4L3KA

Crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein UreE
publication title Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study.
pubmed doi rcsb
source organism Sporosarcina pasteurii
molecule tags Chaperone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4l3kA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 4l3kA02
1EARA 2QLDA 4L3KA 3TJAA 3NY0A 3I38A 3AGXA 1EB0A 1GMWA 1GMUA 1C3GA 1NLTA 2B26A 1XAOA 2Q2GA 1GMWD 3LA0A 3TJ8A 1GMVA 3L9ZA 3LZ8A 3AGZA 3NXZA 3AGYA 4J80A 2HFVA 3TJ9A
chains in the Genus database with same CATH superfamily
3DOLB 2KZZA 4RNOA 4KO0A 2J7KA 4IOCQ 4USHA 1JNRB 3B4MA 2ZWOA 1N6QB 4ERDA 4AUKA 4F4XA 4DCOB 1Y11A 3DRYA 3TJ9A 1FEEA 2BJ1A 3H98A 2ROEA 3UE2A 2YKNB 3D0IE 2MTLA 3KHLA 2DNHA 2X1AA 4KH0B 1WI8A 3RAQA 4KJIA 2BMBA 4JI5F 2RF2A 2VASA 3CCWA 5F3ZA 1NPKA 1Z2LA 3ISND 3TNVA 5IM0B 4I0WA 5I3UB 2GC8A 4TQRA 1KVJA 1H2TZ 1HNIA 1FWKA 5CYMA 3IM8A 2MGZA 2WW4A 2J76E 3VQSA 3MD1A 5ADZA 2ZUAA 1FK9B 1Z1ZA 2GA7A 2KDOA 3OLBA 5ETTA 1DURA 3BPDA 3VHQA 3GWCA 5HN0A 5K8OA 1Y5LB 4C3LA 1W2BR 4CO4A 1MU2A 4DSEA 2DXEA 5F3TA 2QA4S 2J9DA 4K0KF 1XNRJ 2JSXA 2ASDA 2HNZB 3BKFA 1HBMA 3JB9k 2BANB 3RRGA 1JJCB 3IWLA 4RO0A 2IA0A 3AD8C 4F26A 5LSRA 3LTOA 4NASA 1SPBP 3K2YA 3DM2B 3EM1A 4N41A 2HWHA 3MEDB 2IMOA 1CJUB 2HBYB 2COLA 4ATNA 4OI4A 5KFKA 5J2MA 1VLOA 4ZIWA 1OMSA 4FKXA 4J9RA 3BQ2A 1QJHA 4CLYA 3EDQB 4ZVEA 2GIQA 2EG2A 3KLIA 3OT9A 5LSOA 1I94F 3C6UB 5KG0A 1HFEL 2VD3A 1QLNA 4C8KA 1PCAA 3AKOB 4EGLA 2YNFB 1GXLA 2HRUA 2X1BA 1X0FA 2WONB 3TX8A 3RU0A 4KV8A 1IR2A 3M1VB 2IDLA 2C3MA 3MECA 2BACA 4NLTA 4ETZA 3MM6B 1O6XA 1OY6A 4YHHJ 2HG4A 1V3SA 2DPIA 4IFVB 4GC6A 5IC4B 3AAWB 4C4WA 4YY3F 3CCQS 3MR5A 2K7JA 3CCES 4RW4B 3SQGA 2K7KA 3W65A 4FN5A 3FDSA 2QEXS 3T9NA 3MEGA 1RHRB 1ACMB 4KHMA 3CMAS 1NK7A 5HLFA 1OSDA 1ELOA 5HJYA 4N7TA 5IZHA 2CPYA 5LJ5Y 3FMWA 4ZKAA 1FKOB 2VB6A 3H7HB 3NCRA 3BH7B 3W3SA 1SB6A 1RTIA 5D0RA 3EXCX 2IAJB 4KY3A 4DLEA 3V6JA 3BSCA 2FJVA 1U1KA 2HQ3A 5AXMA 3P3DA 2V69A 2CUYA 2MZQA 1WOSA 3K7RA 1D8ZA 1YHQS 4K2XA 4B9MA 3NG8A 2CPZA 1U7LA 3W5YA 2G13A 2CG8A 2LP4A 3G71S 4ECSA 1FDNA 1BQXA 1TKZA 4HHHA 5JXSA 2R8IA 2CQBA 2QLFB 4OZNA 4X65F 4N8NA 3JQKA 3KLFB 2QC3A 3CCVS 4DEZA 4NZ0A 2KFYA 4XDDA 3LP1A 1SC1B 5DG8A 3RRKA 4IRDA 1U1OA 3TWZA 3JQMA 5E3PA 3H5UA 1HHQA 3K8VA 2HQCA 1JXEA 3G82B 2HAIA 3TO8A 2DGWA 3SV4A 2HIQA 3PV8A 4MAKA 3PR4A 4LFBF 2BEFA 3AJ2A 2CQGA 2FLNA 3OBIA 4DXLA 2OP5A 2AHOB 3L09A 4M5NA 4QJVA 2LQ9A 3TI0A 3D6MB 2YXLA 1DHMA 1RAEB 2MHNA 4EBDA 2DXFA 1JLEA 1NDPA 3J7AN 1T9WA 3TVZA 2FGCA 4FDFA 4WFAQ 3PG9A 5C42B 2VQFF 1FRMA 5LMNF 5KFAA 4USKA 4ER8A 5KFFA 1V5IB 1U26A 1WNEA 1MMLA 3FCVA 2IBKA 1HBOA 4B3OB 3UVJB 1FFWB 1FNXH 4WZQA 5C24A 5A2QU 3NGUA 1QUVA 3FJ2A 3TZWA 4IQMA 1RT5A 3WX4A 1S9FA 3EE3A 5IT9U 4ZA1A 1YLXA 3CO0P 3WQPA 3JTNA 4L3KA 3J81Y 5DG7A 1RBAA 5B0GA 1BQMB 2R9LA 3QIDA 3KK1B 2Y1JA 3V81A 1FESA 4NCAA 4RWWA 2DNZA 5L9NA 4ICLB 1J5EJ 3Q8RB 4LF4F 2QV6A 2FQQB 1SKWA 3MEKA 4A8XA 3R97A 4ZP7A 2WBMA 5MAOA 1U25A 2ZD1A 2DNRA 2BRLA 4NE9C 4BBYA 4NXNJ 2J7UA 3EGZA 1EB0A 4TY8A 2OJ3A 1VQLS 1S0OA 2YBVA 4K4TA 1Q8IA 3SBMA 4CCHA 2XLIA 1NHKL 3LH2S 2W2MP 2M88A 1ZZFA 4CNZA 3NL0A 2MKSA 4U6PA 4PUOB 1IKXA 1H3DA 2IM1A 2VG5B 2BKPA 3BV8A 3KNAA 3J7YU 3R1HA 1HBNA 4EYIB 3CCJS 3KHRA 3BR8A 2H5JB 2EPIA 1HWLA 2B4OA 2C3UA 4ZDNA 2FYXA 3SXLA 2XEXA 3FBFA 5CZXA 2RIJA 3MURP 2KKHA 2NR0A 3IBCB 4CLSA 1UVNA 2WVCA 2XZWA 3E2EA 2DT9A 1FDDA 1VQ7S 3UD4P 4ZCLA 3MEEA 2C3YA 2C22A 2AV5A 1FNOA 3A4TA 3H2VE 1H7WA 3AT1B 3D0HE 2JVMA 1U09A 2VOPA 4B9LA 4DV7F 3U7JA 2QA2A 2PMZD 4AXJA 1N32F 2OHDA 1RXOB 1WF1A 2R7VA 1VBXA 2WB1D 1C4AA 4JYAF 4C9DA 1RT3B 2FVPA 2ZUGA 1PGZA 4DPWA 1S1VA 2YKOA 2KRBA 4JI0J 2WVBA 4DR2J 2ZVIA 4CI0B 4YMEA 3MFIA 3WZ0A 3H5SA 1A6LA 1NJYA 2DITA 3MMBA 4DV4F 1ZAWA 3V6KA 1C4CA 1I6JA 1MWQA 2NSCA 3CCUS 5I4MA 1F2HA 4JOUA 3VAFA 1NKBA 4F04B 1N52B 2QL5B 5J2PB 1WWHA 4ENOA 4C3MA 4NPOA 1TL7A 2ZBCA 4LF8F 3CGIA 3RB6A 2R8GA 2ASJA 4F25A 2MJNA 4OZLA 2P8IA 1UAWA 3JSYA 1F9HA 4D3HA 4HDHA 3M2RA 1N5YA 1X9MA 3GFYA 4W92B 4A48A 4RW7B 1GX6A 2FIUA 3RGIA 4GVBB 2WCXA 2MXYA 1N8RT 3QQCD 1K44A 2GHPA 3DXSX 4URQU 2QLWA 3FZBA 3CWJA 5ETVA 2F40A 1WKKA 2DGUA 2LEPA 3SSRA 2DBBA 3P8BB 3ETMA 5FIIA 4K7QA 2LECA 2AGQA 4FZVA 2QFIA 3QATA 4QPTA 1JLCB 1KP6A 3UR3C 3U27A 4A8QA 3M6XA 2IPOB 1S79A 4CT9A 4MK9A 1QSLA 2ZOFA 4I68A 3BF4A 3CW2C 3WC0A 4GKKJ 1D9AA 3HXMA 2KHDA 1N5QA 1IBLF 1UVMA 2P9GA 2HFOA 2R8JA 2YX4A 3I0SA 2ZH3A 5D6GA 1B99A 3GJTB 4DPXA 1LOUA 4JI8J 5L8RC 5GADI 4R5PB 4ZPVR 5HK4A 2XO6A 1KTVA 4Q7AA 1T02A 3I0RB 5KOXA 1ZTTA 4NLXA 3QAEA 3DLEA 3MMAA 1HPZB 2LYVA 2HHHJ 1OY9A 1QE1B 2ZC4A 3HVTB 2KM8B 2RKIA 4FF3A 3KLGB 1RA7A 2HZAA 2W4PA 4WF9Q 2J0XA 2XYGB 4MKVA 2J8AA 2Q1LA 3F41A 3ILLA 1RJJA 2XSJB 3OHAA 4GKJJ 3SSQA 3MFHA 1B7FA 3FSYA 1YZ6A 5FDLA 4Y65A 3VTIA 2N7YA 1UEUA 1FJGF 4WK3A 3CJ0A 4ANCA 2XMKA 4ILLA 1VC5A 2AEFA 3EICA 1QUPA 2G4BA 1GAOA 3CULA 2J5AA 3I9ZA 2HZCA 2DNPA 4CO3A 3FFIB 2CPEA 1S9EA 1ICEB 1U48A 2DNMA 4DV2J 2WHOA 2I5JA 2LXIA 1YBAA 3NMAA 4LIWA 1RBOB 3W2WA 3V4IB 3J81U 1CJTB 1HQEA 2W9BB 1GMUA 2H65B 4QWBA 4ZS6A 2R7RA 4JI6F 2DTJA 4LFAJ 4CNYA 1JJ4A 1YJTA 3RBDA 1RHMB 1IXKA 4G1QB 4IR9A 1RLCL 3M32A 5CYJA 3T3FA 1SUQB 2CQ0A 3PY8A 1RTJA 2H54B 4URSA 3N4WA 3LWLA 3KOAA 4RUHA 3GV7B 4UY8T 1SJ1A 1Q81T 4ED8A 2YPZA 5LMUF 1YJWS 1W25A 4LREA 1CSJA 3CCMS 4B3TJ 1A0OB 1V5VA 1KDNA 2CVEA 4MMOA 5KFNA 1BC6A 2UXDF 4DR5F 3BREA 2FD2A 1T9TA 1GMVA 2ZHOA 4DR4F 2UUAF 2LVWA 1VI7A 1UWAA 4OX6A 3OL6A 1JKHB 3OHBA 2HHQA 1NK4A 3I9V9 1S4EA 2JH3A 2XG8A 2WBRA 1JLFB 1UVLA 4UOFA 4NLUA 3OVSA 4UOCA 1AW0A 3G6VA 1RT6B 3OPKA 5DQHA 4KSEB 3EX7B 2XGPA 2V8PA 2D1CA 5FD1A 4DR6J 3IBWA 3N79A 2DHGA 1SCJB 3MAQA 4WFZA 2D69A 1EIYB 4WE1A 2KB2A 4DV0F 3OTOF 1S12A 1WEXA 2A2DA 4PG4A 2D74B 2ZH1A 4QWEA 1IJFB 4QIGA 1VIOA 5F8GA 3CT9A 1EETA 2HLUA 2R3VA 1TL4A 2C3OA 2V8GA 3SZ2A 3QO9B 4P7VA 4ZCIA 4LIRA 4DG1A 4M5JA 1LWCB 3IBFB 3A1YG 2IJNA 1FVSA 2KJVA 1QM9A 2XTJP 3F0NA 1TKXA 1T9VA 2HSEB 3DGPA 4DZDA 1RU2A 6FDRA 5DLFA 1EHWA 5L39A 3T6BA 4Z7CA 4DR1F 4DCJB 3DRRA 5HMXA 3G8SA 3BGOP 3MOJB 4R0EA 4CO1A 3KYLA 4Y0FA 3C46A 2NLWA 1IBKF 3NY0A 2IVFB 2YNHB 3D1QA 1C2PA 4LF6J 5A8RB 3DLLQ 3CSKA 4NYZA 3BZQA 2MQ8A 3M2UB 3OJUA 3HF5A 3B4DA 2FJXA 1U6ZA 3RYLA 1NNDA 4AQYF 1KD1T 3S1TA 3T41A 4KFBB 1D1UA 1RT7B 4DS4A 1GQEA 3OQ2A 2MMYA 1TUGB 3W5XA 2AYBA 2QLDA 1VK3A 2AWZA 4MT1A 2BDPA 4LT6A 2ASYA 3R5JB 2OTJS 2ZZNA 4LF9J 1RHQB 3T9ZA 1PAUB 1T9YA 4CP5A 2H4YB 5HI7A 4K4VA 5D4PA 2XNQA 3ZZZA 4LSNA 4ZJLA 3HMJG 2JRRA 4NRTA 1U47A 1HD1A 4QW9A 2OPRA 2FJAB 5KFHA 1S7IA 3MGJA 3C6TB 3ISZA 1TFYA 4YB6A 3J7ZT 2VJVA 1R7IA 3I55S 1FRKA 3PVXA 3GZ7A 2JLEA 5H9EK 2M8HA 4O3QA 3CVKA 3K17A 3D3BJ 1WC1A 1VDHA 1CULB 3BH6B 2GO8A 3CIMA 1EZZB 3CDBA 4DWIA 2UXBF 1UZHA 1NU4A 5CYQB 2V4QA 3O44A 5F8IA 2E1AA 2F8MA 3JYTB 3LALA 1JXVA 2Q3PA 3RW6A 4B3SJ 3J80Y 2YKMB 1RP5A 4AXIA 4Q2MA 2LKZA 1U6FA 4WCEQ 3D6FB 3MMCA 2HNYA 3M9OB 3KKFA 3RB0A 4FYDA 4PZVA 2YTCA 4NXMF 2DR7A 2EK6A 3MM9B 1KWMA 3CIZA 5L38A 5DDOC 4J9OA 1HMVA 1S1TB 4JI3F 3DXBA 1KQFB 4DR7J 4EEYA 1D0EA 2GGPB 3VR1A 1R0BG 2RNEA 4ZJQA 2E9RX 4RL1A 4ZHRB 1T3OA 4HTIA 3OL9A 1R8HA 2VBWA 3HZEA 4OV6A 4ECTA 4USMA 1WC6A 4NI2B 2XMUA 1E6YA 2WW8A 2K8GA 3CD0A 1FHTA 1VIXA 3IP0A 1FTCA 2R8HA 4A8FA 1UVKA 1VRTA 3TA0A 1HW8A 4LRFA 5KFJA 4DV5J 4ECZA 2E5HA 1O5JA 3AQPA 4WTYA 2GVDA 4DQPA 2ZNYA 1VQ9S 4QZVB 3DN9A 4QWAA 3KJVA 2V50A 2MLZA 3SQOP 3AB2B 3HZGA 2HRTA 3QSIA 2RT3A 4X62F 2BJDA 2W2OP 3OUYA 3M9NB 5K8PA 4HHUA 3A8EA 3RR7A 4UY85 3SCIE 2CQ2A 1HKAA 3O2IA 2KM8C 1S0VA 4L74A 2F7VA 1O8BA 3M2VA 4LRDA 2Z0GA 1BQNA 3SCKE 3CF5Q 4KGVB 1UA0A 2LLZA 4PWUA 2KXNB 4R0JA 3H42A 1VQ4S 4EO6A 2ODXA 3DRXA 2ZM6F 1SQEA 4ZCMA 5KTQA 2V0NA 1NDCA 1RYSA 2M7SA 3W62A 4KB7A 3UNGC 4QIEA 1NCLA 2DR5A 3M8RA 3FUYA 4P6QA 2QLXA 1TL3B 2P9CA 2R7TA 5I3QA 3FEXB 3DLKB 3C14A 3H4DA 4OYBA 3S8SA 3C15A 4C8LA 2MLXA 1RISA 4ID5A 4RBVA 2JC1A 4U96A 2FJDB 2UUCF 1SV5A 4TQSA 2K1RB 3U1LA 3T1YF 2CFXA 5LJ3Y 4I64A 5EGYA 1C0UA 3MPDA 3UFCX 1OYDA 4HT5A 4C6AA 3V2UC 3WDOA 4KYZA 4RPFA 4GO5X 2RMLA 3AA9A 3M8SA 1S48A 3HVAA 1RTHB 2H5IB 1F9FA 4KHPF 3PACA 3VAIA 1S9GA 1C3GA 3S7RA 3NP5A 1FNMA 1VISA 2OPSA 1H38A 4X84A 5KG1A 1DZ5A 1JWWA 5FLXY 1H2UX 3BGRA 3PJXA 3MHYA 1JLGA 2G0CA 2VC1A 4OX9J 2N82B 2PMHA 4ED7A 2EKYA 4PG5A 2IRXA 3EJMA 3NBPB 4OJ1A 2KVQE 1U2RA 5KT7A 2J0WA 2G1DA 4DL4A 1PJ6A 2V2QA 1RAFB 1B70B 2RE1A 3I31A 1X31C 2OD4A 2PMWA 2VFTA 1YRTA 2GVZB 5DM7Q 2KU7A 2VL1A 3H8YA 2F9JA 3FVYA 2HHPA 3O3LA 5B0DA 3R2CJ 3KXDA 2BVZA 1FERA 4S0MA 2GFFA 1R8BA 5HROA 5BJRA 1NSKL 3PW7A 4F02A 2DY9A 4TLQA 3LPYA 2XS7A 2W7AA 2N4DA 1L5UA 1F5CA 2AP6A 1HI0P 5G0RB 4FYVB 2XMTA 5IC6B 1NRKA 2M70A 1EX8A 1S72S 2CXEA 3KJNB 1KNZA 3GYGA 4M5GA 4XIUA 3TP2A 2AGOA 2JFDA 1W2IA 2DJWA 3J7Z5 1OSCA 8RUCA 2AGPA 1LW2B 4NZ6A 2U1AA 1TKTA 2LMIA 1XR6A 3V5RA 1ZZNA 4LF7J 4LFCF 4CLWA 3RAMA 2GMJA 4USWA 1GH8A 4DL7A 4AT1B 1DTTB 2R7XA 1EP4B 1RT2A 4LSLA 2CJKA 1N36J 1VQ5S 5D8HB 1HR0J 2DB1A 2PE8A 4RWXA 2DPJA 2MKJA 3J80U 1LK5A 2E5JA 3DOLA 2OELA 3K0JA 1WF2A 3WIVA 1KR4A 2CPFA 1TR0A 5HAOA 2XMVA 4DFMA 3IS9B 3NGDA 1N6QA 4DSJA 4WTOB 3F56A 4OYWA 4PR6A 2PEBA 4LF5J 1QVFR 2DCLA 3HHDA 1EJ7L 3VAMA 4J9KA 1HNZJ 1NJIT 2HVEA 2YKNA 1RE1B 2DRBA 4QIVA 2CAJA 3TJAA 3QJPA 5KFZA 3MAAA 2MZRA 2AZ1A 3EVWA 5DM6Q 3BGLA 4D3GA 1RK8A 1WC4A 4H4MB 2C2EA 1WTFA 5K5MA 4P9SA 4K50A 1IN0A 2RU9A 3ENAA 2YWKA 3G2XA 1XQIA 3THVA 1WI6A 2GZOA 1FK9A 3RR8A 2VONA 1KHWA 1SL0A 5A0YA 1FO1A 2MHEA 2NPIA 3RW7A 3VVUA 3V6DB 4I56A 5B09A 4NCBA 1Q86T 4JV2A 4DV6F 1Q7LB 4LJMA 3OSNA 3OXLA 3I5CA 4NX9A 1B0VA 5DDPC 3QAUA 1S6OA 2Y8WA 2RD5C 3WHIA 4DDFA 2BANA 4NRUA 4CLPA 1FWLA 1M5HA 2FJWA 3PDNA 2DNOA 4DL6A 5M2UA 1WTBA 4QR2A 4JI5J 3HHLC 3DM2A 1FXLA 4OJ3A 2FPHX 5EWFA 2ZJPQ 1X9SA 3MEDA 1CJUA 3M8YA 4OZ3A 1WKLA 1TV6A 2ZOMA 2YNGA 4RJVA 3IMQJ 4LUBA 3QT8A 5HVHA 2FY8A 4OFZA 3TUJC 1X8DA 4F3OA 4DMZA 5F8MA 5A8KB 2DNKA 1XN9A 4OJGA 2PFDA 2HFUA 5D4LA 4WPAA 1UPMB 2SXLA 4YEAA 3CE8A 2WAQD 2HYIB 2E66A 3C6UA 2XS5A 4GVLA 1WKJA 1UVJA 1JNZB 1Y7PA 1HA1A 1JQGA 3FCHA 2BX6A 3VZIA 2YNFA 3BGFA 1WUUA 3AHPA 1MSWD 3MCSA 4K0KJ 1PC5A 3RRHA 2GJFA 2MEWA 1R0AB 3DU5A 3FZ2A 1U6BA 1PIEA 2OMLA 4QYRA 1NPPA 4G1PA 3MF5A 3LUYA 