4L3KA

Crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein UreE
publication title Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study.
pubmed doi rcsb
source organism Sporosarcina pasteurii
molecule tags Chaperone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4l3kA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 4l3kA02
3TJ9A 1GMVA 4J80A 2QLDA 3TJ8A 2Q2GA 1EARA 1GMWD 3AGYA 1GMUA 1NLTA 1C3GA 3AGXA 1EB0A 3LZ8A 1XAOA 3TJAA 3NY0A 1GMWA 3I38A 3L9ZA 4L3KA 2HFVA 2B26A 3AGZA 3LA0A 3NXZA
chains in the Genus database with same CATH superfamily
5ETQA 4X4SA 1Z1ZA 1KD1T 4NL5A 2HLTA 3CTRA 2FJEB 3ITHA 5E0OA 2DHAA 4YUDA 1EETA 3Q24A 5C24B 2B4PA 2YTCA 5I4MA 2J0XA 4I0WA 5GVQA 4XTTA 1QE1B 2J8AA 4GO7X 2YVSA 1V6HA 1HW8A 3KHLA 3MM8A 4DX6A 1FD8A 1XR7A 3TAMA 3NNHA 4IFYA 3NWGA 4IQXA 1SUQA 3AY0A 4U95A 2IM3A 1DQ8A 4OHZA 2E29A 1KEKA 1AYEA 2AJ0A 2F8HA 1Y7PA 2IBOA 4RW6B 3W8PA 2QJ3A 4WF9Q 4P2MA 1EIYB 1RTDB 1GMWA 2HAFA 2E5GA 1YKWA 3SQGB 2AKWB 2UU9J 1S9EA 2ROEA 1RBAA 4V19X 2JVMA 4FF3A 3TX8A 4C4WA 4EZ6A 1SIWB 2GMHA 1CC8A 1VGYA 3CCMS 3CDWA 1D9AA 1OPZA 2GAHC 4DL3A 2FLPA 3I0RB 4W92B 4MT1A 2QG9B 4JI5J 4A8WA 3OV7A 1LOUA 4LFBJ 2FHMA 4YS2A 1VRUB 3A8IA 1YBAA 1RAHB 4B3SF 1RE1B 4Y2IA 4ZJQA 2P2CB 2DRBA 4GVLA 4CO0A 4NLTA 3M2VA 5GAGU 4ECZA 5KFSA 2VUGA 5E41A 5A8WA 2ZD1B 3C14B 3K0JA 5CXTA 2HNDA 1S5ZA 4P75A 4JI6J 2O01C 4F4ZA 2YKOA 5DLFA 4DCJB 5ETMA 1RXOB 4Q5VA 4USKA 1KKHA 3X1LB 3ZZPA 3CDAA 3JSMB 2RQCA 4F67A 3BPDA 3KMQA 1EX8A 1IBCB 3DM2B 3DDNA 1M1GA 3TAPA 3DYAB 2L3MA 4EBDA 4B3MF 4PPDA 3H20A 1NK4A 4ES2A 1KLMB 1S9FA 3OBIA 5A8KA 2C22A 4RW4A 5B0AA 2F3JA 3EJMA 1DURA 1XK8A 2QYCA 1S4FA 1EKRA 4BBYA 4AL5A 1JIHA 5F8NA 5IM0A 4ECYA 2G2ZA 3AXMA 4LJMA 3BKTA 4OI2A 3NGTA 2HHSA 2ZE2A 4IO9Q 1SPBP 3HKWA 2ZH6A 1QE1A 1FX2A 2LA6A 3JQMA 3TUZC 2ADCA 2CNOB 3EPGA 5AE2A 4LSLB 2WW8A 4J9OA 5HQMA 1CLFA 1LV5A 1DY3A 4PG6A 2J9DE 1OY6A 1FK9B 3ZZTA 3NGKA 1SL2A 2Y1LB 3I9V9 2UXDJ 2DT9A 3UCGA 4L72B 3GIKA 4NLDA 2WVEA 3BQ1A 4K7QA 3SQGA 1A6LA 1RAIB 2JVRA 3CJ3A 2GIFA 2MKCA 1MROB 2Q43A 4X4PA 1HNXJ 2W24A 3WX4A 2HFSA 4MAKA 2VIHA 4DV1F 2D7SA 1UWBB 2PI4A 4J9VA 3KUGA 4C48A 2N3LA 3I0RA 3CCJS 2R2SA 5CA5A 2V8VA 1VQ9S 5L1LA 2HQFA 3L7OA 3MDFA 1RQ0A 2FTRA 4K5SA 4KPYA 3AD8C 5F8LA 2HRUA 1SJ3P 4CLZA 3M4XA 3VZHA 4DX5A 2G9OA 3DMJB 1QLNA 2BANB 3O6QA 4M5KA 5J2QB 2NZ4A 2ZD1A 2A1BA 4LF9J 2WAQD 1YSJA 1N36F 4I2PA 4Y2MA 1VS3A 3GFZA 4NZ0A 4DS4A 3NBPB 4TVAB 2VJVA 4C8LA 4QU6A 2CQDA 3JSMA 3FBBA 2CQGA 4RW8B 2ZKTA 1YITS 2LP4A 2PFDA 1BE4A 2HQGA 2DXEA 2EKNA 2KHDA 5KFEA 5J2NA 3T1YJ 2RJZA 5LMUJ 4ERDA 1RT1B 2V67A 3D68A 3H40A 4CQ1A 5KFUA 3QSYB 3AJDA 1TTHB 2QL5B 3GG1A 5DG9A 4FPIA 2DNLA 3E51A 1OY8A 3NAIA 3AODA 4L74A 3R5CA 3VGTA 1ZPWX 4ZCMA 4B3OA 1PILA 3NMRA 4WYLA 1Q4RA 3CIZA 4JP8A 4DL7A 2D1CA 1U1OA 1IKVA 1F3FA 4L3NA 1HLWA 2PC6A 1N6QB 3KG4A 3CC7S 2MKIA 1NZAA 2VPXB 1UVKA 4DCPB 1CULB 1RHQB 4Z2XA 4KHRA 1WTFA 1Q8BA 2LQ8A 4QW9A 1LW2B 5A6PA 2LFVA 5DG7A 5HJXA 2EFOA 1LXNA 3MAAA 2YPYA 2X51A 1S76D 4KIAA 2I8EA 1X4CA 3LGHA 3K59A 3G8TA 3GU0A 2ZH5A 3ZZRA 3FFIB 1JLFA 1X31C 4P73A 4P74A 1U1QA 1NPPA 2UV8G 1TVRA 4F0HA 2ATLA 1U02A 3Q8PB 1NHVA 4ANCA 1X0FA 2HURA 3R7SB 3PX6A 1R8AA 1J5EF 4KE5A 3TA1A 1Q95G 3PEJA 2QTWA 4URSA 3U7JA 1KQKA 1FJ7A 4EYHB 1T9XA 4B08A 1TMMA 1KBRA 3EYZA 1T94A 2OGUA 4OHXA 4QYRA 3VAKA 4LREA 4ENOA 2CQPA 1XC9A 2Z58B 4GKKF 3GV5B 2L9DA 2Z4PA 3PKYA 1S12A 2IY5B 1RTIA 1GXUA 2KFYA 3VAMA 2NPIA 3L7UA 2CKWA 2RQKA 4O3NA 2RHSB 2ILYA 1NSPA 4N8NA 3ZNJ1 4UQTA 1N54B 3ENAA 2MLZA 1DJ0A 5KT5A 2IYGA 4LSZB 3MM7B 3UE2A 4X2BA 3R7BB 1QSYA 3ILJA 4PG7A 4LRAA 1REVA 4IRCA 2XHWA 1UTAA 3C66A 3G4SS 1Q7YT 2CUYA 1UFWA 2CNLB 4C8YA 2WRMA 1ZZFA 4CO5A 1G6BA 2HVZA 1W25A 1NB7A 4IG0A 4LBPA 4Q43A 3M6WA 2DGQA 2IVYA 3GCXP 1U49A 3NOGA 3HHLC 3I38A 4DV5F 1P1TA 3GPAA 2DY1A 1H3DA 4CTAB 4I2QB 5F3TA 2MLXA 4NLWA 2IA6A 2D3UA 3DLHA 3W2WB 2XBPA 3M6XA 5LL6d 3CJ5A 3L3CA 2PDAA 4M8LA 4FVCA 4CO3A 4Y6IA 2ZNYA 4JI0F 2NUHA 2DVIA 2VQEJ 4Q2LA 4DR1F 1AA1B 3GJTB 4X4OA 8AT1B 1CSJA 3GSDA 4G3IA 2XO7A 3G86A 2RMLA 1UCNA 2WHOA 1LWEB 5D4OA 4PWUA 3MMJA 2M8HA 2VA3A 1CBKA 2EC0A 2EKYA 3DFEA 3OR2A 1HBMA 4ECSA 4PZVA 1QTNB 2A6OA 2PMZD 3OUYB 3KLGA 4YP3A 1KOOA 1GMWD 3G82A 3TARA 4GVBA 3BEGB 4DSKA 1RK8A 3CD7A 3V6HA 2HLUA 3WDOA 2DNYA 2LKZA 4WYWA 3DRPB 5DZ7A 2D3ZA 2CG8A 2VBWA 2XS7A 5LXRA 5JUMA 3W7BA 3S01A 2EC2A 3RB4A 2CQ2A 2U1AA 2CPHA 1S59A 1I94J 1FE0A 1DQAA 3DGPB 3LO3A 2DITA 1KSPA 4Y2CA 2OFHX 1M1HA 1XNRJ 4A8MP 3LF0A 2Y0SD 4G1IA 4B9MA 1Q5YA 2CNNB 1CJTA 1C1CA 1SIZA 1X4FA 3TX0A 1PKUA 3FZBA 1V3ZA 3OSPA 2WONA 5J2PA 4ZVTB 1VBYA 3FEYB 2W9BB 4IFVB 2B3TB 4CLPA 1NLKL 3M2RB 3BS9A 4CCHA 1FO1A 1HBOA 1RT6A 2RD5C 1DARA 1SV5A 3KJVA 3AGZA 1EKSA 4OZNA 3ULHA 3N0VA 2VQFJ 3A4TA 4O3RA 4CI0B 2NSCA 3MF5A 2M5YA 1WEYA 1X4DA 5D0RA 2WSFC 1KVJA 1ZH5A 3RGIA 3FEXB 3TP2A 3UDEA 2B26A 2M0GB 2ZUAA 2OEJA 2KH9A 4ZLPA 2HGNA 3IA0A 1XTZA 1PBUA 1UKUA 3BH7B 5EGYA 2MGZB 3RB3A 1I5OB 2ROGA 4F4KA 4C98A 5K8PA 5CQGA 3QLHA 4AQYJ 2W9CB 3OL6A 5CZXA 2JHEA 3IS9B 2YNGA 1CJUA 5H9EJ 1TU0B 1TKTA 2VV5A 2C3PA 5CYJA 3M9NB 2IJRA 5H1SV 1HHQA 2CDQA 5HLFA 3O2IA 4CH7A 4ZIWA 4ES3A 4YOEA 3C8YA 4DF8A 3GV7B 2VL1A 2R7RA 1BQNA 2YQ0A 3W5YA 3OQ2A 2GHWA 3H2LA 3BKUA 1G3OA 2UUAJ 4DG1B 1T9VA 4X4RA 1PJ7A 2KT3A 4KKOA 3ENQA 4JUZA 3GB0A 5HBMA 2L48A 3NCPA 3CCUS 4QU7A 1XR6A 4QR0A 2CJKA 5IWAF 4OYXA 5EN1A 1XAOA 3H5SA 3AQOA 2LLZA 3GCWP 4LF5F 2FIUA 2ZBPA 2E7WA 4OFZA 1F5BA 3CJSA 2OMOA 5D0HA 4M5MA 2NXUA 1WC0A 2W9BA 4IFVA 2UUTA 2COLA 1RJJA 1RWNB 1HNZJ 2CPZA 1UPPA 4I69A 1WTBA 3I87A 2RS2A 3EM1A 1FF2A 3MM6A 3LP1A 1F5AA 3HD2A 2ZC4A 4KH1B 1MN7A 4EGLA 2R8JA 1S48A 2AJ1A 1SCJB 3Q8QB 2DGWA 2VG7B 3HF5A 1UWAA 2UUBF 1S0OA 5A2QY 4CRJA 3U27A 2CJYB 3Q83A 2AD9A 5LSOA 3BQ0A 3CMAS 2CQ1A 1MWZA 4ECQA 3CWJA 2YBVA 3TEHB 5I3PA 2K3KA 2UUCF 5KT7A 3QT5A 2V4QA 5IC6B 1KQGB 2AQ4A 4CDIA 4DQSA 1FFSB 2XEXA 1HR0F 5KOWA 2W2MP 3K7RA 3SCLE 4USWA 2VC0A 3W65A 5ETKA 2MKJA 4KBIA 2CWKA 2JNJA 5KT4A 1K1SA 1Y4ZB 3D1HA 3MD3A 4OX7A 4K8RA 3G71S 2HHVA 1TL3B 3OLBA 1JJ2R 2J6TA 3TEGA 3LPYA 3UPFA 1HL6A 4M5JA 4B3RF 2APOA 4F4WA 3C16B 3DNCA 1R27B 1HBNB 1VBKA 5CCLA 2B8QA 2NUUG 5KFDA 1G2EA 2DHGA 2MQOA 2LXUA 3GJQB 1WF0A 3FC9A 3QQCD 3N4WA 2HNZA 2M52A 4WWSA 1D0EA 4NYPA 1FE4A 4USIA 5THWA 2VDIA 3BO4A 2Y3YA 4HDHA 5BYQA 2IYIA 2E5JA 3K58A 3PR4A 1RTJA 2G2YA 4WJBA 2VFSA 1YJUA 5A2QU 4LR9A 2XO6A 4EO6A 1IM6A 1KFSA 1T03B 2I0XA 1SC1B 5LT5A 4M63A 2UP1A 4KGVB 4WCEQ 2JRRA 5F0UA 3PKMA 5EDWA 3CSKA 2E1MC 1IR1A 4IG3B 4Z37A 4WKRA 3KHGA 4YN3B 5IOLA 2WOMB 3E01B 4L76A 4NMXA 2ASJA 1RA6A 5DGAA 3W3SA 4M1KA 1FXDA 1R8HA 3R5DA 3TUIC 5DM6Q 4OZ3A 2ZZNA 3IC1A 2WVCA 2P6TA 4OYWA 1NDPA 1FRKA 2HKEA 4C2MA 1DQ9A 4MKVA 4C11A 4F4AA 4DWIA 5HK4A 4PKDB 3WC0A 2XY6A 4IKAA 4JI5F 3MUVP 4J9PA 3PYDA 1FVSA 3MEGB 4OMFG 3BDEA 4LFBF 2GQ2A 4ED6A 1DFDA 4KHPF 2CZVC 5D4LA 3MEEA 4UOFA 1VIXA 3R5AA 3R8YA 1J27A 4FXWA 3GILA 4JV5F 1K73T 4WFBQ 3BO2A 2ZM6J 3TWZA 5BR8J 3N9UC 4ED1A 2KRRA 3K5NA 1IKYB 3C19A 3S6EA 1C3GA 3UVJA 1TL3A 1R31A 2PI5A 5CCMA 2GS8A 2QYGA 2M8DB 2OPQB 1HBNA 2RNEA 3TZYA 1HYSB 3SSQA 2DJWA 2XZTB 4FF1A 3BSCA 2DTJA 2CQ3A 1RHMB 3AHPA 4D3HA 2GGPB 4Y34A 4QYZK 2EVZA 4U67Q 2BE2A 2QE5A 2RU9A 4PG8A 3MPUB 2VJUA 2CPJA 3SSRA 4KO0B 5KFQA 1T03A 1IWGA 5IZHA 2XNRA 1UZDA 3H2UB 4OX9F 3LTOA 2C2NA 3DLGB 2HG4A 1TP7A 2B9XA 1B0VA 4DPXA 3V4IA 2W2PP 2CZ4A 3KK3A 2BM1A 5SZTA 1CQNA 2M88A 1SC6A 3DU5A 5KFHA 1B7YB 3EGZA 3RTVA 1RWOB 2NYHA 3D28A 1FRLA 2UXDF 2FJDB 2H54B 3MM9B 2HHWA 3FMWA 1X9MA 2W8LA 1LEOA 1HNXF 1REGX 5DQIA 1U8WA 2JZ5A 3FGVA 3JSYA 3PR5B 5GAGI 3KLHB 4YEAA 2JWNA 1RADB 4K4WA 1HPZB 4GRSA 3G9CA 1RT5B 4DFMA 2BOAA 2IJFA 4AXJA 2Y8YA 4F8RA 1U1PA 2DNHA 4DX8H 3D6MB 2Z2MA 1YG0A 2H4YB 3BGLA 3G6YA 4F3MA 4PXEA 3PX4A 4ZVSB 4Y65A 3J7AN 2AEMA 1ZAVA 1RHRB 4DFKA 2DGOA 1SL1A 1PIEA 3M1VB 2IDEA 1SVDA 2KVQE 4ZP6A 2ZH1A 3BGOP 3FCWA 5G0RB 4K4UA 2MXYA 2FVCA 3RAMA 1SL0A 5KFCA 2UVUA 1KN6A 4WKYA 2OPQA 1S0VA 3AQPA 1O0PA 4J9LA 3CCES 2XZWA 3KWMA 1J5OB 3DOLA 3G8QA 5IT9Y 4ED0A 3A1YG 3LWLA 3QIPA 4HHHA 1HYSA 1NKEA 2EFQA 2XQCA 2VBXA 2VG6A 1WELA 4NZ6A 2DNRA 2GGPA 5LMUF 2K2PA 3HP6A 3FZ2A 5AXMA 3QBCA 3W2VB 4DU7A 5IFMA 1VDHA 2MQPA 3EXCX 1YDLA 5J2MB 3MCSA 4H4KA 4OZ2A 2W7OA 1N4LA 1S77D 1Z2LA 1OMSA 2Z2YB 3ISZA 1AUDA 1EHWA 4JV1A 3TI0A 2ASLA 3RU0A 5K20B 4OI1A 3DLGA 2YPZA 3OXGA 3AA8A 4U96A 2H4WB 2YX7A 3NS5A 2XMAA 2B4OA 1C4CA 1U8SA 1Z4UA 5GADU 1LK7A 3JSBA 3QRQA 5C7PA 4TU9A 4Q8FA 4KFBB 4O4GB 4JB8B 1D9DA 2D9PA 3V6DA 2XGQA 4K59A 1R0AA 4ZVUB 2RDDA 4O4RA 2FVQA 4RUBA 3GYNA 2Q6CA 2R7QA 3FBCA 3BM7A 4IRDA 1AFJA 2GAGC 4DR2F 3B54A 4PXBA 4QBUA 4K4VA 2WCXA 5KFOA 3QJLA 1YJNS 3GFXA 4J9RA 2UV8A 3KUEA 3J81Y 2DH7A 1HPZA 4L73A 1ZM2A 4EK2A 5IT9U 5E5NA 3GTYX 4Y28C 3Q8SB 2CPIA 2NSBA 1C4AA 2DNGA 3T5HA 2DPIA 4CO1A 1VC0A 4RJVA 4LSNB 1FFWB 2LCWA 2MZSA 5MLCV 1H6KX 2W01A 1RUSA 3A8JA 2C2KB 2V4JA 2D69A 3NNCA 2X3DA 3LQVA 2Z56B 1JXVA 5A76A 3QNWB 4EO8A 3TNVA 2F9JA 3JTOA 2MSTA 1YVFA 2J9EA 4U7UD 3T9ZA 2KN4A 4DEZA 2JEIA 1MWYA 3BKFA 1IR2A 4XK8C 1CS4A 4M5GA 2ILZA 2M4MA 3BSOA 3Q8YA 2ACMA 1D09B 3PTWA 3NS6A 4MK7A 1FJGJ 3KK1B 4A48A 1UVIA 2QT7A 2HQCA 5DJBA 3QYYA 3IG1A 4DZ6A 2CPFA 4U9RA 2CYYA 1S1XA 2HK2A 3UD4P 4O3SA 5M2UA 2FZKB 1E6VB 2K8GA 2XMKA 3NS7B 1OS5A 3J81U 3G6XA 1X9SA 3IGNA 3RZAA 2DNMA 1X4AA 2HVDA 5E3AA 3TO8A 4OYAA 4YB1P 2YKMB 2JC1A 3BJYA 3NLCA 1X4BA 4NXMJ 1XNQF 2MZRA 2VONA 3BGRA 4BC7A 5KFWA 5LSRA 2M3DA 2O67A 1OYEA 1VR6A 2B0GA 3KOAA 1OYDA 3TR5A 4EWTA 3C6UB 3POTB 4G65A 3VGSA 1T02A 5J1PA 3CEDA 2O66A 4HH1A 3AGXA 1KS2A 2E1AA 4HHUA 1B0TA 4JYAF 4K0KJ 1TR0A 2RUSA 1L5UA 4ZJLA 4LF1A 1IBLJ 2HGMA 1TL4A 4FF4A 3S8SA 3ONQA 4MK8A 2NYIA 1X8DA 3PW5A 3MFHA 2VQEF 3QSIA 3OTCA 3DKDA 2LQ5A 3B8HA 1M5HA 4RZRA 4L6V3 2HS0A 3DI6A 2EEYA 2RIJA 3LW5C 1EZZB 2OIHA 2VG5A 2XC9A 1JMTA 3DOKB 1ZTTA 2V5HG 2FJVA 3GONA 3IN5A 4ZCKA 4LF8J 2XG8A 4CNYA 2D9OA 1VRTB 2G2OA 3SCJE 2EK6A 2HFUA 1WHWA 1RYSA 2HEKA 3DRSA 1NUEA 3HHLD 5I3UB 2FJBB 1RT2A 4GKJF 3MEDB 3M8RA 4DL0C 4C8KA 3BR9A 1LWFA 2C1EB 2IC3B 2VH7A 2GJFA 5KFIA 3SMZA 1UEUA 2A0FB 3EVMA 2PMWA 1H7WA 2ZBQA 3DCAA 1YI2S 2JL9A 1I1GA 3NNAA 5D8HB 4LF2A 4JI1J 4DXLA 1MU2B 2N82B 1MG7A 4QWEA 5FIIA 1TL7A 3G6VA 5KFFA 