4L3KA

Crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
MLITKIVGHIDDYESSDKKVDWLEVEWEDLNKRILRKETENGTDIAIKLENSGTLRYGDVLYESDDTLIAIRTKLEKVYVIKPQTMQEMGKMAFEIGNRHTMCIIEDDEILVRYDKTLEKLIDEVGVSYEQSERRFKEPFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selectivity of Ni(II) and Zn(II) binding to Sporosarcina pasteurii UreE, a metallochaperone in the urease assembly: a calorimetric and crystallographic study.
pubmed doi rcsb
source organism Sporosarcina pasteurii
molecule tags Chaperone
molecule keywords Urease accessory protein UreE
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 4l3kA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 4l3kA02
1C3GA 3AGXA 3NXZA 1EARA 2HFVA 3AGZA 3LA0A 3TJ9A 3I38A 1EB0A 1GMWA 2Q2GA 1GMUA 1NLTA 3L9ZA 2B26A 4L3KA 3AGYA 1GMVA 3LZ8A 3TJ8A 1XAOA 1GMWD 2QLDA 3TJAA 3NY0A 4J80A
chains in the Genus database with same CATH superfamily
5ETSA 1MLAA 3U27A 3OUYB 1NK5A 1KTVA 2KYZA 5D4PA 5ETOA 1GTHA 1X7VA 2BE2B 3AJ1A 1I51B 3NOGA 4U9RA 5K8NA 4JI5J 1T05B 2YX7A 1V3ZA 3EMTA 3JB9k 3VAFA 3W3SA 1FJGF 5JUMA 1QAJA 2ZH6A 3NGKA 4C3LA 2FJBB 3MECA 4ZPVR 5DRKA 4RW7A 4URGA 1LV5A 3GFHA 2O67A 1QSYA 5KT7A 2OTJS 4P52A 2Z56B 5HLFB 1FTCA 1D0EA 2W01A 1I6JA 3UE2A 3DLBA 4OX6A 1Y5NB 2CPXA 2DISA 2FIUA 2GIRA 2RRBA 3N28A 1TV6A 5F9LA 2UUCF 3MAAB 2JNJA 4PAAA 4ZLJA 4FS2A 4C8OA 2FLPA 1G4CA 2XMJA 5KG2A 4P73A 1GXTA 3FMBA 4KGMA 1T9XA 3DHXA 4RJVA 4HYKA 1SH0A 3SMZA 3PKMA 2DNNA 2Y8YA 4ZP7A 3D7SB 2VIHA 4F50A 1WNEA 3TX8A 1H0HB 4ID5A 1N5SA 1KRPA 3KLFB 2BQ3A 2XNRA 3NL0A 3SQGA 2QX0A 2W25A 4CT9A 1DBDA 3DRPA 1U49A 2E5LJ 1KEKA 3DOMA 3M30A 1FRMA 1YDLA 1MMNA 4YY3J 5I3UB 4DUYF 4F3MA 1N5VA 4BCAA 1G6BA 1LW0B 2H5JB 2E44A 4LFCF 4HKQA 4KB7A 1PILA 4RUBA 3MPWA 3V6KA 4YY3F 5CQGA 4FF1A 3V6DB 4RUHA 2M9KA 4CO4A 3H2UB 5KFFA 2J9DE 2ZBQA 2F40A 2BJEA 1NZAA 2EFOA 4Q0BB 1F2GA 1S7HA 2WSEC 4JI6J 1OY9A 2WVCA 1HW8A 1FFGB 4DV7J 3A8IA 3ILOA 3NGUA 4FVCA 4PWUA 4ZVQB 2RS2A 1HIYA 1U7LA 2CPIA 2Z0GA 4JB8B 4YB5A 1O51A 2LLZA 2DIUA 4FKYA 3CJ0A 3TAMA 3FSYA 3W61A 1WI8A 5ADZA 1ZAWA 3DLKB 2AD9A 4DV1F 1KLMB 4WCEQ 4RNMA 2UXBJ 2ZE2A 1UP1A 2C2ZB 2BV3A 2RDJA 2N4DA 2WBMA 5KT5A 2ZWPA 4IFVA 2UV8A 2GNKA 4HHJA 3FUYA 1ZZNA 2IRYA 2R42A 3PYDA 3RRHA 3R1LA 4Y00A 4LFAJ 4IR1A 2DRAA 3D67A 4U7CA 2XCAA 3GIIA 2YVSA 2MZ1A 1SL0A 1K73T 2GVDB 1F9HA 2P5VA 3DXBA 4HEA9 1Y3KA 2OGUA 4PQUA 2QSFA 4J9QA 4ZHRA 4DL4A 1IBKF 3G86A 2IC3B 4NLDA 3ZZYA 1HWUA 5GADU 1QD1A 2AJ4A 2W2PP 1UZHA 3L7PA 2LQ9A 3DLLQ 2XLIA 2PI4A 3IC1A 2BMBA 3MMBA 4O3SA 1WKLA 3HHKA 4Y6IA 3EXYA 3GFYA 3PHTA 3G87A 1RT7B 2LDYA 3UD5A 3UDLA 4MK7A 3UQSA 2AWZA 3EXCX 3BO3A 2YNFB 4DL3A 3EICA 2QN6B 1W2BR 4OV1A 4NCBA 4FBTA 1HLWA 1CBKA 4NYOA 4TXSA 1APSA 2QE5A 3DC2A 1QM9A 2VFTA 1VC0A 3D6FB 3M8QA 2ZM6F 2LXIA 4HR2A 3N6LA 1RDRA 3F73A 3A13A 1VGYA 2B8PA 1S72S 4LRCA 4AL5A 4Z7CA 4UOFA 5EWEA 3V4MA 4QU7A 3PACA 2DRDA 4OX8A 3TA0A 3W60A 2E66A 2EI5A 2Q3PA 2G2YA 2WVFA 5M2UA 3B4MA 4DV2F 1U1RA 1JLGB 2EC2A 3M9MB 4DV3F 1DURA 1A7GE 1NHUA 4NLOA 3NS6A 5HMXA 1BWVA 2BE9B 2M52A 5AXMA 1BLUA 3PW4A 2XSJB 1C4AA 3QT5A 1X8DA 2R7OA 2H9ZA 4CH7A 2YQ3A 1NDKA 3ILJA 4CLSA 1S1UB 4RUAA 4ZVTB 5LMNJ 3N5BA 1IKVB 1U2CA 1RTHA 4LT6A 4WTOB 1DAXA 3BJYA 2RKIB 2NR0A 2CA9A 1FHTA 2WZ1A 4WE1A 3W9JA 2B0GA 3NWRA 3C46A 1U26A 3N9UC 2HWHA 4G1PA 3AD9C 4QOTA 1HBMB 1M5VC 4DL6A 4IO1A 4YR0A 2MQOA 1VQ9S 3A8KA 4F2RA 4LF5F 2XGQA 2LDIA 5LMNF 1PO6A 4DN9A 2PSZA 2UVRA 2IVFB 2KO1A 1S97A 4ELUA 2LP4A 2QGFB 1UFWA 5KFUA 3FQKA 4H4KA 2HK2A 4FXDA 4RO0A 2ZKTA 1J2VA 1PKUA 1CC7A 4RW6A 4CT8A 3GIMA 2VPWB 2DO4A 3ZZ0A 2RS8A 3NS5A 3PIOQ 1IUJA 3JQMA 4HACB 2F8MA 4I2PB 2EPIA 1VRTB 4USJC 1FERA 5D0EA 1Y5IB 4NMLA 4YDXA 2POKA 3G82A 5C25B 1SL1A 3SCLE 2DY1A 2JEIA 2J0XA 4X4VA 1Z2LA 3NCPA 4PG5A 4ENOA 5AT1B 2E5HA 3EX7B 3PW5A 4DR5J 3M2VB 2MJUA 2F4FA 1RP5A 2Z8QA 1DARA 3MTKA 4MAKA 1WG5A 3THPA 1S57A 1XN9A 3KDNA 2A0FB 4Y2AA 1F9EB 3TUPA 4HACA 4KJIA 1RTJA 2VV5A 2E9TA 2FVRA 3PM9A 2J5AA 3VAJA 2VDHA 1X5PA 1ZZFA 2V5HG 5KFEA 2DGXA 3GJQB 5HVHA 1NBEB 4X65J 3MI7X 1UMJA 2DCLA 2Z4PA 3H5UA 2WVBA 8RUCA 3F56A 2IPOB 3NAIA 1HBMA 3R1HA 3CUNA 1T03A 1HQUA 4MH8A 2HHPA 1T0TV 1N5TA 4WE1B 2GIQA 1FRJA 1KQGB 1U48A 4K4SA 3ULHA 3EZ5A 1XMQJ 1K47A 1HYSA 2ZZMA 1SC3B 2DGTA 2UXBF 