2GNKA 3RBXA 4IG0B 4IFVA 6AT1B 2I38A 2ZHBA 4DSFA 2HHWA 2G0JA 2K3KA 3SEOA 1NJWA 5FJ4A 2VF3A 4WYLA 4G1IA 1DBDA 4RW4A 1GFWB 3D68A 3K59A 1IKWB 3R3TA 4PEOA 4X4VA 1BGXT 3CCRS 3IM9A 2DR9A 3CCTA 2G2YA 3R5CA 5C7PA 1I94J 4OI0A 3LGHA 3NGKA 4C0BA 1ULRA 2M5YA 4FS1A 1KQGB 4FYXB 3T1AA 3IO1A 1NHVA 5FLXU 3PIOQ 2OSQA 2QA4G 2HNDB 5KFDA 4Y2IA 1TP7A 2ZKTA 3KLFA 5HMZA 4Z7YA 2IRYA 1HNWF 3K5NA 1Y0HA 2A6MA 3M7VA 1NSAA 3HFVA 5F41A 4YY3J 4ZN1A 1RA6A 3SDEA 2FHOB 4F2RA 3I87A 2YY3A 2FUG9 1X4EA 2J9DE 2UVWA 1N34F 3R6GB 3ZZTA 4M94A 2QG9B 1N56A 3AOAA 3PEHA 4MTPA 4EYHB 2IBOA 1R8AA 1U2FA 3R5DA 1U24A 1FXDA 2BW2A 3G82A 4DL3A 1L3SA 4AL5A 3R7NB 2O01C 4EI2A 1ZAXA 2CNOB 3UCGA 4TXSA 5E3RA 1FFSB 4LRBA 4ZIVA 4M5HA 3BR9A 3SFGA 1I1GA 1PBUA 1Q79A 3EZ5A 4KGZB 4M5MA 1KRPA 4NZ7A 3E51A 3NOCA 4ED4A 4B08A 3HT0A 1GMWA 2DR8A 1JLBA 1WC3A 4X65J 4Y3CA 4CTAA 2RHQB 5GADU 2ZE2B 4CLZA 4B3OA 3UVJA 4Q0BB 2CPJA 3FRZA 1LWEA 3T6JA 3U1NA 2DGXA 5AT1B 5ETNA 1RKJA 2XI3A 1TVRB 1RBLA 2KRRA 3M8WA 4ED6A 3RB3A 5C2GA 1BQMA 4FBTA 2IVMA 2VBYA 3KK1A 4CO2A 1YBUA 4LFBJ 1K0TA 4ICLA 4NA1A 1XNQF 2HURA 1Y9OA 3VVTA 2NXCA 4Y2CA 1M1GA 2HQFA 2ATCB 1C1CA 3MR6A 2E44A 2KXHA 2BYCA 1NK9A 3BO2A 2HVZA 3R5BA 2VQFJ 5LMNJ 1VHFA 4RU2A 2B4PA 3ZTQA 5B08A 4KHRA 1MN9A 2AQ4A 1XMOF 2V34A 3FSIA 1JB0C 3GE9A 3ZFVA 3KWMA 2D3OR 4XTTA 5GAHI 2N3LA 4PUOA 1AT1B 3NEKA 2C2DA 2XYPB 3B54A 2VA2A 2B9YA 1WSRA 3MCNA 1U0HB 1R43A 2XY7A 1GXTA 1N5VA 1RACB 4IOAQ 3CUNA 5F8HA 4NMXA 1U8SA 3FEYB 4ANDA 3K5LA 1HNIB 3GMGA 4LF4J 3L4BC 3BSOA 3LZ8A 4B9UA 1KFSA 1QY7A 3QGIA 2UVVA 2ABYA 2ZH6A 5AE3A 4IO1A 4P75A 1SXLA 1NH8A 4LR7A 1PYSB 3OFGA 4EMDA 2F3JA 4NLWA 5B7WA 1LXJA 4RW8A 2AX1A 1RT3A 1PKUA 4QIWD 3UD3P 4F36A 4NWBA 1X9WA 1T9XA 2ZC3A 3MWBA 4A8OA 3D6HB 2MZTA 1RAHB 5J1PA 3QFWA 1ZM3A 4I6AA 3GYNA 3PRBA 3W66A 4MFBB 3FQKA 3CC4S 5D0EA 2YNIB 1K8AT 5J2PA 3G6XA 5J2MB 5U47A 2FVCA 2RB7A 2WZ1A 1RCOB 4XO0A 1UWBB 1S0MA 3NAIA 3IRXA 5CXTA 4UOGA 2UUBF 3KLIB 1WHVA 1X4GA 3AXMA 4DV7J 3UPFA 1IR0A 1N32J 4PAAA 4ECUA 3G8QA 5L1IA 4IG3B 2KT3A 3MPUB 4RW7A 4IH5A 4JYAJ 2CG4A 1DLOB 1CQMA 1W26A 5F8JA 4DQRA 3R2DJ 4DV4J 1OS5A 1T03B 3W60A 2OH2A 4N5SA 5D4NA 3QYYA 1XWLA 1UP1A 1M1KT 2E9ZA 2EG1A 2B9XA 1JLCA 4G6VB 5KG2A 3Q8SB 1S0NA 1G7CB 1S99A 5J1EA 2MQLA 4U8YA 4C48A 3TEHB 3KK3B 3SQGB 2LQ8A 2HVDA 2I9SA 4J90A 2HQIA 4LF8J 2RDIA 2HHXA 1PJ5A 2JVRA 4BLGA 4HR2A 3HD2A 2XWXA 4DX5A 3UO0A 3TZZA 3BO4A 3I4HX 5LM7E 1I5OB 1WSVA 1V3RA 1VQKS 3CJKB 3QMQA 3DYAA 4ZK7M 4R5PA 2W25A 2AX0A 3I0RA 1CBKA 3KMSA 4L72B 4C2MA 1FD8A 2ACMA 3NOGA 1HPZA 3POTB 1TKZB 2PD1A 2HVHA 2MKCA 4DFJA 1QE1A 4G65A 5KFTA 2R7OA 3HVTA 2R4FA 4J9LA 3KLGA 2RU3A 4J37A 3MR7A 4ED0A 3SCJE 2HFNA 5KG5A 4JI2F 2ZBQA 1YJRA 4RZRA 1NUEA 5J2QB 2JL9A 1S49A 1S6UA 4DUYF 3FC9A 3I56S 3C3LA 3N6LA 2W7PA 3TOQA 2X7IA 3PZPA 2NUUG 3X1LB 3OVAA 4K4ZA 3H40A 3MUVP 2H5EA 2CA9A 2D9OA 4B9NA 2ZFHA 4QYZJ 1TKDA 1IBLJ 4ZP9A 2J6UA 2EFGA 4FF1A 1VS3A 2BKOA 4A8YA 4KTQA 3HX9A 2A10A 3FFIA 1Z2ZA 1YJ9S 4OZ5A 1Q5YA 1BWVA 2QL9B 3THPA 2Q79A 4RNHA 5C5JA 1WC0A 1P27B 2RSQA 4WBFA 4L73A 3V4IA 4DU8A 1CJTA 1K9MT 1RT4A 2W9BA 5HSPA 3KLHB 2FC8A 4CQ1A 2EBGA 1LV5A 3JXOA 3FCWA 1VQSA 4G1QA 4DQQA 3SSSA 1RWOB 3GJSB 1N0UA 4OI1A 5C24B 1YGYA 3GIKA 2UV8G 1TUWA 1UVIA 3G4SS 2R2RA 3GJQB 1DTQA 2QYCA 2VODA 3OL8A 3PYFA 1FJGJ 1SJ3P 3AOBA 2CJYB 2JEFA 4ZPBA 1KHVA 2BV3A 1Q82T 3IAS9 2Q2GA 1VMBA 3LA0A 1X0PA 2C2NA 3J81j 2AYGA 5GMDA 3W9JA 1JMTA 3P5BP 2EFPA 1PYTA 1HNXF 2FHJD 2C42A 2HFZA 3G8TA 3TAQA 1MROB 1JKHA 2MZJA 5L1JA 3W8PA 4Z2XA 3PRVA 2HEKA 1JLFA 3GLJA 4JI6J 2EEYA 4IR1A 4CIOA 4EZ9A 4TY8B 4WFYA 4CLUA 5J1NA 1RTZA 1NEEA 4O44B 1UW9A 2OUGA 5HMYA 1HWUA 1F0XA 1C0TB 5LMUJ 2O5DA 4X66F 2NREA 5EN1A 2Q66A 2ZZTA 3ENVA 5DETA 3OXFA 3C5XC 3R9LA 2FLLA 2UXDJ 4DR5J 2JVOA 3CD6S 2XY5A 2CADA 3QZ7A 2HBQB 4V1Ak 5KFIA 4DR4J 2UUAJ 3QO9A 1IR1A 4J5OA 4OLPA 2K06A 4K4WA 2KN4A 4TYBA 2ZVSA 1BE4A 3ZO7A 2QMWA 2EBEA 3MM7B 4CYUB 3KMQA 5E33A 3PYGA 3CMQA 2B9WA 3Q22A 2E7XA 2V8VA 5K14A 1D09B 3Q83A 5IT9Y 3FNNA 3P45B 2DEJA 1S6QA 2LQJA 3OR2A 3HHKA 5IV4A 2OFHX 2HHSA 4OHYA 2YNHA 2VIHA 1FD2A 2CIMA 2V2KA 4NLDA 1C1BB 2W2QP 5E3QA 3HHLD 1KKHA 5A8RA 5CA5A 4DV0J 3BDEA 3OTOJ 3D5MA 2AD9A 5GMKa 5I42B 2XCPA 4Q5VA 2JWNA 4U8VA 1F3FA 5IT4A 2MQPA 2JLFA 3IWNC 4KFBA 4XK8C 2BBEA 4DS5A 2PI4A 3KJQB 1WEZA 3Q8UA 1YWXA 2QRRA 4CLFA 3GIRA 2RVJA 2YH1A 3FMBA 1F3VA 4ECYA 2AJQA 4DR1J 1Q4RA 2PIIA 2R7WA 5F8LA 3BKUA 4UF4A 2UU9F 1LXNA 1IBKJ 3R5AA 8AT1B 4GC7A 1M5OC 5HP1A 3C6TA 1Q7YT 3AY0A 1RWMB 3TANA 4QW8A 1IKVB 2J8SA 3W8GA 3PFOA 5KFPA 1HYSB 3TAPA 2YWHA 1JK9B 3GU0A 5IT0A 4M1KA 4FYYB 2UXCF 3M30A 4W90B 4AQYJ 2LU2A 1CULA 1K1SA 2VG6B 2HVIA 3U1MA 1JJHA 2CJBA 1MWYA 3R27A 4ED3A 2X51A 3F73A 4OZ0A 5DDRC 3GV8B 4ZP6A 4YN3B 3JYTA 4WXOA 2PI5A 4H54A 3HPOA 2BZ2A 3QSYB 5DO2A 3Q2TC 1P1TA 4CO0A 1UJ4A 2HMIB 1RWUA 1FJEB 4B9SA 3GJRB 4OHXA 5K8MA 3KDNA 3W9IA 4AYBD 4JI4F 4X4SA 2MZ1A 1KSPA 4P73A 1M1HA 2LFVA 2XNRA 4FXVA 5HQ8A 3E3XA 2FDNA 2QN6B 4YB1P 4JP8A 4EK2A 3MM9A 1URNA 2GAGC 2AW0A 1HWIA 2C2ZB 4Q43A 1IQZA 4O4GB 3HFZB 3BBCA 2F5GA 2ZJQQ 1WG5A 3JSRA 4FP9A 1LWFB 1U1NA 4Y2AA 3CJRA 1BHNA 3MCMA 4ZHRA 3FEZA 2ZITA 4NI2A 2UXBJ 3EGNA 4NMLA 2VU5A 5A76A 2WSCC 3CJ2A 2LDIA 2KG0A 2F1FA 3CXCR 2ZH9A 3FRYA 2ATLA 1RWWB 1REVB 2LA6A 3C16B 2VH7A 8ATCB 5KT5A 4CDIA 3SIPB 2MY7A 3N9UC 2IIHA 1GX5A 1RYRA 4WK1A 3EGVA 4M95A 2XYHB 1GMWD 3CO9A 4CLTA 2YX7A 4NXMJ 4XDCA 2QO3A 3EVOA 1HQEB 4C8ZA 4IH6A 4ZOSA 1WDDA 2RRAA 4JI3J 2OPQA 2BQ3A 4J9MA 3TZXA 4CM2A 1HIYA 2D3ZA 1R8PA 2OGUA 4KC5A 2K2PA 1RTJB 1TTHB 4RBUA 3UW1A 1WOPA 1SL2A 4F0KA 2GAHC 3Q8PB 1AUSL 4I2QB 2BE7D 3K5MA 2C2OB 1NB7A 1D9DA 1B7YB 4O0NA 1P6TA 2QT7A 2NZCA 1HWJA 5G4DA 1BUXA 3LO3A 1TU0B 1S77D 4I7FB 3UDEA 3N0VA 2LXUA 1TL3A 5H1SV 4ETXA 4X62J 2A1BA 2BOPA 2GHVC 4ZJOA 2CQPA 3DLKA 1S10A 4RW6B 4PXCA 5IV3A 1N33F 5AXLA 4NOHA 3KUHA 1HI8A 2ZNZA 5C25B 5GAGI 5E7OB 2B4VA 3RTVA 2GJ2A 4H4KA 3LF0A 1U1MA 3JSMA 1NHUA 2GMHA 4F50A 1V6HA 4WE1B 2HPUA 2DEIA 1TUVA 2AJFE 2WOMA 2W8KA 1FEHA 4K4UA 5ETKA 5HJXA 1T94A 3KG0A 2OMOA 4HH0A 4IH7A 2VBXA 2ZM6J 3IFEA 3OR1A 3B78A 1HNVA 1EETB 1R27B 2BKNA 1RAJA 1RTHA 1BXNA 5L1KA 4X4RA 2V68A 3VAHA 2R42A 2ZH8A 2E9TA 2C2KB 1Q78A 5KFLA 4ED2A 5CHCB 2V4JB 3OL7A 1QSSA 1FRIA 3GFXA 3LP0B 4L6V3 3D67A 5KFQA 3CDEA 1XIQA 5BYRA 2CNLB 5KFWA 3LANA 4PKDB 1DFDA 1TL1A 5E41A 2YX1A 4C0HA 2B6AB 1WG4A 2UUCJ 2J0QD 1XJWB 3MPVA 2WVEA 3T1YJ 4F3QA 5T14A 2D41A 3RJMB 1K0VA 1J27A 2DNLA 3EZUA 3KJFB 4PXBA 4MYTA 4HT7A 2GVZA 4MKAA 1VR6A 2F63A 4LVNP 4WFNQ 4A8SA 3SYZA 2VBZA 4USVA 3Q8QB 4ZLLA 2ZDOA 3HSJA 3CC2S 4NCGB 1NK5A 2R8KA 2YWWA 4GRSA 3NRBA 1EAYC 3HI9A 4KHPJ 2FVRA 5MLCV 2H51B 3D0GE 3R1LA 2UVRA 3QLHA 4RLEA 3TA2A 3MM8B 1U1RA 3CTRA 3GIJA 3IN5A 3CD7A 5KAKA 2ZJRQ 4C11A 1M5VC 4ZPWR 3W64A 4USUA 3I5AA 1X4BA 1FCAA 5BR8F 3RAXA 1DTTA 4C8OA 1EP4A 3PJ9A 3OXGA 2XB2D 1YQHA 4PG8A 3KG4A 4X2BA 3L7PA 4PPDA 1SJFA 1H74A 3RB4A 3T5LA 2IC3A 2HHVA 4TU9A 3IS9A 1IUJA 1X4AA 1KLNA 3QGPA 4WP3A 3ENWA 1AZSA 4R8UB 4YQWA 4HLBA 2DRDA 4HACB 4F4WA 4ED1A 4KGMA 2ZOGA 1RAGB 1LEOA 2M52A 2MSTA 3VGUA 4U7UD 2DXDA 1Z4UA 4OI6A 2EWHA 1XMQF 4LFCJ 4H4MA 4RUBA 4OYAA 3NAHA 4M5IA 3CDWA 4O0IA 1CC7A 4WWSA 5H9FK 1SKSA 4MYUA 4WYWA 4ZLJA 5KFEA 2V9KA 1PC4A 2MPUA 4ECQA 3BN4A 1RABB 4M5DB 1HMVB 3OV7A 2VFUA 3DKDA 1HHTP 4DV1F 2U2FA 3KLEA 1R31A 2Q6CA 3M8ZA 2MY8A 3ZXWA 3ZZ0A 4QQBA 2VV5A 1S57A 2PC6A 2LA4A 2FGOA 1YJ7A 1SKUB 4UUWA 4EWTA 5K9FA 5DLGA 3VWSA 2OFGX 5CABA 2CPXA 2OO4A 5GAEI 3M8PA 3H20A 4RX6A 1H0HB 1ZM2A 2JLGA 1S6PB 4PRFA 1VRQC 2G9OA 1RWKB 1GTHA 2MJUA 2EFNA 2LDYA 3LP2B 3SMZA 5DRKA 5A8WB 2PA8D 2KHCA 5HANA 4YS2A 2XLKA 4ID8A 3KJVB 3ULHA 2E1MC 3W63A 5GAHU 4OYXA 5E3AA 3BBBA 1IBMF 1Q8KA 1JJ2R 3QT7A 3M05A 7FD1A 2W7OA 1S1UA 4LBHA 3D6TB 5A8KA 3OUYB 1UL3A 2ERRA 3DOMB 2DIUA 3I6PA 4TLRA 3W2VA 2H4WB 2E1RA 4Y2MA 4IFYB 2YWGA 3RBEA 4J7CA 4DV6J 2J9CA 4JB8B 2CQDA 3W1YC 1U1QA 2CZ4A 3E01B 3NNAA 4LBPA 3SI8A 4XPEA 3GP9A 1NH7A 4Y28C 1R0AA 3PCOB 4OZJA 2MKHA 2FVSA 3IG1A 5EX3A 1CVJA 1X4CA 1HQUB 1WJ9A 3W7BA 2HGLA 1FE4A 4PYAA 2ZH7A 3GCXP 2ZZMA 3B6BA 4IKAA 4IOBA 3KK2A 3TW0A 1MMNA 3GFZA 1IKWA 2VUGA 1VK8A 2FLOA 4WP9A 3ENQA 1ZBTA 3FGVA 2E1PA 5IFMA 3T5JA 4JUZA 3C15B 4DBQA 5ETRA 7AT1B 1IQTA 2D3UA 2O67A 3HKWA 4H4OA 1TELA 1PILA 2OSRA 2CPDA 3H5XA 2HHUA 1BY9A 1IWGA 5HBMB 2DH7A 1ZH5A 4I67A 1RU1A 1EKSA 3ZNJ1 3QJLA 4O3RA 1FJCA 4AD6A 3OTBA 4IDKA 2A6OA 3UDCA 3V6HA 2AIRB 1CJVB 2B56A 4LF2A 1SI9A 2LXFA 3I5BA 3H90A 5DQIA 3HFKA 2EI5A 2PA3A 3DRSB 1S9GB 2KT5A 2APOA 1VHIA 1FTRA 1O0PA 2OPSB 3GR0A 4MKBA 4YR0A 2GS8A 1RI7A 4OZ2A 3MZIA 4IYQA 4DV3F 5EDWA 3Q0AA 3BGRB 3GPAA 2HQDA 2YVSA 2N4CA 4DU7A 1LQ9A 4C3KA 2RH3A 1WHWA 1FKPB 1D3WA 3R7SB 4I2PB 2ZBRA 3QT6A 4EFAC 3FKBA 3ZC4A 3T1HF 2UVUA 3TRGA 4JI7F 1S7HA 3ICLA 1VBZA 2VFVA 4FVCA 1ITPA 1JLAB 2NXJA 2FJEB 1VJQA 4P71A 2IJRA 1T05B 1OPIA 4ES3A 1J2VA 3HSZA 5E5NA 4ZVPB 4P72A 2VPXB 1HNWJ 2ZE2A 2CJAA 1SJ4P 5K8NA 1N5TA 1HBUB 2CQ3A 1U02A 2LQ5A 4OMFG 1WOOA 3DOKA 3MR3A 1N34J 4DL2A 4CH0S 1TVRA 2DGVA 3IXQA 2XI2A 2WVFA 1LFWA 2RQ4A 2VQEF 3HM9A 1T11A 2GO9A 1AROP 3K57A 4TYAA 4USJC 1YRUA 5ETQA 2E5LF 5CCMA 2DO4A 1VQMS 2DVIA 5D3GB 2CJ9A 1RTDA 2CNNB 3O1LA 2MQOA 2KH9A 3N5BA 3C66A 2DNGA 5KOWA 4DQSA 3D54A 4LSLB 4V19J 5ETSA 3CCZA 3GTYX 4RKUC 1O51A 4F67A 1IVZA 2KO1A 3ZTSA 3NKYA 4U7CA 3DHXA 1U1LA 3ZZOA 3GILA 2OPPA 4FVMA 2GMLA 2KXFA 5KFRA 5L1LA 1Q95G 2OEKA 4GO7X 2Y3YA 3S6EA 3MI7X 4ZITA 4Y34A 2QMXA 3CJSA 4O3SA 1CC8A 1U0HA 1F5AA 3MAAB 3ITHB 2HBZB 2DNNA 3BQ0A 2LQBA 2XMMA 1XNQJ 4QR0A 1U0SA 5I3PA 4WP8A 3HVRA 2W2NP 3PX6A 5A0YB 3GCWP 3DMJB 1XTZA 3N28A 2AEMA 3HJFA 3NGTA 5B0CA 3PKMA 5L46A 3MXHP 2M4MA 4K4SA 1XMOJ 3BGUA 1H6KX 5D4OA 4Q8EA 1OQ3A 2QSWA 3FBBA 2QLJB 1RT1A 4C7QA 4LRCA 3OVBA 4DOZA 1PJ7A 2E7WA 1VOMA 1RDRA 5KFBA 1Y5NB 3CJ3A 3I38A 4F0HA 2VPYB 1ZAVA 3PRDA 3HHLB 3K5OA 1YI2S 2VC0A 3PNIA 1FF2A 2Z2MA 2P6TA 4MFBA 3HSGA 2EW9A 1F9EB 1TV6B 4YB5A 5KG3A 2YNIA 2YNGB 3A3NB 4YDDB 3UN5A 2RQCA 2JDJA 2IY5B 2VPZB 4B9TA 2PDAA 2B8PA 1S1XB 1VFJA 4Q44A 1Q8BA 2KI2A 3BYPA 1UWBA 2HGMA 4NLVA 4DSKA 1CS4B 2RS2A 2OTLS 2F4VF 4PQUB 3G9CA 4P10A 4CLLA 1VBKA 4L75A 3PX0A 2KJWA 1E6VB 3DDNA 5HVFA 4I6WA 4IG3A 3MD3A 2VDHA 1S4FA 4MJKA 1DLOA 5IQQA 2KT2A 1WELA 1SQGA 5T7LA 5E0OA 