4A8SA 3LP0B 2F4VJ 3EWGA 1Q8IA 1SC3B 1I94F 2A3JA 3CMQA 4PEOA 4Q45A 4JI3J 4A8XA 3MMBB 2CADA 1XNRF 1KC8T 3Q86A 3SBMA 1S0NA 3IBCB 4RW9A 3K5PA 2ALYB 3LP2A 1UFKA 1ZM4A 3AXKA 2HNYB 2K06A 1P9QC 2KG1A 4KB7A 2VHGA 4ED2A 1RT3B 4WFZA 3M8SA 4ZPAA 1EP4B 1HWUA 2LU2A 3C6UA 1BHNA 2H3EB 3DOMA 3K5LA 3HI9A 2M70A 3Q89A 1HQEA 4E8UA 2MTLA 3M32B 2F8EX 4N5SA 1V3SA 2P9GA 2VQFF 3CE8A 5LXYA 5B0BA 3MPDA 1QUVA 2OD4A 2NR0A 2YNIA 1QSSA 2EXUA 1ZA2B 4R8UA 5A0YA 3GZ7A 4C3KA 3MR2A 1TV6A 4Q0BA 4TY8A 4ZVGA 2ADBA 2IA0A 2RQ4A 2AZ1A 3RBEA 5E3RA 2E7VA 2VBYA 4JI2J 3HSJA 5KFBA 3A3NB 1PC5A 4IOAQ 1R89A 4DV0J 1RAAB 2HHUA 1WJ9A 3T6JA 2F8MA 2JEGA 2MKKA 3T1HJ 1WC1A 5C25A 5LMNJ 2VFTA 3MEDA 1IQTA 4IUFA 2RKIB 1HA1A 1ELOA 2BMBA 3I0SA 4Z7YA 2GVDB 1M1KT 4ED4A 3AD9C 1Z2ZA 2KXFA 1U1RA 2DNZA 2YY3A 4WE1A 1RT4B 2XMUA 1YJTA 2EK1A 3LH2S 4KQZA 1S6QA 1LWCB 4RR5A 3LGMA 1JKHA 1FXRA 5HI7A 3LP0A 3QT8A 5E3PA 3OFEA 2UUAF 2K1RB 3S7RA 2L9NA 5F8JA 4LVNP 3QATA 2AIRB 1WSRA 3TUPA 5HQLA 1KTQA 4O44B 1QAJA 2QMWA 2QZ8A 1S99A 2A6MA 4BWJA 2X1FA 4FF2A 1HBUB 1S6PA 2HHHJ 2A2CA 1SQGA 2UXBJ 2L9WA 2CQ4A 3HFVA 1T05B 3DLKB 4NLOA 3GMGA 4JI4J 1Q8LA 4DV3J 1EP4A 2GVZB 1SI9A 1PGZA 3EMTA 1Q86T 2QA2A 1S10A 1DTQA 2MZTA 4LT6A 1VQMS 3CNQP 2EBEA 1V5IB 1IKWB 3EPIA 4DL5A 1HNVB 1FVQA 2CQBA 2W25A 1AFIA 2WSCC 2E9RX 2C2MB 2KRBA 2P6SA 4CLSA 5KFPA 4OI6A 1T95A 5A8RB 3RB6A 2MQQA 2CRLA 3AOCA 3W9JA 5K14A 4B9NA 1R0BG 4C9DA 3ZZZA 5FDLB 2UXCJ 3THPA 3UD5A 4DR4J 4J9MA 1TKXB 2VFUA 5CYMA 1FCAA 2X3GA 4HACB 3D1QA 2QLWA 2KI2A 2YKNB 4DS5A 3N5BA 3MMAA 3D66A 1MMLA 1KHWA 1ZZNA 2B9WA 2J7WA 2XHCA 2Z0GA 2R8HA 1WORA 2GIQA 1JB0C 3H0PA 2PMHA 4LF6J 5KFYA 2AEFA 3FSXA 3P49B 3LANA 3TJ8A 3OT9A 2QSFA 1C1BA 3GYGA 3Q0AA 1Q0NA 1DLOB 4X64J 2HWHA 2XMWA 2I9SA 3QWPA 2DKOB 1P27B 1LWCA 4NRTA 4ILLA 3BYRA 2B9EA 2WW4A 1HQUA 4MFBB 3ZC4A 3TW0A 3TVZA 4DUZJ 3UR3C 1Q16B 2ALZA 1YHQS 4ILRA 3T5KA 2V69A 4QJVA 3DLBA 5CYQB 3EVOA 5F3ZA 2HFNA 1XR5A 4E2FB 3PW2A 4DN0A 2ZKUA 2JH3A 1NBEB 5D15A 1TK5A 1ZPVA 4ZA1A 3BDPA 2J7UA 1CPZA 3NGDA 2YNHB 4ZVOB 2VICA 1U7LA 2G4BA 5F8HA 2P9EA 2RF2B 3GV8B 2CG4A 5IC4B 4USTA 1CJVB 4GC7A 1IKXA 4NA2A 1JLGA 3MCMA 4EU0A 3IFEA 3HSGA 3QAEA 4ICLA 2A10A 4F26A 4K2XA 4KYZA 4HEA9 3AD7C 5HMYA 1S1WB 2YWWA 2RUGA 1JLAA 2R7XA 3T19A 1U09A 1TAQA 1HNVA 4TYAA 1FNMA 5I42B 2DNQA 2R7WA 4DQPA 4NEYA 1NRKA 1HI0P 1TL1A 5A8RA 3OL7A 3MWBA 4UT4A 1AUSL 3UR0A 2BJ3A 1IM4A 2E5LJ 1VQ7S 4USUA 4MJKA 1VQPS 2XYGB 1U48A 4YMEA 4RKUC 4AE5A 3NGUA 4ZLJA 2H5JB 2P9CA 2FJAB 4DR5J 4DF4A 1NH8A 3CC2S 1KTVA 2ABYA 4NLPA 5RUBA 1N33F 2ZM6F 4QWDA 5AXNA 1NK8A 3BSAA 3UNYA 5BR8F 1U47A 1VBZA 3DXSX 2FZGB 4NCGB 3LZ8A 4K2JA 3M9MB 3IR6B 1ZA1B 1YBUA 2OMLA 4R5PB 2HYIB 4DUYJ 2GJ2A 1YTYA 2LU1A 3CJKA 1NDCA 2YNFB 2MPUA 1IWAA 2EPIA 1VQYA 2Q79A 1HNWJ 4I7FB 3GIMA 1RHJB 3OW2R 4QIGA 3RRKA 3GLJA 4QW8A 5KTQA 3Q23A 5HANA 2DXFA 3ITHB 4OYOA 5E7OB 1EETB 1R6VA 3EVWA 1WDTA 2RH3A 5JMNA 1RB0A 4RW7A 5D77A 4KTQA 1OPIA 1XN9A 3MM8B 1F2GA 3G87A 1RKJA 2AYEA 5B0FA 5LJ5Y 5F8IA 2PO4A 3TAMB 4IFYB 2WVFA 2BJDA 1U6BA 1NMEB 2QMXA 1FD2A 4MTPA 1ICEB 3RB0A 4A8OA 2EWHA 2BDPA 1UVMA 3P6YC 4YR0A 2C28A 2DGVA 2AEJA 2OFGX 1RT7A 1S9EB 2GQQA 2NXEA 4WFXA 1RBLA 2I5JA 2GW8A 1I51B 2KM8B 3NOCA 3H7HB 2D3OR 3MGJA 3KJFB 1R7IA 2KYXA 1NM2A 4NWBA 2F63A 2N3OA 2CPEA 1NZ8A 2HWTA 2KB2A 2YH0A 2LXFA 3GFHA 1VISA 4TLRA 1WEZA 2XB2D 1F9FA 3PY8A 4LIRA 4EZ9A 3RW6A 3UCZP 2DO4A 4B9LA 3HM9A 3M2VB 2R2UA 2FVRA 4YB6A 5A8WB 4WP3A 3CJTA 4JV0A 4AYBD 1PO6A 2HNDB 1JNRB 3N01A 2WBMA 4DFPA 2FVSA 4RWWA 2PT0A 4TQRA 1ZOTA 2AHOB 1TUGB 3MEKA 3ISND 2QLBB 1WC4A 1PYOB 3D54A 3CF5Q 3H2VE 1DZ5A 3E8OA 3PJXA 2VKZG 5A8KB 4EI2A 1DTTA 4RW4B 4NCAA 2BABA 2J76E 2ZC3A 1PC4A 4F0MA 3QO9A 1WACA 2BA9A 1DHMA 1EJ7L 1YJ7A 3KG0A 2KDOA 1HD0A 4HT7A 2GJIA 3JQJA 3GG0A 4G1QA 3JYTA 5IM0B 1D8YA 1M5PC 4B3SJ 5L46A 3QJPA 2F4FA 2ZE2B 1U0SA 3R27A 2AP6A 2J0WA 3D7SB 4LRFA 3SXLA 2RRAA 4PUOA 4G6VB 3UWTA 3UN5A 5IV3A 3HVTB 4ELUA 2L08A 3RR7A 1RWMB 2HZCA 4FYYB 1KRPA 2ZVIA 5EX3A 5KG0A 3W64A 3DHWC 2CFXA 5L1JA 3U02A 4ZLLA 3W60A 3I56S 2QLDA 3JSRA 4B17A 3FCHA 2V2ZA 1U2CA 2DH8A 3KDOA 4RBUA 1H74A 4ZPDA 5GMKa 2R8GA 1D3WA 2BQ3A 1SKWA 4B3MJ 1B3TA 5ETTA 3KDNA 1QUPA 3J7ZT 3HHEA 2DCLA 4DHVA 5HROA 2BRLA 2RDJA 3HZEA 4OJGA 1Y3KA 2IM0A 4TN2A 2FD2A 1VFJA 4ZPVR 2RS8A 3IMQJ 2DCUB 2RQMA 3SCKE 4I64A 2B43A 4KV8B 2XCAA 3F41A 2YWKA 1U1LA 2PA3A 2C2OB 2AGOA 4KGMA 3OLAA 4YR2A 2IM2A 3ZFVA 3PFEA 2OP5A 4CLLA 4MKAA 4ZDNA 4OHYA 1X5OA 3R1LA 4I6YA 3HXMA 2LQ9A 4IH6A 3CO9A 4QWBA 2J6UA 2BKNA 4P2SA 4FN5A 5HMZA 2CJQA 2MKHA 1S0MA 4I2PB 3MR7A 4DR6J 5EWGA 2EI5A 2FC9A 3ELHA 1LQ9A 1RTHA 3M9OB 5LJ3Y 2IAJA 3PHTA 3M2UA 5K9FA 4DV1J 1HNIA 2Y0BB 5J2NB 4I67A 2F1FA 1VLOA 1FJGF 4EUVA 3ICLA 3VQSA 1M5KC 1G1XA 2AYGA 4FP9A 2F7VA 2B5JA 1S57A 3OPKA 1AZSA 2XI2A 4Z7CA 2LYVA 4TLQA 3QWUA 1JLQA 4RBVA 1IBKJ 3KG1A 1RAEB 5GADI 4B3OB 4DV2J 4QPTA 2HGLA 2QLJB 3ENVA 1RHKB 4UW2A 3QGGA 3HVTA 3OVAA 4J91A 2C2RA 3HHNB 1LFPA 1N36J 4YY3J 1IKVB 1TK0A 2ZVSA 3R2CJ 1WOOA 4DSLA 1KFDA 3VWSA 2ZHOA 1WD6A 3UD3P 3FNNA 4NEZA 2DR7A 2E1RA 4PQUA 2GZOA 3C5XC 2R7SA 4PCQA 4F3OA 2LEAA 4DDFA 4DPWA 3QZ7A 4KSEB 1PYTA 3GYXB 3P5BP 1MW7A 1MSWD 5ETPA 4LFCJ 2FLLA 3MAAB 4LFAJ 2JFDA 5HMXA 3JQKA 2HIYA 2PSZA 2VA2A 3OTEA 1T9TA 4DR3F 2J0SD 4K0KF 4PWDA 4ANDA 4YDDB 1RWKB 4KV8A 1NK0A 2RHQB 1JLFB 1OQ6A 2CPDA 1IBLF 3KLIB 3R5JB 4RU9A 4WPAA 2XMMA 1HQ2A 4N7TA 3VVTA 1C0TA 4NXNJ 1U2RA 2XWXA 2J6SA 1TVRB 1SKUB 2HQDA 3R5GA 2GQCA 1J2VA 1OSCA 1U24A 4QIEA 1B7FA 3CGIA 1V3RA 1WOPA 2X1GA 3NMAA 3W1YC 3U1MA 4K4TA 4M94A 5HL7Q 4X84A 5CD4A 4BDPA 4LF8F 3HCXA 5T41A 3OXLA 4AXIA 4ES1A 4IH7A 1SQEA 3EZOA 5KFVA 2XYHB 1SC4B 3C6TB 4C8OA 5L39A 2GV1A 1RTIB 2MZQA 4ZP8A 1I6JA 4UZBA 3M8QA 2V63A 1FKPA 4ECRA 4JBCA 5KG7A 5KFXA 2XTJP 4X4QA 3HFKA 4B3TJ 4DPTA 4X4VA 9ATCB 4NMLA 2CJAA 2WSEC 6FDRA 3IRWP 4WIQA 1TZ0A 1FXLA 1MN9A 1HWJA 3WX8A 1FKAF 3T41A 2PN6A 1UA0A 2F4VF 4Y2KA 1VHIA 2YWHA 1H0HB 2MKSA 2OPRB 2FJWA 5LSLA 2ASYA 1REVB 1JK9B 3CCTA 2K7KA 4QR2A 1JJHA 3CCLS 3HSZA 4WK3A 2JLGA 3KLEA 3D6HB 4DLGA 3FKBA 3V6KA 4IG0B 3MOJB 4JOUA 1TK8A 4CH1A 2EFPA 2MLYA 2EG2A 3ZO7A 4GKKJ 3NXZA 3AKOB 2Q3PA 3I6PA 1QM9A 4Q7AA 2E5HA 4C0OC 1U45A 3NY0A 5AXLA 2DH9A 2POKA 2VKRA 4OLPA 3I5BA 3PEHA 1IN0A 4N41A 1FRHA 4R0EA 4GO5X 3QGHA 3I31A 5KFKA 3KJQB 4UZCA 3QRRA 3WHIA 4IH5A 1O8BA 2BKPA 4FYXB 3KLIA 2J9DA 4DCOB 2ZH4A 2YWFA 5L8RC 3BN4A 1T8EA 2GFFA 4USVA 4ZVRB 1B64A 2R42A 3PRBA 2W2OP 1Q53A 3JTPA 4RNMA 2CXEA 3DRYA 3OR2B 1NJXA 1HBMB 4LUBA 1VQ4S 2Y1IA 3GR0A 4DUTA 3KLGB 5B09A 4ZVQB 3G82B 3PIPQ 1VCTA 3OFGA 4F25A 1QVGR 3C6TA 3T1HF 1A9NB 4CO4A 4GVBB 1GMVA 5LMNF 2PFFB 2JFKA 1VC5A 3OFHA 2V9WA 2YQ3A 3NAHA 1X4HA 1V9OA 3KNAA 3D3CJ 3D3BJ 2KM8C 2V8HA 4WK1A 4K4SA 4PABA 3FRZA 1Q79A 4DR1J 3WIUA 3N79A 3AA9A 2DY9A 1CEZA 2DBBA 2DEIA 1TFWA 4NLYA 4AT1B 1M90T 1QAYA 2CAJA 2ZBIA 1U1KA 2QA4S 2OPRA 2BE7D 3MOZA 1BQXA 3TYTA 1BD6A 1WC3A 1CJTB 1FJEB 4RO0A 3DLLQ 3L4BC 3W5XA 1C1CB 5C42A 1NK9A 2XLKA 4NLXA 2WONB 5J2PB 4H54A 5ETLA 2HW3A 1RCOB 4UY8T 5DDOC 5HP1A 2XI3A 4X62J 1Y11A 2KT2A 4IOCQ 5KFAA 4V19J 2UXBF 1V5VA 3SQOP 2KXNB 4E98A 3H5YA 4JI4F 3H90A 1HBOB 4DV3F 1RT6B 2MY8A 4ZITA 3JTNA 1SV5B 1RTZA 3M6VA 3HK2A 3KJVB 4MKYA 2GX8A 1L3SA 5U47A 5DDRC 2VOPA 2V8PA 3RW7A 5EUHA 4J9UE 1SJ1A 3ENWA 5E3CA 1F1BB 4LF7J 2B8PA 3FEZA 4H4OA 4U6PA 3DLJA 5D4NA 5M2PA 5HVFA 2MSSA 1UVLA 1P1LA 1HHSA 1HWKA 3EICA 4LF4F 3KK2A 3AJ1A 3RAQA 3UN2A 3I4HX 4OHWA 3U1LA 1FRJA 2HQ3A 5M2RA 2EG1A 4UOGA 3RRGA 4QYZJ 3QLHB 2JOQA 3N28A 3HMJG 4L3KA 3RUBL 1FWKA 4FKXA 3SFUA 1GXTA 1QTMA 4C0BA 3CW2C 2YNGB 3VVUA 1CJUB 1NHKL 4FKYA 3QFHA 1TKTB 1HMVA 3PV8A 4YHHJ 2V9KA 3CO0P 4ED3A 5D3GA 4IDKA 4ZOSA 4P72A 5HLFB 1WDDA 1DRZA 3M8PA 1BQNB 5D0EA 1ZAXA 2MMYA 1YQHA 5DETA 4KT0C 1IJFB 3FBEA 4X64F 1AT1B 3I96A 1L3TA 4UTGA 3MM5B 4X66J 1WKKA 4KKOB 1ZYQA 3VAGA 2QC3A 2R2TA 5A6WA 5HBMB 4UF4A 3PO5A 2VU5A 3M05A 1N32J 2AX0A 2Z57B 3K8WA 2HQIA 1N34J 2DGSA 4KHMA 4BCAA 4A47A 5F41A 5GAEU 1ACMB 1K0VA 1URNA 2IFXA 3CVKA 4RPFA 3D9BA 2MQNA 3OR1A 1Y3JA 2RRBA 1GNKA 4P2FA 2G0JA 1F9HA 1ZAWA 2FZCB 1DBDA 4XAKA 1RAFB 2W7PA 3OVSA 2XYPB 1JLCA 5H9FJ 3MM6B 2H9ZA 3LP1B 4G1PA 1PG5B 3FSYA 2IIHA 4OZLA 1FJCA 2MY7A 1U1MA 2DO0A 3H4BA 1QSLA 1EQMA 3C46A 1RLDA 2HMIA 2DGXA 3KXDA 4DZDA 3PXGa 4NYOA 1TMJA 5L9NA 4N47A 3IBWA 3A13A 2OPSB 2ZOMA 2F65A 2VD3A 4LF5J 3RYLA 3QFWA 3OL8A 3HT3A 1FRIA 3A8EA 1RACB 4P6QA 5HMWA 2E5LF 4NLVA 3UN3A 2BV3A 2IVFB 3R97A 3UNGC 3LAMA 1FFGB 1SKSA 5C2GA 1UVNA 2HAIA 4XIUA 4A8FA 2DNKA 2ZJPQ 2HBRB 1HD1A 3VGVA 2IMOA 4GC6A 4TXSA 2AJFE 4ANEA 1YJRA 2YX4A 2LQBA 2GIRA 3ZNUA 3DDIA 1YK9A 4P2XA 5KFLA 4RL1A 4WU3A 1VQNS 1BY9A 4DUYF 3D67A 2HS3A 3Q22A 4DJBA 2EFVA 3FMBA 2HNZB 2VBZA 3WZ0A 2FGCA 2DR6A 3MM5A 2HFZA 2V4RA 2RRNA 2BEFA 2OKQA 1UETA 3ILIA 2UUCJ 2ZWOA 4DV7J 2ZJRQ 1RTJB 4TKTA 2GHVC 2XMTA 3V81A 1S1TA 4ZCIA 4V1Ak 3VAJA 1L3KA 2GC8A 4K4YA 1T0TV 4Q8EA 1KWMA 3GFYA 5ETVA 2W4PA 4MMOA 4ALZA 4CLWA 1QAIA 1VI7A 3H8YA 2UVWA 4B3RJ 1P9YA 3HHLB 2VC1A 1LWXA 2MYFA 1GX5A 2DNPA 3C15A 2C3OA 1XBWA 3IXQA 1CJKA 1YX2A 3BZQA 3MPVA 4P10A 3OXFA 2ZUGA 1UJ5A 2NCKL 3PYEA 5E33A 1NLTA 4C11B 1EQ0A 4OI0A 1RBOB 4NA3A 2OPSA 1UPMB 4HT5A 4JI8J 3DHXA 3ETMA 1TKZA 1UFLA 4HI2A 3R9LA 5EX0A 3V2UC 3SV3A 4ZPWR 1YRTA 2O5DA 3MEEB 2ZDPA 2C2ZB 1XMQF 4JI7J 4ID8A 3CCVS 4NE9C 2PEHA 4OYZA 5CABA 1RAJA 4CIOA 3D0IE 3TZWA 2KU7A 3RBXA 3T6BA 1K44A 1XIQA 1FNXH 2OEKA 4R25A 1H2VZ 4DQIA 3FRYA 4OQJA 3BBBA 3UVJB 1X5TA 1NAQA 5C5JA 4HTJA 4TNOA 5AJ3F 2HBYB 3MECB 2OD6A 1M5SA 1NSAA 2XY5A 2A2DA 3D2WA 2BQRA 3CT9A 3CCRS 2HSEB 1SKRA 1WNEA 2GA7A 1RHUB 2YKQA 3HO1A 2BE2B 3TZXA 4KHPJ 3MPWA 1AROP 2HHXA 2OAUA 4JV5J 3CC4S 3PW0A 5E3QA 2KO1A 2N7YA 2W8KA 2Q66A 1U2FA 1WG5A 3O5TB 1HWLA 1RYRA 1VQLS 2E66A 1FHTA 3GQCA 3V4IB 3KK3B 2UZAA 3IR7B 2RDIA 4PG4A 4RBTA 4FDFA 1D1UA 4A8YA 1YLXA 1XJWB 4HI1A 3HHLA 5L1KA 3KFWX 3MTJA 1C0UA 3US5A 5J1NA 5T7LA 5F9NA 2KVIA 2CJBA 2XNQA 5IS2A 3C2PA 2UU9F 4HLBA 3KYLA 3UDCA 2IRYA 3P5TL 5EWFA 4C8ZA 1WOSA 5DQGA 3K17A 3TJ9A 4ZPCA 3CMES 2OUGA 1H98A 1GH8A 3MR5A 5C24A 2W9AA 2C3YA 4EBCA 3NP5A 4CYUB 4I1TA 4OX9J 3HFZB 3W9HA 3QGPA 4Q2MA 2VFVA 3MD1A 2M2BA 4KAIA 1BLUA 1R43A 3SSSA 4WP8A 4F4XA 2YXLA 1QDUB 3W5ZA 4BWMA 1CC7A 3G8SA 4JI6F 4RW6A 1U6ZA 