1S1UA 5E3AA 4F67A 4B3OA 3LP1B 2FLNA 2QT7A 2RQCA 1IN0A 2DNHA 2Y8WA 1PG5B 1UAWA 2GGPA 2NXCA 2OHDA 4FYWB 2LU2A 3R5BA 3GP9A 4P2XA 3RZAA 3H40A 3R2CJ 2CNKB 3ETMA 4X65F 2LECA 3FZ2A 1RWOB 4TKTA 2CRLA 3VGVA 1UW4A 4OZ1A 4C3MA 4DV7F 3QRQA 1Q8KA 3L7UA 1ZS6A 3S6EA 1I94F 4KHPJ 1FEHA 3R3TA 4DSKA 3V6JA 1C1CB 2ZBPA 4KY3A 3ZC4A 4I67A 3HHEA 5D4OA 2EKNA 2DNQA 4DQPA 1JLEB 1UZDA 3MM6B 3IWNC 4K4XA 2V2KA 5HBMB 4EYHB 1R0AA 1YJVA 4PPDA 1N32J 4ZCLA 4IH6A 1WHXA 1M5HA 2M0GB 5DETA 1J5OA 1RT3A 2P6SA 2L41A 3TEHB 4HH1A 2ZH7A 5GMEA 1BD6A 1YX2A 4U67Q 2AGOA 1VJWA 2DXEA 4ECRA 1VI7A 2WVDA 3O2IA 4O0NA 2IBKA 4WBFA 5KG3A 3PZPA 1TFYA 4PWWA 4DFPA 3RW6A 4WKYA 2QO3A 5KFLA 2HZAA 5EWFA 1N4LA 2BOPA 3HFVA 3ZXWA 2PI5A 3P4UB 3LPYA 1WC1A 3B6BA 5CH7B 3BDEA 3DRRA 3OQ2A 2HBYB 3D3BJ 1EJ7L 2OSRA 3EZOA 5KG4A 1U47A 1QDUB 3DMJB 4YR3A 3RYLA 4N56A 1ZPVA 2H54B 4IKAA 1L3KA 1LKZA 5ETNA 4WKRA 3MD3A 3QYYA 1ZM4A 4IUFA 2RD5C 1TL3B 3WC2A 3AD7C 3UWTA 3C3LA 1FJGJ 1RHRB 3MCSA 2E9RX 3QNWB 2CFXA 2JL9A 1RBLA 3GWCA 5KT3A 4LF9J 3QAUA 2IA6A 2KRRA 3DLKA 3OTEA 1OIAA 2NUHA 5F41A 2VICA 3E51A 3AGYA 4NLPA 2QJ3A 2GA7A 1JLCB 3NGSA 2YX1A 2V9KA 3OR1A 2GZOA 3TP2A 2W8LA 3I5BA 5G4DA 4Z2XA 5CD4H 4M5DB 3Q8SB 5BR8F 2LYVA 4PUOB 2B7BB 5KG5A 3THVA 1RLCL 2W9CB 4WFXA 1M90T 4LBIA 1UA0A 3OSPA 2AZ3A 4NI2B 2QFJA 2RHSB 1RXOB 2IFXA 5B0CA 5L1IA 3HPOA 3O6QA 3MCOA 3PX0A 1ZPWX 2HQGA 2QLBB 1OPIA 4GO5X 1M5PC 4QR0A 4DR7F 2R7VA 2F9DA 4DL0C 3DRPB 3CB4A 2D9OA 2FVCA 5GAEI 2WB1D 4YB6A 1Q7YT 2ZD1B 1HWIA 2DNPA 3GSDA 1U4BA 1X0FA 2DH7A 1VYAA 2YNHB 3M9NB 1KSPA 4F4ZA 4YDDB 5IWAF 2NSCA 4CNZA 4CLFA 4EBCA 1NKCA 5E41A 3UW1A 4NEYA 2G2ZA 1UPMB 3PW2A 1FDNA 1AYEA 3PO4A 5CABA 3QIDA 3EDRB 2QRRA 3TVYA 1X5OA 3LUYA 4F2SA 1RHKB 3CJRA 3RB0A 4O3OA 3RGIA 2DXDA 4F36A 2CJ9A 3TANA 1QSLA 2FHKA 1G2EA 4LF9F 2F1FA 1RAHB 2HS3A 4NYPA 4QWBA 4Z37A 3CCES 1P1TA 3Q2SC 3IN5A 2HBZB 2Z57B 4LRAA 3T19A 4N7TA 3OUYA 4O3RA 3C6TB 1N52B 3UNYA 3AY0A 2R7XA 1XK8A 2AV5A 2ZEJA 1REVA 2NYIA 4RW9B 5LOQA 1RYSA 3MAHA 2Z2LA 1S6PB 4O44B 1MN9A 1BC6A 5EN1A 3HX9A 3DCAA 3T9ZA 3NGDA 3KYLA 2IDLA 2E5JA 4Q45A 2IJFA 2I8EA 3QGIA 3HVRA 1OJ4A 4DV5F 1TKXB 3KLHA 4CTAA 1KKHA 3CJKA 1WDTA 1BQXA 1SKWA 4F7VA 2LXFA 1H2UX 1RAGB 2C2OB 1NK8A 3Q0AA 1JKHA 5J1PA 2CXEA 2V4JA 2JEGA 3QMQA 2FJVA 1DFDA 2DNKA 2FHJA 4MFBB 4UQGA 4JI4F 1Q8LA 3BH7B 2DR7A 1TU0B 2ZVSA 4DX5A 2C1EB 1N32F 4B17A 4J90A 2C3OA 1T9UA 2PO4A 2QLFB 4LFCJ 4R5PA 1RCXB 4ELTA 1T11A 2HQ3A 3QLHA 2BVZA 1XR7A 1XIQA 3FEXB 3FRZA 1HNZJ 4XPCA 2EBGA 3VQSA 2ALZA 3EZUA 2HQDA 4OZ3A 1SC6A 3E3XA 1R6YA 1S5ZA 2F7VA 1TKXA 4QIFA 4QR2A 3LQVA 5HMYA 3H4DA 2JLEA 5KFRA 3KG0A 1RTDA 4ZOSA 1CJVB 3LA0A 3I9V9 3KK1A 1VQMS 2IY5B 4RL1A 1AT1B 4TY8A 3V4IB 1YHQS 5AJ3F 3OL9A 1QUPA 4PG7A 1IBMJ 3A8JA 2ZJPQ 3CMES 3K17A 2VBWA 4JBCA 1CC8A 2MHNA 2PMZD 3CXCR 5GADI 2LEBA 3VVTA 7AT1B 4ECVA 1HMVA 2P8IA 4ECZA 2AMCB 3C8YA 4WFZA 2XCPA 1WC0A 3R2DJ 1X31C 4PWDA 1NXIA 3K8VA 3MEEB 4WFNQ 1RTHB 4QQBA 4EMDA 1F5AA 1Z4UA 3FFIA 3HVAA 4LUBA 3U1MA 3GIKA 5HROA 3PEHA 2ZUGA 3PJWA 4TLRA 2FLOA 4OMFG 4K5RA 3OVAA 2YWHA 3PO5A 3CPWR 3K7RA 5GMDA 3J7AN 1FFWB 2GC8A 1D9AA 2DBBA 2IM1A 4WFAQ 5CD4A 1SV5A 3HHDA 1AXQA 1GT8A 1RABB 2EG2A 2Q1LA 2Z2YB 5SUHA 3WDOA 4YUDA 4CIOA 5KT2A 1JB0C 2C2NA 4DR5F 1BGXT 3VHQA 1C2PA 3AH6A 2R7TA 1GMWA 4WPAA 4KH1B 4O3QA 1RKJA 3NG8A 2Q6BA 2YPYA 2EWHA 3K2YA 2KRBA 3QFWA 2YKMA 5C2CA 3V5RA 3RAXA 1CLFA 1N5YB 2AEFA 1LFPA 1EP4B 4IQMA 4C0OC 5MLCV 4EEYA 4IOCQ 1MN7A 1DJ0A 2FUG9 4O4GB 4RLEA 5LT5A 2JRRA 1LQ9A 5BYSA 2NPFA 2ZC4A 4RNFA 3CMAS 3A1YG 4GO7X 2HW3A 2QSWA 1LWCA 1WDDA 5HN0A 2B56A 1EETA 2ZOFA 2B6AB 2H48B 3OVBA 4MMOA 2C28A 2Z2ZA 3N0VA 2C3PA 1JLBA 2AW0A 2EFNA 1TUGB 3IRXB 4YB7A 5DO2A 3RTVA 4IRDA 1AB8A 4KV8B 4P7VA 2GCFA 3C14B 2QC3A 1D9DA 1DTQA 2HBQB 2DPJA 2OPSA 2RB7A 4JI7J 2VG5B 2KJWA 2ZVIA 1FDBA 1BUXA 3OR2A 1DQ9A 2B8QA 1S6QA 2VF3A 5IT0A 3TQEA 3H4BA 4FS1A 5IC4B 5T7LB 4CLUA 2MGZA 1TK0A 1JJHA 2RUGA 4IG3B 4ZP6A 3HD1A 2BANA 4DU7A 2RJZA 3FRYA 3IRXA 4PG4A 3ITHA 4E8UA 1KFSA 2G9OA 1NDCA 1HQ2A 3DRXA 3TAMB 4DHVA 3VAHA 4DX6A 3WZ0A 4XK8C 5DM6Q 4ELVA 4RBTA 2PMWA 3MMAA 1QVFR 3HO1A 4ZLLA 4DV0F 2V8GA 1Q79A 3KK3B 1TMJA 2XULA 1H38A 3US5A 1VRUA 3R5GA 3BV8A 2VODA 5C24A 3ZZRA 1LNQA 2FJDB 1SIZA 1OY6A 1HPZA 4Y65A 1BQNB 4ETXA 5HJYA 1DQAA 