1JIHA 4UT4A 2AYEA 3IR6B 1T03A 2BE2B 2DO0A 5GVQA 3QPIA 2BRKA 2L41A 4R25A 3QBCA 2HAFA 3LQVA 5CQGA 2RAQA 5KT6A 2B26A 1ZA1B 3C8YA 3BBFA 3KK3A 3P5TL 3R6LB 5M2RA 4KQZA 2DGTA 2Z56B 4KAIA 3O5TB 2QA1A 1HL6A 3US5A 3H0PA 2UUBJ 3GIMA 4TN2A 4DR3F 2DKOB 4ZCKA 1Y3KA 3CJKA 4K8RA 4P74A 3AGXA 1S5ZA 3Q2SC 2MLYA 5CAAA 2AZ3A 2HS4A 4DFKA 2XWYA 1NK8A 3POTA 3TVYA 3Q8YA 3QT5A 4RUCA 1D9FA 5IWAF 5HL7Q 1YK9A 3PXGa 4NLSA 4FPIA 4IRCA 1U49A 5J2QA 1ZM9A 2DISA 3NLCA 1IBCB 3SDEB 1Q1KA 2MSSA 1CJKB 1NJZA 4X4NA 2NCKL 2ZEJA 2ASLA 1UZDA 2CYYA 3GB0A 5HATA 2HFSA 4N77A 3A8IA 4UQTA 3CDAA 5BYQA 3CCSS 3JS9A 2KYZA 4IO9Q 1KVIA 4X64F 5AJ3F 3GYXB 2ROPA 3HO1A 3HLUA 2L08A 2BE9B 5RUBA 2HWIA 2DHHA 4QR1A 3HP6A 4OZ1A 3A8JA 1IM4A 4NLGA 2C2MB 2Y0SD 2RDDA 3WC2A 3PEJA 2KG1A 1JLBB 5THWA 2HK3A 3QGHA 2ILZA 4CTAB 3TUIC 5H9FJ 2RUGA 3KLHA 1T8EA 4JI2J 2V8HA 4NL5A 1DARA 1BMQB 1SJRA 1D8YA 2GQQA 1GT8A 1WC5A 4DUYJ 2I8EA 1LWEB 2DGQA 3DCAA 1DQ9A 2CRLA 3D7SB 3MPYA 1XERA 1VQ6S 4CZCA 4NEZA 4RW9A 1BLUA 3AQOA 4MIWA 2CNKB 5E3CA 1SIZA 5LXYA 2E5GA 4ILRA 3UQSA 2UZAA 3TAMA 2R7QA 3CJ8A 4OX7A 5HO4A 3ET6B 1Q8LA 4ALZA 3KUEA 1Y4ZB 3QRPA 1XAOA 2XQCA 1LW0B 4DZ6A 2X3GA 1MROA 4ZVUB 1S1WB 1C1CB 1Q53A 2FJBB 4ES1A 5IS2A 4NYPA 4ECXA 2GQ2A 2C3PA 3MM5B 5SUHA 2A3JA 3NXZA 4YFUA 4PCQA 5EWGA 1FX4A 1LKZA 4QU7A 4O44A 3DLGA 4C8MA 1GEHA 1KOHA 4LSZB 4W98A 2Y8YA 3ZZYA 4WKYA 1X5TA 2VHGA 4IRKA 2LCWA 4I4BA 2ZH2A 4J9UE 3ELHA 4UW2A 4ZVGA 2QX0A 3H2UB 4W4MA 1TFWA 2EC0A 1C0TA 5D0HA 2Z2ZA 1UFKA 1U8WA 2MQQA 4I6YA 4J9QA 3IC1A 2R2TA 1EKRA 1VC6A 2AF6A 4OYIA 1HNXJ 2W2PP 2ROGA 2J0SD 2RJZA 2ZWPA 2JEGA 2BUNA 5EHHA 1UKUA 1U45A 3H25A 4QWCA 3MM7A 3BB5A 3BO3A 4CYUA 2VKZG 1URRA 2GCFA 1UEKA 5HQMA 2CJQA 3VGSA 3AJDA 1DAXA 4RW8B 4PWDB 4X4OA 2LU1A 5L9XA 2JJ4D 3W9HA 1A7GE 5LT5A 5ETMA 5J2NB 1SH2A 2V8DA 3UDLA 1CQNA 1C1BA 3ONQA 4DHVA 4FPRA 5ETPA 4J9PA 3PO5A 5B0FA 4LBIA 1VLYA 3TZYA 4X66J 2YWEA 5LL6d 5ETLA 3DU6A 5I42A 3AD9C 4OYPA 1FI4A 1WORA 5GAGU 1QD1A 3P6YC 1FRLA 4CH1A 4YDXA 4WU3A 1NSQA 1RHKB 1B3TA 4M5KA 1ZPWX 4JV5F 1EARA 4YP3A 3OTDA 2QYGA 4KKOB 3I96A 5IM0A 5I3UA 4WXWA 4FF4A 1WHYA 3IRXB 2CQ1A 4N8OA 5KFVA 4CM0A 5D78A 3TUZC 1JLQB 3JTPA 2JZ5A 3V4MA 1NO8A 2A0FB 3JQJA 1QSYA 2X1GA 1QAYA 5A6WA 3O8WA 3PO4A 1VRUB 2V4RA 1KLMB 1YSJA 4FYWB 5JUMA 1UW4A 4BC7A 1VQ8S 1HWKA 2L9NA 1IKYB 3AOCA 4DQIA 1MLAA 2VJUA 3EPIA 2ALZA 4WJBA 3WBZA 1IKVA 3EVMA 2ACYA 1UFWA 4LR8A 2W01A 3KTQA 1HYSA 3O6QA 5BYSA 2FZKB 1M0SA 1CG2A 2HNZA 1CLFA 1RZMA 2BJ3A 4P2XA 3DI6B 4K59A 5HVGA 2VG6A 5J1EB 4LQ3A 3DNCA 4DCPB 1F5BA 5LOQA 1SC4B 2JC0A 2O1PA 3HT3A 2CDRB 4B17A 3UR0A 4RUAA 2UP1A 2ZBPA 2HZVA 3KUGA 1NLTA 4A8KA 4EBCA 2W9CB 4B3RF 4HH1A 1FDAA 4U7UK 3D1HA 4O3NA 1G1XA 2HMIA 2R2UA 2FZGB 2GHWA 5BXIA 3DYAB 4X4PA 3UCUP 1FFGB 2UU9J 2JNJA 3R7BB 3QWUA 5LSLA 4ZVSB 5DQGA 3GR1A 2V6AA 1OY8A 4ZVFA 2ZH5A 5DG9A 5CCLA 4UZBA 4ZVRB 3H5YA 4NYOA 4B3MF 2WONA 4O4GA 2QSFA 2QLBB 1S76D 1LWFA 4BHQA 3M1VA 4BWMA 2UXCJ 3BDPA 4C98A 7FDRA 2OEJA 3MM6A 4L3NA 4JI1F 4TNOA 5KFGA 1KVKA 3QGGA 1SC3B 1N5SA 4AL6A 5IXUA 1NK0A 2HBRB 3GV5B 1REVA 4RNNA 3C16A 2RILA 1YJUA 4KBIA 5GMEA 3MPWA 1LK7A 1Y00A 4JI4J 1FKOA 3PIPQ 3NWRA 4V19X 5HQLA 4A46A 3H4BA 1FRHA 3PHEA 4AE5A 4DLGA 2IAJA 3ZTRA 4A8WA 4BWJA 5DDQC 1S97A 1RT4B 3GFHA 2YKAA 1ZETA 1YRXA 1YBTA 2AEJA 1H7XA 2V67A 3GQCA 4DUZF 1KQKA 3CNQP 1AYEA 1U2CA 2ZKUA 4E8UA 1RCXB 3OW2R 4FKYA 3P49B 3HD1A 1AB8A 1KOOA 1RADB 3EPGA 1DTQB 2IMWP 4HDGA 3CEDA 4UOHA 2YPYA 2OIHA 1RB0A 4I2QA 5DGAA 2XO7A 4I1TA 3HK2A 3SV3A 2F4FA 2I6WA 5H9EJ 4Q45A 2VZ9A 4B9VA 3VZHA 1UTAA 4J91A 4MIBA 3VF0B 2IA6A 2QZ8A 3G86A 2IHR1 1XMBA 3AGZA 2RHSB 4KIAA 3UD5A 3KG1A 2HK2A 2O3DA 1MWZA 3HCXA 5GAEU 5KG6A 3M8QB 4I7FA 4FXWA 2QIFA 1W7WA 5F9LA 3Q8VA 2KVIA 3DRPB 4NA2A 4U67Q 4ELUA 1P1LA 4RW6A 1TQLA 1MW7A 5C25A 3K58A 5C42A 3NS6A 5KG4A 3N5FA 4HI1A 2NSBA 4EZ6A 5B0EA 2VG7B 2B5JB 3D2WA 2Z2LA 4ECVA 3ZTOA 2M2BA 1YITS 2HWTA 1NMEB 3AFGA 4QCLA 3IA0A 1MN7A 3QIPB 5D0GA 1V9OA 3TYTA 3C19A 4RBTA 1NSPA 5IQ6A 2XHWA 1BWEA 3NWGA 2HLTA 1U1PA 2OLWA 2V4JA 4FNHA 1WDTA 3NMRA 5AXNA 3LP0A 3L7UA 4URGA 1N33J 5K14B 2PO4A 1J5OB 4EUVA 3K89A 1S6QB 3ILJA 2Q6BA 3OR2B 4QPXA 2B6AA 4KO0B 2F9DA 1ZM4A 3K5PA 2NQPA 4U95A 3PW2A 3DDIA 2AYMA 1XNRF 4Z37A 1KS2A 2YKPA 2CJXB 4LVOP 3RZAA 4DN9A 2VG5A 3EWGA 1QTNB 2FHMA 2CPIA 4NCGA 5KFCA 2HHTA 1VGYA 1M5KC 4ZN3A 4JBCA 1VQPS 2MQNA 1IWAA 2RF2B 1F60B 2NYHA 1VQNS 5CYMB 2MGZB 3MM8A 1WHXA 4OV1A 1EQ0A 5KFXA 4O4RA 1T95A 1PSDA 2RDJA 1FVQA 2R2SA 3WIUA 4QBUA 4LR9A 1XR7A 5HP1B 1B0PA 1SH0A 1UJ5A 1OQ6A 3BM7A 1MU2B 4P2MA 3EDRB 3MUMP 3LWMA 1KONA 1X5PA 2V5HG 4NLRA 1RSCA 1HBMB 5CZVA 2WSEC 3M30B 4IUFA 3I4PA 2NXUA 2P6SA 3T19A 2DIVA 4YHHF 4R8UA 2RRBA 4HACA 3BQ1A 2IM2A 1QAJA 2BM0A 4Y6IA 2GX8A 3M6UA 3UN3A 2QTWA 2R7SA 3ILIA 1U4BA 2IYIA 3LGMA 4ED5A 3DC2A 1M5PC 4B02A 2FY1A 5F0WA 3BEGB 2QFJA 3AGYA 3A3PB 1KTQA 2CQIA 5BR8J 4LQ9A 2FZCB 3D4JA 2W4CA 4DPTA 3VGTA 1UMJA 4L76A 4GVBA 2CZ9A 1NBEB 4ELVA 2J7WA 4M5DA 4KV8B 1V3ZA 5F9NA 4KGXB 1MMDA 3MECB 4EBEA 3OTEA 9RUBA 4USTA 2N7CA 3HULA 4ELTA 2A18A 1SBRA 3ADAC 3FBCA 1S6PA 1B0TA 1OYEA 2FLPA 1RAAB 3MEGB 4ITSA 3PX4A 1R8CA 3LP2A 3CCLS 5HLFB 2W4DA 1X7VA 5A8WA 2EKNA 2DR6A 2DGSA 1K1QA 1XMQJ 3OLAA 2AJ0A 4LF1A 2HIYA 2XMWA 3TA1A 1NDKA 1RTIB 1MG7A 2FVQA 4UTGA 2I0XA 5CH7B 2YKQA 4QWDA 3TARA 3C6EC 2OPQB 4DV1J 3DOMA 2JZ8A 2IFXA 4HTJA 1XK8A 3DLJA 4PPZA 1FJ7A 4FF2A 3R5GA 4DX6A 4AFFA 2NXNA 2IM0A 1WF0A 2RS8A 4IFYA 1FRXA 3HSDA 4LMZA 2VDIA 1VYAA 4BDPA 2PFFB 1Y10A 1CPZA 1LFPA 3E01A 4OX8A 4PG6A 2EC2A 4CH7A 3LP1B 4F8RA 4PQAA 2XGQA 5LXRA 4O3PA 3JAMY 3H2LA 2XSJA 2RRNA 2AT1B 2Y1RI 1KBRA 1HQUA 3VGVA 3L9ZA 3MOZA 4WIQA 2YQ0A 2B4UA 4NA3A 1TL5A 4PXDA 4J9VA 5KT4A 1FWPA 1IBMJ 2AJ4A 1CEZA 4TKTA 1J5EF 1S59A 1T9UA 2L9DA 3ZZPA 3CDUA 2V2VA 4I69A 2CPHA 5EWEA 2XHCA 2OD6A 4J80A 1WEYA 4O3OA 1JLEB 2NS1B 4A4JA 4A8MP 4MKYA 4TY9A 2HW3A 1VQYA 3JSMB 2MKIA 4NXNF 3DGVA 3QFHA 1B4SA 2IYGA 3EYZA 2V94A 5HBMA 1GNKA 2HGNA 1HBOB 2JEJA 1VQOS 2WOMB 1N48A 3NNHA 1SUQA 3OJSA 3QRQA 3E8OA 4CWBA 2G2ZA 3VAKA 1N0VC 1CJVA 4MIAA 1RT5B 4JV1A 1G4CA 3OR1B 1HNVB 3IAM9 4BS2A 4PXEA 3DRSA 1P9QC 1UA1A 3V81B 1RWXB 3J7A1 4OIXA 1WG1A 3KDOA 1JX4A 4N47A 3BS9A 2VICA 2DYAA 1FKPA 1NAQA 3I32A 2ZD1B 4C97A 3D28A 4I2PA 1TL1B 2CQHA 2EFVA 3A12A 4DUTA 1FXRA 3Q89A 1RT6A 2RQMA 1PO6A 2DH9A 4FS2A 4TU8A 2HQGA 3Q24A 5AXKA 2DNYA 1JLAA 4OI2A 4JI0F 1WD6A 3AB4B 4DR2F 1YVFA 1RWNB 2HRYA 2QL7B 3TR5A 1T05A 2P5VA 4N56A 3IR7B 1IKXB 4F4AA 4QU6A 2BJ9A 1HBNB 2BXJA 1HBUA 4XAKA 2MDAA 4C0OC 1H2VZ 1AXQA 4DV3J 3QLHB 4ZVOB 3JTOA 2EXUA 3PHTA 3MDFA 1RHUB 1LWCA 5KFUA 3TQ1A 3LGNA 3W61A 4C11B 3MEEB 3X3UA 2G0IA 3PM9A 2F8HA 4X4QA 5D3GA 3BSAA 1X5SA 1LNQA 2G2OA 3T1HJ 4JI7J 2ADBA 1YDLA 2RQKA 2A2CA 2FHJA 3D1OA 1S1VB 2P2CB 2BJ8A 2MKYA 2C1EB 4G3IA 1YKWA 2YQ3A 4DSLA 2HKEA 3PYEA 1OIAA 2DNQA 2IC3B 3MMBB 4ECRA 1N4LA 1FA0A 3LPEA 3M6WA 2F8EX 4QYZK 1AZSB 3M2UA 2EFOA 4Y2KA 4OYOA 4Y00A 2R7UA 2BQUA 1UPPA 2E5IA 4ZLNA 1L3TA 1T7PA 1EQMA 2FC9A 4BCAA 4OQJA 1SQFA 1QAXA 5F0UA 1RT7A 3S01A 2JHEA 5DJBA 1TL7B 2QE5A 3GSIA 2V9WA 2VQEJ 1OWXA 1HQ2A 3ITHA 4GKKF 2DY1A 2E5LJ 2BA9A 3LW5C 3RG6A 1G3OA 3UNYA 3PKYA 1Y3JA 3R8YA 2JRSA 1JXLA 3SCLE 3M2RB 1N5YB 3MTKA 4JI8F 4JV0A 3UI3A 3TQEA 2DGOA 2CKWA 1K47A 1VJWA 1TZ0A 2FHKA 3CJ5A 3DMJA 1AFJA 3KLEB 3VCDA 1REGX 4NEYA 3ETOA 2KTQA 2HHHF 2AJ2A 1RGVA 2JOQA 4GMKA 3NGRA 2BOAA 1G6BA 3AD7C 4DL5A 2Z57B 1UFLA 3M8PB 3N6MA 4NLQA 3TUPA 1NXIA 4PWWA 1NK6A 1SKRA 1X4FA 5M2PA 4CO5A 4GKJF 3HHLA 1QVGR 4LRAA 3QZ8A 1VC0A 5CYQA 2CWXA 1YJVA 3KHHA 1TK0A 4WKRA 1X60A 4XPCA 3PW4A 4DI6A 1FDBA 5DZ6A 2AU0A 2W9AA 3I0SB 2DCUB 2EK1A 4C8YA 2YKMA 5F8NA 1R6YA 3H59A 3HHNB 1R3NA 3TJ8A 1TK5A 1GTEA 3IR5B 2C28A 1HHSA 5EX0A 1TK8A 2W1BA 3LAMA 4DV2F 3GG0A 1S1XA 1S1UB 3WX8A 3JAMU 2Y0BB 2XBPA 3ISNC 3PFEA 2X3DA 1AUDA 4HL9A 3W2VB 3DLEB 5IOLA 3MMAB 2Z58B 1CS4A 1T0TV 4PQUA 3G6ES 4OHZA 2RKIB 3CJQA 1E6VA 3G87A 1S1TA 4HKQA 4LFAF 2WVDA 2HFVA 3MTJA 3Q86A 2NZ4A 3PJWA 2C2RA 2WK4A 2Z8QA 1SC6A 2GGPA 1KC8T 3CD5A 4OYZA 4F7VA 2B51A 3A13A 3IWXA 2M0GB 2CVIA 4ZPDA 1PBAA 3IG1B 2BE2A 5FDLB 9ATCB 1NDLA 3KFWX 3L95X 2H1YA 2IM3A 1RWVB 2NUHA 2Z30B 3PW0A 4PABA 4B3TF 3FK4A 1K73T 3CPWR 2WB4A 2B8QA 2YWFA 3KK2B 3LOUA 4PYDA 1HI1A 2GIFA 1R6VA 2H48B 1KN6A 4AL7A 2XLJA 1S9EB 4MH8A 1XR5A 3HDSA 2I5JB 1MNEA 1XBWA 2Y1IA 3GIIA 2Z2YB 2J6SA 4ZP8A 4YR2A 2F4VJ 4P2SA 1ROFA 3W2WB 1AFIA 2L48A 3VALA 2E29A 4H4OB 1HARA 2H9ZA 4WU2A 2XMAA 3IRWP 4X4TA 3J7YI 1YIJS 3DFEA 2POKA 5E2QA 2CQ4A 5A6PA 1SJQA 3M32B 4EU0A 3M9MB 3OSPA 2MZSA 4ZVHA 4DR6F 3ILOA 1ZTWA 4IDKB 1L3UA 5ITHA 1HLWA 5CD4H 2J6TA 4HHJA 4M5LA 1AA1B 4P2FA 2MB0B 3JSBA 2ZH4A 1DQ8A 4DX8H 2BABA 3W5ZA 3RBZA 1CJKA 4K4XA 4DJBA 4M63A 2OI2A 3D66A 2YH0A 3MR2A 3DDKA 3MMJA 4WZMA 1B64A 4DPUA 4F4YA 4N76A 1L3KA 2BJEA 3IGVA 4C8NA 3KLVA 2ILYA 2W8LA 3BPSP 3Q23A 5AE2A 1RHJB 2XZDB 3CJTA 1NB2A 5KT2A 4DR3J 4PG7A 3UWTA 3IGNA 5DZ7A 3D3CJ 2IJFA 2ADCA 2DHAA 2B7BB 4QOTA 1KFDA 1NJXA 4U9RA 1NM2A 4FBUA 1OO0B 3L3CA 4P52A 4OHWA 4H4KC 1VBYA 3A8KA 3ZZUA 1Q16B 2K1RA 3MCOA 2L3MA 3NCPA 1L3VA 5IWAJ 4LF6F 2B43A 2YQ1A 3TVKA 4K5SA 1TMMA 4A47A 3CMES 1FX2A 4KT0C 2GQCA 3DOKB 5KFMA 3NNCA 3C2PA 5JJBA 4YR3A 4K5RA 3EZOA 1NKCA 2D7SA 4DG1B 4HYKA 4FXDA 1TKXB 4KGKA 3DGPB 3EUNA 3PYDA 1Y5IB 2XULA 2Q43A 5AJ3J 4X64J 3EGWB 5JMNA 2BR0A 3KHGA 3OFEA 4LF9F 1RTDB 3UDVA 4KR0B 3HKZD 3DRRB 3ET6A 1PAEX 4BC9A 4Q8FA 5D77A 3P4UB 3NBPA 1LW0A 4YB7A 3ZNUA 2BQRA 1S1WA 3F44A 3OFFA 3B8HA 5DGBA 3EMTA 1T3NA 3NCQA 3BYRA 4DX7A 1HW9A 2OPPB 3MUTP 3MM5A 2XC9A 4KH1B 2N3OA 4IQXA 1RWPB 1R0CB 1H72C 3DLHA 2F65A 4J9SA 3SFUA 4ZMMA 2UUTA 2D9PA 5KG7A 1DQAA 1RAIB 2KL8A 5G0RA 2K3IA 1PYOB 2GW8A 1F2GA 3FQLA 2PT0A 3UN2A 3NS7B 4ZPCA 4B3SF 2VKRA 1UJ6A 1H73A 3QWPA 3DLBA 1LW2A 4LSNB 3ZTPA 4WIIA 1F6TA 2OPRB 1DY3A 2CWKA 4EO8A 2ZBIA 4MK7A 4HEA9 2XZTB 2EVZA 1SVDA 1ZYQA 3PTWA 1X4HA 2WRMA 4ES2A 3VQTA 4DF8A 2AMCB 2LEBA 4PWDA 4DR7F 5KFYA 1YTYA 2KYXA 1KEKA 1WACA 2NXEA 1FT8A 5J2NA 1RT1B 3GG1A 2HS3A 1RLDA 4DPYA 2UUWA 2GJIA 1I3OB 1SIWB 2PSZA 4CT8A 2JX2A 2FTRA 2QJ3A 6FD1A 1QDUB 1N88A 2MQMA 4E2FB 3THTA 4DV5F 3AJ1A 3OFHA 1HD0A 2XMJA 2KFNA 4F3MA 3D9BA 4KKOA 5K20B 3MMCB 3GSDA 1TAUA 2HNYB 4HVZA 2DHSA 2AKWB 3HHEA 4F0MA 2DH8A 