4DQQA 4CLYA 4ZVEA 1BXNA 4DR6F 5KFRA 1RTDA 2WB1D 4DV4J 4I4BA 2AMCB 1RCXB 3CD6S 4FS1A 3CCSS 1WC5A 1MNEA 3MECA 4DL6A 3A8KA 3NCRA 2ZJQQ 3DOLB 4HDGA 1RWUA 1Q1KA 4RU2A 3QIPB 1KQSR 1ROFA 3J7Z5 5ETRA 1PCAA 2V8GA 1WEXA 2FPHX 4URGA 2VG6B 3MAQA 2BUNA 4P71A 1E6YB 1VRUA 2V2VA 1S6UA 3E3XA 2E5IA 5HVGA 1IBKF 2FUG9 1U0HB 2YWGA 2FHJD 4DV2F 1Q8KA 2ZH8A 1H2UX 4ED7A 4BHQA 2OSQA 1WI6A 3C14A 2IBKA 3TOQA 4LRDA 1Q5VA 3IWLA 2H51B 4YY3F 4F0KA 3ET6B 2BR0A 3MUTP 2V8DA 2DHHA 2HBQB 3H98A 1EAYC 2CVIA 5L9XA 4I56A 1VJWA 3V6DB 2CPYA 5B0DA 5BYSA 4MK9A 1FDAA 2UVVA 1KNZA 1R0AB 3B78A 3DM2A 5L38A 3DYAA 4C3MA 1KLMA 2JRSA 3X3UA 1RISA 2C3MA 3BPSP 1NXIA 2NLWA 3MPYA 3PG9A 4LFCF 4LFAF 5B7WA 2AW0A 4NLSA 3VCDA 3B4MA 3P96A 4C8NA 3H5UA 4RUAA 2QLXA 3K5MA 4NCBA 5K8NA 1TFYA 4CYUA 1NK7A 1JQGA 2JDJA 1QJHA 4RX6A 4LSLA 4NXNF 5H9FK 1P8GA 2JJ4D 2AT1B 1RABB 3R1HA 1FK9A 4OZ1A 3UFCX 5ADZA 2E1CA 2V4JB 3CDBA 3FDSA 1XMBA 4LF9F 4ED5A 3O44A 4IRKA 2JX2A 3HPOA 4W90B 2ZWPA 2JC0A 1UMJA 4QIWD 3B82A 2A18A 5HN0A 4FVMA 4CLKA 5JVHQ 3TZZA 2KYZA 4DR2J 2C3UA 2G13A 1CS4B 2NXCA 1MROA 3HHDA 1APSA 1UWBA 2KZMA 2YQ1A 3SFGA 3T1YF 4O3QA 5KAKA 3IG1B 3J81j 3FSIA 4DPOA 1S1XB 1E6YA 1RWWB 2U2FA 3Q2TC 4B3TF 4RUHA 2FQQB 4KY3A 3NKYA 1F5CA 3W63A 2XZDB 4A46A 1FTCA 3O1LA 4J7CA 3DMJA 1U0HA 2BANA 3J7A1 1JLBB 4ECVA 5KFNA 2VF3A 4EEYA 5J2QA 3F0NA 4C0HA 5HVHA 3QZ8A 3VQTA 4O3OA 2IRXA 4KPCA 3ET6A 2Q2GA 4HR2A 4ZP9A 2HZVA 3BGRB 3NBPA 2DIVA 3FVYA 3N6MA 1VMBA 3PRVA 2HRYA 2D41A 4RW8A 1S1UB 5IT4A 1RU1A 3PYGA 4ZP7A 2NS1B 1LW0B 4IR9A 3TAQA 1XEZA 5CD4H 3KHRA 4WXWA 1RT1A 2BJ8A 3RR8A 3IBFB 2VDHA 2RAQA 1NU4A 1D8ZA 4XDDA 1HKAA 1NPKA 4U7UK 5GAHU 3I55S 1PBAA 1YJVA 1FERA 4IYQA 3PJWA 9RUBA 3PW7A 1R8CA 5F8MA 2FHOB 1YIJS 2V2KA 3DI6B 5LM7E 1TAUA 3EXYA 2VG5B 3ZTOA 1HFEL 4UOHA 3QT7A 1XNQJ 2IM1A 1Y5IB 1N6QA 2R3VA 3AH6A 3KNGA 3AFGA 4DV6J 3WIVA 3AOAA 3TA2A 1ZTWA 2IHR1 1NEEA 4X65J 3IWNC 3DRSB 2OJ3A 2HVEA 1FEEA 4ZPTR 1RT2B 2XMVA 2KG0A 1CULA 1LWFB 3R5BA 1GTHA 1X5SA 4FXVA 3BREA 4JYAJ 1LW2A 4FBTA 3MR3A 3CUNA 4H4MB 3IP0A 2R7VA 4J9SA 3OTBA 2HHPA 2X1AA 4DSJA 1TL7B 2KHCA 2YKPA 2BVZA 4Q44A 3FFIA 2MZ1A 8RUCA 2FGOA 1T9YA 3ZZ0A 3THVA 5AE3A 2Y8WA 2XULA 1YJWS 3CCZA 4F02A 3LWMA 4WTYA 1JLBA 3IGVA 2LA4A 5KT3A 5B08A 4RW9B 2JVOA 2J7KA 3LP2B 5SUHA 2WB4A 1NKBA 1B4SA 2PEBA 5J1EB 5B0CA 4CLFA 4GKJJ 4M5DB 4O0IA 4DFJA 4ZJOA 4X62F 3VTIA 1S1UA 3D6FB 2R7OA 1F9EB 3AB4B 4UOCA 3DOMB 2I6WA 4WIIA 1AW0A 4ZVFA 4DSEA 2JLEA 1VQ8S 1LW0A 3BF4A 4OV1A 1HQEB 3JAMY 1VC6A 1MMDA 1EB0A 2B4UA 4X4TA 2HHTA 1PSDA 2BRKA 1P6TA 3UI3A 4DPUA 2YX1A 4B9SA 2CDRB 4NASA 5GMEA 2YNIB 4NYZA 4LF7F 1NJWA 4R8UB 5A0YB 5KG5A 3MM7A 4Q0BB 1TV6B 4TY8B 1BWVA 5DLGA 4B9TA 4J9KA 2B51A 4QIVA 3QJJA 4R0JA 6AT1B 1B0PA 1B99A 1KQFB 3W8GA 3BQ2A 5DGBA 1YRUA 2JSXA 3A12A 3HVRA 4LBIA 2GMLA 3P8BB 2ZZTA 3SZ2A 3PACA 2D3O1 5K8OA 2DB1A 4ZLNA 5C25B 4UY85 4UQGA 2BJ9A 2RU3A 2R8IA 2EBGA 2E1PA 3DGVA 3I0SB 5KG6A 3EDQB 4TY9A 4MIWA 4K4ZA 4ATNA 1BWEA 4YHHF 1NSKL 1UEKA 4CTAA 3BN7A 4I2QA 1XMOJ 1H2TZ 3D1OA 3ZTQA 4WE1B 2OPPB 2E7XA 3W2WA 1X7VA 4H4MA 4CWBA 2W7AA 2ZOFA 1S6QB 2BJEA 3MUMP 1JKHB 3G2XA 3HULA 3MTKA 5HO4A 4OZ5A 4M95A 2V34A 3N5FA 1K9MT 4ZVHA 3JAMU 2MHEA 2G0CA 3DLEB 1H38A 2DGTA 4X66F 3BH6B 1WSVA 1MMNA 2ZZMA 4YDXA 3VZIA 1N48A 2AJ4A 1LWEA 5F9LA 3H5XA 1N32F 3CJQA 3P3DA 5K8MA 1W26A 4EFAC 1N34F 4HL9A 4DN9A 2QV6A 1S6PB 1NDKA 4DR7J 5J1EA 4CZCA 2CIMA 1TUWA 3IWXA 3BR8A 2XS2A 1FDDA 2F9DA 2H1YA 3CJ4A 3LALA 3OUYA 4M5DA 2MZJA 1VQOS 3ZTSA 3NCQA 3OJSA 1IQZA 2XSJB 4KRWA 3BGUA 2ZHBA 3D6TB 1DTQB 4KR0B 3PW4A 1FX4A 3THTA 3PZPA 3CXCR 2GNKA 1S79A 2P8IA 3DRPA 2QA4G 1HIYA 4XPEA 1A7GE 1KONA 1WG4A 2AWZA 8ATCB 4IOBA 2AF6A 3GIJA 3L7PA 1URRA 4Y3CA 1PJ5A 2L41A 3EGVA 3DGPA 4P7VA 2RSQA 4ZN1A 5D78A 4H4KC 3Q8RB 3J7YI 3MURP 5K14B 1KDNA 1OJ4A 5KG2A 1WF2A 3AJ2A 2ODXA 1TKDA 1PAEX 4KC5A 5CYMB 4N77A 1N8RT 4OYMA 3WC2A 4PAAA 2RE1A 1GK8A 2C2DA 4ZVPB 1VLYA 4PG5A 4AQYF 4ETZA 1RU2A 3MMAB 2I38A 1YZ6A 4PR6A 5FJ4A 1FDNA 3M2RA 3PX0A 3M7VA 3QRPA 1UL3A 3OL9A 2OHDA 1ZS6A 1VBXA 1C1BB 2OEMA 2DRAA 1JLEB 2BJ1A 2OPPA 1FT8A 1FI4A 2VASA 3HJFA 3I5CA 1FWLA 3N6NA 4ETXA 5ITHA 3BO3A 4OLOA 4PYDA 1OO0B 4OJ3A 4A4JA 1HQUB 5GAEI 4WFAQ 3KLVA 3DLEA 5FLXY 1PYSB 1RA7A 3DXBA 2EFNA 1WKJA 2XMJA 1L3VA 4DV7F 2K7JA 2MGZA 4J90A 3RBDA 3MZIA 1YGYA 4NI2B 3QGIA 1S72S 5DDPC 1S97A 1IR0A 1ITPA 2W9CA 3CDEA 3PHEA 1S4EA 2FJXA 2Q1LA 2IMWP 4M5NA 3IS9A 2XSJA 1IKXB 1JLGB 1JXLA 5HSPA 4ICLB 3H42A 1HNZF 2CVEA 2WBRA 4DOZA 1EARA 1NDLA 3FUYA 2B6AB 1JLAB 4YB5A 4I6AA 2DHSA 5KT2A 4OYPA 2GMJA 4LRBA 4LBHA 3BYPA 4DG1A 3T1AA 1WHXA 1S9GB 2W4CA 4PXCA 4ID5B 4HHJA 1TL1B 3RBZA 4QZVB 3MCNA 1ULRA 4YQWA 2N7CA 2QL9B 1Q81T 3AOBA 3GR1A 3EGWB 4JI8F 1JXEA 4LR7A 4DBQA 1UW4A 3T3FA 3PVXA 4NOHA 1D9FA 3RJMB 4FS2A 5AT1B 5FLXU 4JI7F 1S7IA 2BX6A 2AGQA 1U26A 4FNHA 2FLNA 2NXJA 3VALA 4WZMA 4KH0B 4OJHA 4PPZA 4LQ3A 1NPRA 3FK4A 3KUHA 4URQU 2XM3A 3LA0A 1RLCL 2VFRA 3AGYA 1JLEA 4ZMMA 5KFGA 2HRTA 3CJKB 2ACYA 1XQIA 3OTOJ 4WTOB 2VG7A 2Q6BA 2PD1A 2W1BA 2DNOA 1VJQA 2WTFA 1IBMJ 5CH7B 4W4MA 1QAXA 1K47A 1NJZA 4FXDA 2H5EA 1VIOA 3TJAA 3RG6A 2B7BB 4RW7B 2X1BA 3V6JA 5HAOA 3BBFA 4WFYA 3VAHA 4NI2A 3FBFA 3HHKA 3K5OA 3CB4A 1N33J 3CDUA 3CJRA 3M8ZA 3OVBA 4XO0A 5CZVA 4Y0FA 1NJIT 3DN9A 1PJ6A 1Y00A 4OIXA 3W66A 2Y1JA 1KVKA 2IJNA 2JEJA 4L75A 2HVIA 2NXNA 3OHAA 1K8AT 4YR3A 3C16A 1RT7B 2KFZA 2XCPA 1R8BA 1Y5NB 5KFJA 2B6AA 2SXLA 5D4PA 2I5JB 4HKQA 2FY1A 3EX7B 4WZQA 4E0DA 2VODA 5JXSA 2QA1A 2ZITA 1S9GA 4ID5A 2XLIA 4MH8A 4EBEA 4CLUA 1KHVA 1Y10A 3IM9A 3KKFA 3OTDA 2B56A 3PYFA 1CQMA 5FD1A 5JVGQ 4DPYA 3Q2SC 1N0VC 3TUJC 2W2QP 1VQKS 2ZH9A 4BS2A 3IAM9 4U7CA 5C2CA 4CO2A 5DZ6A 1KVIA 3TQEA 7FD1A 4DQRA 4BC9A 3ETOA 2QEXS 4X4NA 2DHXA 4IG3A 1JJ4A 4AD6A 3G6ES 1TELA 2WOMA 2KTQA 3E01A 3ISNC 2XS5A 4IR1A 1ZBTA 3MHYA 1OSDA 3M30B 4LVOP 1GX6A 4B9UA 3KLFB 4DV4F 4PWWA 2H65B 2JEFA 4CH0S 1AXQA 4HTIA 1DTTB 3J80Y 2ASDA 3V5RA 2VB6A 1AB8A 3BV8A 3QO9B 1M0SA 4C8MA 1SJ4P 4YB7A 3ZXWA 2DR8A 4G1QB 2J5AA 4MKBA 3MEGA 3ZTRA 3JYTB 4OYBA 4NX9A 4P52A 1VOMA 2G1DA 3NEKA 4PUOB 4ZCLA 4WXOA 2CQIA 4RNNA 1RWXB 1U6FA 2VPYB 1U25A 3H59A 2AX1A 2I2YA 1WHYA 4RLEA 4DLEA 4B02A 3HD1A 4QR1A 4NLQA 5DM7Q 4TU8A 1IVZA 2HFVA 1IKYA 2HFOA 2LECA 3TQ1A 3CJ2A 1CVJA 2EFGA 4ZIVA 3TANA 4USJC 4QWAA 3HSDA 5HROB 2BYCA 3N6LA 1X60A 3VAIA 4S0MA 1KLNA 2BOPA 1UEVA 1RP5A 3M6UA 3VGUA 5DQHA 2BXJA 4ZK7M 4ZHRB 1RKIA 1OQ3A 2Z2ZA 2P5VA 3RRHA 3JB9k 3J80U 1WHVA 4KO0A 4FBUA 1PAUB 4F2RA 5H9EK 1S6OA 4U8YA 4XDCA 4QWCA 1F3VA 2HWIA 1K0TA 3M8WA 4ECUA 3I82A 1Y0HA 3GE9A 4AFFA 2CQ0A 4C6AA 5IT0A 1TL5A 1RWVB 2VPZB 3KHHA 1RTHB 4F50A 2LDYA 1U1NA 4C7QA 2QFJA 2IAJB 3M30A 2KZZA 3M2UB 2BW2A 3PIOQ 3KLFA 1NNDA 1Y9OA 3K57A 1HHTP 4MYTA 4I68A 1HNIB 2CQHA 3CCWA 3MM9A 3TVYA 1Q7LB 3BB5A 4DX7A 3H4DA 2OTLS 1H73A 4P9SA 3WBZA 4O3PA 5AE1A 1SJFA 1T3NA 3KLHA 4PXDA 2V0NA 2B5JB 3MFIA 1RT5A 2Z2LA 3OHBA 1AZSB 2PA8D 3DDKA 2FDNA 2V50A 4D3GA 3FQLA 2J0QD 1JLQB 2OLWA 3HVAA 2ZBCA 4J5OA 2BKOA 3EDRB 2IVMA 2DR5A 3MI7X 1SXLA 3QIDA 4ITSA 1GFWB 1C2PA 1T9WA 2MQLA 1I3OB 5GMDA 3NRBA 3M1VA 2DGUA 4B9VA 1WF1A 4PQUB 2GCFA 5G0RA 5AXKA 4RWXA 4DL2A 2W2NP 3T5LA 3CIMA 2E9ZA 1Q78A 4ZKAA 5D6GA 1J5OA 1VK8A 3CD5A 3NWRA 1G7CB 1YRXA 4F36A 2DYAA 4CM0A 4ZHRA 3W2VA 1GMUA 4PWDB 2YKAA 2N4CA 3VF0B 3A3PB 5J2MA 1OWXA 2Z30B 1C0TB 5IXUA 3PCOB 1SJRA 1FRXA 1WKLA 1BUXA 3W62A 1SJQA 2MJNA 1M5OC 1JWWA 4OV6A 1MWQA 3ADAC 1CG2A 4KFBA 4O4GA 1VRQC 4DV6F 4N8OA 1UW9A 4M5IA 3PDNA 5DG8A 4X65F 2E9TA 4P7TA 4UUXA 2DRDA 5BXIA 1UA1A 1N5TA 3W9IA 2FVPA 2QX0A 2C2EA 3L95X 3I5AA 3M8QB 3F73A 1FKPB 3I4PA 1R6YA 1IUJA 1N5VA 4FYDA 1A0OB 4DR3J 3B4DA 5CHCB 1BQMB 2V2QA 1H7XA 2IDLA 4OHVA 4LMZA 2XGPA 4EYIB 1W2IA 4NLRA 1NSQA 2ROPA 3HZGA 3SV4A 4OL8A 2BM0A 3R6LB 4LSNA 2GO8A 1OY9A 2MDAA 1N88A 1YBTA 2KJVA 3KLEB 4NPOA 3OFFA 1NJYA 4K4XA 2FLOA 1FESA 3SYZA 2J8SA 1XWLA 1GXLA 3HVWA 1GT8A 4NXMF 3ZTPA 4N76A 1H72C 5IV4A 2KXHA 2ZNZA 4Y00A 1YZ7A 3K89A 3MAHA 4TU7A 1X9WA 2IRUA 5GAHI 2R7TA 3KK1A 4IQMA 2Y1RI 3DRRB 2QGFB 1SH2A 3GIRA 2NQPA 1RWPB 4IO1A 3QPIA 1F0XA 3MCOA 5IQ6A 1GEHA 2DISA 3EUNA 3UDLA 2YWEA 3RAXA 3SCIE 1TUVA 1U4BA 3PFOA 2O3DA 2ERRA 2AYMA 4OX8A 2VPWB 3D0HE 1E6VA 1QY7A 2DNNA 3MR6A 3ZZYA 2DIUA 2ATCB 2DR9A 3I32A 1FA0A 1OIAA 5F8GA 2MQ8A 1SB6A 2ZH7A 2R7UA 3PM9A 2GO9A 2YKMA 2LDIA 2WVBA 3O8WA 3H25A 2QO3A 1X5PA 1O6XA 4RNOA 2NPFA 5EHHA 1G4CA 3D5MA 2BQUA 4JV2A 2LXIA 1IJEB 1SH3A 2KJWA 3POTA 4ED8A 1VK3A 3MMCB 4DU8A 1UAWA 2HBZB 2R8KA 3MXHP 4N56A 2LQJA 3GIIA 3C3LA 3AT1B 2HVHA 2CZ9A 3R3TA 4AL6A 1XMOF 5HQ8A 3OJUA 3LPEA 4USMA 3VAFA 1BQMA 1W7WA 1NO8A 5B0GA 3SEOA 4JI1F 1SQFA 2LEPA 5HATA 1Q82T 2MJUA 2AZ3A 3FJ2A 2ZOGA 3ZZOA 4BLGA 5T14A 3ILLA 1K1QA 3R7NB 1J5EJ 3T5JA 3K2YA 2O1PA 1N56A 4JI3F 3NL0A 3HKZD 3DOKA 2BBEA 2VOOA 5C42B 4WFNQ 4FZVA 1NH7A 4NZ7A 1FNOA 3W61A 1GTEA 1VRTA 1TQLA 4DR7F 2BE9B 4KJIA 3C6EC 1GAOA 5HP1B 3V4MA 1HI1A 3UQSA 1LXJA 2OO4A 1RI7A 3L9ZA 3CJ8A 5I3UA 5BYRA 3KMSA 4J80A 1SBRA 2HS4A 3GJSB 4ZS6A 2NREA 4F3QA 2Y9HA 2IC3A 4TQSA 2E44A 4OYIA 1R3NA 3LOUA 5KFTA 2B4VA 1IXKA 3HX9A 2GHPA 3DRRA 3LGNA 4PRFA 5KG3A 5KG4A 4J9NA 1MU2A 2IPOB 3P4UB 1KP6A 3NGRA 5E2QA 5LOQA 4CT8A 5D0GA 5ETOA 3A3OB 4H4OB 4J37A 4OJ1A 2QL7B 1R8PA 3F56A 3PNIA 3KTQA 2AYBA 3TVKA 4DSFA 3KK2B 2QMUB 4QQBA 3MMBA 3PRDA 4TYBA 4A8QA 2G1HA 2ZH3A 4JI2F 4MYUA 2CPXA 2MB0B 2BZ2A 1WI8A 4F04B 2DD8S 3E2EA 2HNYA 1FDBA 3KJNB 3HT0A 3L09A 3HLUA 2EW9A 4DV0F 1RT3A 4KGZB 3T9NA 4DV5J 2B9YA 2AV5A 1HMVB 4DL4A 1WWHA 4ZPBA 2I1RA 2QFIA 1JX4A 5D3GB 1X0PA 5HJYA 2YH1A 3MMCA 4IDKB 1SH0A 2ZBRA 3LUYA 1ZM9A 3P45B 4MIBA 4A8KA 5IQQA 1ZETA 4F2SA 3M8PB 2QSWA 3M32A 5B0EA 1N5YB 3O3LA 3DRXA 1FEHA 3IAS9 1O5JA 3EGNA 1WUUA 4JI0J 2DXDA 1N0UA 3ILOA 3BSNA 1UVJA 4ELTA 4EMDA 3B6BA 1W2BR 5K5MA 3SDEB 4LF4J 1HARA 4HH0A 3NGSA 3TRGA 2RVJA 3AB2B 7FDRA 3EZUA 1B70B 2FB0A 4CP5A 3ZZUA 5DDQC 3R6GB 4LIWA 3UW1A 1NHUA 2X7IA 1FRMA 2JLFA 2M9KA 1UZHA 2ZFHA 4WP9A 2LMIA 1KOHA 4CNZA 2R2RA 4ZN3A 4ECXA 2B7CB 1F2HA 4DI6A 2WK4A 4ILMA 2ZH2A 3Q8UA 2HHHF 3OR1B 2JZ8A 5ETNA 3UCUP 3TA0A 1N5SA 1UJ4A 1X4EA 2D74B 2OI2A 2RKIA 2OTJS 1RZMA 1JLCB 2GVDA 1Y5LB 1HW9A 5I3QA 1MLAA 2XSFA 4OX6A 5KOXA 1WG1A 1RT4A 2HIQA 4M5LA 2XWYA 4OI4A 1T9UA 4FPRA 4AUKA 4UUWA 