KFP A;  2EK6 A;  1UEU A;  3QSY B;  3BGR A;  4UZC A;  1HNI B;  1NSK L;  3MCN A;  1RWX B;  3BR8 A;  5HL7 Q;  3DM2 A;  2C2R A;  2BVZ A;  2AD9 A;  4ZJO A;  4B08 A;  1TU0 B;  5H1S V;  3THV A;  1F5B A;  3CCE S;  4NXM F;  5HP1 A;  1YJN S;  1KQG B;  4E2F B;  1Y0H A;  2DCL A;  2DGS A;  5CAA A;  1RA6 A;  4J9O A;  3SYZ A;  1YHQ S;  2IIH A;  2AIR B;  1Z1Z A;  2LA4 A;  1XNR F;  2XY5 A;  2F1F A;  4C0H A;  3EZO A;  2JFK A;  5RUB A;  4OZ3 A;  3TZY A;  2MXY A;  3P49 B;  3SXL A;  1RHQ B;  5KFH A;  5LMU J;  1U1P A;  4ECY A;  4ED8 A;  1AZS B;  1NJY A;  3I0S A;  3JYT A;  2GJ2 A;  1SH0 A;  2XSJ B;  4ZCM A;  5JVG Q;  4JI5 J;  5A0Y B;  2ZH5 A;  2HFO A;  2VC0 A;  5F8M A;  2DGQ A;  3DRS A;  1S0V A;  1VCT A;  4CLU A;  4NMX A;  4ES3 A;  2XQC A;  1RP5 A;  2F9J A;  3GJT B;  1YX2 A;  1X7V A;  5KFB A;  2Z57 B;  3DYA B;  5I3U B;  4DOZ A;  3C16 B;  4HI2 A;  5L46 A;  4TLQ A;  4NEZ A;  2EFV A;  2E1C A;  1HBU B;  3SQG B;  4Q8E A;  2YKA A;  1VLY A;  3BKU A;  2AP6 A;  2C3U A;  3D0I E;  1ZS6 A;  3NCQ A;  2YQ3 A;  4DV2 F;  1RWV B;  3P5T L;  4DL0 C;  1F0X A;  1G3O A;  3MAA A;  2IY5 B;  4WFZ A;  3OHB A;  1PO6 A;  2DBB A;  2M4M A;  3CCZ A;  1RHJ B;  2M52 A;  3BO3 A;  2FLP A;  4YR3 A;  1KN6 A;  2HFZ A;  2CZ4 A;  5KT2 A;  1SKS A;  3NEK A;  1PCA A;  3W65 A;  1YSJ A;  2ACM A;  2KO1 A;  2W7A A;  4USH A;  1IBL J;  4X2B A;  2CJ9 A;  2CQG A;  4FKX A;  3OXL A;  3GCX P;  3A3N B;  4J90 A;  1AXQ A;  2BKO A;  2X1G A;  3IM9 A;  4G1Q A;  5HK4 A;  1RKJ A;  2JH3 A;  4DL3 A;  1X4B A;  4M5K A;  2NUU G;  4LBI A;  2FHK A;  4RW8 A;  3DRR A;  3I5A A;  5DG8 A;  2CYY A;  1VK8 A;  4ZPD A;  2KH9 A;  4BS2 A;  1RAJ A;  1KS2 A;  3ICL A;  1HNW J;  2R9L A;  1TK5 A;  1W2I A;  4Q45 A;  3E2E A;  2RQK A;  2CJA A;  3FBB A;  4NCG B;  3T1A A;  1S76 D;  4J80 A;  2W9B A;  1U2F A;  1OQ3 A;  4OI6 A;  2CFX A;  1UVK A;  4FNI A;  1KVK A;  3UNY A;  9RUB A;  2AU0 A;  1J2V A;  1FD8 A;  4ZCL A;  3TAM A;  3U1N A;  1A9N B;  2UUW A;  2FHJ A;  4I1T A;  4C2M A;  2QSF A;  4P2S A;  1BUX A;  2AJF E;  4L72 B;  3HHL C;  4DN9 A;  4DQP A;  1MRO B;  4NAS A;  2V50 A;  4DI6 A;  5KFK A;  3GFY A;  2BJD A;  4DSF A;  1TKT B;  2IJN A;  3GFZ A;  2XO6 A;  4WKR A;  1CLF A;  3GCW P;  3PYE A;  3M05 A;  2J6U A;  3NGD A;  3CDE A;  4LF7 F;  1HI0 P;  4JI6 F;  4UY8 T;  2HMI A;  2MST A;  1S48 A;  2BM0 A;  3FZB A;  3BBF A;  4IO1 A;  5ADZ A;  2YNF B;  3M2U A;  4DR5 J;  4A8O A;  2CDR B;  2OH2 A;  5D8H B;  1NK6 A;  3OTC A;  1JXL A;  2V69 A;  2IPO B;  3IMQ J;  3TX0 A;  2YWE A;  5HN0 A;  2QE5 A;  2XNQ A;  4MMO A;  2IAJ A;  2IRY A;  2YWK A;  4NL5 A;  2MQL A;  1MRO A;  3QID A;  3BGR B;  3GWC A;  3J81 U;  3CMA