2DNRA 3KG1A 2GHVC 2LKZA 3D2WA 2I5JB 4LF8F 1FVQA 2VQEF 1HBOA 2XMAA 1YITS 3S1TA 4ES3A 2UUBJ 2L08A 5K5MA 4DPXA 3UN2A 3CIZA 5LJ3Y 3VAMA 4WP9A 1HKAA 3K5PA 3H20A 4N8OA 5LSLA 2VJVA 2X1BA 2DNLA 3D0IE 1CJUA 3A3PB 1R3NA 3JSRA 3NBPB 4LSZB 1WUUA 2PE8A 3WX8A 1U1PA 4DL7A 5KFGA 5DDPC 5IV3A 3AGXA 1D8ZA 2OJ3A 1NK4A 5SZTA 3A3OB 1SV5B 4ITSA 4UTGA 2R8HA 1PYOB 4J5OA 4OYIA 1JXVA 4USWA 5HQMA 4J91A 2RH3A 1VHFA 3ZFVA 4F0HA 3PR5B 1IBKJ 2D74B 3K58A 4DV6J 2BZ2A 2J7WA 5J2MA 3UDVA 3SV3A 3LTOA 1RT2B 2VC0A 2MB0B 2LCWA 3FFIB 3KJNB 4UW2A 4K7QA 2PFFB 5B08A 4MKVA 2YH0A 2HVZA 2KM8C 1M5KC 2HHQA 4V19J 3B54A 1FRLA 5DZ6A 3KLEA 4B3RF 3A8EA 1IKXA 3EGNA 3CT9A 1K8AT 2DGQA 1T03B 1DHMA 3GZ7A 3QO9A 3GE9A 4JV0A 3ZZOA 2A1BA 4B9TA 3I5CA 5D6GA 4QIEA 1ZOTA 4NA3A 3IFEA 7FD1A 2Y3YA 5J2NA 1S6QB 3DKDA 2V50A 3HD2A 3OR2B 3W63A 4ED3A 4LF4J 2UXCF 3N79A 4ETZA 4UZBA 3T5LA 3BBFA 4FF2A 3NGTA 2CQCA 2XMMA 5HJXA 5M2RA 3QLHB 4NRUA 3AJDA 3IMQJ 4BC7A 2ZH8A 3UD3P 1FE0A 4GKJF 3CE8A 3CO9A 1N33J 2MY7A 2BOAA 1VS3A 4KC5A 1RWMB 1QTMA 4ZJOA 2ZBRA 2XB2D 1LWFB 3MM9A 5KFNA 2HIQA 4HI2A 1CJKA 1XMBA 1U6ZA 1SI9A 4BC9A 1S1XB 1ZAVA 5C42A 5HO4A 3CCSS 4EYIB 3MTJA 1U1NA 1HHQA 2V4JB 1HR0J 1RACB 3KK2B 3GONA 3M8RA 4DR7J 2IVYA 3W5YA 3T6BA 1RK8A 3KLHB 1NZ8A 2CQ3A 1SCJB 1CQMA 4UY85 2BJ8A 3PFOA 1HBNA 1JX4A 2U1AA 3Q22A 3QBCA 2XLJA 5EX0A 2B9YA 4OHZA 4Y28C 2DR6A 5AXKA 1T9WA 4R8UB 2E9ZA 3I38A 4J9NA 3MF5A 3H5SA 1R8CA 3G2XA 3JTNA 4USVA 4ED4A 2BYCA 3LP2B 4A4JA 1BQMB 3J7YI 4PRFA 4K50A 4J9RA 2ZNZA 2RQMA 1CG2A 2C3YA 1IKXB 3HHLC 1U6FA 5T41A 3BSNA 1TAQA 4K5SA 4DQQA 1QVGR 5KFPA 3HM9A 1T3OA 4JI5F 1CQNA 5L9NA 1PGZA 4OYAA 1BXNA 1RU2A 1HI1A 4DI6A 1NU4A 4HT7A 1CVJA 4GRSA 1IKVA 1XR6A 2K1RA 2M88A 1JJ4A 3FK4A 2HLTA 4I4BA 2Q79A 3TUIC 3CDBA 4CM0A 1FDAA 3QGHA 3HVTB 3MEDA 1WOOA 3NGRA 1HMVB 5DGBA 4LQ9A 4DBQA 3GJSB 2HZCA 2V8VA 1FKOA 3SBMA 3NNHA 1RYRA 4MYUA 4DQIA 3P5BP 5ITHA 4KGXB 4CNYA 5GAEU 1VDHA 2AYEA 1PJ5A 3B4DA 3NP5A 4WFYA 1V5VA 2O1PA 3I82A 4XO0A 4Q43A 2QA4S 2FJEB 3HDSA 3QJJA 1F9FA 5BXIA 3ET6A 3CDEA 4DPTA 1PC4A 1YRUA 4I6WA 4K8RA 3QZ7A 1PYSB 1BHNA 4A47A 5ETTA 2B3TB 1EKSA 1S6OA 1XBWA 4KH0B 4OV6A 2HFUA 5KFJA 1VRQC 4ED0A 1D9FA 2ZOGA 1XNRJ 1VHIA 3KOAA 2M7SA 4L73A 4CLTA 5LSOA 1ZAXA 2LXUA 2UU9J 1W7WA 4P2FA 2BJDA 1S1VB 1UWAA 2IM2A 4DX8H 3KNGA 4JI1F 4X4TA 2Y1IA 4OI6A 3K0JA 3CCZA 3QATA 2MQQA 2JEFA 1NSQA 1FJ7A 3FCHA 1VBKA 3R5DA 1VISA 1WC5A 2H5EA 3T5JA 1X4FA 3VALA 3HFZB 4CO3A 2QMXA 3I87A 4F04B 2CIMA 2I0XA 3M6WA 2W9CA 5K9FA 2A6OA 1JKHB 2D41A 5A8KA 2IC3A 3JYTA 1HNVA 4OHXA 1K44A 4J9PA 2R7WA 2ZFHA 3D68A 1DLOB 3CULA 1U1QA 1JIHA 2ATCB 3CIMA 4AQYF 2CPZA 4L72B 1GX6A 3HJVA 5D0RA 3T9NA 3TA2A 1M1KT 2DITA 2FZCB 2RRNA 5CCMA 3G9CA 4JI3J 1ACMB 1X4AA 2CQ0A 4LSLA 3R7SB 4C0BA 4J37A 3R9LA 1C0UA 2KN4A 5KFKA 1DTQB 2ZE2B 4DR6J 5EHHA 1VBXA 3R5JB 2MSTA 2IYIA 3DNCA 4ZPAA 4B9VA 5LMUF 4JI8F 4Q8FA 3PKYA 3CJTA 3FVYA 2YWKA 4QR1A 3OHAA 1IM6A 4FPIA 3SSRA 5KFVA 5AE1A 5EWGA 3HHNB 1VQNS 3PFEA 3BB5A 1V9OA 2XQCA 2FQQB 3MHYA 5FD1A 4RU9A 2F8HA 3GFXA 4F26A 4MK9A 4YFUA 3ISZA 1U25A 2WOMA 1VJQA 3BO2A 4WJBA 4J9MA 4X84A 3EYZA 1R0AB 2AJ1A 3LP0A 4C2MA 3M8ZA 2YNHA 2CQBA 5KFWA 4OJGA 1GQEA 4KGZB 4RWWA 3SXLA 2OIHA 3KUGA 2KG1A 1C1CA 3WC0A 5GAHU 3NXZA 4CWBA 2QIFA 3MM6A 2IMOA 2I5JA 4LBHA 2QYCA 2KXFA 4NL5A 4QPTA 4AYBD 5D0HA 1S9FA 3RRGA 1F3FA 1MU2A 3A12A 4LBPA 4ZVHA 4NWBA 2XS5A 1X4HA 4DL2A 4RBUA 1PBAA 1UA1A 1VBZA 4N5SA 2DKOB 2DO0A 2EC0A 3UD4P 2RSQA 2XNQA 1R0BG 2AJFE 4F3QA 3KJVB 1OO0B 1B3TA 3KK3A 3H5XA 4ILLA 1KHWA 9RUBA 2VG6B 1WORA 2C3UA 4NI2A 4ZVPB 3CCMS 1X9SA 1FEEA 1N36J 2W9BA 2BDPA 2X7IA 2ZWOA 2GGPB 4OX9J 2FDNA 2MKCA 5DS7A 3VR1A 3FQLA 4TYAA 4KRWA 1F5CA 3TI0A 2YXLA 2PIIA 2YTCA 2AQ4A 1R8AA 2DGVA 1CSJA 3KFWX 4NXNJ 4IH7A 2BE2A 3QWPA 4BDPA 3EVMA 2ZDOA 4I1TA 1WI6A 5AE2A 4O23A 2VPZB 5E0OA 5D0GA 1S59A 2N7CA 1RAFB 4A8YA 2ZKUA 3DLEA 4ILRA 3ZTOA 4EBEA 1WD6A 3DOLA 3KDOA 4NEZA 3GJRB 3OSNA 3CCUS 1TL3A 4B3SF 3TNVA 4F0KA 3IM9A 4CP5A 1QE1A 2V8HA 2ZDPA 4BLGA 4ES2A 2YBVA 3PDNA 5ETLA 1P8GA 2XMUA 3DMJA 4NLYA 3PYFA 2HSEB 2BJ7A 4Y3CA 3OT9A 2Z30B 4ZMMA 4CI0B 3RU0A 4PG8A 1H2VZ 2JZ5A 1OMSA 2KT5A 4P7TA 3ZZTA 1YI2S 1AUSL 2MKHA 4CRJA 1IJFB 4P6QA 2NXJA 4U95A 3CW2C 5D4LA 2OFHX 1C0TB 4TY9A 3W9IA 2R7UA 2FHMA 4X4OA 2NREA 1H73A 