2RT3A 3F44A 2HMIB 1HWIA 2RB7A 2KT5A 4QCLA 4NLUA 2XY7A 3GSIA 2UVRA 2DK2A 4W98A 4HYKA 2K1RA 1NK5A 1RAGB 1N5QA 3AAWB 1UJ6A 3VV2B 3FQKA 2QIFA 2V68A 4LQ9A 3U1NA 2V94A 4F7VA 4O44A 2AJ2A 3IR5B 1BMQB 4LRCA 4PYAA 2K3IA 2FHJA 5DS7A 1HBUA 2UXCF 5KT6A 1LK5A 1UP1A 2CNKB 2HPUA 4DR4F 1WC6A 5L1IA 3J7YU 2OH2A 1T05A 4FNIA 3DLKA 2LEBA 6FD1A 4ECWA 1JNZB 3JXOA 2GVZA 3QMQA 2F40A 4NA1A 3G96A 4ELVA 1GQEA 1DAXA 3HJVA 1RDRA 2DEJA 2FYXA 4RNHA 3BGFA 2KL8A 3EZ5A 4LF6F 2R4FA 5F0WA 2V6AA 1VQSA 3UDVA 1IKWA 1N5YA 4WBFA 4F4YA 3OTOF 5G4DA 3LAKA 1FKOB 3SI8A 2LVWA 2Z8QA 3SDEA 1LNQA 1IBMF 2XLJA 3BBCA 3IRXB 2RILA 4DUZF 3V81B 2WZ1A 1NB2A 4CT9A 4CLTA 1S1TB 2PIIA 4ECTA 4MIAA 5BJRA 1X4GA 3VR1A 2F5GA 5FDLA 1VQ5S 2HHQA 7AT1B 2NZCA 5KG1A 3QT6A 1TKXA 4C3LA 3CJ0A 1RGVA 5JJBA 4J9QA 2CJ9A 4HACA 1S1VB 2OELA 1ZM3A 3NG8A 2YKNA 5DRKA 2CWXA 2M7SA 2KKHA 1M5VC 3OSNA 4GMKA 3VHQA 2FHKA 4K5RA 2N4DA 1BC6A 2CQCA 2BACA 4OZJA 3C15B 1F60B 2BW7A 4ER8A 1CJKB 4WU2A 5DO2A 1DLOA 4U8VA 1LKZA 1BGXT 1JJCB 4PQAA 4QPXA 1QD1A 4LR8A 3R2DJ 2J9CA 2UUWA 4I6WA 5KFZA 4OZ0A 3CPWR 1YWXA 4MFBA 3WQPA 4QOTA 5IWAJ 2PE8A 1N52B 1TKZB 5CYQA 3DU6A 3CULA 1RSCA 1FTRA 1T3OA 1YJ9S 2MEWA 2CJXB 1VHFA 4M5HA 2H5IB 5MAOA 4YFUA 1R0CB 2OSRA 1QVFR 2VZ9A 2YNHA 2AGPA 4O0NA 1SUQB 2G0IA 4KGXB 1VYAA 3M8YA 2RF2A 2BJ7A 4AL7A 3UO0A 3FCVA 3D0GE 5ETSA 4DR5F 1KR4A 1CJVA 2H48B 3SIPB 1RAOA 3PJ9A 1XERA 4RUCA 4FYWB 3IO1A 1HI8A 4USHA 3CCQS 1S1WA 4X4UA 1T7PA 2R9LA 2QN6B 2HK3A 3QAUA 3JS9A 3S1TA 2UUBJ 2HZAA 1O51A 3IM8A 3HDSA 3PO4A 5KFMA 4DMZA 5I42A 1S49A 1HNWF 1FKOA 4RNFA 2KFNA 2CA9A 3EE3A 2FC8A 1S7HA 2C42A 3IRXA 1L3UA 2AJQA 4NLGA 1XMQJ 2MKYA 3OD2A 2MHNA 3GWCA 1HR0J 3K8VA 2AU0A 1VQ6S 2FY8A 4KGKA 1S1VA 4CM2A 2QRRA 3D4JA 4NRUA 4C97A 2DPJA 1F6TA 3GP9A 4Y2AA 1T11A 2WVDA 2QLFB 5EWEA 5AJ3J 4HVZA 2ZDOA 2W4DA 3DC2A 1LFWA 2ZHAA 4NCGA 4FYVB 2MQMA 1C0UB 1FWPA 1NK6A 5T7LB 4R5PA 4DSIA 1NCLA 2PGCA 4K50A 3GJRB 2YNFA 4O23A 4QIFA 5CAAA 3I9ZA 4OI3A 1NKCA 4XPCA 2ZEJA 3CD0A 3Q8VA 4I7FA
chains in the Genus database with same CATH topology
3TJ9A 1GMVA 4J80A 2QLDA 3TJ8A 2Q2GA 1EARA 1GMWD 3AGYA 1GMUA 1NLTA 1C3GA 3AGXA 1EB0A 3LZ8A 1XAOA 3TJAA 3NY0A 1GMWA 3I38A 3L9ZA 4L3KA 2HFVA 2B26A 3AGZA 3LA0A 3NXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ9 A;  1GMV A;  4J80 A;  2QLD A;  3TJ8 A;  2Q2G A;  1EAR A;  1GMW D;  3AGY A;  1GMU A;  1NLT A;  1C3G A;  3AGX A;  1EB0 A;  3LZ8 A;  1XAO A;  3TJA A;  3NY0 A;  1GMW A;  3I38 A;  3L9Z A;  4L3K A;  2HFV A;  2B26 A;  3AGZ A;  3LA0 A;  3NXZ A; 
#chains in the Genus database with same CATH topology
 5ETQ A;  4X4S A;  1Z1Z A;  1KD1 T;  4NL5 A;  2HLT A;  3CTR A;  2FJE B;  3ITH A;  5E0O A;  2DHA A;  4YUD A;  1EET A;  3Q24 A;  5C24 B;  2B4P A;  2YTC A;  5I4M A;  2J0X A;  4I0W A;  5GVQ A;  4XTT A;  1QE1 B;  2J8A A;  4GO7 X;  2YVS A;  1V6H A;  1HW8 A;  3KHL A;  3MM8 A;  4DX6 A;  1FD8 A;  1XR7 A;  3TAM A;  3NNH A;  4IFY A;  3NWG A;  4IQX A;  1SUQ A;  3AY0 A;  4U95 A;  2IM3 A;  1DQ8 A;  4OHZ A;  2E29 A;  1KEK A;  1AYE A;  2AJ0 A;  2F8H A;  1Y7P A;  2IBO A;  4RW6 B;  3W8P A;  2QJ3 A;  4WF9 Q;  4P2M A;  1EIY B;  1RTD B;  1GMW A;  2HAF A;  2E5G A;  1YKW A;  3SQG B;  2AKW B;  2UU9 J;  1S9E A;  2ROE A;  1RBA A;  4V19 X;  2JVM A;  4FF3 A;  3TX8 A;  4C4W A;  4EZ6 A;  1SIW B;  2GMH A;  1CC8 A;  1VGY A;  3CCM S;  3CDW A;  1D9A A;  1OPZ A;  2GAH C;  4DL3 A;  2FLP A;  3I0R B;  4W92 B;  4MT1 A;  2QG9 B;  4JI5 J;  4A8W A;  3OV7 A;  1LOU A;  4LFB J;  2FHM A;  4YS2 A;  1VRU B;  3A8I A;  1YBA A;  1RAH B;  4B3S F;  1RE1 B;  4Y2I A;  4ZJQ A;  2P2C B;  2DRB A;  4GVL A;  4CO0 A;  4NLT A;  3M2V A;  5GAG U;  4ECZ A;  5KFS A;  2VUG A;  5E41 A;  5A8W A;  2ZD1 B;  3C14 B;  3K0J A;  5CXT A;  2HND A;  1S5Z A;  4P75 A;  4JI6 J;  2O01 C;  4F4Z A;  2YKO A;  5DLF A;  4DCJ B;  5ETM A;  1RXO B;  4Q5V A;  4USK A;  1KKH A;  3X1L B;  3ZZP A;  3CDA A;  3JSM B;  2RQC A;  4F67 A;  3BPD A;  3KMQ A;  1EX8 A;  1IBC B;  3DM2 B;  3DDN A;  1M1G A;  3TAP A;  3DYA B;  2L3M A;  4EBD A;  4B3M F;  4PPD A;  3H20 A;  1NK4 A;  4ES2 A;  1KLM B;  1S9F A;  3OBI A;  5A8K A;  2C22 A;  4RW4 A;  5B0A A;  2F3J A;  3EJM A;  1DUR A;  1XK8 A;  2QYC A;  1S4F A;  1EKR A;  4BBY A;  4AL5 A;  1JIH A;  5F8N A;  5IM0 A;  4ECY A;  2G2Z A;  3AXM A;  4LJM A;  3BKT A;  4OI2 A;  3NGT A;  2HHS A;  2ZE2 A;  4IO9 Q;  1SPB P;  3HKW A;  2ZH6 A;  1QE1 A;  1FX2 A;  2LA6 A;  3JQM A;  3TUZ C;  2ADC A;  2CNO B;  3EPG A;  5AE2 A;  4LSL B;  2WW8 A;  4J9O A;  5HQM A;  1CLF A;  1LV5 A;  1DY3 A;  4PG6 A;  2J9D E;  1OY6 A;  1FK9 B;  3ZZT A;  3NGK A;  1SL2 A;  2Y1L B;  3I9V 9;  2UXD J;  2DT9 A;  3UCG A;  4L72 B;  3GIK A;  4NLD A;  2WVE A;  3BQ1 A;  4K7Q A;  3SQG A;  1A6L A;  1RAI B;  2JVR A;  3CJ3 A;  2GIF A;  2MKC A;  1MRO B;  2Q43 A;  4X4P A;  1HNX J;  2W24 A;  3WX4 A;  2HFS A;  4MAK A;  2VIH A;  4DV1 F;  2D7S A;  1UWB B;  2PI4 A;  4J9V A;  3KUG A;  4C48 A;  2N3L A;  3I0R A;  3CCJ S;  2R2S A;  5CA5 A;  2V8V A;  1VQ9 S;  5L1L A;  2HQF A;  3L7O A;  3MDF A;  1RQ0 A;  2FTR A;  4K5S A;  4KPY A;  3AD8 C;  5F8L A;  2HRU A;  1SJ3 P;  4CLZ A;  3M4X A;  3VZH A;  4DX5 A;  2G9O A;  3DMJ B;  1QLN A;  2BAN B;  3O6Q A;  4M5K A;  5J2Q B;  2NZ4 A;  2ZD1 A;  2A1B A;  4LF9 J;  2WAQ D;  1YSJ A;  1N36 F;  4I2P A;  4Y2M A;  1VS3 A;  3GFZ A;  4NZ0 A;  4DS4 A;  3NBP B;  4TVA B;  2VJV A;  4C8L A;  4QU6 A;  2CQD A;  3JSM A;  3FBB A;  2CQG A;  4RW8 B;  2ZKT A;  1YIT S;  2LP4 A;  2PFD A;  1BE4 A;  2HQG A;  2DXE A;  2EKN A;  2KHD A;  5KFE A;  5J2N A;  3T1Y J;  2RJZ A;  5LMU J;  4ERD A;  1RT1 B;  2V67 A;  3D68 A;  3H40 A;  4CQ1 A;  5KFU A;  3QSY B;  3AJD A;  1TTH B;  2QL5 B;  3GG1 A;  5DG9 A;  4FPI A;  2DNL A;  3E51 A;  1OY8 A;  3NAI A;  3AOD A;  4L74 A;  3R5C A;  3VGT A;  1ZPW X;  4ZCM A;  4B3O A;  1PIL A;  3NMR A;  4WYL A;  1Q4R A;  3CIZ A;  4JP8 A;  4DL7 A;  2D1C A;  1U1O A;  1IKV A;  1F3F A;  4L3N A;  1HLW A;  2PC6 A;  1N6Q B;  3KG4 A;  3CC7 S;  2MKI A;  1NZA A;  2VPX B;  1UVK A;  4DCP B;  1CUL B;  1RHQ B;  4Z2X A;  4KHR A;  1WTF A;  1Q8B A;  2LQ8 A;  4QW9 A;  1LW2 B;  5A6P A;  2LFV A;  5DG7 A;  5HJX A;  2EFO A;  1LXN A;  3MAA A;  2YPY A;  2X51 A;  1S76 D;  4KIA A;  2I8E A;  1X4C A;  3LGH A;  3K59 A;  3G8T A;  3GU0 A;  2ZH5 A;  3ZZR A;  3FFI B;  1JLF A;  1X31 C;  4P73 A;  4P74 A;  1U1Q A;  1NPP A;  2UV8 G;  1TVR A;  4F0H A;  2ATL A;  1U02 A;  3Q8P B;  1NHV A;  4ANC A;  1X0F A;  2HUR A;  3R7S B;  3PX6 A;  1R8A A;  1J5E F;  4KE5 A;  3TA1 A;  1Q95 G;  3PEJ A;  2QTW A;  4URS A;  3U7J A;  1KQK A;  1FJ7 A;  4EYH B;  1T9X A;  4B08 A;  1TMM A;  1KBR A;  3EYZ A;  1T94 A;  2OGU A;  4OHX A;  4QYR A;  3VAK A;  4LRE A;  4ENO A;  2CQP A;  1XC9 A;  2Z58 B;  4GKK F;  3GV5 B;  2L9D A;  2Z4P A;  3PKY A;  1S12 A;  2IY5 B;  1RTI A;  1GXU A;  2KFY A;  3VAM A;  2NPI A;  3L7U A;  2CKW A;  2RQK A;  4O3N A;  2RHS B;  2ILY A;  1NSP A;  4N8N A;  3ZNJ 1;  4UQT A;  1N54 B;  3ENA A;  2MLZ A;  1DJ0 A;  5KT5 A;  2IYG A;  4LSZ B;  3MM7 B;  3UE2 A;  4X2B A;  3R7B B;  1QSY A;  3ILJ A;  4PG7 A;  4LRA A;  1REV A;  4IRC A;  2XHW A;  1UTA A;  3C66 A;  3G4S S;  1Q7Y T;  2CUY A;  1UFW A;  2CNL B;  4C8Y A;  2WRM A;  1ZZF A;  4CO5 A;  1G6B A;  2HVZ A;  1W25 A;  1NB7 A;  4IG0 A;  4LBP A;  4Q43 A;  3M6W A;  2DGQ A;  2IVY A;  3GCX P;  1U49 A;  3NOG A;  3HHL C;  3I38 A;  4DV5 F;  1P1T A;  3GPA A;  2DY1 A;  1H3D A;  4CTA B;  4I2Q B;  5F3T A;  2MLX A;  4NLW A;  2IA6 A;  2D3U A;  3DLH A;  3W2W B;  2XBP A;  3M6X A;  5LL6 d;  3CJ5 A;  3L3C A;  2PDA A;  4M8L A;  4FVC A;  4CO3 A;  4Y6I A;  2ZNY A;  4JI0 F;  2NUH A;  2DVI A;  2VQE J;  4Q2L A;  4DR1 F;  1AA1 B;  3GJT B;  4X4O A;  8AT1 B;  1CSJ A;  3GSD A;  4G3I A;  2XO7 A;  3G86 A;  2RML A;  1UCN A;  2WHO A;  1LWE B;  5D4O A;  4PWU A;  3MMJ A;  2M8H A;  2VA3 A;  1CBK A;  2EC0 A;  2EKY A;  3DFE A;  3OR2 A;  1HBM A;  4ECS A;  4PZV A;  1QTN B;  2A6O A;  2PMZ D;  3OUY B;  3KLG A;  4YP3 A;  1KOO A;  1GMW D;  3G82 A;  3TAR A;  4GVB A;  3BEG B;  4DSK A;  1RK8 A;  3CD7 A;  3V6H A;  2HLU A;  3WDO A;  2DNY A;  2LKZ A;  4WYW A;  3DRP B;  5DZ7 A;  2D3Z A;  2CG8 A;  2VBW A;  2XS7 A;  5LXR A;  5JUM A;  3W7B A;  3S01 A;  2EC2 A;  3RB4 A;  2CQ2 A;  2U1A A;  2CPH A;  1S59 A;  1I94 J;  1FE0 A;  1DQA A;  3DGP B;  3LO3 A;  2DIT A;  1KSP A;  4Y2C A;  2OFH X;  1M1H A;  1XNR J;  4A8M P;  3LF0 A;  2Y0S D;  4G1I A;  4B9M A;  1Q5Y A;  2CNN B;  1CJT A;  1C1C A;  1SIZ A;  1X4F A;  3TX0 A;  1PKU A;  3FZB A;  1V3Z A;  3OSP A;  2WON A;  5J2P A;  4ZVT B;  1VBY A;  3FEY B;  2W9B B;  4IFV B;  2B3T B;  4CLP A;  1NLK L;  3M2R B;  3BS9 A;  4CCH A;  1FO1 A;  1HBO A;  1RT6 A;  2RD5 C;  1DAR A;  1SV5 A;  3KJV A;  3AGZ A;  1EKS A;  4OZN A;  3ULH A;  3N0V A;  2VQF J;  3A4T A;  4O3R A;  4CI0 B;  2NSC A;  3MF5 A;  2M5Y A;  1WEY A;  1X4D A;  5D0R A;  2WSF C;  1KVJ A;  1ZH5 A;  3RGI A;  3FEX B;  3TP2 A;  3UDE A;  2B26 A;  2M0G B;  2ZUA A;  2OEJ A;  2KH9 A;  4ZLP A;  2HGN A;  3IA0 A;  1XTZ A;  1PBU A;  1UKU A;  3BH7 B;  5EGY A;  2MGZ B;  3RB3 A;  1I5O B;  2ROG A;  4F4K A;  4C98 A;  5K8P A;  5CQG A;  3QLH A;  4AQY J;  2W9C B;  3OL6 A;  5CZX A;  2JHE A;  3IS9 B;  2YNG A;  1CJU A;  5H9E J;  1TU0 B;  1TKT A;  2VV5 A;  2C3P A;  5CYJ A;  3M9N B;  2IJR A;  5H1S V;  1HHQ A;  2CDQ A;  5HLF A;  3O2I A;  4CH7 A;  4ZIW A;  4ES3 A;  4YOE A;  3C8Y A;  4DF8 A;  3GV7 B;  2VL1 A;  2R7R A;  1BQN A;  2YQ0 A;  3W5Y A;  3OQ2 A;  2GHW A;  3H2L A;  3BKU A;  1G3O A;  2UUA J;  4DG1 B;  1T9V A;  4X4R A;  1PJ7 A;  2KT3 A;  4KKO A;  3ENQ A;  4JUZ A;  3GB0 A;  5HBM A;  2L48 A;  3NCP A;  3CCU S;  4QU7 A;  1XR6 A;  4QR0 A;  2CJK A;  5IWA F;  4OYX A;  5EN1 A;  1XAO A;  3H5S A;  3AQO A;  2LLZ A;  3GCW P;  4LF5 F;  2FIU A;  2ZBP A;  2E7W A;  4OFZ A;  1F5B A;  3CJS A;  2OMO A;  5D0H A;  4M5M A;  2NXU A;  1WC0 A;  2W9B A;  4IFV A;  2UUT A;  2COL A;  1RJJ A;  1RWN B;  1HNZ J;  2CPZ A;  1UPP A;  4I69 A;  1WTB A;  3I87 A;  2RS2 A;  3EM1 A;  1FF2 A;  3MM6 A;  3LP1 A;  1F5A A;  3HD2 A;  2ZC4 A;  4KH1 B;  1MN7 A;  4EGL A;  2R8J A;  1S48 A;  