1NZ8A 2MKKA 4USIA 1JLQA 4OL8A 3PR5B 1KQSR 1XC9A 1FE0A 3AODA 1VRUA 1KLMA 4O23A 2RUSA 1F1BB 1M90T 5T7LB 2GIRA 3V6DA 2XY6A 1NLKL 2KZMA 1IKYA 1IJEB 3BN7A 2DK2A 2LEAA 2L9WA 3KNGA 3M4XA 1E6YB 2DHXA 2VPWB 1Q0NA 2GV1A 3GONA 1RQ0A 2KFZA 2IVYA 4K4YA 2O66A 3B82A 4ECWA 2OKQA 3DI6A 1VRTB 4P7TA 4RNFA 1X4DA 4RU9A 3AA8A 2CZVC 4JV5J 4ZPAA 5C2CA 1R89A 2GVDB 4DN0A 4ZLPA 1A9NB 2IRUA 2E1CA 3EXYA 3BSNA 4HI2A 4KE5A 3N01A 3P96A 2DRAA 2B3TB 2EFQA 5HMWA 2W9CA 2W24A 3HVWA 4DFPA 3CB4A 1IM6A 3NGSA 1APSA 4OHVA 1OPZA 5ETOA 2UV8A 1P9YA 2B7CB 1YX2A 4UZCA 2AJ1A 2ZHAA 2VOOA 4TU7A 3QRRA 2I2YA 2BJ7A 5SZTA 3L7OA 3M2VB 4ILMA 1BQNB 3U02A 2HS0A 3VV2B 2B9EA 4M8LA 3T5HA 2XSFA 4Q2LA 2PGCA 2QGFB 4RR5A 4YUDA 1ZPVA 3TEGA 1H98A 5JVHQ 2BM1A 1X5OA 3LAKA 2NPFA 5B0AA 2VA3A 4IG0A 3BKTA 1G2EA 3MAHA 2ALYB 2MYFA 4CRJA 3ZZRA 2D3O1 3QJJA 3FSXA 2B0GA 1PG5B 2IDEA 5KFOA 4KRWA 5AE1A 4B3RJ 1VCTA 3CJ4A 4KPCA 3HJVA 4MK8A 5KFSA 3NS5A 3QNWB 2XCAA 4WFXA 2I1RA 2V2ZA 4OX9F 4KPYA 4UUXA 4NLPA 4NLYA 3C14B 3OD2A 1RUSA 1NKEA 3BJYA 3VAGA 4OJHA 4UQGA 4ID5B 5D15A 2WTFA 1ZS6A 4DPOA 4DL0C 1SV5B 3DHWC 2VFRA 4K2JA 4J9NA 1I51B 4B3MJ 3TX0A 4RNMA 5EUHA 1RAOA 1UCNA 1C0UB 4TVAB 2HNDA 5B0BA 3RUBL 2CDQA 4ZVTB 2BW7A 5JVGQ 2H3EB 4OI3A 4JI1J 3K8WA 1OJ4A 2Z4PA 4OYMA 1LWXA 2PEHA 2Y9HA 3AH6A 2XM3A 4RW9B 1QTMA 1BD6A 1YG0A 1QAIA 2E7VA 2M8DB 2WSFC 3TAMB 5T41A 2X1FA 1JLGB 2NYIA 1FKAF 4NLOA 5CD4A 2M9KA 3N6NA 3G6YA 2FB0A 1ZOTA 2XS2A 2Y1LB 3M8QA 1TMJA 4LF7F 1YJNS 2G1HA 4E0DA 4YOEA 2V63A 3AXKA 1SL1A 3DRPA 1N36F 3FBEA 4FNIA 1HR0F 4DUZJ 1N54B 2OEMA 1RKIA 1UETA 3M6VA 3DLGB 2QMUB 4ZPTR 5DS7A 4F4ZA 3VAJA 5HROB 1YZ7A 1NZAA 2VFSA 2B5JA 2VG7A 4Q0BA 4OLOA 4LF5F 2DD8S 3PW5A 2CQCA 3CC7S 1HNZF 3G96A 2PN6A 4F4KA 2JFKA 1XEZA 1M5SA 2P9EA 4WFBQ 5KT3A 2JEIA 1GXUA 3UCZP 2M3DA 3T5KA 3QIPA 1GK8A 1UEVA 1TKTB 4ZVQB 2ZDPA 2J9EA 1Q5VA 4DF4A 4DSIA 3OTCA 3A3OB 3I82A 1P8GA 5A2QY 1FRJA 4X4UA 4QIFA 1SH3A 1RT2B 1ZA2B 1DJ0A 4ANEA 4E98A 2OAUA 4CLKA 1TAQA 4F2SA 1J5OA 1DRZA 1NPRA
chains in the Genus database with same CATH topology
1EARA 2QLDA 4L3KA 3TJAA 3NY0A 3I38A 3AGXA 1EB0A 1GMWA 1GMUA 1C3GA 1NLTA 2B26A 1XAOA 2Q2GA 1GMWD 3LA0A 3TJ8A 1GMVA 3L9ZA 3LZ8A 3AGZA 3NXZA 3AGYA 4J80A 2HFVA 3TJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAR A;  2QLD A;  4L3K A;  3TJA A;  3NY0 A;  3I38 A;  3AGX A;  1EB0 A;  1GMW A;  1GMU A;  1C3G A;  1NLT A;  2B26 A;  1XAO A;  2Q2G A;  1GMW D;  3LA0 A;  3TJ8 A;  1GMV A;  3L9Z A;  3LZ8 A;  3AGZ A;  3NXZ A;  3AGY A;  4J80 A;  2HFV A;  3TJ9 A; 
#chains in the Genus database with same CATH topology
 3DOL B;  2KZZ A;  4RNO A;  4KO0 A;  2J7K A;  4IOC Q;  4USH A;  1JNR B;  3B4M A;  2ZWO A;  1N6Q B;  4ERD A;  4AUK A;  4F4X A;  4DCO B;  1Y11 A;  3DRY A;  3TJ9 A;  1FEE A;  2BJ1 A;  3H98 A;  2ROE A;  3UE2 A;  2YKN B;  3D0I E;  2MTL A;  3KHL A;  2DNH A;  2X1A A;  4KH0 B;  1WI8 A;  3RAQ A;  4KJI A;  2BMB A;  4JI5 F;  2RF2 A;  2VAS A;  3CCW A;  5F3Z A;  1NPK A;  1Z2L A;  3ISN D;  3TNV A;  5IM0 B;  4I0W A;  5I3U B;  2GC8 A;  4TQR A;  1KVJ A;  1H2T Z;  1HNI A;  1FWK A;  5CYM A;  3IM8 A;  2MGZ A;  2WW4 A;  2J76 E;  3VQS A;  3MD1 A;  5ADZ A;  2ZUA A;  1FK9 B;  1Z1Z A;  2GA7 A;  2KDO A;  3OLB A;  5ETT A;  1DUR A;  3BPD A;  3VHQ A;  3GWC A;  5HN0 A;  5K8O A;  1Y5L B;  4C3L A;  1W2B R;  4CO4 A;  1MU2 A;  4DSE A;  2DXE A;  5F3T A;  2QA4 S;  2J9D A;  4K0K F;  1XNR J;  2JSX A;  2ASD A;  2HNZ B;  3BKF A;  1HBM A;  3JB9 k;  2BAN B;  3RRG A;  1JJC B;  3IWL A;  4RO0 A;  2IA0 A;  3AD8 C;  4F26 A;  5LSR A;  3LTO A;  4NAS A;  1SPB P;  3K2Y A;  3DM2 B;  3EM1 A;  4N41 A;  2HWH A;  3MED B;  2IMO A;  1CJU B;  2HBY B;  2COL A;  4ATN A;  4OI4 A;  5KFK A;  5J2M A;  1VLO A;  4ZIW A;  1OMS A;  4FKX A;  4J9R A;  3BQ2 A;  1QJH A;  4CLY A;  3EDQ B;  4ZVE A;  2GIQ A;  2EG2 A;  3KLI A;  3OT9 A;  5LSO A;  1I94 F;  3C6U B;  5KG0 A;  1HFE L;  2VD3 A;  1QLN A;  4C8K A;  1PCA A;  3AKO B;  4EGL A;  2YNF B;  1GXL A;  2HRU A;  2X1B A;  1X0F A;  2WON B;  3TX8 A;  3RU0 A;  4KV8 A;  1IR2 A;  3M1V B;  2IDL A;  2C3M A;  3MEC A;  2BAC A;  4NLT A;  4ETZ A;  3MM6 B;  1O6X A;  1OY6 A;  4YHH J;  2HG4 A;  1V3S A;  2DPI A;  4IFV B;  4GC6 A;  5IC4 B;  3AAW B;  4C4W A;  4YY3 F;  3CCQ S;  3MR5 A;  2K7J A;  3CCE S;  4RW4 B;  3SQG A;  2K7K A;  3W65 A;  4FN5 A;  3FDS A;  2QEX S;  3T9N A;  3MEG A;  1RHR B;  1ACM B;  4KHM A;  3CMA S;  1NK7 A;  5HLF A;  1OSD A;  1ELO A;  5HJY A;  4N7T A;  5IZH A;  2CPY A;  5LJ5 Y;  3FMW A;  4ZKA A;  1FKO B;  2VB6 A;  3H7H B;  3NCR A;  3BH7 B;  3W3S A;  1SB6 A;  1RTI A;  5D0R A;  3EXC X;  2IAJ B;  4KY3 A;  4DLE A;  3V6J A;  3BSC A;  2FJV A;  1U1K A;  2HQ3 A;  5AXM A;  3P3D A;  2V69 A;  2CUY A;  2MZQ A;  1WOS A;  3K7R A;  1D8Z A;  1YHQ S;  4K2X A;  4B9M A;  3NG8 A;  2CPZ A;  1U7L A;  3W5Y A;  2G13 A;  2CG8 A;  2LP4 A;  3G71 S;  4ECS A;  1FDN A;  1BQX A;  1TKZ A;  4HHH A;  5JXS A;  2R8I A;  2CQB A;  2QLF B;  4OZN A;  4X65 F;  4N8N A;  3JQK A;  3KLF B;  2QC3 A;  3CCV S;  4DEZ A;  4NZ0 A;  2KFY A;  4XDD A;  3LP1 A;  1SC1 B;  5DG8 A;  3RRK A;  4IRD A;  1U1O A;  3TWZ A;  3JQM A;  5E3P A;  3H5U A;  1HHQ A;  3K8V A;  2HQC A;  1JXE A;  3G82 B;  2HAI A;  3TO8 A;  2DGW A;  3SV4 A;  2HIQ A;  3PV8 A;  4MAK A;  3PR4 A;  4LFB F;  2BEF A;  3AJ2 A;  2CQG A;  2FLN A;  3OBI A;  4DXL A;  2OP5 A;  2AHO B;  3L09 A;  4M5N A;  4QJV A;  2LQ9 A;  3TI0 A;  3D6M B;  2YXL A;  1DHM A;  1RAE B;  2MHN A;  4EBD A;  2DXF A;  1JLE A;  1NDP A;  3J7A N;  1T9W A;  3TVZ A;  2FGC A;  4FDF A;  4WFA Q;  3PG9 A;  5C42 B;  2VQF F;  1FRM A;  5LMN F;  5KFA A;  4USK A;  4ER8 A;  5KFF A;  1V5I B;  1U26 A;  1WNE A;  1MML A;  3FCV A;  2IBK A;  1HBO A;  4B3O B;  3UVJ B;  1FFW B;  1FNX H;  4WZQ A;  5C24 A;  5A2Q U;  3NGU A;  1QUV A;  3FJ2 A;  3TZW A;  4IQM A;  1RT5 A;  3WX4 A;  1S9F A;  3EE3 A;  5IT9 U;  4ZA1 A;  1YLX A;  3CO0 P;  3WQP A;  3JTN A;  4L3K A;  3J81 Y;  5DG7 A;  1RBA A;  5B0G A;  1BQM B;  2R9L A;  3QID A;  3KK1 B;  2Y1J A;  3V81 A;  1FES A;  4NCA A;  4RWW A;  2DNZ A;  5L9N A;  4ICL B;  1J5E J;  3Q8R B;  4LF4 F;  2QV6 A;  2FQQ B;  1SKW A;  3MEK A;  4A8X A;  3R97 A;  4ZP7 A;  2WBM A;  5MAO A;  1U25 A;  2ZD1 A;  2DNR A;  2BRL A;  4NE9 C;  4BBY A;  4NXN J;  2J7U A;  3EGZ A;  1EB0 A;  4TY8 A;  2OJ3 A;  1VQL S;  1S0O A;  2YBV A;  4K4T A;  1Q8I A;  3SBM A;  4CCH A;  2XLI A;  1NHK L;  3LH2 S;  2W2M P;  2M88 A;  1ZZF A;  4CNZ A;  3NL0 A;  2MKS A;  4U6P A;  4PUO B;  1IKX A;  1H3D A;  2IM1 A;  2VG5 B;  2BKP A;  3BV8 A;  3KNA A;  3J7Y U;  3R1H A;  1HBN A;  4EYI B;  3CCJ S;  3KHR A;  3BR8 A;  2H5J B;  2EPI A;  1HWL A;  2B4O A;  2C3U A;  4ZDN A;  2FYX A;  3SXL A;  2XEX A;  3FBF A;  5CZX A;  2RIJ A;  3MUR P;  2KKH A;  2NR0 A;  3IBC B;  4CLS A;  1UVN A;  2WVC A;  2XZW A;  3E2E A;  2DT9 A;  1FDD A;  1VQ7 S;  3UD4 P;  4ZCL A;  3MEE A;  2C3Y A;  2C22 A;  2AV5 A;  1FNO A;  3A4T A;  3H2V E;  1H7W A;  3AT1 B;  3D0H E;  2JVM A;  1U09 A;  2VOP A;  4B9L A;  4DV7 F;  3U7J A;  2QA2 A;  2PMZ D;  4AXJ A;  1N32 F;  2OHD A;  1RXO B;  1WF1 A;  2R7V A;  1VBX A;  2WB1 D;  1C4A A;  4JYA F;  4C9D A;  1RT3 B;  2FVP A;  2ZUG A;  1PGZ A;  4DPW A;  1S1V A;  2YKO A;  2KRB A;  4JI0 J;  2WVB A;  4DR2 J;  2ZVI A;  4CI0 B;  4YME A;  3MFI A;  3WZ0 A;  3H5S A;  1A6L A;  1NJY A;  2DIT A;  3MMB A;  4DV4 F;  1ZAW A;  3V6K A;  1C4C A;  1I6J A;  1MWQ A;  2NSC A;  3CCU S;  5I4M A;  1F2H A;  4JOU A;  3VAF A;  1NKB A;  4F04 B;  1N52 B;  2QL5 B;  5J2P B;  1WWH A;  4ENO A;  4C3M A;  4NPO A;  1TL7 A;  2ZBC A;  4LF8 F;  3CGI A;  3RB6 A;  2R8G A;  2ASJ A;  4F25 A;  2MJN A;  4OZL A;  2P8I A;  1UAW A;  3JSY A;  1F9H A;  4D3H A;  4HDH A;  3M2R A;  1N5Y A;  1X9M A;  3GFY A;  4W92 B;  4A48 A;  4RW7 B;  1GX6 A;  2FIU A;  3RGI A;  4GVB B;  2WCX A;  2MXY A;  1N8R T;  3QQC D;  1K44 A;  2GHP A;  3DXS X;  4URQ U;  2QLW A;  3FZB A;  3CWJ A;  5ETV A;  2F40 A;  1WKK A;  2DGU A;  2LEP A;  3SSR A;  2DBB A;  3P8B B;  3ETM A;  5FII A;  4K7Q A;  2LEC A;  2AGQ A;  4FZV A;  2QFI A;  3QAT A;  4QPT A;  1JLC B;  1KP6 A;  3UR3 C;  3U27 A;  4A8Q A;  3M6X A;  2IPO B;  1S79 A;  4CT9 A;  4MK9 A;  1QSL A;  2ZOF A;  4I68 A;  3BF4 A;  3CW2 C;  3WC0 A;  4GKK J;  1D9A A;  3HXM A;  2KHD A;  1N5Q A;  1IBL F;  1UVM A;  2P9G A;  2HFO A;  2R8J A;  2YX4 A;  3I0S A;  2ZH3 A;  5D6G A;  1B99 A;  3GJT B;  4DPX A;  1LOU A;  4JI8 J;  5L8R C;  5GAD I;  4R5P B;  4ZPV R;  5HK4 A;  2XO6 A;  1KTV A;  4Q7A A;  1T02 A;  3I0R B;  5KOX A;  1ZTT A;  4NLX A;  3QAE A;  3DLE A;  3MMA A;  1HPZ B;  2LYV A;  2HHH J;  1OY9 A;  1QE1 B;  2ZC4 A;  3HVT B;  2KM8 B;  2RKI A;  4FF3 A;  3KLG B;  1RA7 A;  2HZA A;  2W4P A;  4WF9 Q;  2J0X A;  2XYG B;  4MKV A;  2J8A A;  2Q1L A;  3F41 A;  3ILL A;  1RJJ A;  2XSJ B;  3OHA A;  4GKJ J;  3SSQ A;  3MFH A;  1B7F A;  3FSY A;  1YZ6 A;  5FDL A;  4Y65 A;  3VTI A;  2N7Y A;  1UEU A;  1FJG F;  4WK3 A;  3CJ0 A;  4ANC A;  2XMK A;  4ILL A;  1VC5 A;  2AEF A;  3EIC A;  1QUP A;  2G4B A;  1GAO A;  3CUL A;  2J5A A;  3I9Z A;  2HZC A;  2DNP A;  4CO3 A;  3FFI B;  2CPE A;  1S9E A;  1ICE B;  1U48 A;  2DNM A;  4DV2 J;  2WHO A;  2I5J A;  2LXI A;  1YBA A;  3NMA A;  4LIW A;  1RBO B;  3W2W A;  3V4I B;  3J81 U;  1CJT B;  1HQE A;  2W9B B;  1GMU A;  2H65 B;  4QWB A;  4ZS6 A;  2R7R A;  4JI6 F;  2DTJ A;  4LFA J;  4CNY A;  1JJ4 A;  1YJT A;  3RBD A;  1RHM B;  1IXK A;  4G1Q B;  4IR9 A;  1RLC L;  3M32 A;  5CYJ A;  3T3F A;  1SUQ B;  2CQ0 A;  3PY8 A;  1RTJ A;  2H54 B;  4URS A;  3N4W A;  3LWL A;  3KOA A;  4RUH A;  3GV7 B;  4UY8 T;  1SJ1 A;  1Q81 T;  4ED8 A;  2YPZ A;  5LMU F;  1YJW S;  1W25 A;  4LRE A;  1CSJ A;  3CCM S;  4B3T J;  1A0O B;  1V5V A;  1KDN A;  2CVE A;  4MMO A;  5KFN A;  1BC6 A;  2UXD F;  4DR5 F;  3BRE A;  2FD2 A;  1T9T A;  1GMV A;  2ZHO A;  4DR4 F;  2UUA F;  2LVW A;  1VI7 A;  1UWA A;  4OX6 A;  3OL6 A;  1JKH B;  3OHB A;  2HHQ A;  1NK4 A;  3I9V 9;  1S4E A;  2JH3 A;  2XG8 A;  2WBR A;  1JLF B;  1UVL A;  4UOF A;  4NLU A;  3OVS A;  4UOC A;  1AW0 A;  3G6V A;  1RT6 B;  3OPK A;  5DQH A;  4KSE B;  3EX7 B;  2XGP A;  2V8P A;  