S;  5HO4 A;  5E33 A;  3DXB A;  2VZ9 A;  4V19 X;  2F40 A;  4XPE A;  4XDD A;  4NA1 A;  4NLU A;  1TKZ B;  3P4U B;  4NXM J;  3MUT P;  3ZTP A;  4PPD A;  3WX8 A;  1JKH B;  1MN9 A;  2JFD A;  1BQN B;  1JXE A;  4DV4 F;  1RTI B;  3K5O A;  5E41 A;  1MWQ A;  2W4D A;  1HLW A;  4PAB A;  2Y1I A;  4DV4 J;  3M2V B;  3MED B;  1MW7 A;  4BHQ A;  3K57 A;  2WSE C;  1HW9 A;  1RTJ B;  3KK1 B;  4HDH A;  1Q78 A;  3UQS A;  3V2U C;  1VHI A;  5ETP A;  3TZX A;  3J80 U;  4ID8 A;  4LJM A;  2HKE A;  3HHD A;  4P2M A;  2DH7 A;  4IFV A;  4QPT A;  1HPZ A;  5GAG U;  3CC4 S;  1SIW B;  2DHA A;  2I5J B;  4OI3 A;  5AXL A;  2GW8 A;  1O6X A;  3LP2 B;  2K3I A;  2LA6 A;  4ZKA A;  1RTD A;  3N5F A;  2WVF A;  3W9H A;  2H3E B;  2X3D A;  3I4P A;  4QWE A;  2CQC A;  2Z8Q A;  1AT1 B;  3AA8 A;  3FBF A;  2VG5 A;  3LP1 B;  2N7Y A;  3UDC A;  3ZZ0 A;  1HI1 A;  2YKN A;  1UWB A;  5L9N A;  1PG5 B;  2ZBC A;  3BB5 A;  1N34 J;  1VQ6 S;  5B0G A;  2R8H A;  3NNA A;  4BLG A;  1ZAX A;  1T05 B;  2E5L J;  5D0E A;  2CPI A;  5F8I A;  2FC8 A;  5IQQ A;  1TKX B;  3PVX A;  1SC6 A;  5I42 A;  2QA4 S;  5MAO A;  1XNQ J;  4FYW B;  2AYE A;  2JVO A;  3BSA A;  4G65 A;  3O2I A;  2FVS A;  3RZA A;  1WTF A;  2AKW B;  1JLA B;  1S9E A;  1BGX T;  1WOS A;  1RHU B;  4I2P A;  1KHW A;  3G8T A;  2AEF A;  2GS8 A;  5IXU A;  3W60 A;  1QJH A;  1XMO J;  2HS0 A;  2WVB A;  1T11 A;  3DFE A;  5J2M B;  3L3C A;  2XSJ A;  1RAB B;  2ATC B;  1GAO A;  2Q66 A;  2HRU A;  4LF6 J;  1HQE B;  2YKO A;  3DKD A;  2ASL A;  2CQ2 A;  3LGH A;  3TYT A;  4CDI A;  1RAG B;  2FJA B;  1IXK A;  1NME B;  2UXB F;  3MM7 B;  1FWK A;  5LL6 d;  3H5U A;  4ED5 A;  2XBP A;  2AYB A;  1YRT A;  2B4U A;  4I56 A;  3QJJ A;  5A6W A;  4U7U D;  1F3V A;  1KHV A;  1QY7 A;  1RB0 A;  1RHK B;  2EBG A;  3LF0 A;  3OR2 B;  1SKW A;  1HNI A;  4ZJQ A;  2GV1 A;  2MPU A;  2MKS A;  3EGZ A;  2UXB J;  3N01 A;  1XNR J;  2XSF A;  2HWH A;  1URR A;  4RNN A;  5D3G B;  2DR6 A;  5HQM A;  2D3O R;  1Q16 B;  3N79 A;  4LFB F;  1REV B;  3QGH A;  1HMV A;  2MY8 A;  2HG4 A;  2VL1 A;  4DEZ A;  2WK4 A;  3A3P B;  2IM0 A;  3MMA B;  2ADB A;  4N7T A;  3MFH A;  5CAB A;  4NLW A;  2QLJ B;  2IBO A;  1WC1 A;  1B7F A;  1KFD A;  3H4D A;  5GAE I;  5A8W A;  3E3X A;  2XLI A;  2KT2 A;  2D69 A;  3KG1 A;  3NGT A;  4I2Q A;  4QYR A;  1K73 T;  4IR9 A;  2A18 A;  2ZWP A;  5CZV A;  2ZH4 A;  4NZ7 A;  1RHR B;  2GHP A;  3OBI A;  1U1O A;  2M0G B;  2IA6 A;  3HVT B;  2IJR A;  4URG A;  1S9G A;  2C42 A;  4C4W A;  1UJ6 A;  4ERD A;  2FVP A;  1Y11 A;  2ZHO A;  1HL6 A;  4U7C A;  4YY3 J;  3W2V B;  3K17 A;  1LQ9 A;  2VFU A;  3QZ8 A;  1U47 A;  2B7C B;  1TQL A;  1FEE A;  2WW8 A;  1L3K A;  1YJ7 A;  