2AJ1 A;  1SCJ B;  3Q8Q B;  2DGW A;  2VG7 B;  3HF5 A;  1UWA A;  2UUB F;  1S0O A;  5A2Q Y;  4CRJ A;  3U27 A;  2CJY B;  3Q83 A;  2AD9 A;  5LSO A;  3BQ0 A;  3CMA S;  2CQ1 A;  1MWZ A;  4ECQ A;  3CWJ A;  2YBV A;  3TEH B;  5I3P A;  2K3K A;  2UUC F;  5KT7 A;  3QT5 A;  2V4Q A;  5IC6 B;  1KQG B;  2AQ4 A;  4CDI A;  4DQS A;  1FFS B;  2XEX A;  1HR0 F;  5KOW A;  2W2M P;  3K7R A;  3SCL E;  4USW A;  2VC0 A;  3W65 A;  5ETK A;  2MKJ A;  4KBI A;  2CWK A;  2JNJ A;  5KT4 A;  1K1S A;  1Y4Z B;  3D1H A;  3MD3 A;  4OX7 A;  4K8R A;  3G71 S;  2HHV A;  1TL3 B;  3OLB A;  1JJ2 R;  2J6T A;  3TEG A;  3LPY A;  3UPF A;  1HL6 A;  4M5J A;  4B3R F;  2APO A;  4F4W A;  3C16 B;  3DNC A;  1R27 B;  1HBN B;  1VBK A;  5CCL A;  2B8Q A;  2NUU G;  5KFD A;  1G2E A;  2DHG A;  2MQO A;  2LXU A;  3GJQ B;  1WF0 A;  3FC9 A;  3QQC D;  3N4W A;  2HNZ A;  2M52 A;  4WWS A;  1D0E A;  4NYP A;  1FE4 A;  4USI A;  5THW A;  2VDI A;  3BO4 A;  2Y3Y A;  4HDH A;  5BYQ A;  2IYI A;  2E5J A;  3K58 A;  3PR4 A;  1RTJ A;  2G2Y A;  4WJB A;  2VFS A;  1YJU A;  5A2Q U;  4LR9 A;  2XO6 A;  4EO6 A;  1IM6 A;  1KFS A;  1T03 B;  2I0X A;  1SC1 B;  5LT5 A;  4M63 A;  2UP1 A;  4KGV B;  4WCE Q;  2JRR A;  5F0U A;  3PKM A;  5EDW A;  3CSK A;  2E1M C;  1IR1 A;  4IG3 B;  4Z37 A;  4WKR A;  3KHG A;  4YN3 B;  5IOL A;  2WOM B;  3E01 B;  4L76 A;  4NMX A;  2ASJ A;  1RA6 A;  5DGA A;  3W3S A;  4M1K A;  1FXD A;  1R8H A;  3R5D A;  3TUI C;  5DM6 Q;  4OZ3 A;  2ZZN A;  3IC1 A;  2WVC A;  2P6T A;  4OYW A;  1NDP A;  1FRK A;  2HKE A;  4C2M A;  1DQ9 A;  4MKV A;  4C11 A;  4F4A A;  4DWI A;  5HK4 A;  4PKD B;  3WC0 A;  2XY6 A;  4IKA A;  4JI5 F;  3MUV P;  4J9P A;  3PYD A;  1FVS A;  3MEG B;  4OMF G;  3BDE A;  4LFB F;  2GQ2 A;  4ED6 A;  1DFD A;  4KHP F;  2CZV C;  5D4L A;  3MEE A;  4UOF A;  1VIX A;  3R5A A;  3R8Y A;  1J27 A;  4FXW A;  3GIL A;  4JV5 F;  1K73 T;  4WFB Q;  3BO2 A;  2ZM6 J;  3TWZ A;  5BR8 J;  3N9U C;  4ED1 A;  2KRR A;  3K5N A;  1IKY B;  3C19 A;  3S6E A;  1C3G A;  3UVJ A;  1TL3 A;  1R31 A;  2PI5 A;  5CCM A;  2GS8 A;  2QYG A;  2M8D B;  2OPQ B;  1HBN A;  2RNE A;  3TZY A;  1HYS B;  3SSQ A;  2DJW A;  2XZT B;  4FF1 A;  3BSC A;  2DTJ A;  2CQ3 A;  1RHM B;  3AHP A;  4D3H A;  2GGP B;  4Y34 A;  4QYZ K;  2EVZ A;  4U67 Q;  2BE2 A;  2QE5 A;  2RU9 A;  4PG8 A;  3MPU B;  2VJU A;  2CPJ A;  3SSR A;  4KO0 B;  5KFQ A;  1T03 A;  1IWG A;  5IZH A;  2XNR A;  1UZD A;  3H2U B;  4OX9 F;  3LTO A;  2C2N A;  3DLG B;  2HG4 A;  1TP7 A;  2B9X A;  1B0V A;  4DPX A;  3V4I A;  2W2P P;  2CZ4 A;  3KK3 A;  2BM1 A;  5SZT A;  1CQN A;  2M88 A;  1SC6 A;  3DU5 A;  5KFH A;  1B7Y B;  3EGZ A;  3RTV A;  1RWO B;  2NYH A;  3D28 A;  1FRL A;  2UXD F;  2FJD B;  2H54 B;  3MM9 B;  2HHW A;  3FMW A;  1X9M A;  2W8L A;  1LEO A;  1HNX F;  1REG X;  5DQI A;  1U8W A;  2JZ5 A;  3FGV A;  3JSY A;  3PR5 B;  5GAG I;  3KLH B;  4YEA A;  2JWN A;  1RAD B;  4K4W A;  1HPZ B;  4GRS A;  3G9C A;  1RT5 B;  4DFM A;  2BOA A;  2IJF A;  4AXJ A;  2Y8Y A;  4F8R A;  1U1P A;  2DNH A;  4DX8 H;  3D6M B;  2Z2M A;  1YG0 A;  2H4Y B;  3BGL A;  3G6Y A;  4F3M A;  4PXE A;  3PX4 A;  4ZVS B;  4Y65 A;  3J7A N;  2AEM A;  1ZAV A;  1RHR B;  4DFK A;  2DGO A;  1SL1 A;  1PIE A;  3M1V B;  2IDE A;  1SVD A;  2KVQ E;  4ZP6 A;  2ZH1 A;  3BGO P;  3FCW A;  5G0R B;  4K4U A;  2MXY A;  2FVC A;  3RAM A;  1SL0 A;  5KFC A;  2UVU A;  1KN6 A;  4WKY A;  2OPQ A;  1S0V A;  3AQP A;  1O0P A;  4J9L A;  3CCE S;  2XZW A;  3KWM A;  1J5O B;  3DOL A;  3G8Q A;  5IT9 Y;  4ED0 A;  3A1Y G;  3LWL A;  3QIP A;  4HHH A;  1HYS A;  1NKE A;  2EFQ A;  2XQC A;  2VBX A;  2VG6 A;  1WEL A;  4NZ6 A;  2DNR A;  2GGP A;  5LMU F;  2K2P A;  3HP6 A;  3FZ2 A;  5AXM A;  3QBC A;  3W2V B;  4DU7 A;  5IFM A;  1VDH A;  2MQP A;  3EXC X;  1YDL A;  5J2M B;  3MCS A;  4H4K A;  4OZ2 A;  2W7O A;  1N4L A;  1S77 D;  1Z2L A;  1OMS A;  2Z2Y B;  3ISZ A;  1AUD A;  1EHW A;  4JV1 A;  3TI0 A;  2ASL A;  3RU0 A;  5K20 B;  4OI1 A;  3DLG A;  2YPZ A;  3OXG A;  3AA8 A;  4U96 A;  2H4W B;  2YX7 A;  3NS5 A;  2XMA A;  2B4O A;  1C4C A;  1U8S A;  1Z4U A;  5GAD U;  1LK7 A;  3JSB A;  3QRQ A;  5C7P A;  4TU9 A;  4Q8F A;  4KFB B;  4O4G B;  4JB8 B;  1D9D A;  2D9P A;  3V6D A;  2XGQ A;  4K59 A;  1R0A A;  4ZVU B;  2RDD A;  4O4R A;  2FVQ A;  4RUB A;  3GYN A;  2Q6C A;  2R7Q A;  3FBC A;  3BM7 A;  4IRD A;  1AFJ A;  2GAG C;  4DR2 F;  3B54 A;  4PXB A;  4QBU A;  4K4V A;  2WCX A;  5KFO A;  3QJL A;  1YJN S;  3GFX A;  4J9R A;  2UV8 A;  3KUE A;  3J81 Y;  2DH7 A;  1HPZ A;  4L73 A;  1ZM2 A;  4EK2 A;  5IT9 U;  5E5N A;  3GTY X;  4Y28 C;  3Q8S B;  2CPI A;  2NSB A;  1C4A A;  2DNG A;  3T5H A;  2DPI A;  4CO1 A;  1VC0 A;  4RJV A;  4LSN B;  1FFW B;  2LCW A;  2MZS A;  5MLC V;  1H6K X;  2W01 A;  1RUS A;  3A8J A;  2C2K B;  2V4J A;  2D69 A;  3NNC A;  2X3D A;  3LQV A;  2Z56 B;  1JXV A;  5A76 A;  3QNW B;  4EO8 A;  3TNV A;  2F9J A;  3JTO A;  2MST A;  1YVF A;  2J9E A;  4U7U D;  3T9Z A;  2KN4 A;  4DEZ A;  2JEI A;  1MWY A;  3BKF A;  1IR2 A;  4XK8 C;  1CS4 A;  4M5G A;  2ILZ A;  2M4M A;  3BSO A;  3Q8Y A;  2ACM A;  1D09 B;  3PTW A;  3NS6 A;  4MK7 A;  1FJG J;  3KK1 B;  4A48 A;  1UVI A;  2QT7 A;  2HQC A;  5DJB A;  3QYY A;  3IG1 A;  4DZ6 A;  2CPF A;  4U9R A;  2CYY A;  1S1X A;  2HK2 A;  3UD4 P;  4O3S A;  5M2U A;  2FZK B;  1E6V B;  2K8G A;  2XMK A;  3NS7 B;  1OS5 A;  3J81 U;  3G6X A;  1X9S A;  3IGN A;  3RZA A;  2DNM A;  1X4A A;  2HVD A;  5E3A A;  3TO8 A;  4OYA A;  4YB1 P;  2YKM B;  2JC1 A;  3BJY A;  3NLC A;  1X4B A;  4NXM J;  1XNQ F;  2MZR A;  2VON A;  3BGR A;  4BC7 A;  5KFW A;  5LSR A;  2M3D A;  2O67 A;  1OYE A;  1VR6 A;  2B0G A;  3KOA A;  1OYD A;  3TR5 A;  4EWT A;  3C6U B;  3POT B;  4G65 A;  3VGS A;  1T02 A;  5J1P A;  3CED A;  2O66 A;  4HH1 A;  3AGX A;  1KS2 A;  2E1A A;  4HHU A;  1B0T A;  4JYA F;  4K0K J;  1TR0 A;  2RUS A;  1L5U A;  4ZJL A;  4LF1 A;  1IBL J;  2HGM A;  1TL4 A;  4FF4 A;  3S8S A;  3ONQ A;  4MK8 A;  2NYI A;  1X8D A;  3PW5 A;  3MFH A;  2VQE F;  3QSI A;  3OTC A;  3DKD A;  2LQ5 A;  3B8H A;  1M5H A;  4RZR A;  4L6V 3;  2HS0 A;  3DI6 A;  2EEY A;  2RIJ A;  3LW5 C;  1EZZ B;  2OIH A;  2VG5 A;  2XC9 A;  1JMT A;  3DOK B;  1ZTT A;  2V5H G;  2FJV A;  3GON A;  3IN5 A;  4ZCK A;  4LF8 J;  2XG8 A;  4CNY A;  2D9O A;  1VRT B;  2G2O A;  3SCJ E;  2EK6 A;  2HFU A;  1WHW A;  1RYS A;  2HEK A;  3DRS A;  1NUE A;  3HHL D;  5I3U B;  2FJB B;  1RT2 A;  4GKJ F;  3MED B;  3M8R A;  4DL0 C;  4C8K A;  3BR9 A;  1LWF A;  2C1E B;  2IC3 B;  2VH7 A;  2GJF A;  5KFI A;  3SMZ A;  1UEU A;  2A0F B;  3EVM A;  2PMW A;  1H7W A;  2ZBQ A;  3DCA A;  1YI2 S;  2JL9 A;  1I1G A;  3NNA A;  5D8H B;  4LF2 A;  4JI1 J;  4DXL A;  1MU2 B;  2N82 B;  1MG7 A;  4QWE A;  5FII A;  1TL7 A;  3G6V A;  5KFF A;  4A8S A;  3LP0 B;  2F4V J;  3EWG A;  1Q8I A;  1SC3 B;  1I94 F;  2A3J A;  3CMQ A;  4PEO A;  4Q45 A;  4JI3 J;  4A8X A;  3MMB B;  2CAD A;  1XNR F;  1KC8 T;  3Q86 A;  3SBM A;  1S0N A;  3IBC B;  4RW9 A;  3K5P A;  2ALY B;  3LP2 A;  1UFK A;  1ZM4 A;  3AXK A;  2HNY B;  2K06 A;  1P9Q C;  2KG1 A;  4KB7 A;  2VHG A;  4ED2 A;  1RT3 B;  4WFZ A;  3M8S A;  4ZPA A;  1EP4 B;  1HWU A;  2LU2 A;  3C6U A;  1BHN A;  2H3E B;  3DOM A;  3K5L A;  3HI9 A;  2M70 A;  3Q89 A;  1HQE A;  4E8U A;  2MTL A;  3M32 B;  2F8E X;  4N5S A;  1V3S A;  2P9G A;  2VQF F;  3CE8 A;  5LXY A;  5B0B A;  3MPD A;  1QUV A;  2OD4 A;  2NR0 A;  2YNI A;  1QSS A;  2EXU A;  1ZA2 B;  4R8U A;  5A0Y A;  3GZ7 A;  4C3K A;  3MR2 A;  1TV6 A;  4Q0B A;  4TY8 A;  4ZVG A;  2ADB A;  2IA0 A;  2RQ4 A;  2AZ1 A;  3RBE A;  5E3R A;  2E7V A;  2VBY A;  4JI2 J;  3HSJ A;  5KFB A;  3A3N B;  1PC5 A;  4IOA Q;  1R89 A;  4DV0 J;  1RAA B;  2HHU A;  1WJ9 A;  3T6J A;  2F8M A;  2JEG A;  2MKK A;  3T1H J;  1WC1 A;  5C25 A;  5LMN J;  2VFT A;  3MED A;  1IQT A;  4IUF A;  2RKI B;  1HA1 A;  1ELO A;  2BMB A;  3I0S A;  4Z7Y A;  2GVD B;  1M1K T;  4ED4 A;  3AD9 C;  1Z2Z A;  2KXF A;  1U1R A;  2DNZ A;  2YY3 A;  4WE1 A;  1RT4 B;  2XMU A;  1YJT A;  2EK1 A;  3LH2 S;  4KQZ A;  1S6Q A;  1LWC B;  4RR5 A;  3LGM A;  1JKH A;  1FXR A;  5HI7 A;  3LP0 A;  3QT8 A;  5E3P A;  3OFE A;  2UUA F;  2K1R B;  3S7R A;  2L9N A;  5F8J A;  4LVN P;  3QAT A;  2AIR B;  1WSR A;  3TUP A;  5HQL A;  1KTQ A;  4O44 B;  1QAJ A;  2QMW A;  2QZ8 A;  1S99 A;  2A6M A;  4BWJ A;  2X1F A;  4FF2 A;  1HBU B;  1S6P A;  2HHH J;  2A2C A;  1SQG A;  2UXB J;  2L9W A;  2CQ4 A;  3HFV A;  1T05 B;  3DLK B;  4NLO A;  3GMG A;  4JI4 J;  1Q8L A;  4DV3 J;  1EP4 A;  2GVZ B;  1SI9 A;  1PGZ A;  3EMT A;  1Q86 T;  2QA2 A;  1S10 A;  1DTQ A;  2MZT A;  4LT6 A;  1VQM S;  3CNQ P;  2EBE A;  1V5I B;  1IKW B;  3EPI A;  4DL5 A;  1HNV B;  1FVQ A;  2CQB A;  2W25 A;  1AFI A;  2WSC C;  2E9R X;  2C2M B;  2KRB A;  2P6S A;  4CLS A;  5KFP A;  4OI6 A;  1T95 A;  5A8R B;  3RB6 A;  2MQQ A;  2CRL A;  3AOC A;  3W9J A;  5K14 A;  4B9N A;  1R0B G;  4C9D A;  3ZZZ A;  5FDL B;  2UXC J;  3THP A;  3UD5 A;  4DR4 J;  4J9M A;  1TKX B;  2VFU A;  5CYM A;  1FCA A;  2X3G A;  4HAC B;  3D1Q A;  2QLW A;  2KI2 A;  2YKN B;  4DS5 A;  3N5B A;  3MMA A;  3D66 A;  1MML A;  1KHW A;  1ZZN A;  2B9W A;  2J7W A;  2XHC A;  2Z0G A;  2R8H A;  1WOR A;  2GIQ A;  1JB0 C;  3H0P A;  2PMH A;  4LF6 J;  5KFY A;  2AEF A;  3FSX A;  3P49 B;  3LAN A;  3TJ8 A;  3OT9 A;  2QSF A;  1C1B A;  3GYG A;  3Q0A A;  1Q0N A;  1DLO B;  4X64 J;  2HWH A;  2XMW A;  2I9S A;  3QWP A;  2DKO B;  1P27 B;  1LWC A;  4NRT A;  4ILL A;  3BYR A;  2B9E A;  2WW4 A;  1HQU A;  4MFB B;  3ZC4 A;  3TW0 A;  3TVZ A;  4DUZ J;  3UR3 C;  1Q16 B;  2ALZ A;  1YHQ S;  4ILR A;  3T5K A;  2V69 A;  4QJV A;  3DLB A;  5CYQ B;  3EVO A;  5F3Z A;  2HFN A;  1XR5 A;  4E2F B;  3PW2 A;  4DN0 A;  2ZKU A;  2JH3 A;  1NBE B;  5D15 A;  1TK5 A;  1ZPV A;  4ZA1 A;  3BDP A;  2J7U A;  1CPZ A;  3NGD A;  2YNH B;  4ZVO B;  2VIC A;  1U7L A;  2G4B A;  5F8H A;  2P9E A;  2RF2 B;  3GV8 B;  2CG4 A;  5IC4 B;  4UST A;  1CJV B;  4GC7 A;  1IKX A;  4NA2 A;  1JLG A;  3MCM A;  4EU0 A;  3IFE A;  3HSG A;  3QAE A;  4ICL A;  2A10 A;  4F26 A;  4K2X A;  4KYZ A;  4HEA 9;  3AD7 C;  5HMY A;  1S1W B;  2YWW A;  2RUG A;  1JLA A;  2R7X