2XYHB 4KQZA 5IT9Y 3AOAA 2ASJA 1CS4B 4G1QA 4I64A 2M70A 2VOPA 3MDFA 1B64A 2UZAA 2FPHX 1HWJA 2CUYA 2YKMB 4ER8A 1N0UA 2QA2A 3W9HA 1IR2A 2K06A 4H4OA 2F4VF 3I0SA 2NS1B 1X4EA 3CJKB 1LK7A 2RILA 1WELA 3IO1A 3M32A 2KM8B 4UQTA 1Y5LB 3HT3A 4ZVSB 2ZH1A 1RUSA 2JJ4D 3PV8A 2XHWA 3CVKA 2GIFA 4L75A 2MLZA 1FK9B 4WIIA 4F4XA 3L09A 4WFBQ 2FZGB 3UFCX 3OXFA 3VAGA 4WWSA 1V3SA 1UETA 2XTJP 2CQ4A 1S0OA 4JV2A 1IWAA 1S1WB 2DPIA 4DR4J 2BW2A 1JLQA 3GCWP 2XWYA 2KT3A 4FNHA 3JS9A 3VV2B 3CCJS 1HBUB 4PXBA 5CZVA 2H4WB 1GK8A 1P6TA 2BABA 3BGUA 3S8SA 1WWHA 3M6VA 3LP1A 4RWXA 4L76A 2RKIA 1TL7A 2CQDA 2OI2A 2WCXA 2ASLA 2PD1A 1FJCA 1Q78A 3O44A 3OV7A 1UWBA 1NKBA 4DV1J 1RAJA 3OXLA 3AA9A 2W7OA 4EBDA 5ETPA 1LWEA 1FDDA 1LFWA 3OL7A 3DGPB 2CQHA 1RT6A 3ENVA 1XNQJ 3MUVP 4I2QA 1MU2B 5CYJA 1FCAA 2CQ2A 2K2PA 2CPHA 1QAYA 3KKFA 1IKWA 3GSIA 2EEYA 2H65B 3Q8PB 1U1MA 5E7OB 1RT5A 3HI9A 1ZM3A 2M8HA 3DFEA 4HLBA 4NLVA 3VCDA 4UUWA 2BRLA 4NLUA 3W66A 2W7PA 2QMWA 4PYDA 5LL6d 2GJFA 2JVMA 4XTTA 2FGOA 2OUGA 4B08A 2FVSA 3LWLA 3GJTB 1KQSR 4DSLA 3M1VB 4TU9A 2CJXB 4F0MA 3KMQA 3VQTA 3MEKA 4X66F 3PNIA 2KFYA 2KHDA 4MKBA 4OIXA 2HWIA 3T1HF 2EKYA 2EXUA 5IM0A 1L3TA 4OHYA 4JYAJ 2NQPA 1CJTA 2OPRB 1HQEB 4ZCKA 1P27B 4OI1A 1F6TA 1IXKA 1FX4A 3T5KA 2CG8A 3G82B 4NMXA 2QYGA 3PW7A 1I94J 3ISND 2GFFA 4C8NA 3VGTA 5L39A 2N3OA 2D69A 3L9ZA 1FT8A 1PJ7A 2HQFA 3M2UA 2V4QA 2J0WA 1WF0A 2XGPA 1QE1B 4ZP9A 2XWXA 3BQ1A 4EI2A 3CCRS 2MTLA 4NYZA 5H9EK 3OTDA 3POTA 3DDKA 3CC2S 3TJ8A 1U02A 2OPQB 2DJWA 3AHPA 2OPQA 4IH5A 4M5KA 1YJTA 3D4JA 3BR9A 2DGSA 4XPEA 1M0SA 2KI2A 5AXNA 5KFHA 3G71S 5F8GA 1VQPS 3G96A 2CPDA 2HFVA 2IJNA 1MMLA 3AGZA 1IQZA 1MG7A 4USMA 3J80Y 3DRSB 4QWAA 1VLYA 4DPWA 3A3NB 2R8KA 2G2OA 5JXSA 1NJIT 3H90A 3IR5B 1TP7A 2COLA 4OJ1A 4HHHA 1FWPA 4CQ1A 2WTFA 2Q43A 2VG6A 3V6DA 2GAHC 3QT6A 4HI1A 4J9UE 3U1LA 4QYZK 1HHSA 1LW2B 3ENWA 3MMCB 2CKWA 3NKYA 2N7YA 3D0GE 4P75A 3R6GB 1LW0A 2GMHA 2R7QA 5F9NA 2UUAJ 1CULB 4RZRA 3KUEA 2XSJA 1RT3B 5G0RA 5B0EA 3HZEA 2L9WA 1HWLA 2NXNA 4C11A 2ZD1A 3AOCA 1S0MA 3GFZA 3E01B 2LQJA 5C2GA 2CPFA 3KLFA 3CC7S 2M8DB 2YQ1A 1Q5VA 5E33A 3AD8C 1VK3A 4ED2A 1IKWB 1SQGA 2P9EA 2V2QA 1XMOJ 1DZ5A 4B3TF 4UY8T 1KQKA 3ET6B 4C11B 1VOMA 2JVRA 3M9OB 5I42A 1NJYA 4IRKA 3MUMP 3M8QB 2VFSA 3LANA 4IOAQ 1S9EA 1MW7A 4KAIA 4N8NA 3DGVA 3DU6A 3AXKA 3BKTA 3OXGA 2KU7A 2J6UA 2W2QP 4PXEA 2XI2A 3GV8B 3MMCA 3G4SS 1NSKL 2HNDB 5FDLA 1S10A 5IT4A 2GS8A 2BACA 3LZ8A 3BKUA 3CSKA 4M5DA 5KFMA 3HULA 1JLQB 4DUYJ 4NCAA 1BWEA 3MMBB 5FJ4A 2B5JB 1SBRA 2ILZA 4O4RA 1F5BA 4LIRA 1Q5YA 2YWEA 5JVGQ 1NRKA 3GMGA 3AT1B 4F25A 4X4NA 3OLAA 3GIRA 2V6AA 3ZTPA 4YMEA 2E5LF 3JSYA 3O8WA 3QGPA 4OYXA 1ZA2B 1S49A 2GVDA 2SXLA 2XZTB 1OQ6A 3D6MB 3EWGA 2WAQD 3POTB 4FVMA 4I0WA 4QIGA 4ZPBA 2NZCA 2QLJB 2B51A 2VUGA 1SJQA 5HATA 4DPUA 5KTQA 3MR6A 2AZ1A 1EHWA 1RTJB 2GV1A 3NWGA 4M63A 2J6TA 4B02A 2BRKA 1NLTA 2CVIA 5K8MA 1DLOA 4P74A 1F2HA 4QWCA 3DM2A 4LSNA 3T41A 3CJ2A 1HW9A 4DV3J 1J5EF 4BBYA 2W4CA 1P1LA 2VA3A 2EBEA 1PJ6A 1JNRB 2IRXA 4J9KA 5KFBA 2J0SD 1WOSA 2FC8A 2BM1A 1HI0P 3BM7A 3EJMA 2MQNA 3BYPA 1P9QC 1RT1B 1H7XA 2AEJA 2BBEA 2ROPA 3ELHA 3NCRA 5F8HA 5KFOA 3K5NA 3VZHA 1C3GA 1T9TA 4MKAA 1YBTA 2ZZNA 4HTIA 3TARA 2F9JA 3HZGA 1KTQA 2ZITA 4XIUA 5RUBA 2HLUA 2I1RA 4DV4F 2ROGA 4U7UK 2O66A 4EFAC 3W1YC 2XYPB 1NUEA 2OFGX 1NH7A 1RI7A 2W2OP 4IOBA 4KBIA 1TZ0A 4OZ0A 1X4CA 3M6XA 4EK2A 1HI8A 4FYVB 3DLEB 3WHIA 4I2QB 2QEXS 4QW9A 3N01A 3SQGB 2VHGA 3OTOF 4A8FA 5D77A 2BUNA 4KHMA 2VJUA 1H2TZ 1YRXA 2UVWA 1X60A 2QMUB 1MNEA 1UWBB 1XC9A 5A8RB 1ZM2A 4LR9A 4DSIA 4IDKA 2ZC3A 4FYDA 3DGPA 1RTZA 3MPUB 4GC7A 3BS9A 3HVTA 2HHHF 5C5JA 1HBUA 3MOZA 4I6YA 4ZVEA 5E3CA 2K3KA 3R6LB 1HYSB 4DR6F 1TMMA 4TVAB 1QTNB 4UOCA 3T1AA 1VMBA 3MECB 1KQFB 1T8EA 4JV5J 1WHYA 2Z2MA 3Q8RB 1HQUB 3HK2A 3TEGA 4L74A 4WK3A 2AYBA 4IFYB 2EG1A 1FJEB 1AROP 4DF8A 1BQMA 1JLGA 2J8AA 4CLZA 4QBUA 2OEMA 4O0IA 4C97A 2AP6A 4RW4B 3HJFA 2PEBA 4DG1A 2HFNA 2IVMA 1RBOB 1SQEA 2DNZA 2A18A 3UVJA 1HNXF 1URNA 3RBXA 1XAOA 2ROEA 2YNIA 3I0SB 4YHHF 3T1HJ 3SIPB 3QRPA 2WB4A 1SIWB 3EE3A 5THWA 4QWDA 4DFKA 1JMTA 3PX6A 1RCOB 2P2CB 5DLGA 4X62F 4IRCA 3T5HA 3RR8A 1HNWF 1AFJA 4LF6F 1EZZB 1EQMA 1TL4A 4AXJA 1ZETA 3GV7B 2CDRB 4C6AA 4G1QB 1RT7A 5J2PB 2DH9A 2GO9A 1RT4A 3GV5B 2WONB 2VFRA 1NK0A 