2YY3 A;  4KC5 A;  1CJU B;  4OJH A;  1CJU A;  2ADC A;  4WIQ A;  1XMO F;  1W2B R;  3PO5 A;  4IDK A;  3HZE A;  4QIG A;  5ETK A;  5KFJ A;  2R7S A;  1RQ0 A;  4ZVQ B;  3ZFV A;  3M8Q B;  3M8Y A;  3W2V A;  1X9W A;  4K4U A;  2JRR A;  4YR2 A;  4DV5 J;  2MGZ B;  3KK3 A;  1Q82 T;  1Q8I A;  2GVD B;  2YWH A;  3T5H A;  1HR0 J;  4GKK F;  4LSZ B;  2BV3 A;  1D1U A;  4X66 F;  3BQ1 A;  1F5C A;  3MPW A;  2XS5 A;  1LW2 B;  2X1F A;  1WC4 A;  2W1B A;  3DLG A;  4TN2 A;  4RNO A;  2V8G A;  5E2Q A;  1VYA A;  3KUH A;  5ITH A;  4OJG A;  4OHY A;  1UTA A;  1A6L A;  1R8H A;  1KEK A;  2I6W A;  2C2O B;  5LJ3 Y;  4DL4 A;  1U0H A;  2RQM A;  3TP2 A;  1S77 D;  5C25 A;  3J7Y U;  3HK2 A;  4DN0 A;  2J7W A;  2AJ0 A;  1LK7 A;  4EK2 A;  4Y2C A;  4IG3 B;  4TYA A;  2C3O A;  4I64 A;  1XQI A;  2I1R A;  4IFY A;  3LQV A;  3LP0 A;  3G6Y A;  2DNK A;  1FD2 A;  3DGP A;  5KFI A;  4JI1 F;  1XIQ A;  4OIX A;  3M2R B;  3OL7 A;  1TKD A;  4C8L A;  1N5S A;  1IJE B;  3FSY A;  3DLH A;  2VOD A;  2AV5 A;  2XMW A;  3FRZ A;  3QGI A;  2GHW A;  2AYM A;  1IBK F;  3K58 A;  1H2V Z;  1R0C B;  2VF3 A;  4X4S A;  4DV3 J;  3JB9 k;  3CME S;  2YQ0 A;  2M3D A;  2KRR A;  2B6A B;  4ZS6 A;  1T9W A;  4Q44 A;  1NK5 A;  3DNC A;  4YS2 A;  1K0T A;  3M6U A;  2IHR 1;  4BC9 A;  4L3K A;  1SQF A;  4LRD A;  2ZH8 A;  3F41 A;  3R5B A;  5KFR A;  1GXU A;  1B0V A;  1HQU B;  5DLG A;  4EYH B;  2ATL A;  1VC5 A;  1VQK S;  1YJR A;  1OY8 A;  2DIS A;  5LSR A;  1R8C A;  2H4W B;  2LQJ A;  5ETT A;  3BZQ A;  4B3M F;  2QLF B;  2AEJ A;  5K20 B;  1N6Q B;  1CJK B;  4I7F A;  1Y4Z B;  1EP4 B;  2A1B A;  3E01 B;  2CG4 A;  1FT8 A;  4IG0 A;  4RBT A;  4D3H A;  4WFA Q;  3I38 A;  2KN4 A;  2V6A A;  4RBU A;  3ZNU A;  5K8O A;  2XYH B;  2C22 A;  2ILZ A;  2R7V A;  4ILR A;  1WG4 A;  4KE5 A;  1J27 A;  1DTQ B;  1WI8 A;  5KFU A;  1PBU A;  1DUR A;  4XDC A;  3V4I B;  1JLG B;  5DET A;  1S1T A;  2HYI B;  2G4B A;  1HWL A;  1R6V A;  1CC7 A;  4YP3 A;  5EWF A;  3CXC R;  2A10 A;  3D9B A;  1OQ6 A;  4RKU C;  5DDP C;  5A8R B;  3PX6 A;  4E0D A;  4ZP9 A;  1UVJ A;  3QQC D;  1G1X A;  4QWB A;  1RSC A;  2HHU A;  2R42 A;  4K5R A;  1FRI A;  2B4O A;  4ZVS B;  4OX8 A;  3QBC A;  2O5D A;  2U2F A;  4K2J A;  4ES1 A;  4DR5 F;  4Q43 A;  5BYS A;  1T05 A;  2E1A A;  4PQA A;  4Q2M A;  2BOA A;  3A8I A;  3QYY A;  4DPY A;  1P27 B;  1PJ6 A;  1UJ4 A;  4NYP A;  4JI6 J;  2HBZ B;  1N0V C;  2YNG B;  4YN3 B;  3EXY A;  2YKN B;  5KG2 A;  3Q24 A;  2ZOM A;  1NLT A;  2QFI A;  3OVA A;  2VG5 B;  3LP1 A;  4B02 A;  1U1M A;  1FES A;  3PKY A;  2C3Y A;  3PV8 A;  1M5O C;  3HVA A;  2B4P A;  2CQ4 A;  3JAM Y;  5F8H A;  2VJU A;  1U6B A;  1FKP A;  2AX1 A;  4OI1 A;  2JC1 A;  