A;  3T19 A;  1U09 A;  1TAQ A;  1HNV A;  4TYA A;  1FNM A;  5I42 B;  2DNQ A;  2R7W A;  4DQP A;  4NEY A;  1NRK A;  1HI0 P;  1TL1 A;  5A8R A;  3OL7 A;  3MWB A;  4UT4 A;  1AUS L;  3UR0 A;  2BJ3 A;  1IM4 A;  2E5L J;  1VQ7 S;  4USU A;  4MJK A;  1VQP S;  2XYG B;  1U48 A;  4YME A;  4RKU C;  4AE5 A;  3NGU A;  4ZLJ A;  2H5J B;  2P9C A;  2FJA B;  4DR5 J;  4DF4 A;  1NH8 A;  3CC2 S;  1KTV A;  2ABY A;  4NLP A;  5RUB A;  1N33 F;  2ZM6 F;  4QWD A;  5AXN A;  1NK8 A;  3BSA A;  3UNY A;  5BR8 F;  1U47 A;  1VBZ A;  3DXS X;  2FZG B;  4NCG B;  3LZ8 A;  4K2J A;  3M9M B;  3IR6 B;  1ZA1 B;  1YBU A;  2OML A;  4R5P B;  2HYI B;  4DUY J;  2GJ2 A;  1YTY A;  2LU1 A;  3CJK A;  1NDC A;  2YNF B;  2MPU A;  1IWA A;  2EPI A;  1VQY A;  2Q79 A;  1HNW J;  4I7F B;  3GIM A;  1RHJ B;  3OW2 R;  4QIG A;  3RRK A;  3GLJ A;  4QW8 A;  5KTQ A;  3Q23 A;  5HAN A;  2DXF A;  3ITH B;  4OYO A;  5E7O B;  1EET B;  1R6V A;  3EVW A;  1WDT A;  2RH3 A;  5JMN A;  1RB0 A;  4RW7 A;  5D77 A;  4KTQ A;  1OPI A;  1XN9 A;  3MM8 B;  1F2G A;  3G87 A;  1RKJ A;  2AYE A;  5B0F A;  5LJ5 Y;  5F8I A;  2PO4 A;  3TAM B;  4IFY B;  2WVF A;  2BJD A;  1U6B A;  1NME B;  2QMX A;  1FD2 A;  4MTP A;  1ICE B;  3RB0 A;  4A8O A;  2EWH A;  2BDP A;  1UVM A;  3P6Y C;  4YR0 A;  2C28 A;  2DGV A;  2AEJ A;  2OFG X;  1RT7 A;  1S9E B;  2GQQ A;  2NXE A;  4WFX A;  1RBL A;  2I5J A;  2GW8 A;  1I51 B;  2KM8 B;  3NOC A;  3H7H B;  2D3O R;  3MGJ A;  3KJF B;  1R7I A;  2KYX A;  1NM2 A;  4NWB A;  2F63 A;  2N3O A;  2CPE A;  1NZ8 A;  2HWT A;  2KB2 A;  2YH0 A;  2LXF A;  3GFH A;  1VIS A;  4TLR A;  1WEZ A;  2XB2 D;  1F9F A;  3PY8 A;  4LIR A;  4EZ9 A;  3RW6 A;  3UCZ P;  2DO4 A;  4B9L A;  3HM9 A;  3M2V B;  2R2U A;  2FVR A;  4YB6 A;  5A8W B;  4WP3 A;  3CJT A;  4JV0 A;  4AYB D;  1PO6 A;  2HND B;  1JNR B;  3N01 A;  2WBM A;  4DFP A;  2FVS A;  4RWW A;  2PT0 A;  4TQR A;  1ZOT A;  2AHO B;  1TUG B;  3MEK A;  3ISN D;  2QLB B;  1WC4 A;  1PYO B;  3D54 A;  3CF5 Q;  3H2V E;  1DZ5 A;  3E8O A;  3PJX A;  2VKZ G;  5A8K B;  4EI2 A;  1DTT A;  4RW4 B;  4NCA A;  2BAB A;  2J76 E;  2ZC3 A;  1PC4 A;  4F0M A;  3QO9 A;  1WAC A;  2BA9 A;  1DHM A;  1EJ7 L;  1YJ7 A;  3KG0 A;  2KDO A;  1HD0 A;  4HT7 A;  2GJI A;  3JQJ A;  3GG0 A;  4G1Q A;  3JYT A;  5IM0 B;  1D8Y A;  1M5P C;  4B3S J;  5L46 A;  3QJP A;  2F4F A;  2ZE2 B;  1U0S A;  3R27 A;  2AP6 A;  2J0W A;  3D7S B;  4LRF A;  3SXL A;  2RRA A;  4PUO A;  4G6V B;  3UWT A;  3UN5 A;  5IV3 A;  3HVT B;  4ELU A;  2L08 A;  3RR7 A;  1RWM B;  2HZC A;  4FYY B;  1KRP A;  2ZVI A;  5EX3 A;  5KG0 A;  3W64 A;  3DHW C;  2CFX A;  5L1J A;  3U02 A;  4ZLL A;  3W60 A;  3I56 S;  2QLD A;  3JSR A;  4B17 A;  3FCH A;  2V2Z A;  1U2C A;  2DH8 A;  3KDO A;  4RBU A;  1H74 A;  4ZPD A;  5GMK a;  2R8G A;  1D3W A;  2BQ3 A;  1SKW A;  4B3M J;  1B3T A;  5ETT A;  3KDN A;  1QUP A;  3J7Z T;  3HHE A;  2DCL A;  4DHV A;  5HRO A;  2BRL A;  2RDJ A;  3HZE A;  4OJG A;  1Y3K A;  2IM0 A;  4TN2 A;  2FD2 A;  1VFJ A;  4ZPV R;  2RS8 A;  3IMQ J;  2DCU B;  2RQM A;  3SCK E;  4I64 A;  2B43 A;  4KV8 B;  2XCA A;  3F41 A;  2YWK A;  1U1L A;  2PA3 A;  2C2O B;  2AGO A;  4KGM A;  3OLA A;  4YR2 A;  2IM2 A;  3ZFV A;  3PFE A;  2OP5 A;  4CLL A;  4MKA A;  4ZDN A;  4OHY A;  1X5O A;  3R1L A;  4I6Y A;  3HXM A;  2LQ9 A;  4IH6 A;  3CO9 A;  4QWB A;  2J6U A;  2BKN A;  4P2S A;  4FN5 A;  5HMZ A;  2CJQ A;  2MKH A;  1S0M A;  4I2P B;  3MR7 A;  4DR6 J;  5EWG A;  2EI5 A;  2FC9 A;  3ELH A;  1LQ9 A;  1RTH A;  3M9O B;  5LJ3 Y;  2IAJ A;  3PHT A;  3M2U A;  5K9F A;  4DV1 J;  1HNI A;  2Y0B B;  5J2N B;  4I67 A;  2F1F A;  1VLO A;  1FJG F;  4EUV A;  3ICL A;  3VQS A;  1M5K C;  1G1X A;  2AYG A;  4FP9 A;  2F7V A;  2B5J A;  1S57 A;  3OPK A;  1AZS A;  2XI2 A;  4Z7C A;  2LYV A;  4TLQ A;  3QWU A;  1JLQ A;  4RBV A;  1IBK J;  3KG1 A;  1RAE B;  5GAD I;  4B3O B;  4DV2 J;  4QPT A;  2HGL A;  2QLJ B;  3ENV A;  1RHK B;  4UW2 A;  3QGG A;  3HVT A;  3OVA A;  4J91 A;  2C2R A;  3HHN B;  1LFP A;  1N36 J;  4YY3 J;  1IKV B;  1TK0 A;  2ZVS A;  3R2C J;  1WOO A;  4DSL A;  1KFD A;  3VWS A;  2ZHO A;  1WD6 A;  3UD3 P;  3FNN A;  4NEZ A;  2DR7 A;  2E1R A;  4PQU A;  2GZO A;  3C5X C;  2R7S A;  4PCQ A;  4F3O A;  2LEA A;  4DDF A;  4DPW A;  3QZ7 A;  4KSE B;  1PYT A;  3GYX B;  3P5B P;  1MW7 A;  1MSW D;  5ETP A;  4LFC J;  2FLL A;  3MAA B;  4LFA J;  2JFD A;  5HMX A;  3JQK A;  2HIY A;  2PSZ A;  2VA2 A;  3OTE A;  1T9T A;  4DR3 F;  2J0S D;  4K0K F;  4PWD A;  4AND A;  4YDD B;  1RWK B;  4KV8 A;  1NK0 A;  2RHQ B;  1JLF B;  1OQ6 A;  2CPD A;  1IBL F;  3KLI B;  3R5J B;  4RU9 A;  4WPA A;  2XMM A;  1HQ2 A;  4N7T A;  3VVT A;  1C0T A;  4NXN J;  1U2R A;  2XWX A;  2J6S A;  1TVR B;  1SKU B;  2HQD A;  3R5G A;  2GQC A;  1J2V A;  1OSC A;  1U24 A;  4QIE A;  1B7F A;  3CGI A;  1V3R A;  1WOP A;  2X1G A;  3NMA A;  3W1Y C;  3U1M A;  4K4T A;  4M94 A;  5HL7 Q;  4X84 A;  5CD4 A;  4BDP A;  4LF8 F;  3HCX A;  5T41 A;  3OXL A;  4AXI A;  4ES1 A;  4IH7 A;  1SQE A;  3EZO A;  5KFV A;  2XYH B;  1SC4 B;  3C6T B;  4C8O A;  5L39 A;  2GV1 A;  1RTI B;  2MZQ A;  4ZP8 A;  1I6J A;  4UZB A;  3M8Q A;  2V63 A;  1FKP A;  4ECR A;  4JBC A;  5KG7 A;  5KFX A;  2XTJ P;  4X4Q A;  3HFK A;  4B3T J;  4DPT A;  4X4V A;  9ATC B;  4NML A;  2CJA A;  2WSE C;  6FDR A;  3IRW P;  4WIQ A;  1TZ0 A;  1FXL A;  1MN9 A;  1HWJ A;  3WX8 A;  1FKA F;  3T41 A;  2PN6 A;  1UA0 A;  2F4V F;  4Y2K A;  1VHI A;  2YWH A;  1H0H B;  2MKS A;  2OPR B;  2FJW A;  5LSL A;  2ASY A;  1REV B;  1JK9 B;  3CCT A;  2K7K A;  4QR2 A;  1JJH A;  3CCL S;  3HSZ A;  4WK3 A;  2JLG A;  3KLE A;  3D6H B;  4DLG A;  3FKB A;  3V6K A;  4IG0 B;  3MOJ B;  4JOU A;  1TK8 A;  4CH1 A;  2EFP A;  2MLY A;  2EG2 A;  3ZO7 A;  4GKK J;  3NXZ A;  3AKO B;  2Q3P A;  3I6P A;  1QM9 A;  4Q7A A;  2E5H A;  4C0O C;  1U45 A;  3NY0 A;  5AXL A;  2DH9 A;  2POK A;  2VKR A;  4OLP A;  3I5B A;  3PEH A;  1IN0 A;  4N41 A;  1FRH A;  4R0E A;  4GO5 X;  3QGH A;  3I31 A;  5KFK A;  3KJQ B;  4UZC A;  3QRR A;  3WHI A;  4IH5 A;  1O8B A;  2BKP A;  4FYX B;  3KLI A;  2J9D A;  4DCO B;  2ZH4 A;  2YWF A;  5L8R C;  3BN4 A;  1T8E A;  2GFF A;  4USV A;  4ZVR B;  1B64 A;  2R42 A;  3PRB A;  2W2O P;  1Q53 A;  3JTP A;  4RNM A;  2CXE A;  3DRY A;  3OR2 B;  1NJX A;  1HBM B;  4LUB A;  1VQ4 S;  2Y1I A;  3GR0 A;  4DUT A;  3KLG B;  5B09 A;  4ZVQ B;  3G82 B;  3PIP Q;  1VCT A;  3OFG A;  4F25 A;  1QVG R;  3C6T A;  3T1H F;  1A9N B;  4CO4 A;  4GVB B;  1GMV A;  5LMN F;  2PFF B;  2JFK A;  1VC5 A;  3OFH A;  2V9W A;  2YQ3 A;  3NAH A;  1X4H A;  1V9O A;  3KNA A;  3D3C J;  3D3B J;  2KM8 C;  2V8H A;  4WK1 A;  4K4S A;  4PAB A;  3FRZ A;  1Q79 A;  4DR1 J;  3WIU A;  3N79 A;  3AA9 A;  2DY9 A;  1CEZ A;  2DBB A;  2DEI A;  1TFW A;  4NLY A;  4AT1 B;  1M90 T;  1QAY A;  2CAJ A;  2ZBI A;  1U1K A;  2QA4 S;  2OPR A;  2BE7 D;  3MOZ A;  1BQX A;  3TYT A;  1BD6 A;  1WC3 A;  1CJT B;  1FJE B;  4RO0 A;  3DLL Q;  3L4B C;  3W5X A;  1C1C B;  5C42 A;  1NK9 A;  2XLK A;  4NLX A;  2WON B;  5J2P B;  4H54 A;  5ETL A;  2HW3 A;  1RCO B;  4UY8 T;  5DDO C;  5HP1 A;  2XI3 A;  4X62 J;  1Y11 A;  2KT2 A;  4IOC Q;  5KFA A;  4V19 J;  2UXB F;  1V5V A;  3SQO P;  2KXN B;  4E98 A;  3H5Y A;  4JI4 F;  3H90 A;  1HBO B;  4DV3 F;  1RT6 B;  2MY8 A;  4ZIT A;  3JTN A;  1SV5 B;  1RTZ A;  3M6V A;  3HK2 A;  3KJV B;  4MKY A;  2GX8 A;  1L3S A;  5U47 A;  5DDR C;  2VOP A;  2V8P A;  3RW7 A;  5EUH A;  4J9U E;  1SJ1 A;  3ENW A;  5E3C A;  1F1B B;  4LF7 J;  2B8P A;  3FEZ A;  4H4O A;  4U6P A;  3DLJ A;  5D4N A;  5M2P A;  5HVF A;  2MSS A;  1UVL A;  1P1L A;  1HHS A;  1HWK A;  3EIC A;  4LF4 F;  3KK2 A;  3AJ1 A;  3RAQ A;  3UN2 A;  3I4H X;  4OHW A;  3U1L A;  1FRJ A;  2HQ3 A;  5M2R A;  2EG1 A;  4UOG A;  3RRG A;  4QYZ J;  3QLH B;  2JOQ A;  3N28 A;  3HMJ G;  4L3K A;  3RUB L;  1FWK A;  4FKX A;  3SFU A;  1GXT A;  1QTM A;  4C0B A;  3CW2 C;  2YNG B;  3VVU A;  1CJU B;  1NHK L;  4FKY A;  3QFH A;  1TKT B;  1HMV A;  3PV8 A;  4YHH J;  2V9K A;  3CO0 P;  4ED3 A;  5D3G A;  4IDK A;  4ZOS A;  4P72 A;  5HLF B;  1WDD A;  1DRZ A;  3M8P A;  1BQN B;  5D0E A;  1ZAX A;  2MMY A;  1YQH A;  5DET A;  4KT0 C;  1IJF B;  3FBE A;  4X64 F;  1AT1 B;  3I96 A;  1L3T A;  4UTG A;  3MM5 B;  4X66 J;  1WKK A;  4KKO B;  1ZYQ A;  3VAG A;  2QC3 A;  2R2T A;  5A6W A;  5HBM B;  4UF4 A;  3PO5 A;  2VU5 A;  3M05 A;  1N32 J;  2AX0 A;  2Z57 B;  3K8W A;  2HQI A;  1N34 J;  2DGS A;  4KHM A;  4BCA A;  4A47 A;  5F41 A;  5GAE U;  1ACM B;  1K0V A;  1URN A;  2IFX A;  3CVK A;  4RPF A;  3D9B A;  2MQN A;  3OR1 A;  1Y3J A;  2RRB A;  1GNK A;  4P2F A;  2G0J A;  1F9H A;  1ZAW A;  2FZC B;  1DBD A;  4XAK A;  1RAF B;  2W7P A;  3OVS A;  2XYP B;  1JLC A;  5H9F J;  3MM6 B;  2H9Z A;  3LP1 B;  4G1P A;  1PG5 B;  3FSY A;  2IIH A;  4OZL A;  1FJC A;  2MY7 A;  1U1M A;  2DO0 A;  3H4B A;  1QSL A;  1EQM A;  3C46 A;  1RLD A;  2HMI A;  2DGX A;  3KXD A;  4DZD A;  3PXG a;  4NYO A;  1TMJ A;  5L9N A;  4N47 A;  3IBW A;  3A13 A;  2OPS B;  2ZOM A;  2F65 A;  2VD3 A;  4LF5 J;  3RYL A;  3QFW A;  3OL8 A;  3HT3 A;  1FRI A;  3A8E A;  1RAC B;  4P6Q A;  5HMW A;  2E5L F;  4NLV A;  3UN3 A;  2BV3 A;  2IVF B;  3R97 A;  3UNG C;  3LAM A;  1FFG B;  1SKS A;  5C2G A;  1UVN A;  2HAI A;  4XIU A;  4A8F A;  2DNK A;  2ZJP Q;  2HBR B;  1HD1 A;  3VGV A;  2IMO A;  4GC6 A;  4TXS A;  2AJF E;  4ANE A;  1YJR A;  2YX4 A;  2LQB A;  2GIR A;  3ZNU A;  3DDI A;  1YK9 A;  4P2X A;  5KFL A;  4RL1 A;  4WU3 A;  1VQN S;  1BY9 A;  4DUY F;  3D67 A;  2HS3 A;  3Q22 A;  4DJB A;  2EFV A;  3FMB A;  2HNZ B;  2VBZ A;  3WZ0 A;  2FGC A;  2DR6 A;  3MM5 A;  2HFZ A;  2V4R A;  2RRN A;  2BEF A;  2OKQ A;  1UET A;  3ILI A;  2UUC J;  2ZWO A;  4DV7 J;  2ZJR Q;  1RTJ B;  4TKT A;  2GHV C;  2XMT A;  3V81 A;  1S1T A;  4ZCI A;  4V1A k;  3VAJ A;  1L3K A;  2GC8 A;  4K4Y A;  1T0T V;  4Q8E A;  1KWM A;  3GFY A;  5ETV A;  2W4P A;  4MMO A;  4ALZ A;  4CLW A;  1QAI A;  1VI7 A;  3H8Y A;  2UVW A;  4B3R J;  1P9Y A;  3HHL B;  2VC1 A;  1LWX A;  2MYF A;  1GX5 A;  2DNP A;  3C15 A;  2C3O A;  1XBW A;  3IXQ A;  1CJK A;  1YX2 A;  3BZQ A;  3MPV A;  4P10 A;  3OXF A;  2ZUG A;  1UJ5 A;  2NCK