2D1C A;  5FD1 A;  4DR6 J;  3IBW A;  3N79 A;  2DHG A;  1SCJ B;  3MAQ A;  4WFZ A;  2D69 A;  1EIY B;  4WE1 A;  2KB2 A;  4DV0 F;  3OTO F;  1S12 A;  1WEX A;  2A2D A;  4PG4 A;  2D74 B;  2ZH1 A;  4QWE A;  1IJF B;  4QIG A;  1VIO A;  5F8G A;  3CT9 A;  1EET A;  2HLU A;  2R3V A;  1TL4 A;  2C3O A;  2V8G A;  3SZ2 A;  3QO9 B;  4P7V A;  4ZCI A;  4LIR A;  4DG1 A;  4M5J A;  1LWC B;  3IBF B;  3A1Y G;  2IJN A;  1FVS A;  2KJV A;  1QM9 A;  2XTJ P;  3F0N A;  1TKX A;  1T9V A;  2HSE B;  3DGP A;  4DZD A;  1RU2 A;  6FDR A;  5DLF A;  1EHW A;  5L39 A;  3T6B A;  4Z7C A;  4DR1 F;  4DCJ B;  3DRR A;  5HMX A;  3G8S A;  3BGO P;  3MOJ B;  4R0E A;  4CO1 A;  3KYL A;  4Y0F A;  3C46 A;  2NLW A;  1IBK F;  3NY0 A;  2IVF B;  2YNH B;  3D1Q A;  1C2P A;  4LF6 J;  5A8R B;  3DLL Q;  3CSK A;  4NYZ A;  3BZQ A;  2MQ8 A;  3M2U B;  3OJU A;  3HF5 A;  3B4D A;  2FJX A;  1U6Z A;  3RYL A;  1NND A;  4AQY F;  1KD1 T;  3S1T A;  3T41 A;  4KFB B;  1D1U A;  1RT7 B;  4DS4 A;  1GQE A;  3OQ2 A;  2MMY A;  1TUG B;  3W5X A;  2AYB A;  2QLD A;  1VK3 A;  2AWZ A;  4MT1 A;  2BDP A;  4LT6 A;  2ASY A;  3R5J B;  2OTJ S;  2ZZN A;  4LF9 J;  1RHQ B;  3T9Z A;  1PAU B;  1T9Y A;  4CP5 A;  2H4Y B;  5HI7 A;  4K4V A;  5D4P A;  2XNQ A;  3ZZZ A;  4LSN A;  4ZJL A;  3HMJ G;  2JRR A;  4NRT A;  1U47 A;  1HD1 A;  4QW9 A;  2OPR A;  2FJA B;  5KFH A;  1S7I A;  3MGJ A;  3C6T B;  3ISZ A;  1TFY A;  4YB6 A;  3J7Z T;  2VJV A;  1R7I A;  3I55 S;  1FRK A;  3PVX A;  3GZ7 A;  2JLE A;  5H9E K;  2M8H A;  4O3Q A;  3CVK A;  3K17 A;  3D3B J;  1WC1 A;  1VDH A;  1CUL B;  3BH6 B;  2GO8 A;  3CIM A;  1EZZ B;  3CDB A;  4DWI A;  2UXB F;  1UZH A;  1NU4 A;  5CYQ B;  2V4Q A;  3O44 A;  5F8I A;  2E1A A;  2F8M A;  3JYT B;  3LAL A;  1JXV A;  2Q3P A;  3RW6 A;  4B3S J;  3J80 Y;  2YKM B;  1RP5 A;  4AXI A;  4Q2M A;  2LKZ A;  1U6F A;  4WCE Q;  3D6F B;  3MMC A;  2HNY A;  3M9O B;  3KKF A;  3RB0 A;  4FYD A;  4PZV A;  2YTC A;  4NXM F;  2DR7 A;  2EK6 A;  3MM9 B;  1KWM A;  3CIZ A;  5L38 A;  5DDO C;  4J9O A;  1HMV A;  1S1T B;  4JI3 F;  3DXB A;  1KQF B;  4DR7 J;  4EEY A;  1D0E A;  2GGP B;  3VR1 A;  1R0B G;  2RNE A;  4ZJQ A;  2E9R X;  4RL1 A;  4ZHR B;  1T3O A;  4HTI A;  3OL9 A;  1R8H A;  2VBW A;  3HZE A;  4OV6 A;  4ECT A;  4USM A;  1WC6 A;  4NI2 B;  2XMU A;  1E6Y A;  2WW8 A;  2K8G A;  3CD0 A;  1FHT A;  1VIX A;  3IP0 A;  1FTC A;  2R8H A;  4A8F A;  1UVK A;  1VRT A;  3TA0 A;  1HW8 A;  4LRF A;  5KFJ A;  4DV5 J;  4ECZ A;  2E5H A;  1O5J A;  3AQP A;  4WTY A;  2GVD A;  4DQP A;  2ZNY A;  1VQ9 S;  4QZV B;  3DN9 A;  4QWA A;  3KJV A;  2V50 A;  2MLZ A;  3SQO P;  3AB2 B;  3HZG A;  2HRT A;  3QSI A;  2RT3 A;  4X62 F;  2BJD A;  2W2O P;  3OUY A;  3M9N B;  5K8P A;  4HHU A;  3A8E A;  3RR7 A;  4UY8 5;  3SCI E;  2CQ2 A;  1HKA A;  3O2I A;  2KM8 C;  1S0V A;  4L74 A;  2F7V A;  1O8B A;  3M2V A;  4LRD A;  2Z0G A;  1BQN A;  3SCK E;  3CF5 Q;  4KGV B;  1UA0 A;  2LLZ A;  4PWU A;  2KXN B;  4R0J A;  3H42 A;  1VQ4 S;  4EO6 A;  2ODX A;  3DRX A;  2ZM6 F;  1SQE A;  4ZCM A;  5KTQ A;  2V0N A;  1NDC A;  1RYS A;  2M7S A;  3W62 A;  4KB7 A;  3UNG C;  4QIE A;  1NCL A;  2DR5 A;  3M8R A;  3FUY A;  4P6Q A;  2QLX A;  1TL3 B;  2P9C A;  2R7T A;  5I3Q A;  3FEX B;  3DLK B;  3C14 A;  3H4D A;  4OYB A;  3S8S A;  3C15 A;  4C8L A;  2MLX A;  1RIS A;  4ID5 A;  4RBV A;  2JC1 A;  4U96 A;  2FJD B;  2UUC F;  1SV5 A;  4TQS A;  2K1R B;  3U1L A;  3T1Y F;  2CFX A;  5LJ3 Y;  4I64 A;  5EGY A;  1C0U A;  3MPD A;  3UFC X;  1OYD A;  4HT5 A;  4C6A A;  3V2U C;  3WDO A;  4KYZ A;  4RPF A;  4GO5 X;  2RML A;  3AA9 A;  3M8S A;  1S48 A;  3HVA A;  1RTH B;  2H5I B;  1F9F A;  4KHP F;  3PAC A;  3VAI A;  1S9G A;  1C3G A;  3S7R A;  3NP5 A;  1FNM A;  1VIS A;  2OPS A;  1H38 A;  4X84 A;  5KG1 A;  1DZ5 A;  1JWW A;  5FLX Y;  1H2U X;  3BGR A;  3PJX A;  3MHY A;  1JLG A;  2G0C A;  2VC1 A;  4OX9 J;  2N82 B;  2PMH A;  4ED7 A;  2EKY A;  4PG5 A;  2IRX A;  3EJM A;  3NBP B;  4OJ1 A;  2KVQ E;  1U2R A;  5KT7 A;  2J0W A;  2G1D A;  4DL4 A;  1PJ6 A;  2V2Q A;  1RAF B;  1B70 B;  2RE1 A;  3I31 A;  1X31 C;  2OD4 A;  2PMW A;  2VFT A;  1YRT A;  2GVZ B;  5DM7 Q;  2KU7 A;  2VL1 A;  3H8Y A;  2F9J A;  3FVY A;  2HHP A;  3O3L A;  5B0D A;  3R2C J;  3KXD A;  2BVZ A;  1FER A;  4S0M A;  2GFF A;  1R8B A;  5HRO A;  5BJR A;  1NSK L;  3PW7 A;  4F02 A;  2DY9 A;  4TLQ A;  3LPY A;  2XS7 A;  2W7A A;  2N4D A;  1L5U A;  1F5C A;  2AP6 A;  1HI0 P;  5G0R B;  4FYV B;  2XMT A;  5IC6 B;  1NRK A;  2M70 A;  1EX8 A;  1S72 S;  2CXE A;  3KJN B;  1KNZ A;  3GYG A;  4M5G A;  4XIU A;  3TP2 A;  2AGO A;  2JFD A;  1W2I A;  2DJW A;  3J7Z 5;  1OSC A;  8RUC A;  2AGP A;  1LW2 B;  4NZ6 A;  2U1A A;  1TKT A;  2LMI A;  1XR6 A;  3V5R A;  1ZZN A;  4LF7 J;  4LFC F;  4CLW A;  3RAM A;  2GMJ A;  4USW A;  1GH8 A;  4DL7 A;  4AT1 B;  1DTT B;  2R7X A;  1EP4 B;  1RT2 A;  4LSL A;  2CJK A;  1N36 J;  1VQ5 S;  5D8H B;  1HR0 J;  2DB1 A;  2PE8 A;  4RWX A;  2DPJ A;  2MKJ A;  3J80 U;  1LK5 A;  2E5J A;  3DOL A;  2OEL A;  3K0J A;  1WF2 A;  3WIV A;  1KR4 A;  2CPF A;  1TR0 A;  5HAO A;  2XMV A;  4DFM A;  3IS9 B;  3NGD A;  1N6Q A;  4DSJ A;  4WTO B;  3F56 A;  4OYW A;  4PR6 A;  2PEB A;  4LF5 J;  1QVF R;  2DCL A;  3HHD A;  1EJ7 L;  3VAM A;  4J9K A;  1HNZ J;  1NJI T;  2HVE A;  2YKN A;  1RE1 B;  2DRB A;  4QIV A;  2CAJ A;  3TJA A;  3QJP A;  5KFZ A;  3MAA A;  2MZR A;  2AZ1 A;  3EVW A;  5DM6 Q;  3BGL A;  4D3G A;  1RK8 A;  1WC4 A;  4H4M B;  2C2E A;  1WTF A;  5K5M A;  4P9S A;  4K50 A;  1IN0 A;  2RU9 A;  3ENA A;  2YWK A;  3G2X A;  1XQI A;  3THV A;  1WI6 A;  2GZO A;  1FK9 A;  3RR8 A;  2VON A;  1KHW A;  1SL0 A;  5A0Y A;  1FO1 A;  2MHE A;  2NPI A;  3RW7 A;  3VVU A;  3V6D B;  4I56 A;  5B09 A;  4NCB A;  1Q86 T;  4JV2 A;  4DV6 F;  1Q7L B;  4LJM A;  3OSN A;  3OXL A;  3I5C A;  4NX9 A;  1B0V A;  5DDP C;  3QAU A;  1S6O A;  2Y8W A;  2RD5 C;  3WHI A;  4DDF A;  2BAN A;  4NRU A;  4CLP A;  1FWL A;  1M5H A;  2FJW A;  3PDN A;  2DNO A;  4DL6 A;  5M2U A;  1WTB A;  4QR2 A;  4JI5 J;  3HHL C;  3DM2 A;  1FXL A;  4OJ3 A;  2FPH X;  5EWF A;  2ZJP Q;  1X9S A;  3MED A;  1CJU A;  3M8Y A;  4OZ3 A;  1WKL A;  1TV6 A;  2ZOM A;  2YNG A;  4RJV A;  3IMQ J;  4LUB A;  3QT8 A;  5HVH A;  2FY8 A;  4OFZ A;  3TUJ C;  1X8D A;  4F3O A;  4DMZ A;  5F8M A;  5A8K B;  2DNK A;  1XN9 A;  4OJG A;  2PFD A;  2HFU A;  5D4L A;  4WPA A;  1UPM B;  2SXL A;  4YEA A;  3CE8 A;  2WAQ D;  2HYI B;  2E66 A;  3C6U A;  2XS5 A;  4GVL A;  1WKJ A;  1UVJ A;  1JNZ B;  1Y7P A;  1HA1 A;  1JQG A;  3FCH A;  2BX6 A;  3VZI A;  2YNF A;  3BGF A;  1WUU A;  3AHP A;  1MSW D;  3MCS A;  4K0K J;  1PC5 A;  3RRH A;  2GJF A;  2MEW A;  1R0A B;  3DU5 A;  3FZ2 A;  1U6B A;  1PIE A;  2OML A;  4QYR A;  1NPP A;  4G1P A;  3MF5 A;  3LUY A;  2GNK A;  3RBX A;  4IG0 B;  4IFV A;  6AT1 B;  2I38 A;  2ZHB A;  4DSF A;  2HHW A;  2G0J A;  2K3K A;  3SEO A;  1NJW A;  5FJ4 A;  2VF3 A;  4WYL A;  4G1I A;  1DBD A;  4RW4 A;  1GFW B;  3D68 A;  3K59 A;  1IKW B;  3R3T A;  4PEO A;  4X4V A;  1BGX T;  3CCR S;  3IM9 A;  2DR9 A;  3CCT A;  2G2Y A;  3R5C A;  5C7P A;  1I94 J;  4OI0 A;  3LGH A;  3NGK A;  4C0B A;  1ULR A;  2M5Y A;  4FS1 A;  1KQG B;  4FYX B;  3T1A A;  3IO1 A;  1NHV A;  5FLX U;  3PIO Q;  2OSQ A;  2QA4 G;  2HND B;  5KFD A;  4Y2I A;  1TP7 A;  2ZKT A;  3KLF A;  5HMZ A;  4Z7Y A;  2IRY A;  1HNW F;  3K5N A;  1Y0H A;  2A6M A;  3M7V A;  1NSA A;  3HFV A;  5F41 A;  4YY3 J;  4ZN1 A;  1RA6 A;  3SDE A;  2FHO B;  4F2R A;  3I87 A;  2YY3 A;  2FUG 9;  1X4E A;  2J9D E;  2UVW A;  1N34 F;  3R6G B;  3ZZT A;  4M94 A;  2QG9 B;  1N56 A;  3AOA A;  3PEH A;  4MTP A;  4EYH B;  2IBO A;  1R8A A;  1U2F A;  3R5D A;  1U24 A;  1FXD A;  2BW2 A;  3G82 A;  4DL3 A;  1L3S A;  4AL5 A;  3R7N B;  2O01 C;  4EI2 A;  1ZAX A;  2CNO B;  3UCG A;  4TXS A;  5E3R A;  1FFS B;  4LRB A;  4ZIV A;  4M5H A;  3BR9 A;  3SFG A;  1I1G A;  1PBU A;  1Q79 A;  3EZ5 A;  4KGZ B;  4M5M A;  1KRP A;  4NZ7 A;  3E51 A;  3NOC A;  4ED4 A;  4B08 A;  3HT0 A;  1GMW A;  2DR8 A;  1JLB A;  1WC3 A;  4X65 J;  4Y3C A;  4CTA A;  2RHQ B;  5GAD U;  2ZE2 B;  4CLZ A;  4B3O A;  3UVJ A;  4Q0B B;  2CPJ A;  3FRZ A;  1LWE A;  3T6J A;  3U1N A;  2DGX A;  5AT1 B;  5ETN A;  1RKJ A;  2XI3 A;  1TVR B;  1RBL A;  2KRR A;  3M8W A;  4ED6 A;  3RB3 A;  5C2G A;  1BQM A;  4FBT A;  2IVM A;  2VBY A;  3KK1 A;  4CO2 A;  1YBU A;  4LFB J;  1K0T A;  4ICL A;  4NA1 A;  1XNQ F;  2HUR A;  1Y9O A;  3VVT A;  2NXC A;  4Y2C A;  1M1G A;  2HQF A;  2ATC B;  1C1C A;  3MR6 A;  2E44 A;  2KXH A;  2BYC A;  1NK9 A;  3BO2 A;  2HVZ A;  3R5B A;  2VQF J;  5LMN J;  1VHF A;  4RU2 A;  2B4P A;  3ZTQ A;  5B08 A;  4KHR A;  1MN9 A;  2AQ4 A;  1XMO F;  2V34 A;  3FSI A;  1JB0 C;  3GE9 A;  3ZFV A;  3KWM A;  2D3O R;  4XTT A;  5GAH I;  2N3L A;  4PUO A;  1AT1 B;  3NEK A;  2C2D A;  2XYP B;  3B54 A;  2VA2 A;  2B9Y A;  1WSR A;  3MCN A;  1U0H B;  1R43 A;  2XY7 A;  1GXT A;  1N5V A;  1RAC B;  4IOA Q;  3CUN A;  5F8H A;  4NMX A;  1U8S A;  3FEY B;  4AND A;  3K5L A;  1HNI B;  3GMG A;  4LF4 J;  3L4B C;  3BSO A;  3LZ8 A;  4B9U A;  1KFS A;  1QY7 A;  3QGI A;  2UVV A;  2ABY A;  2ZH6 A;  5AE3 A;  4IO1 A;  4P75 A;  1SXL A;  1NH8 A;  4LR7 A;  1PYS B;  3OFG A;  4EMD A;  2F3J A;  4NLW A;  5B7W A;  1LXJ A;  4RW8 A;  2AX1 A;  1RT3 A;  1PKU A;  4QIW D;  3UD3 P;  4F36 A;  4NWB A;  1X9W A;  1T9X A;  2ZC3 A;  3MWB A;  4A8O A;  3D6H B;  2MZT A;  1RAH B;  5J1P A;  3QFW A;  1ZM3 A;  4I6A A;  3GYN A;  3PRB A;  3W66 A;  4MFB B;  3FQK A;  3CC4 S;  5D0E A;  2YNI B;  1K8A T;  5J2P A;  3G6X A;  5J2M B;  5U47 A;  2FVC A;  2RB7 A;  2WZ1 A;  1RCO B;  4XO0 A;  1UWB B;  1S0M A;  3NAI A;  3IRX A;  5CXT A;  4UOG A;  2UUB F;  3KLI B;  1WHV A;  1X4G A;  3AXM A;  4DV7 J;  3UPF A;  1IR0 A;  1N32 J;  4PAA A;  4ECU A;  3G8Q A;  5L1I A;  4IG3 B;  2KT3 A;  3MPU B;  4RW7 A;  4IH5 A;  4JYA J;  2CG4 A;  1DLO B;  1CQM A;  1W26 A;  5F8J A;  4DQR A;  3R2D J;  4DV4 J;  1OS5 A;  1T03 B;  3W60 A;  2OH2 A;  4N5S A;  5D4N A;  3QYY A;  1XWL A;  1UP1 A;  1M1K T;  2E9Z A;  2EG1 A;  2B9X A;  1JLC A;  4G6V B;  5KG2 A;  3Q8S B;  1S0N A;  1G7C B;  1S99 A;  5J1E A;  2MQL