4FNH A;  4DFJ A;  3Q8S B;  1TMM A;  1S99 A;  3JTP A;  3NOG A;  2HQ3 A;  4FVM A;  2BOP A;  1FVS A;  1RUS A;  2WBR A;  1J5E J;  3DLK B;  4KR0 B;  3BDP A;  1GX5 A;  5E3Q A;  3K59 A;  1X5T A;  1FDN A;  3HHL D;  3OFF A;  3D0G E;  2ZD1 B;  3D3C J;  4QW8 A;  3VQS A;  3VZH A;  1BQN A;  2C2D A;  2PMZ D;  2AYG A;  1RT6 A;  2I8E A;  1QSY A;  1S1W B;  4C3L A;  1RA7 A;  5J2Q A;  2EG2 A;  3CJT A;  5C5J A;  1FWL A;  2Z56 B;  4PXB A;  2IDE A;  2HVH A;  2KI2 A;  1VBZ A;  4H4K A;  4DV1 F;  2K1R A;  2BDP A;  3SI8 A;  3EUN A;  2X7I A;  4G1I A;  4PEO A;  3CJQ A;  1VFJ A;  3UCG A;  4DV1 J;  2B9E A;  2VQF F;  2RQC A;  4NLO A;  2RIJ A;  3TW0 A;  2VG6 B;  2Z2Y B;  4OYB A;  2F4V J;  3ENA A;  2J6T A;  3KWM A;  3WHI A;  1P1T A;  3KK2 A;  4O4G A;  1B64 A;  2R8J A;  1HNV A;  3MF5 A;  1MU2 A;  3RGI A;  3PW5 A;  2GA7 A;  1N48 A;  1X4D A;  2B7B B;  3OXG A;  5D4L A;  1D8Z A;  2XM3 A;  4RO0 A;  2B6A A;  2FVR A;  1TV6 A;  2VHG A;  2IJF A;  3BBC A;  4EGL A;  5KG5 A;  3CC7 S;  2O67 A;  5KFM A;  2C1E B;  3A4T A;  3LA0 A;  1T02 A;  1SXL A;  1YJ9 S;  2VON A;  1R0A B;  3W61 A;  3OL6 A;  4CLF A;  1K9M T;  3QIP A;  3PJW A;  3OW2 R;  3UDE A;  2L9W A;  3T41 A;  5LT5 A;  1RYR A;  1S4E A;  1NSQ A;  3I56 S;  1SB6 A;  2CQI A;  2I38 A;  3LGM A;  4JB8 B;  4ETX A;  5CA5 A;  4GVL A;  4ECT A;  2DR8 A;  3V5R A;  3QZ7 A;  1XN9 A;  3MCS A;  3PNI A;  4BDP A;  2HAI A;  5D4N A;  1FJG J;  2IVF B;  5CYJ A;  1OYD A;  2NSB A;  4DZ6 A;  1QAX A;  3MFI A;  4AYB D;  3PDN A;  1FRH A;  4PWW A;  2CQB A;  3D6M B;  4M1K A;  4JI2 J;  2F4F A;  4JI3 J;  4LF8 J;  1S1U A;  3CCT A;  1ZZF A;  3EGN A;  4DWI A;  2XMU A;  1VOM A;  5FD1 A;  4M5M A;  2GAH C;  5HVF A;  2RRA A;  2R7U A;  4Y2A A;  5A76 A;  2PDA A;  4G1Q B;  3TA1 A;  2W4P A;  4RL1 A;  4BWM A;  5D0G A;  4J9L A;  3CCQ S;  4ECZ A;  4ED2 A;  4DHV A;  5DDO C;  3CCL S;  1PYS B;  1RWN B;  1RAD B;  1IR0 A;  3MMJ A;  3HHL B;  2ABY A;  1Q7Y T;  3PW2 A;  1ITP A;  5L8R C;  3W5Y A;  1IBM J;  3GJQ B;  4OHV A;  4OZJ A;  4O0I A;  5KG6 A;  5CH7 B;  2DRB A;  2M9K A;  1TUG B;  4K4V A;  3NMA A;  1JIH A;  1KTV A;  3CNQ P;  5F8N A;  1S9G B;  1IKX A;  2DCU B;  3NP5 A;  4TYB A;  4O3R A;  3MUM P;  2DTJ A;  3HKZ D;  2NSC A;  2Z4P A;  4OHZ A;  4R5P B;  4A48 A;  1Q53 A;  3CD0 A;  4A8S A;  1BWE A;  4C3M A;  3ILL A;  1X4E A;  2YX4 A;  1KWM A;  2B4V A;  2C2Z B;  3EYZ A;  4DF4 A;  3NNH A;  1R89 A;  2CVI A;  2DY1 A;  5FDL B;  4BCA A;  5IWA J;  2XLJ A;  1Q79 A;  3OFE A;  4DV0 J;  1IQT A;  1RBA A;  1WKL A;  3KJQ B;  2W8K A;  4ED1 A;  2KFY A;  5E7O B;  1FNM A;  3MUV P;  3MEE A;  1NHU A;  2B3T B;  2IM2 A;  5KG3 A;  3H8Y A;  4F2S A;  3FFI