L;  3PYE A;  5E33 A;  1NLT A;  4C11 B;  1EQ0 A;  4OI0 A;  1RBO B;  4NA3 A;  2OPS A;  1UPM B;  4HT5 A;  4JI8 J;  3DHX A;  3ETM A;  1TKZ A;  1UFL A;  4HI2 A;  3R9L A;  5EX0 A;  3V2U C;  3SV3 A;  4ZPW R;  1YRT A;  2O5D A;  3MEE B;  2ZDP A;  2C2Z B;  1XMQ F;  4JI7 J;  4ID8 A;  3CCV S;  4NE9 C;  2PEH A;  4OYZ A;  5CAB A;  1RAJ A;  4CIO A;  3D0I E;  3TZW A;  2KU7 A;  3RBX A;  3T6B A;  1K44 A;  1XIQ A;  1FNX H;  2OEK A;  4R25 A;  1H2V Z;  4DQI A;  3FRY A;  4OQJ A;  3BBB A;  3UVJ B;  1X5T A;  1NAQ A;  5C5J A;  4HTJ A;  4TNO A;  5AJ3 F;  2HBY B;  3MEC B;  2OD6 A;  1M5S A;  1NSA A;  2XY5 A;  2A2D A;  3D2W A;  2BQR A;  3CT9 A;  3CCR S;  2HSE B;  1SKR A;  1WNE A;  2GA7 A;  1RHU B;  2YKQ A;  3HO1 A;  2BE2 B;  3TZX A;  4KHP J;  3MPW A;  1ARO P;  2HHX A;  2OAU A;  4JV5 J;  3CC4 S;  3PW0 A;  5E3Q A;  2KO1 A;  2N7Y A;  2W8K A;  2Q66 A;  1U2F A;  1WG5 A;  3O5T B;  1HWL A;  1RYR A;  1VQL S;  2E66 A;  1FHT A;  3GQC A;  3V4I B;  3KK3 B;  2UZA A;  3IR7 B;  2RDI A;  4PG4 A;  4RBT A;  4FDF A;  1D1U A;  4A8Y A;  1YLX A;  1XJW B;  4HI1 A;  3HHL A;  5L1K A;  3KFW X;  3MTJ A;  1C0U A;  3US5 A;  5J1N A;  5T7L A;  5F9N A;  2KVI A;  2CJB A;  2XNQ A;  5IS2 A;  3C2P A;  2UU9 F;  4HLB A;  3KYL A;  3UDC A;  2IRY A;  3P5T L;  5EWF A;  4C8Z A;  1WOS A;  5DQG A;  3K17 A;  3TJ9 A;  4ZPC A;  3CME S;  2OUG A;  1H98 A;  1GH8 A;  3MR5 A;  5C24 A;  2W9A A;  2C3Y A;  4EBC A;  3NP5 A;  4CYU B;  4I1T A;  4OX9 J;  3HFZ B;  3W9H A;  3QGP A;  4Q2M A;  2VFV A;  3MD1 A;  2M2B A;  4KAI A;  1BLU A;  1R43 A;  3SSS A;  4WP8 A;  4F4X A;  2YXL A;  1QDU B;  3W5Z A;  4BWM A;  1CC7 A;  3G8S A;  4JI6 F;  4RW6 A;  1U6Z A;  4DQQ A;  4CLY A;  4ZVE A;  1BXN A;  4DR6 F;  5KFR A;  1RTD A;  2WB1 D;  4DV4 J;  4I4B A;  2AMC B;  1RCX B;  3CD6 S;  4FS1 A;  3CCS S;  1WC5 A;  1MNE A;  3MEC A;  4DL6 A;  3A8K A;  3NCR A;  2ZJQ Q;  3DOL B;  4HDG A;  1RWU A;  1Q1K A;  4RU2 A;  3QIP B;  1KQS R;  1ROF A;  3J7Z 5;  5ETR A;  1PCA A;  2V8G A;  1WEX A;  2FPH X;  4URG A;  2VG6 B;  3MAQ A;  2BUN A;  4P71 A;  1E6Y B;  1VRU A;  2V2V A;  1S6U A;  3E3X A;  2E5I A;  5HVG A;  1IBK F;  2FUG 9;  1U0H B;  2YWG A;  2FHJ D;  4DV2 F;  1Q8K A;  2ZH8 A;  1H2U X;  4ED7 A;  4BHQ A;  2OSQ A;  1WI6 A;  3C14 A;  2IBK A;  3TOQ A;  4LRD A;  1Q5V A;  3IWL A;  2H51 B;  4YY3 F;  4F0K A;  3ET6 B;  2BR0 A;  3MUT P;  2V8D A;  2DHH A;  2HBQ B;  3H98 A;  1EAY C;  2CVI A;  5L9X A;  4I56 A;  1VJW A;  3V6D B;  2CPY A;  5B0D A;  5BYS A;  4MK9 A;  1FDA A;  2UVV A;  1KNZ A;  1R0A B;  3B78 A;  3DM2 A;  5L38 A;  3DYA A;  4C3M A;  1KLM A;  2JRS A;  3X3U A;  1RIS A;  2C3M A;  3BPS P;  1NXI A;  2NLW A;  3MPY A;  3PG9 A;  4LFC F;  4LFA F;  5B7W A;  2AW0 A;  4NLS A;  3VCD A;  3B4M A;  3P96 A;  4C8N A;  3H5U A;  4RUA A;  2QLX A;  3K5M A;  4NCB A;  5K8N A;  1TFY A;  4CYU A;  1NK7 A;  1JQG A;  2JDJ A;  1QJH A;  4RX6 A;  4LSL A;  4NXN F;  5H9F K;  1P8G A;  2JJ4 D;  2AT1 B;  1RAB B;  3R1H A;  1FK9 A;  4OZ1 A;  3UFC X;  5ADZ A;  2E1C A;  2V4J B;  3CDB A;  3FDS A;  1XMB A;  4LF9 F;  4ED5 A;  3O44 A;  4IRK A;  2JX2 A;  3HPO A;  4W90 B;  2ZWP A;  2JC0 A;  1UMJ A;  4QIW D;  3B82 A;  2A18 A;  5HN0 A;  4FVM A;  4CLK A;  5JVH Q;  3TZZ A;  2KYZ A;  4DR2 J;  2C3U A;  2G13 A;  1CS4 B;  2NXC A;  1MRO A;  3HHD A;  1APS A;  1UWB A;  2KZM A;  2YQ1 A;  3SFG A;  3T1Y F;  4O3Q A;  5KAK A;  3IG1 B;  3J81 j;  3FSI A;  4DPO A;  1S1X B;  1E6Y A;  1RWW B;  2U2F A;  3Q2T C;  4B3T F;  4RUH A;  2FQQ B;  4KY3 A;  3NKY A;  1F5C A;  3W63 A;  2XZD B;  4A46 A;  1FTC A;  3O1L A;  4J7C A;  3DMJ A;  1U0H A;  2BAN A;  3J7A 1;  1JLB B;  4ECV A;  5KFN A;  2VF3 A;  4EEY A;  5J2Q A;  3F0N A;  4C0H A;  5HVH A;  3QZ8 A;  3VQT A;  4O3O A;  2IRX A;  4KPC A;  3ET6 A;  2Q2G A;  4HR2 A;  4ZP9 A;  2HZV A;  3BGR B;  3NBP A;  2DIV A;  3FVY A;  3N6M A;  1VMB A;  3PRV A;  2HRY A;  2D41 A;  4RW8 A;  1S1U B;  5IT4 A;  1RU1 A;  3PYG A;  4ZP7 A;  2NS1 B;  1LW0 B;  4IR9 A;  3TAQ A;  1XEZ A;  5CD4 H;  3KHR A;  4WXW A;  1RT1 A;  2BJ8 A;  3RR8 A;  3IBF B;  2VDH A;  2RAQ A;  1NU4 A;  1D8Z A;  4XDD A;  1HKA A;  1NPK A;  4U7U K;  5GAH U;  3I55 S;  1PBA A;  1YJV A;  1FER A;  4IYQ A;  3PJW A;  9RUB A;  3PW7 A;  1R8C A;  5F8M A;  2FHO B;  1YIJ S;  2V2K A;  3DI6 B;  5LM7 E;  1TAU A;  3EXY A;  2VG5 B;  3ZTO A;  1HFE L;  4UOH A;  3QT7 A;  1XNQ J;  2IM1 A;  1Y5I B;  1N6Q A;  2R3V A;  3AH6 A;  3KNG A;  3AFG A;  4DV6 J;  3WIV A;  3AOA A;  3TA2 A;  1ZTW A;  2IHR 1;  1NEE A;  4X65 J;  3IWN C;  3DRS B;  2OJ3 A;  2HVE A;  1FEE A;  4ZPT R;  1RT2 B;  2XMV A;  2KG0 A;  1CUL A;  1LWF B;  3R5B A;  1GTH A;  1X5S A;  4FXV A;  3BRE A;  4JYA J;  1LW2 A;  4FBT A;  3MR3 A;  3CUN A;  4H4M B;  3IP0 A;  2R7V A;  4J9S A;  3OTB A;  2HHP A;  2X1A A;  4DSJ A;  1TL7 B;  2KHC A;  2YKP A;  2BVZ A;  4Q44 A;  3FFI A;  2MZ1 A;  8RUC A;  2FGO A;  1T9Y A;  3ZZ0 A;  3THV A;  5AE3 A;  2Y8W A;  2XUL A;  1YJW S;  3CCZ A;  4F02 A;  3LWM A;  4WTY A;  1JLB A;  3IGV A;  2LA4 A;  5KT3 A;  5B08 A;  4RW9 B;  2JVO A;  2J7K A;  3LP2 B;  5SUH A;  2WB4 A;  1NKB A;  1B4S A;  2PEB A;  5J1E B;  5B0C A;  4CLF A;  4GKJ J;  4M5D B;  4O0I A;  4DFJ A;  4ZJO A;  4X62 F;  3VTI A;  1S1U A;  3D6F B;  2R7O A;  1F9E B;  3AB4 B;  4UOC A;  3DOM B;  2I6W A;  4WII A;  1AW0 A;  4ZVF A;  4DSE A;  2JLE A;  1VQ8 S;  1LW0 A;  3BF4 A;  4OV1 A;  1HQE B;  3JAM Y;  1VC6 A;  1MMD A;  1EB0 A;  2B4U A;  4X4T A;  2HHT A;  1PSD A;  2BRK A;  1P6T A;  3UI3 A;  4DPU A;  2YX1 A;  4B9S A;  2CDR B;  4NAS A;  5GME A;  2YNI B;  4NYZ A;  4LF7 F;  1NJW A;  4R8U B;  5A0Y B;  5KG5 A;  3MM7 A;  4Q0B B;  1TV6 B;  4TY8 B;  1BWV A;  5DLG A;  4B9T A;  4J9K A;  2B51 A;  4QIV A;  3QJJ A;  4R0J A;  6AT1 B;  1B0P A;  1B99 A;  1KQF B;  3W8G A;  3BQ2 A;  5DGB A;  1YRU A;  2JSX A;  3A12 A;  3HVR A;  4LBI A;  2GML A;  3P8B B;  2ZZT A;  3SZ2 A;  3PAC A;  2D3O 1;  5K8O A;  2DB1 A;  4ZLN A;  5C25 B;  4UY8 5;  4UQG A;  2BJ9 A;  2RU3 A;  2R8I A;  2EBG A;  2E1P A;  3DGV A;  3I0S B;  5KG6 A;  3EDQ B;  4TY9 A;  4MIW A;  4K4Z A;  4ATN A;  1BWE A;  4YHH F;  1NSK L;  1UEK A;  4CTA A;  3BN7 A;  4I2Q A;  1XMO J;  1H2T Z;  3D1O A;  3ZTQ A;  4WE1 B;  2OPP B;  2E7X A;  3W2W A;  1X7V A;  4H4M A;  4CWB A;  2W7A A;  2ZOF A;  1S6Q B;  2BJE A;  3MUM P;  1JKH B;  3G2X A;  3HUL A;  3MTK A;  5HO4 A;  4OZ5 A;  4M95 A;  2V34 A;  3N5F A;  1K9M T;  4ZVH A;  3JAM U;  2MHE A;  2G0C A;  3DLE B;  1H38 A;  2DGT A;  4X66 F;  3BH6 B;  1WSV A;  1MMN A;  2ZZM A;  4YDX A;  3VZI A;  1N48 A;  2AJ4 A;  1LWE A;  5F9L A;  3H5X A;  1N32 F;  3CJQ A;  3P3D A;  5K8M A;  1W26 A;  4EFA C;  1N34 F;  4HL9 A;  4DN9 A;  2QV6 A;  1S6P B;  1NDK A;  4DR7 J;  5J1E A;  4CZC A;  2CIM A;  1TUW A;  3IWX A;  3BR8 A;  2XS2 A;  1FDD A;  2F9D A;  2H1Y A;  3CJ4 A;  3LAL A;  3OUY A;  4M5D A;  2MZJ A;  1VQO S;  3ZTS A;  3NCQ A;  3OJS A;  1IQZ A;  2XSJ B;  4KRW A;  3BGU A;  2ZHB A;  3D6T B;  1DTQ B;  4KR0 B;  3PW4 A;  1FX4 A;  3THT A;  3PZP A;  3CXC R;  2GNK A;  1S79 A;  2P8I A;  3DRP A;  2QA4 G;  1HIY A;  4XPE A;  1A7G E;  1KON A;  1WG4 A;  2AWZ A;  8ATC B;  4IOB A;  2AF6 A;  3GIJ A;  3L7P A;  1URR A;  4Y3C A;  1PJ5 A;  2L41 A;  3EGV A;  3DGP A;  4P7V A;  2RSQ A;  4ZN1 A;  5D78 A;  4H4K C;  3Q8R B;  3J7Y I;  3MUR P;  5K14 B;  1KDN A;  1OJ4 A;  5KG2 A;  1WF2 A;  3AJ2 A;  2ODX A;  1TKD A;  1PAE X;  4KC5 A;  5CYM B;  4N77 A;  1N8R T;  4OYM A;  3WC2 A;  4PAA A;  2RE1 A;  1GK8 A;  2C2D A;  4ZVP B;  1VLY A;  4PG5 A;  4AQY F;  4ETZ A;  1RU2 A;  3MMA B;  2I38 A;  1YZ6 A;  4PR6 A;  5FJ4 A;  1FDN A;  3M2R A;  3PX0 A;  3M7V A;  3QRP A;  1UL3 A;  3OL9 A;  2OHD A;  1ZS6 A;  1VBX A;  1C1B B;  2OEM A;  2DRA A;  1JLE B;  2BJ1 A;  2OPP A;  1FT8 A;  1FI4 A;  2VAS A;  3HJF A;  3I5C A;  1FWL A;  3N6N A;  4ETX A;  5ITH A;  3BO3 A;  4OLO A;  4PYD A;  1OO0 B;  4OJ3 A;  4A4J A;  1HQU B;  5GAE I;  4WFA Q;  3KLV A;  3DLE A;  5FLX Y;  1PYS B;  1RA7 A;  3DXB A;  2EFN A;  1WKJ A;  2XMJ A;  1L3V A;  4DV7 F;  2K7J A;  2MGZ A;  4J90 A;  3RBD A;  3MZI A;  1YGY A;  4NI2 B;  3QGI A;  1S72 S;  5DDP C;  1S97 A;  1IR0 A;  1ITP A;  2W9C A;  3CDE A;  3PHE A;  1S4E A;  2FJX A;  2Q1L A;  2IMW P;  4M5N A;  3IS9 A;  2XSJ A;  1IKX B;  1JLG B;  1JXL A;  5HSP A;  4ICL B;  3H42 A;  1HNZ F;  2CVE A;  2WBR A;  4DOZ A;  1EAR A;  1NDL A;  3FUY A;  2B6A B;  1JLA B;  4YB5 A;  4I6A A;  2DHS A;  5KT2 A;  4OYP A;  2GMJ A;  4LRB A;  4LBH A;  3BYP A;  4DG1 A;  3T1A A;  1WHX A;  1S9G B;  2W4C A;  4PXC A;  4ID5 B;  4HHJ A;  1TL1 B;  3RBZ A;  4QZV B;  3MCN A;  1ULR A;  4YQW A;  2N7C A;  2QL9 B;  1Q81 T;  3AOB A;  3GR1 A;  3EGW B;  4JI8 F;  1JXE A;  4LR7 A;  4DBQ A;  1UW4 A;  3T3F A;  3PVX A;  4NOH A;  1D9F A;  3RJM B;  4FS2 A;  5AT1 B;  5FLX U;  4JI7 F;  1S7I A;  2BX6 A;  2AGQ A;  1U26 A;  4FNH A;  2FLN A;  2NXJ A;  3VAL A;  4WZM A;  4KH0 B;  4OJH A;  4PPZ A;  4LQ3 A;  1NPR A;  3FK4 A;  3KUH A;  4URQ U;  2XM3 A;  3LA0 A;  1RLC L;  2VFR A;  3AGY A;  1JLE A;  4ZMM A;  5KFG A;  2HRT A;  3CJK B;  2ACY A;  1XQI A;  3OTO J;  4WTO B;  2VG7 A;  2Q6B A;  2PD1 A;  2W1B A;  2DNO A;  1VJQ A;  2WTF A;  1IBM J;  5CH7 B;  4W4M A;  1QAX A;  1K47 A;  1NJZ A;  4FXD A;  2H5E A;  1VIO A;  3TJA A;  3RG6 A;  2B7B B;  4RW7 B;  2X1B A;  3V6J A;  5HAO A;  3BBF A;  4WFY A;  3VAH A;  4NI2 A;  3FBF A;  3HHK A;  3K5O A;  3CB4 A;  1N33 J;  3CDU A;  3CJR A;  3M8Z A;  3OVB A;  4XO0 A;  5CZV A;  4Y0F A;  1NJI T;  3DN9 A;  1PJ6 A;  1Y00 A;  4OIX A;  3W66 A;  2Y1J A;  1KVK A;  2IJN A;  2JEJ A;  4L75 A;  2HVI A;  2NXN A;  3OHA A;  1K8A T;  4YR3 A;  3C16 A;  1RT7 B;  2KFZ A;  2XCP A;  1R8B A;  1Y5N B;  5KFJ A;  2B6A A;  2SXL A;  5D4P A;  2I5J B;  4HKQ A;  2FY1 A;  3EX7 B;  4WZQ A;  4E0D A;  2VOD A;  5JXS A;  2QA1 A;  2ZIT A;  1S9G A;  4ID5 A;  2XLI A;  4MH8 A;  4EBE A;  4CLU A;  1KHV A;  1Y10 A;  3IM9 A;  3KKF A;  3OTD A;  2B56 A;  3PYF A;  1CQM A;  5FD1 A;  5JVG Q;  4DPY A;  3Q2S C;  1N0V C;  3TUJ C;  2W2Q P;  1VQK S;  2ZH9 A;  4BS2 A;  3IAM 9;  4U7C A;  5C2C A;  4CO2 A;  5DZ6 A;  