A;  4U8Y A;  4C48 A;  3TEH B;  3KK3 B;  3SQG B;  2LQ8 A;  2HVD A;  2I9S A;  4J90 A;  2HQI A;  4LF8 J;  2RDI A;  2HHX A;  1PJ5 A;  2JVR A;  4BLG A;  4HR2 A;  3HD2 A;  2XWX A;  4DX5 A;  3UO0 A;  3TZZ A;  3BO4 A;  3I4H X;  5LM7 E;  1I5O B;  1WSV A;  1V3R A;  1VQK S;  3CJK B;  3QMQ A;  3DYA A;  4ZK7 M;  4R5P A;  2W25 A;  2AX0 A;  3I0R A;  1CBK A;  3KMS A;  4L72 B;  4C2M A;  1FD8 A;  2ACM A;  3NOG A;  1HPZ A;  3POT B;  1TKZ B;  2PD1 A;  2HVH A;  2MKC A;  4DFJ A;  1QE1 A;  4G65 A;  5KFT A;  2R7O A;  3HVT A;  2R4F A;  4J9L A;  3KLG A;  2RU3 A;  4J37 A;  3MR7 A;  4ED0 A;  3SCJ E;  2HFN A;  5KG5 A;  4JI2 F;  2ZBQ A;  1YJR A;  4RZR A;  1NUE A;  5J2Q B;  2JL9 A;  1S49 A;  1S6U A;  4DUY F;  3FC9 A;  3I56 S;  3C3L A;  3N6L A;  2W7P A;  3TOQ A;  2X7I A;  3PZP A;  2NUU G;  3X1L B;  3OVA A;  4K4Z A;  3H40 A;  3MUV P;  2H5E A;  2CA9 A;  2D9O A;  4B9N A;  2ZFH A;  4QYZ J;  1TKD A;  1IBL J;  4ZP9 A;  2J6U A;  2EFG A;  4FF1 A;  1VS3 A;  2BKO A;  4A8Y A;  4KTQ A;  3HX9 A;  2A10 A;  3FFI A;  1Z2Z A;  1YJ9 S;  4OZ5 A;  1Q5Y A;  1BWV A;  2QL9 B;  3THP A;  2Q79 A;  4RNH A;  5C5J A;  1WC0 A;  1P27 B;  2RSQ A;  4WBF A;  4L73 A;  3V4I A;  4DU8 A;  1CJT A;  1K9M T;  1RT4 A;  2W9B A;  5HSP A;  3KLH B;  2FC8 A;  4CQ1 A;  2EBG A;  1LV5 A;  3JXO A;  3FCW A;  1VQS A;  4G1Q A;  4DQQ A;  3SSS A;  1RWO B;  3GJS B;  1N0U A;  4OI1 A;  5C24 B;  1YGY A;  3GIK A;  2UV8 G;  1TUW A;  1UVI A;  3G4S S;  2R2R A;  3GJQ B;  1DTQ A;  2QYC A;  2VOD A;  3OL8 A;  3PYF A;  1FJG J;  1SJ3 P;  3AOB A;  2CJY B;  2JEF A;  4ZPB A;  1KHV A;  2BV3 A;  1Q82 T;  3IAS 9;  2Q2G A;  1VMB A;  3LA0 A;  1X0P A;  2C2N A;  3J81 j;  2AYG A;  5GMD A;  3W9J A;  1JMT A;  3P5B P;  2EFP A;  1PYT A;  1HNX F;  2FHJ D;  2C42 A;  2HFZ A;  3G8T A;  3TAQ A;  1MRO B;  1JKH A;  2MZJ A;  5L1J A;  3W8P A;  4Z2X A;  3PRV A;  2HEK A;  1JLF A;  3GLJ A;  4JI6 J;  2EEY A;  4IR1 A;  4CIO A;  4EZ9 A;  4TY8 B;  4WFY A;  4CLU A;  5J1N A;  1RTZ A;  1NEE A;  4O44 B;  1UW9 A;  2OUG A;  5HMY A;  1HWU A;  1F0X A;  1C0T B;  5LMU J;  2O5D A;  4X66 F;  2NRE A;  5EN1 A;  2Q66 A;  2ZZT A;  3ENV A;  5DET A;  3OXF A;  3C5X C;  3R9L A;  2FLL A;  2UXD J;  4DR5 J;  2JVO A;  3CD6 S;  2XY5 A;  2CAD A;  3QZ7 A;  2HBQ B;  4V1A k;  5KFI A;  4DR4 J;  2UUA J;  3QO9 A;  1IR1 A;  4J5O A;  4OLP A;  2K06 A;  4K4W A;  2KN4 A;  4TYB A;  2ZVS A;  1BE4 A;  3ZO7 A;  2QMW A;  2EBE A;  3MM7 B;  4CYU B;  3KMQ A;  5E33 A;  3PYG A;  3CMQ A;  2B9W A;  3Q22 A;  2E7X A;  2V8V A;  5K14 A;  1D09 B;  3Q83 A;  5IT9 Y;  3FNN A;  3P45 B;  2DEJ A;  1S6Q A;  2LQJ A;  3OR2 A;  3HHK A;  5IV4 A;  2OFH X;  2HHS A;  4OHY A;  2YNH A;  2VIH A;  1FD2 A;  2CIM A;  2V2K A;  4NLD A;  1C1B B;  2W2Q P;  5E3Q A;  3HHL D;  1KKH A;  5A8R A;  5CA5 A;  4DV0 J;  3BDE A;  3OTO J;  3D5M A;  2AD9 A;  5GMK a;  5I42 B;  2XCP A;  4Q5V A;  2JWN A;  4U8V A;  1F3F A;  5IT4 A;  2MQP A;  2JLF A;  3IWN C;  4KFB A;  4XK8 C;  2BBE A;  4DS5 A;  2PI4 A;  3KJQ B;  1WEZ A;  3Q8U A;  1YWX A;  2QRR A;  4CLF A;  3GIR A;  2RVJ A;  2YH1 A;  3FMB A;  1F3V A;  4ECY A;  2AJQ A;  4DR1 J;  1Q4R A;  2PII A;  2R7W A;  5F8L A;  3BKU A;  4UF4 A;  2UU9 F;  1LXN A;  1IBK J;  3R5A A;  8AT1 B;  4GC7 A;  1M5O C;  5HP1 A;  3C6T A;  1Q7Y T;  3AY0 A;  1RWM B;  3TAN A;  4QW8 A;  1IKV B;  2J8S A;  3W8G A;  3PFO A;  5KFP A;  1HYS B;  3TAP A;  2YWH A;  1JK9 B;  3GU0 A;  5IT0 A;  4M1K A;  4FYY B;  2UXC F;  3M30 A;  4W90 B;  4AQY J;  2LU2 A;  1CUL A;  1K1S A;  2VG6 B;  2HVI A;  3U1M A;  1JJH A;  2CJB A;  1MWY A;  3R27 A;  4ED3 A;  2X51 A;  3F73 A;  4OZ0 A;  5DDR C;  3GV8 B;  4ZP6 A;  4YN3 B;  3JYT A;  4WXO A;  2PI5 A;  4H54 A;  3HPO A;  2BZ2 A;  3QSY B;  5DO2 A;  3Q2T C;  1P1T A;  4CO0 A;  1UJ4 A;  2HMI B;  1RWU A;  1FJE B;  4B9S A;  3GJR B;  4OHX A;  5K8M A;  3KDN A;  3W9I A;  4AYB D;  4JI4 F;  4X4S A;  2MZ1 A;  1KSP A;  4P73 A;  1M1H A;  2LFV A;  2XNR A;  4FXV A;  5HQ8 A;  3E3X A;  2FDN A;  2QN6 B;  4YB1 P;  4JP8 A;  4EK2 A;  3MM9 A;  1URN A;  2GAG C;  2AW0 A;  1HWI A;  2C2Z B;  4Q43 A;  1IQZ A;  4O4G B;  3HFZ B;  3BBC A;  2F5G A;  2ZJQ Q;  1WG5 A;  3JSR A;  4FP9 A;  1LWF B;  1U1N A;  4Y2A A;  3CJR A;  1BHN A;  3MCM A;  4ZHR A;  3FEZ A;  2ZIT A;  4NI2 A;  2UXB J;  3EGN A;  4NML A;  2VU5 A;  5A76 A;  2WSC C;  3CJ2 A;  2LDI A;  2KG0 A;  2F1F A;  3CXC R;  2ZH9 A;  3FRY A;  2ATL A;  1RWW B;  1REV B;  2LA6 A;  3C16 B;  2VH7 A;  8ATC B;  5KT5 A;  4CDI A;  3SIP B;  2MY7 A;  3N9U C;  2IIH A;  1GX5 A;  1RYR A;  4WK1 A;  3EGV A;  4M95 A;  2XYH B;  1GMW D;  3CO9 A;  4CLT A;  2YX7 A;  4NXM J;  4XDC A;  2QO3 A;  3EVO A;  1HQE B;  4C8Z A;  4IH6 A;  4ZOS A;  1WDD A;  2RRA A;  4JI3 J;  2OPQ A;  2BQ3 A;  4J9M A;  3TZX A;  4CM2 A;  1HIY A;  2D3Z A;  1R8P A;  2OGU A;  4KC5 A;  2K2P A;  1RTJ B;  1TTH B;  4RBU A;  3UW1 A;  1WOP A;  1SL2 A;  4F0K A;  2GAH C;  3Q8P B;  1AUS L;  4I2Q B;  2BE7 D;  3K5M A;  2C2O B;  1NB7 A;  1D9D A;  1B7Y B;  4O0N A;  1P6T A;  2QT7 A;  2NZC A;  1HWJ A;  5G4D A;  1BUX A;  3LO3 A;  1TU0 B;  1S77 D;  4I7F B;  3UDE A;  3N0V A;  2LXU A;  1TL3 A;  5H1S V;  4ETX A;  4X62 J;  2A1B A;  2BOP A;  2GHV C;  4ZJO A;  2CQP A;  3DLK A;  1S10 A;  4RW6 B;  4PXC A;  5IV3 A;  1N33 F;  5AXL A;  4NOH A;  3KUH A;  1HI8 A;  2ZNZ A;  5C25 B;  5GAG I;  5E7O B;  2B4V A;  3RTV A;  2GJ2 A;  4H4K A;  3LF0 A;  1U1M A;  3JSM A;  1NHU A;  2GMH A;  4F50 A;  1V6H A;  4WE1 B;  2HPU A;  2DEI A;  1TUV A;  2AJF E;  2WOM A;  2W8K A;  1FEH A;  4K4U A;  5ETK A;  5HJX A;  1T94 A;  3KG0 A;  2OMO A;  4HH0 A;  4IH7 A;  2VBX A;  2ZM6 J;  3IFE A;  3OR1 A;  3B78 A;  1HNV A;  1EET B;  1R27 B;  2BKN A;  1RAJ A;  1RTH A;  1BXN A;  5L1K A;  4X4R A;  2V68 A;  3VAH A;  2R42 A;  2ZH8 A;  2E9T A;  2C2K B;  1Q78 A;  5KFL A;  4ED2 A;  5CHC B;  2V4J B;  3OL7 A;  1QSS A;  1FRI A;  3GFX A;  3LP0 B;  4L6V 3;  3D67 A;  5KFQ A;  3CDE A;  1XIQ A;  5BYR A;  2CNL B;  5KFW A;  3LAN A;  4PKD B;  1DFD A;  1TL1 A;  5E41 A;  2YX1 A;  4C0H A;  2B6A B;  1WG4 A;  2UUC J;  2J0Q D;  1XJW B;  3MPV A;  2WVE A;  3T1Y J;  4F3Q A;  5T14 A;  2D41 A;  3RJM B;  1K0V A;  1J27 A;  2DNL A;  3EZU A;  3KJF B;  4PXB A;  4MYT A;  4HT7 A;  2GVZ A;  4MKA A;  1VR6 A;  2F63 A;  4LVN P;  4WFN Q;  4A8S A;  3SYZ A;  2VBZ A;  4USV A;  3Q8Q B;  4ZLL A;  2ZDO A;  3HSJ A;  3CC2 S;  4NCG B;  1NK5 A;  2R8K A;  2YWW A;  4GRS A;  3NRB A;  1EAY C;  3HI9 A;  4KHP J;  2FVR A;  5MLC V;  2H51 B;  3D0G E;  3R1L A;  2UVR A;  3QLH A;  4RLE A;  3TA2 A;  3MM8 B;  1U1R A;  3CTR A;  3GIJ A;  3IN5 A;  3CD7 A;  5KAK A;  2ZJR Q;  4C11 A;  1M5V C;  4ZPW R;  3W64 A;  4USU A;  3I5A A;  1X4B A;  1FCA A;  5BR8 F;  3RAX A;  1DTT A;  4C8O A;  1EP4 A;  3PJ9 A;  3OXG A;  2XB2 D;  1YQH A;  4PG8 A;  3KG4 A;  4X2B A;  3L7P A;  4PPD A;  1SJF A;  1H74 A;  3RB4 A;  3T5L A;  2IC3 A;  2HHV A;  4TU9 A;  3IS9 A;  1IUJ A;  1X4A A;  1KLN A;  3QGP A;  4WP3 A;  3ENW A;  1AZS A;  4R8U B;  4YQW A;  4HLB A;  2DRD A;  4HAC B;  4F4W A;  4ED1 A;  4KGM A;  2ZOG A;  1RAG B;  1LEO A;  2M52 A;  2MST A;  3VGU A;  4U7U D;  2DXD A;  1Z4U A;  4OI6 A;  2EWH A;  1XMQ F;  4LFC J;  4H4M A;  4RUB A;  4OYA A;  3NAH A;  4M5I A;  3CDW A;  4O0I A;  1CC7 A;  4WWS A;  5H9F K;  1SKS A;  4MYU A;  4WYW A;  4ZLJ A;  5KFE A;  2V9K A;  1PC4 A;  2MPU A;  4ECQ A;  3BN4 A;  1RAB B;  4M5D B;  1HMV B;  3OV7 A;  2VFU A;  3DKD A;  1HHT P;  4DV1 F;  2U2F A;  3KLE A;  1R31 A;  2Q6C A;  3M8Z A;  2MY8 A;  3ZXW A;  3ZZ0 A;  4QQB A;  2VV5 A;  1S57 A;  2PC6 A;  2LA4 A;  2FGO A;  1YJ7 A;  1SKU B;  4UUW A;  4EWT A;  5K9F A;  5DLG A;  3VWS A;  2OFG X;  5CAB A;  2CPX A;  2OO4 A;  5GAE I;  3M8P A;  3H20 A;  4RX6 A;  1H0H B;  1ZM2 A;  2JLG A;  1S6P B;  4PRF A;  1VRQ C;  2G9O A;  1RWK B;  1GTH A;  2MJU A;  2EFN A;  2LDY A;  3LP2 B;  3SMZ A;  5DRK A;  5A8W B;  2PA8 D;  2KHC A;  5HAN A;  4YS2 A;  2XLK A;  4ID8 A;  3KJV B;  3ULH A;  2E1M C;  3W63 A;  5GAH U;  4OYX A;  5E3A A;  3BBB A;  1IBM F;  1Q8K A;  1JJ2 R;  3QT7 A;  3M05 A;  7FD1 A;  2W7O A;  1S1U A;  4LBH A;  3D6T B;  5A8K A;  3OUY B;  1UL3 A;  2ERR A;  3DOM B;  2DIU A;  3I6P A;  4TLR A;  3W2V A;  2H4W B;  2E1R A;  4Y2M A;  4IFY B;  2YWG A;  3RBE A;  4J7C A;  4DV6 J;  2J9C A;  4JB8 B;  2CQD A;  3W1Y C;  1U1Q A;  2CZ4 A;  3E01 B;  3NNA A;  4LBP A;  3SI8 A;  4XPE A;  3GP9 A;  1NH7 A;  4Y28 C;  1R0A A;  3PCO B;  4OZJ A;  2MKH A;  2FVS A;  3IG1 A;  5EX3 A;  1CVJ A;  1X4C A;  1HQU B;  1WJ9 A;  3W7B A;  2HGL A;  1FE4 A;  4PYA A;  2ZH7 A;  3GCX P;  2ZZM A;  3B6B A;  4IKA A;  4IOB A;  3KK2 A;  3TW0 A;  1MMN A;  3GFZ A;  1IKW A;  2VUG A;  1VK8 A;  2FLO A;  4WP9 A;  3ENQ A;  1ZBT A;  3FGV A;  2E1P A;  5IFM A;  3T5J A;  4JUZ A;  3C15 B;  4DBQ A;  5ETR A;  7AT1 B;  1IQT A;  2D3U A;  2O67 A;  3HKW A;  4H4O A;  1TEL A;  1PIL A;  2OSR A;  2CPD A;  3H5X A;  2HHU A;  1BY9 A;  1IWG A;  5HBM B;  2DH7 A;  1ZH5 A;  4I67 A;  1RU1 A;  1EKS A;  3ZNJ 1;  3QJL A;  4O3R A;  1FJC A;  4AD6 A;  3OTB A;  4IDK A;  2A6O A;  3UDC A;  3V6H A;  2AIR B;  1CJV B;  2B56 A;  4LF2 A;  1SI9 A;  2LXF A;  3I5B A;  3H90 A;  5DQI A;  3HFK A;  2EI5 A;  2PA3 A;  3DRS B;  1S9G B;  2KT5 A;  2APO A;  1VHI A;  1FTR A;  1O0P A;  2OPS B;  3GR0 A;  4MKB A;  4YR0 A;  2GS8 A;  1RI7 A;  4OZ2 A;  3MZI A;  4IYQ A;  4DV3 F;  5EDW A;  3Q0A A;  3BGR B;  3GPA A;  2HQD A;  2YVS A;  2N4C A;  4DU7 A;  1LQ9 A;  4C3K A;  2RH3 A;  1WHW A;  1FKP B;  1D3W A;  3R7S B;  4I2P B;  2ZBR A;  3QT6 A;  4EFA C;  3FKB A;  3ZC4 A;  3T1H F;  2UVU A;  3TRG A;  4JI7 F;  1S7H A;  3ICL A;  1VBZ A;  2VFV A;  4FVC A;  1ITP A;  1JLA B;  2NXJ A;  2FJE B;  1VJQ A;  4P71 A;  2IJR A;  1T05 B;  1OPI A;  4ES3 A;  1J2V A;  3HSZ A;  5E5N A;  4ZVP B;  4P72 A;  2VPX B;  1HNW J;  2ZE2 A;  2CJA A;  1SJ4 P;  5K8N A;  1N5T A;  1HBU B;  2CQ3 A;  1U02 A;  2LQ5 A;  4OMF G;  1WOO A;  3DOK A;  3MR3 A;  1N34 J;  4DL2 A;  4CH0 S;  1TVR A;  2DGV A;  3IXQ A;  2XI2 A;  2WVF A;  1LFW A;  2RQ4 A;  2VQE F;  3HM9 A;  1T11 A;  2GO9 A;  1ARO P;  3K57 A;  4TYA A;  4USJ C;  1YRU