4A46A 4X64F 5K8OA 4BS2A 3DLGB 1IVZA 1B4SA 2BE7D 3BF4A 1SB6A 4DCOB 3C2PA 3T6JA 3D3CJ 2WVEA 1C0UB 2AIRB 3CJ5A 4DSJA 3KG4A 8AT1B 1JLFA 1SKRA 1KN6A 2BANB 5HVFA 2CQPA 4UT4A 1WF2A 2VG7B 2HNYB 3Q8VA 5EUHA 2HFZA 3CD5A 2BEFA 2CJBA 1TK8A 2CNOB 2ZHAA 1XTZA 3AAWB 3NAHA 1U2FA 2AT1B 3FBBA 4IFVB 4JP8A 4LVNP 4ZVFA 4A8QA 2CPJA 2OPSB 3PJ9A 2PDAA 4CO0A 4CLPA 1ZYQA 3M8YA 1AA1B 3C5XC 4CH1A 3H59A 3SSSA 4EGLA 5A2QY 3FCWA 4LVOP 2BM0A 4NLSA 4YN3B 4DLEA 1L3UA 2FY1A 2K8GA 1OYEA 2CZ9A 2HS4A 4PKDB 1MWZA 1KC8T 1BMQB 2YKPA 1TUWA 4KGVB 4TLQA 3O5TB 1S0NA 2CZVC 2QLXA 2DIVA 3QJLA 4CM2A 1OWXA 3VZIA 3DRYA 2XHCA 2RNEA 4KR0B 3L7OA 4KPCA 3SSQA 2MKIA 2CG4A 3ZZPA 4JI0J 1I1GA 5BYRA 4DQSA 3WBZA 3LAMA 3DHWC 5I42B 5JVHQ 3I56S 3GR0A 1N34F 3LW5C 3S01A 5J2QA 2VBXA 1I3OB 2E5GA 4AL6A 1TFWA 2HHWA 1X4DA 3G8SA 3UCUP 1EB0A 5U47A 1U09A 5KFQA 4ED8A 1N54B 1WF1A 2ODXA 3E01A 4DLGA 4B3MF 4LF2A 2YWGA 4B9NA 4CZCA 1JXEA 2G1HA 1S4FA 3MPYA 2MXYA 1CULA 1DQ8A 3DI6A 3MMJA 2BW7A 3MEDB 4QPXA 2V0NA 4RU2A 2MLXA 4GKJJ 5JMNA 4KGKA 2FYXA 4OI0A 2CWKA 5F8MA 4ICLB 4NA2A 1WC6A 3SCJE 1Q1KA 2JC1A 2NZ4A 2J9DA 4RBVA 4ANCA 3TAPA 1K0TA 4LF1A 2NPIA 3CCTA 4K2JA 5DG9A 4K0KF 1T05A 4OJHA 4CCHA 3FSXA 2EW9A 2XM3A 3DRSA 4IQXA 3R7NB 1S4EA 2CJKA 2CDQA 2ABYA 4PCQA 2EFGA 3PJXA 3QWUA 3QGGA 1VK8A 4KT0C 2ALYB 2YWFA 4LFBF 3T1YJ 2E7XA 3M8PA 4WYLA 1R8HA 2HHHJ 3OTCA 2OD6A 2VG7A 3V4IA 5H9FJ 2AYMA 3HSZA 1WTBA 1N36F 4KTQA 3CDUA 2ZH4A 1EKRA 2JFKA 3QZ8A 3N4WA 4J7CA 1DRZA 3UI3A 3PEJA 1WKKA 4H4MA 4QJVA 4RW8A 5D8HB 4KV8A 3C6UB 2R2SA 3KNAA 4PG6A 1UVKA 3MM8A 1NSPA 3M6UA 2VKRA 2R9LA 3TAQA 2PN6A 4MIWA 1ZH5A 4CH0S 2AF6A 3QT8A 1NEEA 3CCQS 5C42B 1CJTB 2OPRA 1R8PA 1TKZA 3GTYX 5KOWA 1N6QB 2HRYA 4RUCA 3J7YU 4LRDA 3KLGA 5CYMB 4OZJA 4X4RA 4DV4J 4BWMA 5DQHA 1R43A 4ECQA 3Q8YA 4OJ3A 2ILYA 4MFBA 2JOQA 3MM7B 4ECWA 5A6WA 3AB4B 2PC6A 3HT0A 3M30B 1S48A 2GHWA 3GQCA 4H54A 1E6VB 1GNKA 1FA0A 3TR5A 1U45A 3JSMA 1FI4A 1O8BA 2BKPA 2FD2A 2XMKA 1TL1A 1YJWS 4ID5B 1RWUA 5F0UA 1RT5B 1RZMA 5C7PA 4OX7A 3H25A 5DM7Q 2IAJA 4FKXA 2X1FA 2DGUA 4GVLA 3FMWA 2V2VA 5KG0A 5CA5A 1GH8A 3IXQA 3NCQA 5HSPA 4KPYA 3MM5A 3HHLD 4JI2F 2QA4G 2V4RA 5H9EJ 1VQ7S 1SVDA 3MEGB 4DV0J 4PABA 1NDPA 2KVQE 3I32A 4IFYA 1TTHB 2IA0A 4NZ6A 1X0PA 2VC1A 3GG1A 4WIQA 1REVB 5B0FA 3GPAA 5A0YB 1G3OA 1Y7PA 2RIJA 1RAAB 1FNMA 5ETQA 4JI3F 2V2ZA 3MAQA 2KJVA 3QQCD 3CC4S 3PCOB 3MEEA 1LEOA 4ZP8A 3TX0A 5J2MB 4AQYJ 4ZJLA 5KFXA 4ED1A 1LOUA 1FRKA 2K1RB 4R0EA 2UP1A 2HHVA 5KFYA 1T94A 3NMAA 3I5AA 3QSYB 3HKWA 1L3VA 3ILIA 3PR4A 3BSAA 1T95A 1Q95G 4OYMA 2E1CA 2F4VJ 2B4PA 2P9CA 3L95X 5A8RA 3H0PA 1UW9A 1HD1A 4DCPB 5A0YA 3MUTP 3DOKA 1FK9A 3I4PA 2ZJQQ 1VQ4S 3Q83A 4NPOA 2RF2B 3OD2A 2MKKA 5HP1B 4LF7J 5F8LA 2IHR1 3C16A 4WP8A 3MR3A 3RB6A 2XS7A 3RB4A 1DTTA 1LK5A 2EFPA 1E6VA 3CCWA 1TAUA 4K4VA 1KVKA 2MYFA 2HKEA 3M32B 1RHMB 7FDRA 4DU8A 2GHPA 2QG9B 3D6HB 1U8SA 2KVIA 3DU5A 4Q2LA 1ZBTA 4FXWA 1MROA 2YNGA 5MAOA 3GYNA 4WZMA 1PCAA 3LAKA 2QZ8A 4FPRA 4WTYA 2MKSA 1HPZB 2W9AA 1W26A 4YQWA 3THTA 3HSGA 5BJRA 2C3MA 2NCKL 1T7PA 3HCXA 3I4HX 4JI0F 1NDLA 2DHHA 4A8WA 1RJJA 1PAEX 5LJ5Y 2RE1A 2DR9A 2VD3A 3I55S 3MMAB 3UPFA 4NLTA 4ZN1A 2RAQA 5FLXY 2FY8A 2ZNYA 2O5DA 1FWKA 1B0VA 1KOOA 1YBUA 1NNDA 2E5IA 3IAM9 3DN9A 3IS9A 3ISNC 2VU5A 3NLCA 4C7QA 4OFZA 2VQFJ 4ECYA 2XY5A 4FN5A 4K2XA 3FBFA 3IGVA 5GAGI 1NK7A 2H4YB 4IG0A 2RDDA 2M3DA 4K4YA 2VH7A 2D3OR 4HVZA 4H4MB 4RW8B 2CZ4A 2PT0A 2DCUB 2MQMA 4NLGA 1VQ5S 4QW8A 3C6EC 1M5OC 2VFUA 3HF5A 4PXDA 1TL5A 1U1KA 4OYPA 2CAJA 3QO9B 4I6AA 1E6YA 2MQ8A 2DHGA 2E1MC 2PMHA 2V68A 3BGOP 3C14A 2JEJA 1JLAB 4XDDA 2QV6A 4WXWA 2XEXA 2Y9HA 3LO3A 4USHA 2OSQA 2DT9A 3PYEA 2IDEA 3W8PA 1N0VC 5AE3A 4DFMA 1JLBB 4OLPA 1L5UA 2YKNB 5D78A 5E5NA 4TQRA 3VGSA 5HI7A 2K3IA 3NOCA 3C19A 4GVBA 1KR4A 4Y2IA 2MLYA 1Y3JA 4OZLA 5EGYA 4DXLA 3OW2R 2KZMA 3QIPB 1T9YA 4ICLA 3BGLA 5T14A 5HMWA 2DTJA 3TZYA 2G4BA 5F8IA 4X64J 1CPZA 2ADCA 1WC3A 3ZO7A 3M2RA 1U0SA 3BGRB 1S9EB 4P2SA 4DR2F 4TU7A 1YJUA 2UXDJ 2OEKA 4LRFA 3F41A 4WP3A 3HSDA 1HNZF 4X4PA 4K4ZA 1S79A 1YZ6A 1F1BB 4ZPCA 3CGIA 5J2QB 1OQ3A 2ZJRQ 3BGFA 3CCLS 1HNWJ 1ZA1B 3R8YA 2DHSA 5E3PA 1FXDA 3IG1A 4M94A 2F65A 1CJUB 1XQIA 3W8GA 2CPEA 5DDQC 1AZSB 2KDOA 3D1QA 2VKZG 3UN3A 1SJ1A 2DVIA 1IBCB 3WIUA 4G3IA 4QU6A 5F8JA 1SC4B 2MHEA 