1KVI A;  3TQE A;  7FD1 A;  4DQR A;  4BC9 A;  3ETO A;  2QEX S;  4X4N A;  2DHX A;  4IG3 A;  1JJ4 A;  4AD6 A;  3G6E S;  1TEL A;  2WOM A;  2KTQ A;  3E01 A;  3ISN C;  2XS5 A;  4IR1 A;  1ZBT A;  3MHY A;  1OSD A;  3M30 B;  4LVO P;  1GX6 A;  4B9U A;  3KLF B;  4DV4 F;  4PWW A;  2H65 B;  2JEF A;  4CH0 S;  1AXQ A;  4HTI A;  1DTT B;  3J80 Y;  2ASD A;  3V5R A;  2VB6 A;  1AB8 A;  3BV8 A;  3QO9 B;  1M0S A;  4C8M A;  1SJ4 P;  4YB7 A;  3ZXW A;  2DR8 A;  4G1Q B;  2J5A A;  4MKB A;  3MEG A;  3ZTR A;  3JYT B;  4OYB A;  4NX9 A;  4P52 A;  1VOM A;  2G1D A;  3NEK A;  4PUO B;  4ZCL A;  4WXO A;  2CQI A;  4RNN A;  1RWX B;  1U6F A;  2VPY B;  1U25 A;  3H59 A;  2AX1 A;  2I2Y A;  1WHY A;  4RLE A;  4DLE A;  4B02 A;  3HD1 A;  4QR1 A;  4NLQ A;  5DM7 Q;  4TU8 A;  1IVZ A;  2HFV A;  1IKY A;  2HFO A;  2LEC A;  3TQ1 A;  3CJ2 A;  1CVJ A;  2EFG A;  4ZIV A;  3TAN A;  4USJ C;  4QWA A;  3HSD A;  5HRO B;  2BYC A;  3N6L A;  1X60 A;  3VAI A;  4S0M A;  1KLN A;  2BOP A;  1UEV A;  1RP5 A;  3M6U A;  3VGU A;  5DQH A;  2BXJ A;  4ZK7 M;  4ZHR B;  1RKI A;  1OQ3 A;  2Z2Z A;  2P5V A;  3RRH A;  3JB9 k;  3J80 U;  1WHV A;  4KO0 A;  4FBU A;  1PAU B;  4F2R A;  5H9E K;  1S6O A;  4U8Y A;  4XDC A;  4QWC A;  1F3V A;  2HWI A;  1K0T A;  3M8W A;  4ECU A;  3I82 A;  1Y0H A;  3GE9 A;  4AFF A;  2CQ0 A;  4C6A A;  5IT0 A;  1TL5 A;  1RWV B;  2VPZ B;  3KHH A;  1RTH B;  4F50 A;  2LDY A;  1U1N A;  4C7Q A;  2QFJ A;  2IAJ B;  3M30 A;  2KZZ A;  3M2U B;  2BW2 A;  3PIO Q;  3KLF A;  1NND A;  1Y9O A;  3K57 A;  1HHT P;  4MYT A;  4I68 A;  1HNI B;  2CQH A;  3CCW A;  3MM9 A;  3TVY A;  1Q7L B;  3BB5 A;  4DX7 A;  3H4D A;  2OTL S;  1H73 A;  4P9S A;  3WBZ A;  4O3P A;  5AE1 A;  1SJF A;  1T3N A;  3KLH A;  4PXD A;  2V0N A;  2B5J B;  3MFI A;  1RT5 A;  2Z2L A;  3OHB A;  1AZS B;  2PA8 D;  3DDK A;  2FDN A;  2V50 A;  4D3G A;  3FQL A;  2J0Q D;  1JLQ B;  2OLW A;  3HVA A;  2ZBC A;  4J5O A;  2BKO A;  3EDR B;  2IVM A;  2DR5 A;  3MI7 X;  1SXL A;  3QID A;  4ITS A;  1GFW B;  1C2P A;  1T9W A;  2MQL A;  1I3O B;  5GMD A;  3NRB A;  3M1V A;  2DGU A;  4B9V A;  1WF1 A;  4PQU B;  2GCF A;  5G0R A;  5AXK A;  4RWX A;  4DL2 A;  2W2N P;  3T5L A;  3CIM A;  2E9Z A;  1Q78 A;  4ZKA A;  5D6G A;  1J5O A;  1VK8 A;  3CD5 A;  3NWR A;  1G7C B;  1YRX A;  4F36 A;  2DYA A;  4CM0 A;  4ZHR A;  3W2V A;  1GMU A;  4PWD B;  2YKA A;  2N4C A;  3VF0 B;  3A3P B;  5J2M A;  1OWX A;  2Z30 B;  1C0T B;  5IXU A;  3PCO B;  1SJR A;  1FRX A;  1WKL A;  1BUX A;  3W62 A;  1SJQ A;  2MJN A;  1M5O C;  1JWW A;  4OV6 A;  1MWQ A;  3ADA C;  1CG2 A;  4KFB A;  4O4G A;  1VRQ C;  4DV6 F;  4N8O A;  1UW9 A;  4M5I A;  3PDN A;  5DG8 A;  4X65 F;  2E9T A;  4P7T A;  4UUX A;  2DRD A;  5BXI A;  1UA1 A;  1N5T A;  3W9I A;  2FVP A;  2QX0 A;  2C2E A;  3L95 X;  3I5A A;  3M8Q B;  3F73 A;  1FKP B;  3I4P A;  1R6Y A;  1IUJ A;  1N5V A;  4FYD A;  1A0O B;  4DR3 J;  3B4D A;  5CHC B;  1BQM B;  2V2Q A;  1H7X A;  2IDL A;  4OHV A;  4LMZ A;  2XGP A;  4EYI B;  1W2I A;  4NLR A;  1NSQ A;  2ROP A;  3HZG A;  3SV4 A;  4OL8 A;  2BM0 A;  3R6L B;  4LSN A;  2GO8 A;  1OY9 A;  2MDA A;  1N88 A;  1YBT A;  2KJV A;  3KLE B;  4NPO A;  3OFF A;  1NJY A;  4K4X A;  2FLO A;  1FES A;  3SYZ A;  2J8S A;  1XWL A;  1GXL A;  3HVW A;  1GT8 A;  4NXM F;  3ZTP A;  4N76 A;  1H72 C;  5IV4 A;  2KXH A;  2ZNZ A;  4Y00 A;  1YZ7 A;  3K89 A;  3MAH A;  4TU7 A;  1X9W A;  2IRU A;  5GAH I;  2R7T A;  3KK1 A;  4IQM A;  2Y1R I;  3DRR B;  2QGF B;  1SH2 A;  3GIR A;  2NQP A;  1RWP B;  4IO1 A;  3QPI A;  1F0X A;  3MCO A;  5IQ6 A;  1GEH A;  2DIS A;  3EUN A;  3UDL A;  2YWE A;  3RAX A;  3SCI E;  1TUV A;  1U4B A;  3PFO A;  2O3D A;  2ERR A;  2AYM A;  4OX8 A;  2VPW B;  3D0H E;  1E6V A;  1QY7 A;  2DNN A;  3MR6 A;  3ZZY A;  2DIU A;  2ATC B;  2DR9 A;  3I32 A;  1FA0 A;  1OIA A;  5F8G A;  2MQ8 A;  1SB6 A;  2ZH7 A;  2R7U A;  3PM9 A;  2GO9 A;  2YKM A;  2LDI A;  2WVB A;  3O8W A;  3H25 A;  2QO3 A;  1X5P A;  1O6X A;  4RNO A;  2NPF A;  5EHH A;  1G4C A;  3D5M A;  2BQU A;  4JV2 A;  2LXI A;  1IJE B;  1SH3 A;  2KJW A;  3POT A;  4ED8 A;  1VK3 A;  3MMC B;  4DU8 A;  1UAW A;  2HBZ B;  2R8K A;  3MXH P;  4N56 A;  2LQJ A;  3GII A;  3C3L A;  3AT1 B;  2HVH A;  2CZ9 A;  3R3T A;  4AL6 A;  1XMO F;  5HQ8 A;  3OJU A;  3LPE A;  4USM A;  3VAF A;  1BQM A;  1W7W A;  1NO8 A;  5B0G A;  3SEO A;  4JI1 F;  1SQF A;  2LEP A;  5HAT A;  1Q82 T;  2MJU A;  2AZ3 A;  3FJ2 A;  2ZOG A;  3ZZO A;  4BLG A;  5T14 A;  3ILL A;  1K1Q A;  3R7N B;  1J5E J;  3T5J A;  3K2Y A;  2O1P A;  1N56 A;  4JI3 F;  3NL0 A;  3HKZ D;  3DOK A;  2BBE A;  2VOO A;  5C42 B;  4WFN Q;  4FZV A;  1NH7 A;  4NZ7 A;  1FNO A;  3W61 A;  1GTE A;  1VRT A;  1TQL A;  4DR7 F;  2BE9 B;  4KJI A;  3C6E C;  1GAO A;  5HP1 B;  3V4M A;  1HI1 A;  3UQS A;  1LXJ A;  2OO4 A;  1RI7 A;  3L9Z A;  3CJ8 A;  5I3U A;  5BYR A;  3KMS A;  4J80 A;  1SBR A;  2HS4 A;  3GJS B;  4ZS6 A;  2NRE A;  4F3Q A;  2Y9H A;  2IC3 A;  4TQS A;  2E44 A;  4OYI A;  1R3N A;  3LOU A;  5KFT A;  2B4V A;  1IXK A;  3HX9 A;  2GHP A;  3DRR A;  3LGN A;  4PRF A;  5KG3 A;  5KG4 A;  4J9N A;  1MU2 A;  2IPO B;  3P4U B;  1KP6 A;  3NGR A;  5E2Q A;  5LOQ A;  4CT8 A;  5D0G A;  5ETO A;  3A3O B;  4H4O B;  4J37 A;  4OJ1 A;  2QL7 B;  1R8P A;  3F56 A;  3PNI A;  3KTQ A;  2AYB A;  3TVK A;  4DSF A;  3KK2 B;  2QMU B;  4QQB A;  3MMB A;  3PRD A;  4TYB A;  4A8Q A;  2G1H A;  2ZH3 A;  4JI2 F;  4MYU A;  2CPX A;  2MB0 B;  2BZ2 A;  1WI8 A;  4F04 B;  2DD8 S;  3E2E A;  2HNY A;  1FDB A;  3KJN B;  3HT0 A;  3L09 A;  3HLU A;  2EW9 A;  4DV0 F;  1RT3 A;  4KGZ B;  3T9N A;  4DV5 J;  2B9Y A;  2AV5 A;  1HMV B;  4DL4 A;  1WWH A;  4ZPB A;  2I1R A;  2QFI A;  1JX4 A;  5D3G B;  1X0P A;  5HJY A;  2YH1 A;  3MMC A;  4IDK B;  1SH0 A;  2ZBR A;  3LUY A;  1ZM9 A;  3P45 B;  4MIB A;  4A8K A;  5IQQ A;  1ZET A;  4F2S A;  3M8P B;  2QSW A;  3M32 A;  5B0E A;  1N5Y B;  3O3L A;  3DRX A;  1FEH A;  3IAS 9;  1O5J A;  3EGN A;  1WUU A;  4JI0 J;  2DXD A;  1N0U A;  3ILO A;  3BSN A;  1UVJ A;  4ELT A;  4EMD A;  3B6B A;  1W2B R;  5K5M A;  3SDE B;  4LF4 J;  1HAR A;  4HH0 A;  3NGS A;  3TRG A;  2RVJ A;  3AB2 B;  7FDR A;  3EZU A;  1B70 B;  2FB0 A;  4CP5 A;  3ZZU A;  5DDQ C;  3R6G B;  4LIW A;  3UW1 A;  1NHU A;  2X7I A;  1FRM A;  2JLF A;  2M9K A;  1UZH A;  2ZFH A;  4WP9 A;  2LMI A;  1KOH A;  4CNZ A;  2R2R A;  4ZN3 A;  4ECX A;  2B7C B;  1F2H A;  4DI6 A;  2WK4 A;  4ILM A;  2ZH2 A;  3Q8U A;  2HHH F;  3OR1 B;  2JZ8 A;  5ETN A;  3UCU P;  3TA0 A;  1N5S A;  1UJ4 A;  1X4E A;  2D74 B;  2OI2 A;  2RKI A;  2OTJ S;  1RZM A;  1JLC B;  2GVD A;  1Y5L B;  1HW9 A;  5I3Q A;  1MLA A;  2XSF A;  4OX6 A;  5KOX A;  1WG1 A;  1RT4 A;  2HIQ A;  4M5L A;  2XWY A;  4OI4 A;  1T9U A;  4FPR A;  4AUK A;  4UUW A;  2RT3 A;  3F44 A;  2HMI B;  1HWI A;  2RB7 A;  2KT5 A;  4QCL A;  4NLU A;  2XY7 A;  3GSI A;  2UVR A;  2DK2 A;  4W98 A;  4HYK A;  2K1R A;  1NK5 A;  1RAG B;  1N5Q A;  3AAW B;  1UJ6 A;  3VV2 B;  3FQK A;  2QIF A;  2V68 A;  4LQ9 A;  3U1N A;  2V94 A;  4F7V A;  4O44 A;  2AJ2 A;  3IR5 B;  1BMQ B;  4LRC A;  4PYA A;  2K3I A;  2FHJ A;  5DS7 A;  1HBU A;  2UXC F;  5KT6 A;  1LK5 A;  1UP1 A;  2CNK B;  2HPU A;  4DR4 F;  1WC6 A;  5L1I A;  3J7Y U;  2OH2 A;  1T05 A;  4FNI A;  3DLK A;  2LEB A;  6FD1 A;  4ECW A;  1JNZ B;  3JXO A;  2GVZ A;  3QMQ A;  2F40 A;  4NA1 A;  3G96 A;  4ELV A;  1GQE A;  1DAX A;  3HJV A;  1RDR A;  2DEJ A;  2FYX A;  4RNH A;  3BGF A;  2KL8 A;  3EZ5 A;  4LF6 F;  2R4F A;  5F0W A;  2V6A A;  1VQS A;  3UDV A;  1IKW A;  1N5Y A;  4WBF A;  4F4Y A;  3OTO F;  5G4D A;  3LAK A;  1FKO B;  3SI8 A;  2LVW A;  2Z8Q A;  3SDE A;  1LNQ A;  1IBM F;  2XLJ A;  3BBC A;  3IRX B;  2RIL A;  4DUZ F;  3V81 B;  2WZ1 A;  1NB2 A;  4CT9 A;  4CLT A;  1S1T B;  2PII A;  4ECT A;  4MIA A;  5BJR A;  1X4G A;  3VR1 A;  2F5G A;  5FDL A;  1VQ5 S;  2HHQ A;  7AT1 B;  2NZC A;  5KG1 A;  3QT6 A;  1TKX A;  4C3L A;  3CJ0 A;  1RGV A;  5JJB A;  4J9Q A;  2CJ9 A;  4HAC A;  1S1V B;  2OEL A;  1ZM3 A;  3NG8 A;  2YKN A;  5DRK A;  2CWX A;  2M7S A;  2KKH A;  1M5V C;  3OSN A;  4GMK A;  3VHQ A;  2FHK A;  4K5R A;  2N4D A;  1BC6 A;  2CQC A;  2BAC A;  4OZJ A;  3C15 B;  1F60 B;  2BW7 A;  4ER8 A;  1CJK B;  4WU2 A;  5DO2 A;  1DLO A;  4U8V A;  1LKZ A;  1BGX T;  1JJC B;  4PQA A;  4QPX A;  1QD1 A;  4LR8 A;  3R2D J;  2J9C A;  2UUW A;  4I6W A;  5KFZ A;  4OZ0 A;  3CPW R;  1YWX A;  4MFB A;  3WQP A;  4QOT A;  5IWA J;  2PE8 A;  1N52 B;  1TKZ B;  5CYQ A;  3DU6 A;  3CUL A;  1RSC A;  1FTR A;  1T3O A;  1YJ9 S;  2MEW A;  2CJX B;  1VHF A;  4M5H A;  2H5I B;  5MAO A;  4YFU A;  1R0C B;  2OSR A;  1QVF R;  2VZ9 A;  2YNH A;  2AGP A;  4O0N A;  1SUQ B;  2G0I A;  4KGX B;  1VYA A;  3M8Y A;  2RF2 A;  2BJ7 A;  4AL7 A;  3UO0 A;  3FCV A;  3D0G E;  5ETS A;  4DR5 F;  1KR4 A;  1CJV A;  2H48 B;  3SIP B;  1RAO A;  3PJ9 A;  1XER A;  4RUC A;  4FYW B;  3IO1 A;  1HI8 A;  4USH A;  3CCQ S;  1S1W A;  4X4U A;  1T7P A;  2R9L A;  2QN6 B;  2HK3 A;  3QAU A;  3JS9 A;  3S1T A;  2UUB J;  2HZA A;  1O51 A;  3IM8 A;  3HDS A;  3PO4 A;  5KFM A;  4DMZ A;  5I42 A;  1S49 A;  1HNW F;  1FKO A;  4RNF A;  2KFN A;  2CA9 A;  3EE3 A;  2FC8 A;  1S7H A;  2C42 A;  3IRX A;  1L3U A;  2AJQ A;  4NLG A;  1XMQ J;  2MKY A;  3OD2 A;  2MHN A;  3GWC A;  1HR0 J;  3K8V A;  2AU0 A;  1VQ6 S;  2FY8 A;  4KGK A;  1S1V A;  4CM2 A;  2QRR A;  3D4J A;  4NRU A;  4C97 A;  2DPJ A;  1F6T A;  3GP9 A;  4Y2A A;  1T11 A;  2WVD A;  2QLF B;  5EWE A;  5AJ3 J;  4HVZ A;  2ZDO A;  2W4D A;  3DC2 A;  1LFW A;  2ZHA A;  4NCG A;  4FYV B;  2MQM A;  1C0U B;  1FWP A;  1NK6 A;  5T7L B;  4R5P A;  4DSI A;  1NCL A;  2PGC A;  4K50 A;  3GJR B;  2YNF A;  4O23 A;  4QIF A;  5CAA A;  3I9Z A;  4OI3 A;  1NKC A;  4XPC A;  2ZEJ A;  3CD0 A;  3Q8V A;  4I7F A; 
#chains in the Genus database with same CATH homology
 3TJ9 A;  1GMV A;  4J80 A;  2QLD A;  3TJ8 A;  2Q2G A;  1EAR A;  1GMW D;  3AGY A;  1GMU A;  1NLT A;  1C3G A;  3AGX A;  1EB0 A;  3LZ8 A;  1XAO A;  3TJA A;  3NY0 A;  1GMW A;  3I38 A;  3L9Z A;  4L3K A;  2HFV A;  2B26 A;  3AGZ A;  3LA0 A;  3NXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...