A;  5ETQ A;  2E5L F;  5CCM A;  2DO4 A;  1VQM S;  2DVI A;  5D3G B;  2CJ9 A;  1RTD A;  2CNN B;  3O1L A;  2MQO A;  2KH9 A;  3N5B A;  3C66 A;  2DNG A;  5KOW A;  4DQS A;  3D54 A;  4LSL B;  4V19 J;  5ETS A;  3CCZ A;  3GTY X;  4RKU C;  1O51 A;  4F67 A;  1IVZ A;  2KO1 A;  3ZTS A;  3NKY A;  4U7C A;  3DHX A;  1U1L A;  3ZZO A;  3GIL A;  2OPP A;  4FVM A;  2GML A;  2KXF A;  5KFR A;  5L1L A;  1Q95 G;  2OEK A;  4GO7 X;  2Y3Y A;  3S6E A;  3MI7 X;  4ZIT A;  4Y34 A;  2QMX A;  3CJS A;  4O3S A;  1CC8 A;  1U0H A;  1F5A A;  3MAA B;  3ITH B;  2HBZ B;  2DNN A;  3BQ0 A;  2LQB A;  2XMM A;  1XNQ J;  4QR0 A;  1U0S A;  5I3P A;  4WP8 A;  3HVR A;  2W2N P;  3PX6 A;  5A0Y B;  3GCW P;  3DMJ B;  1XTZ A;  3N28 A;  2AEM A;  3HJF A;  3NGT A;  5B0C A;  3PKM A;  5L46 A;  3MXH P;  2M4M A;  4K4S A;  1XMO J;  3BGU A;  1H6K X;  5D4O A;  4Q8E A;  1OQ3 A;  2QSW A;  3FBB A;  2QLJ B;  1RT1 A;  4C7Q A;  4LRC A;  3OVB A;  4DOZ A;  1PJ7 A;  2E7W A;  1VOM A;  1RDR A;  5KFB A;  1Y5N B;  3CJ3 A;  3I38 A;  4F0H A;  2VPY B;  1ZAV A;  3PRD A;  3HHL B;  3K5O A;  1YI2 S;  2VC0 A;  3PNI A;  1FF2 A;  2Z2M A;  2P6T A;  4MFB A;  3HSG A;  2EW9 A;  1F9E B;  1TV6 B;  4YB5 A;  5KG3 A;  2YNI A;  2YNG B;  3A3N B;  4YDD B;  3UN5 A;  2RQC A;  2JDJ A;  2IY5 B;  2VPZ B;  4B9T A;  2PDA A;  2B8P A;  1S1X B;  1VFJ A;  4Q44 A;  1Q8B A;  2KI2 A;  3BYP A;  1UWB A;  2HGM A;  4NLV A;  4DSK A;  1CS4 B;  2RS2 A;  2OTL S;  2F4V F;  4PQU B;  3G9C A;  4P10 A;  4CLL A;  1VBK A;  4L75 A;  3PX0 A;  2KJW A;  1E6V B;  3DDN A;  5HVF A;  4I6W A;  4IG3 A;  3MD3 A;  2VDH A;  1S4F A;  4MJK A;  1DLO A;  5IQQ A;  2KT2 A;  1WEL A;  1SQG A;  5T7L A;  5E0O A;  1JIH A;  4UT4 A;  2AYE A;  3IR6 B;  1T03 A;  2BE2 B;  2DO0 A;  5GVQ A;  3QPI A;  2BRK A;  2L41 A;  4R25 A;  3QBC A;  2HAF A;  3LQV A;  5CQG A;  2RAQ A;  5KT6 A;  2B26 A;  1ZA1 B;  3C8Y A;  3BBF A;  3KK3 A;  3P5T L;  3R6L B;  5M2R A;  4KQZ A;  2DGT A;  2Z56 B;  4KAI A;  3O5T B;  2QA1 A;  1HL6 A;  3US5 A;  3H0P A;  2UUB J;  3GIM A;  4TN2 A;  4DR3 F;  2DKO B;  4ZCK A;  1Y3K A;  3CJK A;  4K8R A;  4P74 A;  3AGX A;  1S5Z A;  3Q2S C;  2MLY A;  5CAA A;  2AZ3 A;  2HS4 A;  4DFK A;  2XWY A;  1NK8 A;  3POT A;  3TVY A;  3Q8Y A;  3QT5 A;  4RUC A;  1D9F A;  5IWA F;  5HL7 Q;  1YK9 A;  3PXG a;  4NLS A;  4FPI A;  4IRC A;  1U49 A;  5J2Q A;  1ZM9 A;  2DIS A;  3NLC A;  1IBC B;  3SDE B;  1Q1K A;  2MSS A;  1CJK B;  1NJZ A;  4X4N A;  2NCK L;  2ZEJ A;  2ASL A;  1UZD A;  2CYY A;  3GB0 A;  5HAT A;  2HFS A;  4N77 A;  3A8I A;  4UQT A;  3CDA A;  5BYQ A;  3CCS S;  3JS9 A;  2KYZ A;  4IO9 Q;  1KVI A;  4X64 F;  5AJ3 F;  3GYX B;  2ROP A;  3HO1 A;  3HLU A;  2L08 A;  2BE9 B;  5RUB A;  2HWI A;  2DHH A;  4QR1 A;  3HP6 A;  4OZ1 A;  3A8J A;  1IM4 A;  4NLG A;  2C2M B;  2Y0S D;  2RDD A;  3WC2 A;  3PEJ A;  2KG1 A;  1JLB B;  5THW A;  2HK3 A;  3QGH A;  2ILZ A;  4CTA B;  3TUI C;  5H9F J;  2RUG A;  3KLH A;  1T8E A;  4JI2 J;  2V8H A;  4NL5 A;  1DAR A;  1BMQ B;  1SJR A;  1D8Y A;  2GQQ A;  1GT8 A;  1WC5 A;  4DUY J;  2I8E A;  1LWE B;  2DGQ A;  3DCA A;  1DQ9 A;  2CRL A;  3D7S B;  3MPY A;  1XER A;  1VQ6 S;  4CZC A;  4NEZ A;  4RW9 A;  1BLU A;  3AQO A;  4MIW A;  2CNK B;  5E3C A;  1SIZ A;  5LXY A;  2E5G A;  4ILR A;  3UQS A;  2UZA A;  3TAM A;  2R7Q A;  3CJ8 A;  4OX7 A;  5HO4 A;  3ET6 B;  1Q8L A;  4ALZ A;  3KUE A;  1Y4Z B;  3QRP A;  1XAO A;  2XQC A;  1LW0 B;  4DZ6 A;  2X3G A;  1MRO A;  4ZVU B;  1S1W B;  1C1C B;  1Q53 A;  2FJB B;  4ES1 A;  5IS2 A;  4NYP A;  4ECX A;  2GQ2 A;  2C3P A;  3MM5 B;  5SUH A;  2A3J A;  3NXZ A;  4YFU A;  4PCQ A;  5EWG A;  1FX4 A;  1LKZ A;  4QU7 A;  4O44 A;  3DLG A;  4C8M A;  1GEH A;  1KOH A;  4LSZ B;  4W98 A;  2Y8Y A;  3ZZY A;  4WKY A;  1X5T A;  2VHG A;  4IRK A;  2LCW A;  4I4B A;  2ZH2 A;  4J9U E;  3ELH A;  4UW2 A;  4ZVG A;  2QX0 A;  3H2U B;  4W4M A;  1TFW A;  2EC0 A;  1C0T A;  5D0H A;  2Z2Z A;  1UFK A;  1U8W A;  2MQQ A;  4I6Y A;  4J9Q A;  3IC1 A;  2R2T A;  1EKR A;  1VC6 A;  2AF6 A;  4OYI A;  1HNX J;  2W2P P;  2ROG A;  2J0S D;  2RJZ A;  2ZWP A;  2JEG A;  2BUN A;  5EHH A;  1UKU A;  1U45 A;  3H25 A;  4QWC A;  3MM7 A;  3BB5 A;  3BO3 A;  4CYU A;  2VKZ G;  1URR A;  2GCF A;  1UEK A;  5HQM A;  2CJQ A;  3VGS A;  3AJD A;  1DAX A;  4RW8 B;  4PWD B;  4X4O A;  2LU1 A;  5L9X A;  2JJ4 D;  3W9H A;  1A7G E;  5LT5 A;  5ETM A;  5J2N B;  1SH2 A;  2V8D A;  3UDL A;  1CQN A;  1C1B A;  3ONQ A;  4DHV A;  4FPR A;  5ETP A;  4J9P A;  3PO5 A;  5B0F A;  4LBI A;  1VLY A;  3TZY A;  4X66 J;  2YWE A;  5LL6 d;  5ETL A;  3DU6 A;  5I42 A;  3AD9 C;  4OYP A;  1FI4 A;  1WOR A;  5GAG U;  1QD1 A;  3P6Y C;  1FRL A;  4CH1 A;  4YDX A;  4WU3 A;  1NSQ A;  1RHK B;  1B3T A;  4M5K A;  1ZPW X;  4JV5 F;  1EAR A;  4YP3 A;  3OTD A;  2QYG A;  4KKO B;  3I96 A;  5IM0 A;  5I3U A;  4WXW A;  4FF4 A;  1WHY A;  3IRX B;  2CQ1 A;  4N8O A;  5KFV A;  4CM0 A;  5D78 A;  3TUZ C;  1JLQ B;  3JTP A;  2JZ5 A;  3V4M A;  1NO8 A;  2A0F B;  3JQJ A;  1QSY A;  2X1G A;  1QAY A;  5A6W A;  3O8W A;  3PO4 A;  1VRU B;  2V4R A;  1KLM B;  1YSJ A;  4FYW B;  5JUM A;  1UW4 A;  4BC7 A;  1VQ8 S;  1HWK A;  2L9N A;  1IKY B;  3AOC A;  4DQI A;  1MLA A;  2VJU A;  3EPI A;  2ALZ A;  4WJB A;  3WBZ A;  1IKV A;  3EVM A;  2ACY A;  1UFW A;  4LR8 A;  2W01 A;  3KTQ A;  1HYS A;  3O6Q A;  5BYS A;  2FZK B;  1M0S A;  1CG2 A;  2HNZ A;  1CLF A;  1RZM A;  2BJ3 A;  4P2X A;  3DI6 B;  4K59 A;  5HVG A;  2VG6 A;  5J1E B;  4LQ3 A;  3DNC A;  4DCP B;  1F5B A;  5LOQ A;  1SC4 B;  2JC0 A;  2O1P A;  3HT3 A;  2CDR B;  4B17 A;  3UR0 A;  4RUA A;  2UP1 A;  2ZBP A;  2HZV A;  3KUG A;  1NLT A;  4A8K A;  4EBC A;  2W9C B;  4B3R F;  4HH1 A;  1FDA A;  4U7U K;  3D1H A;  4O3N A;  1G1X A;  2HMI A;  2R2U A;  2FZG B;  2GHW A;  5BXI A;  3DYA B;  4X4P A;  3UCU P;  1FFG B;  2UU9 J;  2JNJ A;  3R7B B;  3QWU A;  5LSL A;  4ZVS B;  5DQG A;  3GR1 A;  2V6A A;  1OY8 A;  4ZVF A;  2ZH5 A;  5DG9 A;  5CCL A;  4UZB A;  4ZVR B;  3H5Y A;  4NYO A;  4B3M F;  2WON A;  4O4G A;  2QSF A;  2QLB B;  1S76 D;  1LWF A;  4BHQ A;  3M1V A;  4BWM A;  2UXC J;  3BDP A;  4C98 A;  7FDR A;  2OEJ A;  3MM6 A;  4L3N A;  4JI1 F;  4TNO A;  5KFG A;  1KVK A;  3QGG A;  1SC3 B;  1N5S A;  4AL6 A;  5IXU A;  1NK0 A;  2HBR B;  3GV5 B;  1REV A;  4RNN A;  3C16 A;  2RIL A;  1YJU A;  4KBI A;  5GME A;  3MPW A;  1LK7 A;  1Y00 A;  4JI4 J;  1FKO A;  3PIP Q;  3NWR A;  4V19 X;  5HQL A;  4A46 A;  3H4B A;  1FRH A;  3PHE A;  4AE5 A;  4DLG A;  2IAJ A;  3ZTR A;  4A8W A;  4BWJ A;  5DDQ C;  1S97 A;  1RT4 B;  3GFH A;  2YKA A;  1ZET A;  1YRX A;  1YBT A;  2AEJ A;  1H7X A;  2V67 A;  3GQC A;  4DUZ F;  1KQK A;  3CNQ P;  1AYE A;  1U2C A;  2ZKU A;  4E8U A;  1RCX B;  3OW2 R;  4FKY A;  3P49 B;  3HD1 A;  1AB8 A;  1KOO A;  1RAD B;  3EPG A;  1DTQ B;  2IMW P;  4HDG A;  3CED A;  4UOH A;  2YPY A;  2OIH A;  1RB0 A;  4I2Q A;  5DGA A;  2XO7 A;  4I1T A;  3HK2 A;  3SV3 A;  2F4F A;  2I6W A;  5H9E J;  4Q45 A;  2VZ9 A;  4B9V A;  3VZH A;  1UTA A;  4J91 A;  4MIB A;  3VF0 B;  2IA6 A;  2QZ8 A;  3G86 A;  2IHR 1;  1XMB A;  3AGZ A;  2RHS B;  4KIA A;  3UD5 A;  3KG1 A;  2HK2 A;  2O3D A;  1MWZ A;  3HCX A;  5GAE U;  5KG6 A;  3M8Q B;  4I7F A;  4FXW A;  2QIF A;  1W7W A;  5F9L A;  3Q8V A;  2KVI A;  3DRP B;  4NA2 A;  4U67 Q;  4ELU A;  1P1L A;  4RW6 A;  1TQL A;  1MW7 A;  5C25 A;  3K58 A;  5C42 A;  3NS6 A;  5KG4 A;  3N5F A;  4HI1 A;  2NSB A;  4EZ6 A;  5B0E A;  2VG7 B;  2B5J B;  3D2W A;  2Z2L A;  4ECV A;  3ZTO A;  2M2B A;  1YIT S;  2HWT A;  1NME B;  3AFG A;  4QCL A;  3IA0 A;  1MN7 A;  3QIP B;  5D0G A;  1V9O A;  3TYT A;  3C19 A;  4RBT A;  1NSP A;  5IQ6 A;  2XHW A;  1BWE A;  3NWG A;  2HLT A;  1U1P A;  2OLW A;  2V4J A;  4FNH A;  1WDT A;  3NMR A;  5AXN A;  3LP0 A;  3L7U A;  4URG A;  1N33 J;  5K14 B;  2PO4 A;  1J5O B;  4EUV A;  3K89 A;  1S6Q B;  3ILJ A;  2Q6B A;  3OR2 B;  4QPX A;  2B6A A;  4KO0 B;  2F9D A;  1ZM4 A;  3K5P A;  2NQP A;  4U95 A;  3PW2 A;  3DDI A;  2AYM A;  1XNR F;  4Z37 A;  1KS2 A;  2YKP A;  2CJX B;  4LVO P;  3RZA A;  4DN9 A;  2VG5 A;  3EWG A;  1QTN B;  2FHM A;  2CPI A;  4NCG A;  5KFC A;  2HHT A;  1VGY A;  1M5K C;  4ZN3 A;  4JBC A;  1VQP S;  2MQN A;  1IWA A;  2RF2 B;  1F60 B;  2NYH A;  1VQN S;  5CYM B;  2MGZ B;  3MM8 A;  1WHX A;  4OV1 A;  1EQ0 A;  5KFX A;  4O4R A;  1T95 A;  1PSD A;  2RDJ A;  1FVQ A;  2R2S A;  3WIU A;  4QBU A;  4LR9 A;  1XR7 A;  5HP1 B;  1B0P A;  1SH0 A;  1UJ5 A;  1OQ6 A;  3BM7 A;  1MU2 B;  4P2M A;  3EDR B;  3MUM P;  3LWM A;  1KON A;  1X5P A;  2V5H G;  4NLR A;  1RSC A;  1HBM B;  5CZV A;  2WSE C;  3M30 B;  4IUF A;  3I4P A;  2NXU A;  2P6S A;  3T19 A;  2DIV A;  4YHH F;  4R8U A;  2RRB A;  4HAC A;  3BQ1 A;  2IM2 A;  1QAJ A;  2BM0 A;  4Y6I A;  2GX8 A;  3M6U A;  3UN3 A;  2QTW A;  2R7S A;  3ILI A;  1U4B A;  2IYI A;  3LGM A;  4ED5 A;  3DC2 A;  1M5P C;  4B02 A;  2FY1 A;  5F0W A;  3BEG B;  2QFJ A;  3AGY A;  3A3P B;  1KTQ A;  2CQI A;  5BR8 J;  4LQ9 A;  2FZC B;  3D4J A;  2W4C A;  4DPT A;  3VGT A;  1UMJ A;  4L76 A;  4GVB A;  2CZ9 A;  1NBE B;  4ELV A;  2J7W A;  4M5D A;  4KV8 B;  1V3Z A;  5F9N A;  4KGX B;  1MMD A;  3MEC B;  4EBE A;  3OTE A;  9RUB A;  4UST A;  2N7C A;  3HUL A;  4ELT A;  2A18 A;  1SBR A;  3ADA C;  3FBC A;  1S6P A;  1B0T A;  1OYE A;  2FLP A;  1RAA B;  3MEG B;  4ITS A;  3PX4 A;  1R8C A;  3LP2 A;  3CCL S;  5HLF B;  2W4D A;  1X7V A;  5A8W A;  2EKN A;  2DR6 A;  2DGS A;  1K1Q A;  1XMQ J;  3OLA A;  2AJ0 A;  4LF1 A;  2HIY A;  2XMW A;  3TA1 A;  1NDK A;  1RTI B;  1MG7 A;  2FVQ A;  4UTG A;  2I0X A;  5CH7 B;  2YKQ A;  4QWD A;  3TAR A;  3C6E C;  2OPQ B;  4DV1 J;  3DOM A;  2JZ8 A;  2IFX A;  4HTJ A;  1XK8 A;  3DLJ A;  4PPZ A;  1FJ7 A;  4FF2 A;  3R5G A;  4DX6 A;  4AFF A;  2NXN A;  2IM0 A;  1WF0 A;  2RS8 A;  4IFY A;  1FRX A;  3HSD A;  4LMZ A;  2VDI A;  1VYA A;  4BDP A;  2PFF B;  1Y10 A;  1CPZ A;  1LFP A;  3E01 A;  4OX8 A;  4PG6 A;  2EC2 A;  4CH7 A;  3LP1 B;  4F8R A;  4PQA A;  2XGQ A;  5LXR A;  4O3P A;  3JAM Y;  3H2L A;  2XSJ A;  2RRN A;  2AT1 B;  2Y1R I;  1KBR A;  1HQU A;  3VGV A;  3L9Z A;  3MOZ A;  4WIQ A;  2YQ0 A;  2B4U A;  4NA3 A;  