3AB2B 3W64A 2AGQA 1QUVA 1WEYA 1N33F 4YB1P 1RWKB 1S1TA 2QFIA 4MYTA 1MWYA 5HROB 2XSFA 4ZPWR 4C3KA 1GMWD 2ZH3A 4NZ7A 1K1QA 1BQNA 2NSBA 4LF4F 1H3DA 2BQRA 1XNQF 3VVUA 5E3QA 2BR0A 1IR1A 2J8SA 5IXUA 1Y4ZB 2E1RA 4HT5A 3J7Z5 1FKPA 3RJMB 1VC6A 2VOOA 2B9XA 4ALZA 1YJ9S 3H5YA 3V6HA 3T1YF 3OR1B 2WSCC 4HDHA 4LF6J 1KP6A 4Z7YA 2GJIA 5I4MA 1PC5A 1E6YB 3CJSA 3IBFB 4I68A 2LEAA 3BN7A 4CDIA 4DPOA 2PEHA 2FVQA 1BY9A 3R5CA 4URQU 3I6PA 3K8WA 4J9SA 1RTDB 1YGYA 1Q8IA 5KFAA 3AXMA 4ZPTR 4DFJA 3AKOB 2G0JA 5KFTA 4A48A 1Y11A 3ENQA 3K5OA 2D3UA 2FVPA 3GYXB 5J1NA 3JYTB 1NH8A 4C9DA 1RWVB 1C1BB 5KFCA 4R5PB 4YR2A 2XY6A 1S76D 1EX8A 1U6BA 2XMTA 4C8LA 2LA4A 1HQEA 1Z1ZA 5E3RA 1N56A 4PR6A 2HGLA 2B6AA 2KHCA 4WU3A 2Y0SD 5M2PA 4Q8EA 4P71A 2XYGB 2JX2A 2HURA 1D3WA 4MIAA 4ZPDA 2EFVA 5HVGA 2VQEJ 4ED7A 1FNXH 2HYIB 2KZZA 1FXLA 1Y10A 3JQJA 4I2PA 4FYXB 2X51A 3PVXA 1N34J 5KG7A 4V1Ak 4X4QA 5EX3A 3OHBA 2XS2A 1VFJA 4DR2J 2VONA 4GKKJ 3UVJB 1KNZA 1EP4A 2KFNA 2BKOA 1R7IA 3LGHA 4UZCA 5IFMA 1VQ6S 4X4UA 5IZHA 1VQKS 5ETRA 2R8JA 4O3PA 1Q8BA 4HDGA 1TQLA 1UL3A 2D9PA 4O44A 4QIVA 4P10A 5K14A 1RGVA 1S6UA 2MJNA 1UKUA 2MMYA 4ZLPA 3W7BA 2YQ0A 3M4XA 2HFSA 3UDEA 2MZTA 4K59A 1S9GB 4M5HA 5F3ZA 4NLRA 4AD6A 2AGPA 3G6ES 4FF4A 2YWWA 1Y9OA 3EUNA 4KO0B 2B43A 1UTAA 3EVWA 1REGX 4CLYA 2XI3A 5L38A 1Q0NA 3V81A 4JI7F 2CVEA 4QCLA 3Q8UA 4DS4A 1S7IA 1S1WA 2WK4A 4PWDB 3JQKA 5F3TA 2HIYA 1URRA 3IM8A 1I5OB 3UN5A 3AQOA 4C8KA 1GEHA 4GC6A 4U6PA 4U8YA 4UUXA 4HHUA 4IDKB 2VQFF 4K4TA 2OEJA 3KHHA 4J9OA 2R8GA 1EARA 1KHVA 4B9UA 3B82A 5DG7A 4TY8B 3TJ9A 2HG4A 1PYTA 1HBNB 1O0PA 2MQLA 3AA8A 1A6LA 2KL8A 3VF0B 4CYUA 1VBYA 2F5GA 3JSBA 2Z58B 3GYGA 2K7JA 5KFSA 3OFHA 3OTBA 3KLGB 4CO5A 4K4WA 2FB0A 5B0BA 4C8YA 4W92B 2A2CA 3D66A 5KFIA 2VBYA 2HZVA 1HL6A 3D28A 8ATCB 2YNFA 2ASYA 3G8QA 5IV4A 2UVUA 2NXEA 4MJKA 2HEKA 2VL1A 4PUOA 3W5XA 3BDPA 3I0RA 2QL7B 3RBEA 4OI3A 4J80A 4MIBA 4NCGA 4A8SA 3TVZA 2LQ8A 2MQPA 2XMVA 2MY8A 3Q23A 5A8WA 4WU2A 1L3SA 3BREA 2DY9A 2DHXA 3DM2B 1VCTA 4LSNB 5GVQA 1UJ4A 4QWEA 2ZH2A 3KLIA 2P6TA 1D09B 4EZ6A 2B9EA 5DZ7A 1LWXA 1BE4A 1O5JA 4U8VA 4AXIA 2XO6A 4USKA 4JV5F 4RW9A 5LXRA 1R27B 3C6TA 4F4AA 4N41A 2B26A 3F0NA 2IRUA 1JJCB 2OMOA 1S6PA 2FC9A 1KLMA 5DDRC 5GAGU 5FDLB 1HNIB 2W4DA 4LIWA 3Q24A 4OYBA 3IBWA 5DJBA 4AE5A 4JI2J 2W9BB 1KLNA 1SH2A 4DMZA 2E1AA 1RHUB 3PG9A 2MSSA 1RLDA 2AHOB 2O01C 4M5MA 4O3NA 1WKJA 3KJVA 3NEKA 3W2WB 1RTIB 2UVVA 3TWZA 4ZVRB 1WC4A 1ZTTA 4M1KA 2YKQA 4W98A 2IYGA 4ZA1A 2GAGC 1GFWB 1FRIA 1SJFA 1X9MA 2BX6A 4LJMA 5D15A 2OMLA 4FP9A 4ZVGA 4RNOA 3JAMY 2IM3A 3PRVA 9ATCB 2ASDA 1U1OA 1JK9B 2CQGA 4X4SA 1UJ5A 4X66J 4OI2A 4JI1J 4ZDNA 3J81j 3DOMB 1GAOA 2OTLS 4M5LA 2Q66A 5IQQA 3KXDA 3TRGA 1OYDA 1DY3A 1WEZA 4P72A 2OKQA 2G13A 3CJ3A 2JVOA 3K59A 1PAUB 2ZUAA 1SH3A 2C2DA 3M2RB 1YIJS 1RU1A 2WSFC 1CEZA 1KVIA 1OY8A 3CD7A 4DS5A 1KBRA 3QFHA 4USIA 2EFQA 4FYYB 1A9NB 2DRBA 1NHVA 2C42A 1TV6B 3W2WA 1RHJB 4NA1A 5IOLA 4FF3A 2NXUA 1J5EJ 2P9GA 3L3CA 3TO8A 1R6VA 2PA3A 2WHOA 3H2VE 4NLXA 3RAMA 1UVNA 3IRWP 3HHLA 4LRBA 2RMLA 3I31A 1NSAA 4OYZA 2HQCA 2W2MP 3UCGA 2HBRB 2R4FA 2YKAA 3HMJG 2D1CA 4DR3J 1JXLA 4B9SA 2AYGA 4PQUB 3SDEA 3R7BB 1Q4RA 4LQ3A 3M7VA 3O1LA 4ZKAA 2KG0A 2JFDA 5DG8A 2FLLA 4YEAA 1IBLF 2GVZB 3EGWB 4UOGA 2GVZA 1ELOA 1RKIA 3OVSA 6FDRA 3CMQA 3GILA 3MR2A 2QLDA 1RWPB 1VLOA 2ZOMA 4B9MA 4WF9Q 2XZDB 2DR8A 2IMWP 4CO1A 2BXJA 3DRRB 1YQHA 5B0DA 1LXNA 3QT7A 2H1YA 1H74A 1VQSA 2B4VA 3MR7A 3R27A 4IR9A 1MWQA 3E8OA 5IWAJ 1RB0A 1IKYA 3JAMU 3KHRA 2VASA 1KWMA 2KYXA 3DLGA 1IR0A 2AJQA 2HGNA 1X5SA 4NCGB 1W2IA 2ZBIA 4B3MJ 3LWMA 1K9MT 5J2PA 1LWCB 2HVDA 3RR7A 2Q2GA 2CJYB 2CWXA 2HVHA 1OSCA 5C25A 1Q86T 2LEPA 4BHQA 4F8RA 4GKKF 1U24A 5IM0B 2J7KA 1SJRA 4B3TJ 1AW0A 1NLKL 3MGJA 5LXYA 1YKWA 1EAYC 3BKFA 2N4CA 5HBMA 4E98A 3M1VA 4M5JA 3KHLA 1QLNA 3OPKA 5A76A 4RKUC 4NRTA 1VQLS 1D1UA 2V8DA 3MOJB 1H6KX 2JDJA 3HFKA 4DDFA 2G1DA 1NAQA 3U02A 2R7RA 1AFIA 3MFIA 4JV1A 3D5MA 2CNNB 3HKZD 3TQ1A 1KVJA 3KJQB 2XY7A 1HD0A 1NPRA 4RR5A 1NMEB 3UCZP 4DOZA 2CQ1A 4B3SJ 3IWXA 4KFBB 3HP6A 4LREA 3LF0A 3PIPQ 3ENAA 3CO0P 1LWEB 3Q89A 3AODA 4U96A 3BSOA 3V81B 2WW8A 1RTIA 3BO4A 2YH1A 2K7KA 3SFUA 1IBLJ 4F4YA 3TOQA 4M95A 4B3OB 2UXCJ 4KO0A 3MD1A 4HL9A 2V69A 1HARA 5KT6A 1IJEB 3MXHP 3X1LB 3QAEA 2YKOA 3OL8A 