B;  5K8N A;  2L9N A;  1K44 A;  3KFW X;  2LFV A;  2NUH A;  1C3G A;  1RLC L;  4GRS A;  3ZZY A;  2OI2 A;  5DGA A;  4C8Y A;  4P7T A;  4P74 A;  5K14 A;  4DR3 F;  4ID5 B;  3DYA A;  2JZ8 A;  4F4X A;  1BMQ B;  1X9S A;  1YBT A;  1FXD A;  5L9X A;  2XWY A;  5T14 A;  4N56 A;  4LRB A;  3E01 A;  3VAL A;  4Y00 A;  1CPZ A;  3GYG A;  4KB7 A;  2KG0 A;  3V6K A;  1YGY A;  4A8M P;  5ETL A;  3HP6 A;  2BAN B;  5L1L A;  2L9D A;  2G2O A;  3NBP A;  5DM6 Q;  3M6X A;  3VAG A;  3WDO A;  5AE1 A;  4NLY A;  4R0E A;  1B4S A;  1PKU A;  2JSX A;  2RE1 A;  3BEG B;  2ZDO A;  1NSP A;  4MFB A;  3M9M B;  4IOC Q;  4CO3 A;  1XK8 A;  3BR9 A;  4JV5 J;  2A2D A;  1U4B A;  1JLC B;  2IMW P;  1FWP A;  1FCA A;  1DAR A;  1NH8 A;  2VFS A;  3HD1 A;  3KTQ A;  4U7U K;  3C66 A;  3SFG A;  1R3N A;  3T9N A;  3P96 A;  3U1L A;  3MPD A;  1NHV A;  2XZW A;  3ZZR A;  5CD4 H;  3LUY A;  2E66 A;  2XMA A;  1F5A A;  3F56 A;  1U0S A;  1HYS B;  3NMR A;  2RVJ A;  3BQ0 A;  2MQ8 A;  2FZC B;  3TZZ A;  4RUA A;  3PX0 A;  3QRQ A;  1Y5N B;  3DRP B;  3PCO B;  4DR6 F;  4LFA J;  1EKR A;  2JEI A;  5JJB A;  2DR5 A;  3DXS X;  5IT9 Y;  2Q2G A;  2HW3 A;  3BSC A;  1EQM A;  2RHQ B;  3PHT A;  4A46 A;  4UOG A;  1VRU B;  3PXG a;  3ET6 A;  4QU6 A;  4DSK A;  3WC0 A;  3HVR A;  3F44 A;  2BKP A;  1W7W A;  5EN1 A;  2CG8 A;  1VR6 A;  3IS9 B;  2F9D A;  1N32 J;  1IBC B;  1JB0 C;  2EG1 A;  1TEL A;  2RB7 A;  2YX1 A;  5J1P A;  4TU8 A;  2N82 B;  2XS7 A;  4R8U B;  2Y8W A;  2GVD A;  1HBN A;  2RNE A;  3RAQ A;  4M95 A;  1RIS A;  1X8D A;  3LZ8 A;  3TJA A;  2J76 E;  2EW9 A;  3OSP A;  2UXD F;  1R27 B;  4NLV A;  4KV8 B;  2UXC J;  2XHC A;  3MMC B;  5I4M A;  1CJV A;  1M5K C;  2ALZ A;  3HM9 A;  4EWT A;  5KFZ A;  4LBH A;  3ZTO A;  1VIS A;  2OPP B;  2ZBI A;  3R27 A;  4J9Q A;  4DL2 A;  3OVB A;  5KFD A;  2DHX A;  4WU3 A;  4HAC B;  3D67 A;  3MMC A;  1HPZ B;  1NND A;  4JV0 A;  1LV5 A;  2DRD A;  1AW0 A;  2GVZ B;  3OQ2 A;  4URQ U;  3IGV A;  2KZZ A;  1FTC A;  4OYP A;  2ILY A;  2NYI A;  4CWB A;  2DGV A;  5KT6 A;  4DR6 J;  1RTI A;  2VFR A;  4A8F A;  2GNK A;  3LAN A;  3FRY A;  4CLK A;  5HQ8 A;  3JSM A;  1UL3 A;  2VFV A;  3RB6 A;  4QWA A;  4HR2 A;  2FY1 A;  4B9M A;  4NLR A;  3VZI A;  2LMI A;  2QLD A;  4F36 A;  2ZH1 A;  3A3O B;  3MAH A;  5KFW A;  3CUN A;  3V81 B;  3ZZP A;  5GAH U;  1ZM9 A;  2GJF A;  2NCK L;  1REV A;  3ZTS A;  3M8R A;  3CC2 S;  3X1L B;  1NRK A;  1YVF A;  3BV8 A;  4WTO B;  1M1H A;  1S5Z A;  2QRR A;  3M8P A;  1QTM A;  4UY8 5;  1S1V B;  2IYG A;  1RT4 B;  2N7C A;  1HNX J;  4CM0 A;  3A8J A;  2V5H G;  2JNJ A;  7AT1 B;  4LR8 A;  3HO1 A;  5CZX A;  1P9Y A;  2BJ3 A;  4FBT A;  3PJX A;  3BPS P;  3CDU A;  