1TL5 A;  4PXD A;  4J9V A;  5KT4 A;  1FWP A;  1IBM J;  2AJ4 A;  1CEZ A;  4TKT A;  1J5E F;  1S59 A;  1T9U A;  2L9D A;  3ZZP A;  3CDU A;  2V2V A;  4I69 A;  2CPH A;  5EWE A;  2XHC A;  2OD6 A;  4J80 A;  1WEY A;  4O3O A;  1JLE B;  2NS1 B;  4A4J A;  4A8M P;  4MKY A;  4TY9 A;  2HW3 A;  1VQY A;  3JSM B;  2MKI A;  4NXN F;  3DGV A;  3QFH A;  1B4S A;  2IYG A;  3EYZ A;  2V94 A;  5HBM A;  1GNK A;  2HGN A;  1HBO B;  2JEJ A;  1VQO S;  2WOM B;  1N48 A;  3NNH A;  1SUQ A;  3OJS A;  3QRQ A;  3E8O A;  4CWB A;  2G2Z A;  3VAK A;  1N0V C;  1CJV A;  4MIA A;  1RT5 B;  4JV1 A;  1G4C A;  3OR1 B;  1HNV B;  3IAM 9;  4BS2 A;  4PXE A;  3DRS A;  1P9Q C;  1UA1 A;  3V81 B;  1RWX B;  3J7A 1;  4OIX A;  1WG1 A;  3KDO A;  1JX4 A;  4N47 A;  3BS9 A;  2VIC A;  2DYA A;  1FKP A;  1NAQ A;  3I32 A;  2ZD1 B;  4C97 A;  3D28 A;  4I2P A;  1TL1 B;  2CQH A;  2EFV A;  3A12 A;  4DUT A;  1FXR A;  3Q89 A;  1RT6 A;  2RQM A;  1PO6 A;  2DH9 A;  4FS2 A;  4TU8 A;  2HQG A;  3Q24 A;  5AXK A;  2DNY A;  1JLA A;  4OI2 A;  4JI0 F;  1WD6 A;  3AB4 B;  4DR2 F;  1YVF A;  1RWN B;  2HRY A;  2QL7 B;  3TR5 A;  1T05 A;  2P5V A;  4N56 A;  3IR7 B;  1IKX B;  4F4A A;  4QU6 A;  2BJ9 A;  1HBN B;  2BXJ A;  1HBU A;  4XAK A;  2MDA A;  4C0O C;  1H2V Z;  1AXQ A;  4DV3 J;  3QLH B;  4ZVO B;  3JTO A;  2EXU A;  3PHT A;  3MDF A;  1RHU B;  1LWC A;  5KFU A;  3TQ1 A;  3LGN A;  3W61 A;  4C11 B;  3MEE B;  3X3U A;  2G0I A;  3PM9 A;  2F8H A;  4X4Q A;  5D3G A;  3BSA A;  1X5S A;  1LNQ A;  2G2O A;  3T1H J;  4JI7 J;  2ADB A;  1YDL A;  2RQK A;  2A2C A;  2FHJ A;  3D1O A;  1S1V B;  2P2C B;  2BJ8 A;  2MKY A;  2C1E B;  4G3I A;  1YKW A;  2YQ3 A;  4DSL A;  2HKE A;  3PYE A;  1OIA A;  2DNQ A;  2IC3 B;  3MMB B;  4ECR A;  1N4L A;  1FA0 A;  3LPE A;  3M6W A;  2F8E X;  4QYZ K;  1AZS B;  3M2U A;  2EFO A;  4Y2K A;  4OYO A;  4Y00 A;  2R7U A;  2BQU A;  1UPP A;  2E5I A;  4ZLN A;  1L3T A;  1T7P A;  1EQM A;  2FC9 A;  4BCA A;  4OQJ A;  1SQF A;  1QAX A;  5F0U A;  1RT7 A;  3S01 A;  2JHE A;  5DJB A;  1TL7 B;  2QE5 A;  3GSI A;  2V9W A;  2VQE J;  1OWX A;  1HQ2 A;  3ITH A;  4GKK F;  2DY1 A;  2E5L J;  2BA9 A;  3LW5 C;  3RG6 A;  1G3O A;  3UNY A;  3PKY A;  1Y3J A;  3R8Y A;  2JRS A;  1JXL A;  3SCL E;  3M2R B;  1N5Y B;  3MTK A;  4JI8 F;  4JV0 A;  3UI3 A;  3TQE A;  2DGO A;  2CKW A;  1K47 A;  1VJW A;  1TZ0 A;  2FHK A;  3CJ5 A;  3DMJ A;  1AFJ A;  3KLE B;  3VCD A;  1REG X;  4NEY A;  3ETO A;  2KTQ A;  2HHH F;  2AJ2 A;  1RGV A;  2JOQ A;  4GMK A;  3NGR A;  2BOA A;  1G6B A;  3AD7 C;  4DL5 A;  2Z57 B;  1UFL A;  3M8P B;  3N6M A;  4NLQ A;  3TUP A;  1NXI A;  4PWW A;  1NK6 A;  1SKR A;  1X4F A;  5M2P A;  4CO5 A;  4GKJ F;  3HHL A;  1QVG R;  4LRA A;  3QZ8 A;  1VC0 A;  5CYQ A;  2CWX A;  1YJV A;  3KHH A;  1TK0 A;  4WKR A;  1X60 A;  4XPC A;  3PW4 A;  4DI6 A;  1FDB A;  5DZ6 A;  2AU0 A;  2W9A A;  3I0S B;  2DCU B;  2EK1 A;  4C8Y A;  2YKM A;  5F8N A;  1R6Y A;  3H59 A;  3HHN B;  1R3N A;  3TJ8 A;  1TK5 A;  1GTE A;  3IR5 B;  2C28 A;  1HHS A;  5EX0 A;  1TK8 A;  2W1B A;  3LAM A;  4DV2 F;  3GG0 A;  1S1X A;  1S1U B;  3WX8 A;  3JAM U;  2Y0B B;  2XBP A;  3ISN C;  3PFE A;  2X3D A;  1AUD A;  4HL9 A;  3W2V B;  3DLE B;  5IOL A;  3MMA B;  2Z58 B;  1CS4 A;  1T0T V;  4PQU A;  3G6E S;  4OHZ A;  2RKI B;  3CJQ A;  1E6V A;  3G87 A;  1S1T A;  4HKQ A;  4LFA F;  2WVD A;  2HFV A;  3MTJ A;  3Q86 A;  2NZ4 A;  3PJW A;  2C2R A;  2WK4 A;  2Z8Q A;  1SC6 A;  2GGP A;  1KC8 T;  3CD5 A;  4OYZ A;  4F7V A;  2B51 A;  3A13 A;  3IWX A;  2M0G B;  2CVI A;  4ZPD A;  1PBA A;  3IG1 B;  2BE2 A;  5FDL B;  9ATC B;  1NDL A;  3KFW X;  3L95 X;  2H1Y A;  2IM3 A;  1RWV B;  2NUH A;  2Z30 B;  3PW0 A;  4PAB A;  4B3T F;  3FK4 A;  1K73 T;  3CPW R;  2WB4 A;  2B8Q A;  2YWF A;  3KK2 B;  3LOU A;  4PYD A;  1HI1 A;  2GIF A;  1R6V A;  2H48 B;  1KN6 A;  4AL7 A;  2XLJ A;  1S9E B;  4MH8 A;  1XR5 A;  3HDS A;  2I5J B;  1MNE A;  1XBW A;  2Y1I A;  3GII A;  2Z2Y B;  2J6S A;  4ZP8 A;  4YR2 A;  2F4V J;  4P2S A;  1ROF A;  3W2W B;  1AFI A;  2L48 A;  3VAL A;  2E29 A;  4H4O B;  1HAR A;  2H9Z A;  4WU2 A;  2XMA A;  3IRW P;  4X4T A;  3J7Y I;  1YIJ S;  3DFE A;  2POK A;  5E2Q A;  2CQ4 A;  5A6P A;  1SJQ A;  3M32 B;  4EU0 A;  3M9M B;  3OSP A;  2MZS A;  4ZVH A;  4DR6 F;  3ILO A;  1ZTW A;  4IDK B;  1L3U A;  5ITH A;  1HLW A;  5CD4 H;  2J6T A;  4HHJ A;  4M5L A;  1AA1 B;  4P2F A;  2MB0 B;  3JSB A;  2ZH4 A;  1DQ8 A;  4DX8 H;  2BAB A;  3W5Z A;  3RBZ A;  1CJK A;  4K4X A;  4DJB A;  4M63 A;  2OI2 A;  3D66 A;  2YH0 A;  3MR2 A;  3DDK A;  3MMJ A;  4WZM A;  1B64 A;  4DPU A;  4F4Y A;  4N76 A;  1L3K A;  2BJE A;  3IGV A;  4C8N A;  3KLV A;  2ILY A;  2W8L A;  3BPS P;  3Q23 A;  5AE2 A;  1RHJ B;  2XZD B;  3CJT A;  1NB2 A;  5KT2 A;  4DR3 J;  4PG7 A;  3UWT A;  3IGN A;  5DZ7 A;  3D3C J;  2IJF A;  2ADC A;  2DHA A;  2B7B B;  4QOT A;  1KFD A;  1NJX A;  4U9R A;  1NM2 A;  4FBU A;  1OO0 B;  3L3C A;  4P52 A;  4OHW A;  4H4K C;  1VBY A;  3A8K A;  3ZZU A;  1Q16 B;  2K1R A;  3MCO A;  2L3M A;  3NCP A;  1L3V A;  5IWA J;  4LF6 F;  2B43 A;  2YQ1 A;  3TVK A;  4K5S A;  1TMM A;  4A47 A;  3CME S;  1FX2 A;  4KT0 C;  2GQC A;  3DOK B;  5KFM A;  3NNC A;  3C2P A;  5JJB A;  4YR3 A;  4K5R A;  3EZO A;  1NKC A;  2D7S A;  4DG1 B;  4HYK A;  4FXD A;  1TKX B;  4KGK A;  3DGP B;  3EUN A;  3PYD A;  1Y5I B;  2XUL A;  2Q43 A;  5AJ3 J;  4X64 J;  3EGW B;  5JMN A;  2BR0 A;  3KHG A;  3OFE A;  4LF9 F;  1RTD B;  3UDV A;  4KR0 B;  3HKZ D;  3DRR B;  3ET6 A;  1PAE X;  4BC9 A;  4Q8F A;  5D77 A;  3P4U B;  3NBP A;  1LW0 A;  4YB7 A;  3ZNU A;  2BQR A;  1S1W A;  3F44 A;  3OFF A;  3B8H A;  5DGB A;  3EMT A;  1T3N A;  3NCQ A;  3BYR A;  4DX7 A;  1HW9 A;  2OPP B;  3MUT P;  3MM5 A;  2XC9 A;  4KH1 B;  2N3O A;  4IQX A;  1RWP B;  1R0C B;  1H72 C;  3DLH A;  2F65 A;  4J9S A;  3SFU A;  4ZMM A;  2UUT A;  2D9P A;  5KG7 A;  1DQA A;  1RAI B;  2KL8 A;  5G0R A;  2K3I A;  1PYO B;  2GW8 A;  1F2G A;  3FQL A;  2PT0 A;  3UN2 A;  3NS7 B;  4ZPC A;  4B3S F;  2VKR A;  1UJ6 A;  1H73 A;  3QWP A;  3DLB A;  1LW2 A;  4LSN B;  3ZTP A;  4WII A;  1F6T A;  2OPR B;  1DY3 A;  2CWK A;  4EO8 A;  2ZBI A;  4MK7 A;  4HEA 9;  2XZT B;  2EVZ A;  1SVD A;  1ZYQ A;  3PTW A;  1X4H A;  2WRM A;  4ES2 A;  3VQT A;  4DF8 A;  2AMC B;  2LEB A;  4PWD A;  4DR7 F;  5KFY A;  1YTY A;  2KYX A;  1KEK A;  1WAC A;  2NXE A;  1FT8 A;  5J2N A;  1RT1 B;  3GG1 A;  2HS3 A;  1RLD A;  4DPY A;  2UUW A;  2GJI A;  1I3O B;  1SIW B;  2PSZ A;  4CT8 A;  2JX2 A;  2FTR A;  2QJ3 A;  6FD1 A;  1QDU B;  1N88 A;  2MQM A;  4E2F B;  3THT A;  4DV5 F;  3AJ1 A;  3OFH A;  1HD0 A;  2XMJ A;  2KFN A;  4F3M A;  3D9B A;  4KKO A;  5K20 B;  3MMC B;  3GSD A;  1TAU A;  2HNY B;  4HVZ A;  2DHS A;  2AKW B;  3HHE A;  4F0M A;  2DH8 A;  1NZ8 A;  2MKK A;  4USI A;  1JLQ A;  4OL8 A;  3PR5 B;  1KQS R;  1XC9 A;  1FE0 A;  3AOD A;  1VRU A;  1KLM A;  4O23 A;  2RUS A;  1F1B B;  1M90 T;  5T7L B;  2GIR A;  3V6D A;  2XY6 A;  1NLK L;  2KZM A;  1IKY A;  1IJE B;  3BN7 A;  2DK2 A;  2LEA A;  2L9W A;  3KNG A;  3M4X A;  1E6Y B;  2DHX A;  2VPW B;  1Q0N A;  2GV1 A;  3GON A;  1RQ0 A;  2KFZ A;  2IVY A;  4K4Y A;  2O66 A;  3B82 A;  4ECW A;  2OKQ A;  3DI6 A;  1VRT B;  4P7T A;  4RNF A;  1X4D A;  4RU9 A;  3AA8 A;  2CZV C;  4JV5 J;  4ZPA A;  5C2C A;  1R89 A;  2GVD B;  4DN0 A;  4ZLP A;  1A9N B;  2IRU A;  2E1C A;  3EXY A;  3BSN A;  4HI2 A;  4KE5 A;  3N01 A;  3P96 A;  2DRA A;  2B3T B;  2EFQ A;  5HMW A;  2W9C A;  2W24 A;  3HVW A;  4DFP A;  3CB4 A;  1IM6 A;  3NGS A;  1APS A;  4OHV A;  1OPZ A;  5ETO A;  2UV8 A;  1P9Y A;  2B7C B;  1YX2 A;  4UZC A;  2AJ1 A;  2ZHA A;  2VOO A;  4TU7 A;  3QRR A;  2I2Y A;  2BJ7 A;  5SZT A;  3L7O A;  3M2V B;  4ILM A;  1BQN B;  3U02 A;  2HS0 A;  3VV2 B;  2B9E A;  4M8L A;  3T5H A;  2XSF A;  4Q2L A;  2PGC A;  2QGF B;  4RR5 A;  4YUD A;  1ZPV A;  3TEG A;  1H98 A;  5JVH Q;  2BM1 A;  1X5O A;  3LAK A;  2NPF A;  5B0A A;  2VA3 A;  4IG0 A;  3BKT A;  1G2E A;  3MAH A;  2ALY B;  2MYF A;  4CRJ A;  3ZZR A;  2D3O 1;  3QJJ A;  3FSX A;  2B0G A;  1PG5 B;  2IDE A;  5KFO A;  4KRW A;  5AE1 A;  4B3R J;  1VCT A;  3CJ4 A;  4KPC A;  3HJV A;  4MK8 A;  5KFS A;  3NS5 A;  3QNW B;  2XCA A;  4WFX A;  2I1R A;  2V2Z A;  4OX9 F;  4KPY A;  4UUX A;  4NLP A;  4NLY A;  3C14 B;  3OD2 A;  1RUS A;  1NKE A;  3BJY A;  3VAG A;  4OJH A;  4UQG A;  4ID5 B;  5D15 A;  2WTF A;  1ZS6 A;  4DPO A;  4DL0 C;  1SV5 B;  3DHW C;  2VFR A;  4K2J A;  4J9N A;  1I51 B;  4B3M J;  3TX0 A;  4RNM A;  5EUH A;  1RAO A;  1UCN A;  1C0U B;  4TVA B;  2HND A;  5B0B A;  3RUB L;  2CDQ A;  4ZVT B;  2BW7 A;  5JVG Q;  2H3E B;  4OI3 A;  4JI1 J;  3K8W A;  1OJ4 A;  2Z4P A;  4OYM A;  1LWX A;  2PEH A;  2Y9H A;  3AH6 A;  2XM3 A;  4RW9 B;  1QTM A;  1BD6 A;  1YG0 A;  1QAI A;  2E7V A;  2M8D B;  2WSF C;  3TAM B;  5T41 A;  2X1F A;  1JLG B;  2NYI A;  1FKA F;  4NLO A;  5CD4 A;  2M9K A;  3N6N A;  3G6Y A;  2FB0 A;  1ZOT A;  2XS2 A;  2Y1L B;  3M8Q A;  1TMJ A;  4LF7 F;  1YJN S;  2G1H A;  4E0D A;  4YOE A;  2V63 A;  3AXK A;  1SL1 A;  3DRP A;  1N36 F;  3FBE A;  4FNI A;  1HR0 F;  4DUZ J;  1N54 B;  2OEM A;  1RKI A;  1UET A;  3M6V A;  3DLG B;  2QMU B;  4ZPT R;  5DS7 A;  4F4Z A;  3VAJ A;  5HRO B;  1YZ7 A;  1NZA A;  2VFS A;  2B5J A;  2VG7 A;  4Q0B A;  4OLO A;  4LF5 F;  2DD8 S;  3PW5 A;  2CQC A;  3CC7 S;  1HNZ F;  3G96 A;  2PN6 A;  4F4K A;  2JFK A;  1XEZ A;  1M5S A;  2P9E A;  4WFB Q;  5KT3 A;  2JEI A;  1GXU A;  3UCZ P;  2M3D A;  3T5K A;  3QIP A;  1GK8 A;  1UEV A;  1TKT B;  4ZVQ B;  2ZDP A;  2J9E A;  1Q5V A;  4DF4 A;  4DSI A;  3OTC A;  3A3O B;  3I82 A;  1P8G A;  5A2Q Y;  1FRJ A;  4X4U A;  4QIF A;  1SH3 A;  1RT2 B;  1ZA2 B;  1DJ0 A;  4ANE A;  4E98 A;  2OAU A;  4CLK A;  1TAQ A;  4F2S A;  1J5O A;  1DRZ A;  1NPR A; 
#chains in the Genus database with same CATH homology
 1EAR A;  2QLD A;  4L3K A;  3TJA A;  3NY0 A;  3I38 A;  3AGX A;  1EB0 A;  1GMW A;  1GMU A;  1C3G A;  1NLT A;  2B26 A;  1XAO A;  2Q2G A;  1GMW D;  3LA0 A;  3TJ8 A;  1GMV A;  3L9Z A;  3LZ8 A;  3AGZ A;  3NXZ A;  3AGY A;  4J80 A;  2HFV A;  3TJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...