3J80U 4Y2MA 2KXNB 1D8YA 3GR1A 4DR3F 3DDNA 4ZLNA 3GB0A 4DZDA 5J1EA 2PGCA 3RRKA 2MZRA 2EVZA 3IAS9 2I2YA 4J9VA 2JLFA 3BZQA 1UEKA 2W4PA 3ETOA 3ZTRA 3LP2A 3SV4A 5D3GB 2UV8G 2KKHA 3VTIA 2DH8A 5ETMA 3Q86A 1Q7LB 2HVIA 4DV6F 4R8UA 2IAJB 2W2NP 4OHVA 5HQLA 3KHGA 4ZCMA 2ERRA 4CLKA 2MEWA 3KLIB 4ED5A 3LPEA 4H4OB 2HRUA 5L1LA 2JRSA 4OL8A 3JSMB 1RSCA 4JI6F 3WX4A 1NHKL 3FSIA 3RAQA 5H9FK 3SEOA 2R8IA 3BQ2A 1RWWB 3X3UA 1K0VA 2AKWB 3GG0A 2A6MA 3FJ2A 2LQ5A 3E2EA 1NB2A 3RW7A 5CYMA 3I0RB 2QLWA 5L46A 4WK1A 3T3FA 2L9DA 2BJ1A 2HFOA 4OLOA 4N76A 4V19X 2HHXA 3CJ4A 3LGMA 2HHUA 4YHHJ 3O3LA 3UR3C 2RU9A 3D54A 2XC9A 3RBDA 4PXCA 3FCVA 1HNXJ 2WRMA 2XZWA 4LF8J 1LWFA 3MM9B 1AUDA 2ACMA 2NYHA 1WSVA 1IM4A 1RWXB 1SKUB 5DLFA 2HAIA 3SCKE 4DPYA 2UXDF 4S0MA 1SJ4P 2Y1RI 1K1SA 3DOLB 4CYUB 2AU0A 2NLWA 3D0HE 2ZH5A 4PQAA 4CTAB 3CNQP 4M5IA 4JI8J 4XAKA 5J2NB 1S77D 3CCVS 5EDWA 2J6SA 1M5SA 2QTWA 2V94A 4W4MA 4LMZA 3SDEB 1GMVA 2A2DA 3QSIA 1ROFA 2I6WA 1LXJA 1NJXA 4D3GA 3SZ2A 1ULRA 3TUJC 2KXHA 2V63A 3BSCA 1OPZA 3ADAC 3CTRA 3FEYB 4OQJA 2B5JA 2V34A 1UVMA 4HTJA 2IJRA 1WHVA 2ACYA 4A8OA 1S12A 1GXUA 1JNZB 1ITPA 4CLWA 3IR6B 3MCMA 2V9WA 2CADA 1RT2A 2HNDA 2JHEA 2J9EA 3SQOP 5DQIA 4L3NA 5GAHI 3GLJA 4YP3A 2C2EA 1PIEA 4PPZA 4D3HA 2VB6A 1KONA 1FX2A 2KT2A 4LR8A 1S9GA 4CLLA 5CCLA 5KT4A 2XMWA 4R25A 3PXGa 2FGCA 1XJWB 5HAOA 3P6YC 3NNCA 3LGNA 2AJ2A 1WJ9A 1MMDA 1NPPA 2GJ2A 5K14B 1YLXA 3VWSA 2U2FA 5IT9U 4M8LA 1OS5A 2XBPA 3CD6S 2IM0A 4X2BA 2FJWA 5KAKA 4PZVA 4RNNA 1NJWA 1IQTA 3IG1B 3H42A 3PYGA 3NS7B 3ICLA 4C48A 1TR0A 3NY0A 2WOMB 4IYQA 1RA6A 1NB7A 5G0RB 5ETKA 3NNAA 2CPYA 3K57A 2GMLA 3D1OA 4FNIA 4ANEA 1XERA 3ILLA 3LP0B 1NCLA 1SPBP 5D4NA 4ZITA 5K8PA 4F3OA 1VR6A 1LW2A 5KFDA 2HRTA 3GU0A 5GMKa 4GVBB 2G0CA 3CF5Q 1F3VA 1VQYA 1HHTP 1N88A 3H8YA 2KTQA 2CJAA 4KHRA 3QIPA 4RW7B 3F44A 2GW8A 4LF7F 4DL5A 1HNIA 4NXMF 5L1KA 1FVSA 4K4UA 2YX4A 1JLAA 1JJ2R 4LF5J 4DSFA 5IS2A 1FESA 2HS0A 4PYAA 1YRTA 2RQ4A 3RG6A 2ZHOA 3TVKA 2F63A 3IA0A 1JLCA 1RISA 3BEGB 3ITHB 2H51B 4IO9Q 3SI8A 1NKEA 3N5FA 3N6NA 5HANA 3S7RA 3M8SA 3W5ZA 2N3LA 2OAUA 2J76E 4ZHRB 4G6VB 1FF2A 1HWKA 1YZ7A 4H4KC 4XDCA 3MR5A 4LSLB 1TUVA 1V3RA 4ED6A 1JLFB 2E29A 5HMZA 2UUTA 4EZ9A 3TYTA 2OLWA 2GX8A 3RBZA 2IBOA 1ICEB 3IS9B 4OYOA 4OX9F 2I9SA 4ECSA 1EIYB 3Q2TC 1KOHA 3HHLB 3M2UB 1IBMF 1Q16B 3LOUA 4TNOA 1C4CA 1R8BA 1WG1A 1YVFA 2V67A 1FKPB 1FE4A 4C8ZA 1PSDA 3U1NA 4DV2J 1MSWD 3M8WA 2V8PA 3CD0A 1NK6A 2XLKA 1HA1A 1GTEA 4HH0A 1Q82T 3G6YA 2KB2A 1XMOF 3K89A 3OLBA 4Y34A 1VC5A 2RU3A 1SXLA 2CQIA 3TZXA 2ZM6J 1HR0F 1S1VA 3TZWA 4DN0A 3HVWA 3HXMA 4DZ6A 3P45B 2DR5A 2DK2A 5FIIA 1XR5A 2CYYA 1YK9A 1SJ3P 2HHTA 1DTTB 2CJQA 2HPUA 1V5IB 1AZSA 3SFGA 2L3MA 3C16B 4WYWA 3P49B 4ZIWA 2EK6A 3CWJA 1A0OB 4P2MA 3DLHA 4JI4J 1M1GA 2DNGA 3DOKB 4FXVA 1X4BA 3DXSX 1H98A 2GQ2A 2HAFA 5KG6A 1NK9A 5IC6B 3ZNUA 4ZIVA 3NRBA 4G65A 1NJZA 5HP1A 1WG4A 3KWMA 4ZVOB 1FRHA 4ILMA 3KTQA 1WTFA 4TU8A 4A8KA 4L3KA 1R31A 1FWLA 1YSJA 2JWNA 1TL7B 3I96A 4OI4A 1X9WA 2JLGA 1F60B 2ATLA 3CJQA 2Y0BB 4EWTA 4LFAF 2GMJA 3QJPA 2VPYB 1H7WA 2AX1A 2C2MB 2G0IA 2HQIA 2UUWA 2RRAA 1Y0HA 2E7VA 2YKNA 5A6PA 3VAKA 3DDIA 4A8XA 3JXOA 5KFZA 5CAAA 1Z2ZA 2KFZA 3DLJA 3UNGC 1U1LA 3I9ZA 3C15A 3FNNA 3W65A 1VIOA 4K0KJ 2LU1A 3FBCA 3MPVA 3MEGA 1TVRB 2FTRA 2R2RA 1XWLA 2M2BA 1FXRA 3VGUA 3AOBA 3K5LA 3PRDA 3L4BC 5A8WB 4ANDA 3OJSA 3FKBA 4I7FB 4NLWA 4Q7AA 3TW0A 3ZZUA 4CO2A 4Q44A 4JYAF 1B7YB 1Q81T 1UEUA 1TL1B 2APOA 3AJ2A 5KG1A 3KK2A 3MPDA 2MPUA 2FHOB 3QRRA 2D3O1 1N6QA 2OP5A 1S99A 2AEMA 2Q6CA 1QJHA 2X1GA 4KKOB 5B0AA 3W2VB 5I3QA 3R5AA 1YBAA 1CJKB 3FEZA 1UCNA 4NLQA 2UU9F 2UUBF 4ZN3A 1YG0A 1R89A 4QYZJ 3BYRA 5H1SV 3PHEA 2J9CA 2WBRA 3IWLA 3BPSP 3K5MA 3J7A1 1TKZB 4I56A 2DYAA 1VRTA 3W2VA 3RB3A 1TKDA 4UOHA 3OFFA 4ZK7M 4GMKA 1YTYA 3BQ0A 4EUVA 3M05A 2EK1A 4L6V3 2JH3A 3MM8B 3J81Y 3IGNA 5L9XA 4Q5VA 2Y1JA 2B4UA 4F4WA 2UUCJ 4I69A 3Q8QB 2HK3A 1T02A 3BBCA 3RUBL 3ZNJ1 1U8WA 2B4OA 4OZ2A 4EO8A 1UVLA 4YOEA 3P8BB 5LSRA 2YPZA 2GQQA 3C66A 3CJ8A 1KDNA 1O6XA 4N47A 2N82B 2X3DA 3KMSA 2RF2A 2DGWA 1RQ0A 2HWTA 4N77A 3U7JA 5IQ6A 3HSJA 3G6XA 2JZ8A 4FBUA 4DR4F 2CNLB 2BJ9A 3FZBA 4KYZA 3DYAB 1B99A 1T9VA 1WEXA 4JUZA 4ID8A 3KLEB 1QAIA 2XG8A 4ECXA 3OBIA 5HL7Q 4EU0A 5CYQB 3CDWA 4MTPA 3EM1A 3UO0A 4KE5A 2RUSA 