2Y9H A;  2E9Z A;  1VHF A;  3MM7 A;  3CCR S;  4YOE A;  1JLC A;  2H5J B;  1HBN B;  2LXU A;  2UUC J;  1H74 A;  4W4M A;  4ZA1 A;  1NCL A;  1WUU A;  2K06 A;  2VIH A;  1TFY A;  4HHH A;  2CPE A;  4X4V A;  3C6U B;  2XHW A;  4NRT A;  4ZPW R;  3H4B A;  5SUH A;  1PAU B;  1S57 A;  2VPZ B;  4HLB A;  3U27 A;  1QLN A;  3J7Z T;  3R6L B;  3GG0 A;  2QV6 A;  3S8S A;  4ECX A;  1CJT B;  3AOB A;  1Y7P A;  3J7A N;  1E6Y B;  3V6H A;  1MLA A;  4G6V B;  4FS2 A;  3OVS A;  2EK1 A;  1N0U A;  4OV6 A;  3RR7 A;  3ITH A;  1X0P A;  2B43 A;  3EXC X;  3DHX A;  4DBQ A;  5EWE A;  1Q8L A;  4CIO A;  3RBE A;  1RCX B;  2IYI A;  1X9M A;  2IRU A;  2BA9 A;  2PGC A;  2ZBQ A;  1MWY A;  3HFZ B;  2MB0 B;  1WNE A;  4IQM A;  2BJE A;  3ULH A;  1HYS A;  3S01 A;  1U8W A;  2HBY B;  3TOQ A;  5AT1 B;  1JNZ B;  2AJ2 A;  2J9D E;  5FII A;  2O01 C;  4H4M A;  2VJV A;  4N41 A;  1BHN A;  4IOA Q;  1L3S A;  1UVN A;  4HDG A;  3MMB A;  3I5B A;  2B8Q A;  3I9V 9;  3W7B A;  4NZ6 A;  2QLB B;  4CH1 A;  1F9H A;  4DR2 J;  2JLE A;  4U8V A;  3PYG A;  4IRC A;  4F8R A;  1X4F A;  1D09 B;  3ENQ A;  3ZZO A;  1WG1 A;  4YDD B;  4DCO B;  1CQN A;  2I9S A;  3MTK A;  5HAN A;  3HXM A;  2D74 B;  3FEZ A;  3I87 A;  2R8I A;  2LXI A;  2VBY A;  4DL7 A;  3G86 A;  3H2V E;  3W8G A;  4CT9 A;  1NJW A;  2J9E A;  2D9O A;  3AOD A;  3MR5 A;  2YH0 A;  5B08 A;  4V19 J;  1FJG F;  3CSK A;  3MI7 X;  1KVJ A;  4IFV B;  1T03 B;  4WCE Q;  4DQQ A;  4N8N A;  3DLE A;  2MQP A;  2HLT A;  4WU2 A;  1WEX A;  4ECQ A;  5JMN A;  3DGV A;  4CLP A;  3H20 A;  4B9V A;  1JJH A;  3I32 A;  2ZUG A;  3JSM B;  4KTQ A;  3QRR A;  1NDK A;  3B78 A;  3NOC A;  2EFQ A;  4QJV A;  3C2P A;  4WII A;  2RD5 C;  2MYF A;  2WBM A;  3OXF A;  5KOX A;  3BGO P;  4J7C A;  3PIP Q;  4NWB A;  4GKJ J;  1C1B A;  3EE3 A;  3FCH A;  4LRE A;  3T5K A;  1AYE A;  1S4F A;  4CH0 S;  1AFI A;  4RW7 A;  4YB6 A;  2PN6 A;  3VHQ A;  1JLB A;  4UOC A;  5HBM B;  2GGP A;  4OZL A;  3SV3 A;  4PUO A;  1VBX A;  4F3O A;  4KHP J;  2VKR A;  4R5P A;  4A8K A;  2PA3 A;  4B9L A;  1QDU B;  4XPC A;  5H9F K;  1IKX B;  5FLX U;  3OSN A;  4DFP A;  4GO7 X;  2DR9 A;  4WF9 Q;  4OX6 A;  4XIU A;  2UUB J;  4LF4 F;  3NGR A;  4BC7 A;  3DDK A;  2G13 A;  4WWS A;  4NYZ A;  4YDX A;  6FDR A;  3MPV A;  3N6L A;  3RTV A;  4UOH A;  3GIL A;  3KLG A;  4WE1 A;  2BJ7 A;  1FX2 A;  2J0W A;  2DT9 A;  5AE3 A;  1M5V C;  4OZ1 A;  3TEG A;  2EVZ A;  2VPW B;  4L3N A;  4M5H A;  5H9E J;  1YTY A;  1IN0 A;  2RQ4 A;  3KHL A;  1UKU A;  3LGN A;  2ZC4 A;  4DV6 F;  5LOQ A;  3BPD A;  1N34 F;  5EHH A;  1TVR B;  3HCX A;  5J2N A;  3R7B B;  1AFJ A;  4O0N A;  5E3A A;  2QA2 A;  2ZVS A;  5D4O A;  5KFT A;  1KOO A;  2FY8 A;  3K8V A;  4Y28 C;  3NKY A;  4HT5 A;  2CRL A;  1DTT B;  5B0E A;  1DY3 A;  1HAR A;  1FDA A;  3RB0 A;  2W4C A;  4WPA A;  5LSL A;  3GV7 B;  3GYN A;  1N33 F;  2ZOG A;  4KGZ B;  1RE1 B;  2W9C B;  3BBB A;  3Q86 A;  3L7U A;  1YIT S;  3SIP B;  1JNR B;  4ZMM A;  2PFF B;  2Q3P A;  3VGT A;  2EBE A;  4F3Q A;  4F02 A;  5AE2 A;  1FRL A;  2D3O 1;  1IM6 A;  4C8N A;  5LSO A;  3K5P A;  4V1A k;  2ROP A;  4IO9 Q;  1R0A A;  4NZ0 A;  4J9P A;  2FGO A;  5KAK A;  2C2M B;  4RJV A;  3GV5 B;  3DRR B;  3A8E A;  3TUZ C;  1WI6 A;  3MR7 A;  1RYS A;  4MH8 A;  1VQS A;  4LFA F;  3G2X A;  4K2X A;  1HBO B;  1UP1 A;  2P5V A;  2OPS A;  4KKO A;  3G8S A;  2PC6 A;  3GU0 A;  2CXE A;  3RG6 A;  1RU2 A;  3HHN B;  1WF0 A;  2W9A A;  4FF1 A;  5B0B A;  3KK2 B;  2OSQ A;  2K8G A;  3M32 A;  1XTZ A;  1U2R A;  4JBC A;  3R5D A;  4OZN A;  5EX0 A;  4DPT A;  4LF8 F;  1UAW A;  1VIO A;  3QAT A;  2ASD A;  4FPR A;  2OFH X;  2XMV A;  3KNG A;  4KHR A;  4LVO P;  2HQF A;  3HHL A;  1O8B A;  3LH2 S;  3Q8V A;  4DL6 A;  1LW0 B;  5C2G A;  4USW A;  3HSD A;  2PEH A;  2A0F B;  1IVZ A;  1NPP A;  1HA1 A;  3UW1 A;  1F6T A;  2LEB A;  1Q5Y A;  2IA0 A;  2YNG A;  5M2U A;  1GTE A;  1H3D A;  3MM6 A;  1S0O A;  3US5 A;  1E6V A;  2MZR A;  3KYL A;  2F4V F;  1UA0 A;  1KOH A;  1VRQ C;  2UZA A;  2GHV C;  2AJ4 A;  2CNO B;  3AFG A;  5FDL A;  5G0R A;  4WXW A;  3K0J A;  2CPH A;  4MIA A;  3J81 Y;  2HVI A;  4LQ3 A;  3R5G A;  5G0R B;  2APO A;  1ZAV A;  3HD2 A;  2OTJ S;  1GX6 A;  5I3U A;  2FZK B;  2B5J A;  4FKY A;  4USV A;  4RPF A;  4ENO A;  1PJ5 A;  3J80 Y;  2FHO B;  1PIE A;  1DTQ A;  3BN4 A;  2ERR A;  1VQL S;  1I1G A;  1N4L A;  3T3F A;  1RAA B;  1CBK A;  3I0S B;  1AZS A;  4ZVO B;  2Q43 A;  3ISZ A;  3JSY A;  1AA1 B;  2AX0 A;  2CPF A;  5G4D A;  3VF0 B;  2VQF J;  3B4D A;  1TV6 B;  1PJ7 A;  2RF2 A;  3SDE B;  3MHY A;  1UFL A;  2Y1J A;  1SQG A;  2RRB A;  4DF8 A;  1ZET A;  1C1C A;  5CYQ A;  1P8G A;  2VQE J;  1IBK J;  1EJ7 L;  1WKK A;  1KSP A;  3HMJ G;  1O51 A;  4O23 A;  3IRX B;  2ZH7 A;  4RWW A;  1U24 A;  2DGU A;  2Z0G A;  2LLZ A;  5E0O A;  4P2X A;  4B17 A;  3TQE A;  1RK8 A;  4QZV B;  2DNQ A;  2DGW A;  4ZIW A;  3HFV A;  4DS5 A;  1R43 A;  1TAQ A;  2DH9 A;  2VAS A;  3NGU A;  4TKT A;  3EJM A;  3UO0 A;  2XGQ A;  2RRN A;  2L41 A;  1IKY A;  2H51 B;  4W90 B;  4JI3 F;  1LFP A;  4DCP B;  1S9F A;  1V3R A;  3LPY A;  2R7T A;  2YKM A;  3PW0 A;  2OEJ A;  3AQP A;  3MTJ A;  1U49 A;  1SC1 B;  3HFK A;  2DB1 A;  1HR0 F;  4PPZ A;  1YI2 S;  3W62 A;  1QE1 A;  3V6D A;  3T5J A;  1YRU A;  5DJB A;  2KFZ A;  1SQE A;  1EP4 A;  2DYA A;  5DRK A;  4QWD A;  4OYA A;  4RW6 A;  3Q8U A;  1M90 T;  5D77 A;  1RT7 A;  1C0U A;  3NCP A;  4C8K A;  4KSE B;  1KQF B;  1TL3 A;  1KON A;  4P10 A;  4C48 A;  1TUV A;  2YWG A;  3DN9 A;  3IP0 A;  4UST A;  2DXF A;  1FRX A;  4ZHR B;  5FLX Y;  2J0X A;  1XMB A;  1TL4 A;  2PD1 A;  2RUG A;  3JQJ A;  4USU A;  1C1C B;  4QR0 A;  5CYQ B;  3POT B;  3G87 A;  4Q0B A;  2O1P A;  3TX8 A;  2Q6B A;  4DS4 A;  3KOA A;  3RYL A;  3IG1 A;  5KFV A;  2E5G A;  1VDH A;  4A4J A;  2OML A;  3RUB L;  2ZH3 A;  1NB7 A;  2V2V A;  2ASJ A;  2GO8 A;  4YHH J;  2FLO A;  2JEG A;  3CD6 S;  4ZVR B;  4LMZ A;  3WBZ A;  5H9E K;  2IRX A;  4KFB A;  4MK7 A;  5J2Q B;  3Q8Y A;  3GFX A;  1RT6 B;  3VAI A;  5HQL A;  3RBD A;  4O44 B;  4Z7Y A;  4J37 A;  4NLD A;  2HBR B;  3R2D J;  4LFC F;  3LAL A;  4PUO B;  4ED4 A;  1LWF A;  1UZH A;  1LWF B;  3KLE B;  3KLE A;  4PG4 A;  2ZOF A;  3VAH A;  3R2C J;  2DHS A;  2MLX A;  3DLG B;  1FEH A;  2OP5 A;  4B3T F;  1N5V A;  2C2K B;  2WB1 D;  2DNM A;  3D54 A;  3AOA A;  3IM8 A;  3EZ5 A;  3QRP A;  3FQL A;  2GC8 A;  2IFX A;  3QT7 A;  3UN3 A;  2HHP A;  1S59 A;  2J8A A;  1GT8 A;  1X5P A;  4KFB B;  3J7A 1;  3PIO Q;  3GYX B;  2PE8 A;  1NM2 A;  3PHE A;  3M7V A;  1RT5 A;  2GQ2 A;  3MR2 A;  1F60 B;  3K5L A;  2LDY A;  1CS4 A;  1NBE B;  4PWD B;  2GO9 A;  5MLC V;  3LTO A;  2JVR A;  2VOO A;  2DIV A;  2E9R X;  3GII A;  3LO3 A;  4DSI A;  1WOP A;  4AXJ A;  4C6A A;  3C15 B;  4RX6 A;  3CWJ A;  4PXE A;  3POT A;  1WSV A;  4PQU A;  1SC3 B;  1JLQ A;  3RRG A;  1DJ0 A;  2H48 B;  2KU7 A;  3BS9 A;  3OR2 A;  4LF5 J;  3MXH P;  1HQU A;  1WEZ A;  2V8V A;  2WOM B;  4CP5 A;  1FO1 A;  1RWK B;  2Z2Z A;  1S6P B;  4ZVU B;  1FFG B;  4C97 A;  1NKC A;  1FJE B;  2ZE2 A;  4HTJ A;  1ZTT A;  4MKY A;  3L9Z A;  2V4Q A;  2N3O A;  4KAI A;  5HMX A;  2YPY A;  3WC2 A;  4FVC A;  1T9X A;  1YLX A;  2RJZ A;  1U09 A;  1XMQ J;  1JX4 A;  1HI8 A;  3MMB B;  4YB5 A;  2HLU A;  4DR7 J;  3FQK A;  3DMJ A;  5EX3 A;  2MKK A;  1J5O A;  4Q7A A;  3MPY A;  3O6Q A;  3L09 A;  1P1L A;  4J9N A;  3QWP A;  1RAE B;  2OO4 A;  3UR0 A;  3W8P A;  5KT3 A;  4ETZ A;  4LF9 F;  1S1T B;  1OSC A;  4OL8 A;  2LDI A;  3CED A;  5CHC B;  4UW2 A;  2FLL A;  4XO0 A;  4X4R A;  4RLE A;  2VC1 A;  1GMW D;  4JOU A;  1Q1K A;  3LOU A;  4DPX A;  1Q7L B;  1X4H A;  2MJU A;  4E8U A;  3CCU S;  1DTT A;  2VBW A;  4OLP A;  1FKA F;  1RAC B;  2K7J A; 
#chains in the Genus database with same CATH homology
 3LA0 A;  1NLT A;  1C3G A;  2QLD A;  3L9Z A;  1EB0 A;  3I38 A;  3AGY A;  1EAR A;  1GMU A;  3TJ8 A;  2Q2G A;  2HFV A;  1GMW A;  4L3K A;  3TJA A;  4J80 A;  1XAO A;  3TJ9 A;  1GMW D;  3NXZ A;  3AGZ A;  3NY0 A;  1GMV A;  2B26 A;  3LZ8 A;  3AGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...