5HK4A 4MK8A 3ZTQA 4WXOA 1UVIA 1TKTB 1N8RT 3BPDA 4ERDA 2F3JA 3DI6B 4URSA 2X3GA 2F8EX 4G1IA 4ZS6A 3OJUA 3NBPA 2HHSA 4QYRA 1SQFA 1FD2A 1M1HA 1RE1B 4EO6A 4Y0FA 2HMIB 3B78A 1NPKA 2DXFA 4KIAA 5DGAA 4C4WA 1YJRA 1N48A 2I38A 3HLUA 5DQGA 2PFDA 4ZJQA 5LM7E 5F0WA 3GCXP 4FZVA 3BH6B 4TQSA 1WOPA 1FO1A 2H5IB 1SUQA 3OL6A 4C98A 2AJ0A 3JTOA 4NZ0A 3J7ZT 1WACA 1QAXA 2J7UA 3G8TA 1UJ6A 4ECTA 1RADB 3MM7A 1HBOB 4DX7A 5C24B 5HQ8A 4X62J 2RQKA 1X4GA 2C2KB 2LQBA 1VQOS 2GQCA 4Y2KA 1G7CB 2D7SA 6FD1A 2L9NA 1FNOA 5CYQA 3P96A 4UF4A 4AL7A 4DF4A 2RDIA 2NUUG 4BWJA 3EPGA 3PX4A 4QIWD 3P3DA 2VBZA 4F4KA 1C1BA 1VRUB 2AX0A 3D9BA 4USUA 1RAOA 4R0JA 1RHQB 1U0HB 5ETVA 4KHPF 2FHJD 3GIJA 4DUZJ 3MFHA 4IG3A 1IWGA 4C8MA 3MZIA 4LR7A 4F02A 1XEZA 1N5QA 2DNYA 2JSXA 2HNZB 2MGZB 2PA8D 1B0PA 4ECUA 2W24A 3D1HA 4NXNF 2HNYA 2DD8S 4DR1J 4DQRA 3ONQA 3CDAA 3PY8A 4NX9A 4PEOA 4ZVUB 1XMQF 4B3RJ 2MKYA 1QY7A 3M8PB 5T7LA 1NO8A 2FJAB 3TZZA 3QPIA 1KD1T 1B7FA 2VPXB 3CEDA 3H7HB 3PRBA 1SL2A 5AJ3J 1J27A 2VG5A 4DUTA 3NMRA 3UDCA 3D6TB 1HNVB 2IIHA 4Y2CA 3BR8A 2QL9B 5A8KB 4B9LA 5DDOC 3AFGA 1GMUA 2WONA 4U7UD 2MKJA 1G1XA 2HNZA 1F0XA 1EETB 2B9WA 3ZZZA 4M5NA 2OO4A 5FLXU 1FD8A 2BKNA 4OZ5A 2BJ3A 2ADBA 2M5YA 3N6MA 3WQPA 3J81U 3FGVA 1U0HA 2W1BA 4RPFA 3TA1A 3OTOJ 2VDIA 4RNHA 2W8KA 2DNOA 2FZKB 2R3VA 1RT4B 3MWBA 1S1TB 2VFVA 1FKAF 4KKOA 3V2UC 2J0QD 2W7AA 3MURP 2DEIA 4NOHA 4J9LA 4DWIA 1SUQB 2ZZTA 1ZTWA 4W90B 3IR7B 4O4GA 2B7CB 4E2FB 5I3UA 4I7FA 4JOUA 3EGVA 4DG1B 4QZVB 5K20B 1N5YA 4RW4A 1J5OB 3ZTSA 2FJXA 1SKSA 1RAEB 2HMIA 3TUZC 3G6VA 1JLEA 2HGMA 1TVRA 5JJBA 1KS2A 2YNIB 5L8RC 1S0VA 1YJ7A 2OD4A 1YJNS 1RBAA 4WZQA 1RT6B 1TKTA 3BGRA 1B0TA 4MT1A 3LH2S 4FDFA 2KH9A 2E7WA 3C15B 4DV5J 1JWWA 2ZBCA 4KSEB 5B0GA 1FKOB 1KFDA 1GXLA 3KUHA 4YS2A 5LMUJ 2VA2A 3MAAA 2Y1LB 3UR0A 2A10A 2R7SA 1UPPA 2LA6A 3R97A 2ZH9A 2LMIA 5BYQA 1UFKA 5J1EB 3FC9A 2E1PA 2A3JA 3TJAA 5HLFA 2ZHBA 4LFBJ 4P9SA 3EPIA 4Q2MA 1UEVA 2JC0A 2C22A 3PTWA 4DJBA 2R2TA 4DR1F 3JTPA 2R2UA 3DYAA 2WW4A 2H3EB 4DCJB 1VIXA 2XO7A 3BN4A 2MZQA 1GX5A 5F8NA 5CHCB 4DUZF 3KLVA 2YY3A 4TN2A 4AFFA 3EGZA 2DHAA 2HVEA 2C2RA 3MM5B 3FDSA 4USTA 3SYZA 2OELA 4KFBA 5AXLA 1RWNB 4ES1A 6AT1B 3KJFB 1YWXA 3OFEA 4AUKA 4DSEA 2VZ9A 2RHQB 5A2QU 1B70B 4NXMJ 4ATNA 4DEZA 4OHWA 3MCNA 1R0CB 1TK5A 2MZJA 1H72C 4IG0B 1CJVA 1FTRA 4AT1B 3KK1B 5CZXA 2O3DA 2QL5B 2M4MA 2MDAA 2BA9A 1PBUA 1U2RA 2X1AA 1UVJA 1W25A 1EQ0A 4ZCIA 2L48A 4A8MP 5L1JA 3H98A 1TELA 1ZM9A 4MKYA 1CS4A 5E2QA 3M2VA 2OPPB 3AQPA 4C0HA 3W62A 4NE9C 1HFEL 2DNMA 3IP0A 3OFGA 3PW0A 1XNRF 2BQUA 5I3PA 1C0TA 2LFVA 1S1XA 2MZSA 3WIVA 1X5TA 4RX6A 1FRXA 1Q53A 1Y00A 4NASA 4OYWA 5CXTA 5B7WA 3H2LA 2OPPA 1RT1A 2RVJA 1MROB 2YNGB 4M5GA 4Q0BA 5B09A 2DEJA 1P9YA 3C6UA 2QA1A 3P5TL 1FFSB 1IKYB 3EDQB 1NM2A 5KOXA 2UUAF 2OH2A 1VQ8S 4E0DA 2D3ZA 1OSDA 1RAIB 3A4TA 3EVOA 2DGOA 3BBBA 1RA7A 1WHWA 3FBEA 1WSRA 4RW6B 5BR8J 1T3NA 1QSSA 3LALA 4OZNA 3VAIA 1SC1B 3B8HA 1V6HA 2GO8A 2RT3A 4TYBA 3SCIE 2DB1A 3IBCB 2LVWA 1JQGA 5D3GA 1UFLA
chains in the Genus database with same CATH topology
1C3GA 3AGXA 3NXZA 1EARA 2HFVA 3AGZA 3LA0A 3TJ9A 3I38A 1EB0A 1GMWA 2Q2GA 1GMUA 1NLTA 3L9ZA 2B26A 4L3KA 3AGYA 1GMVA 3LZ8A 3TJ8A 1XAOA 1GMWD 2QLDA 3TJAA 3NY0A 4J80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3G A;  3AGX A;  3NXZ A;  1EAR A;  2HFV A;  3AGZ A;  3LA0 A;  3TJ9 A;  3I38 A;  1EB0 A;  1GMW A;  2Q2G A;  1GMU A;  1NLT A;  3L9Z A;  2B26 A;  4L3K A;  3AGY A;  1GMV A;  3LZ8 A;  3TJ8 A;  1XAO A;  1GMW D;  2QLD A;  3TJA A;  3NY0 A;  4J80 A; 
#chains in the Genus database with same CATH topology
 5ETS A;  1MLA A;  3U27 A;  3OUY B;  1NK5 A;  1KTV A;  2KYZ A;  5D4P A;  5ETO A;  1GTH A;  1X7V A;  2BE2 B;  3AJ1 A;  1I51 B;  3NOG A;  4U9R A;  5K8N A;  4JI5 J;  1T05 B;  2YX7 A;  1V3Z A;  3EMT A;  3JB9 k;  3VAF A;  3W3S A;  1FJG F;  5JUM A;  1QAJ A;  2ZH6 A;  3NGK A;  4C3L A;  2FJB B;  3MEC A;  4ZPV R;  5DRK A;  4RW7 A;  4URG A;  1LV5 A;  3GFH A;  2O67 A;  1QSY A;  5KT7 A;  2OTJ S;  4P52 A;  2Z56 B;  5HLF B;  1FTC A;  1D0E A;  2W01 A;  1I6J A;  3UE2 A;  3DLB A;  4OX6 A;  1Y5N B;  2CPX A;  2DIS A;  2FIU A;  2GIR A;  2RRB A;  3N28 A;  1TV6 A;  5F9L A;  2UUC F;  3MAA B;  2JNJ A;  4PAA A;  4ZLJ A;  4FS2 A;  4C8O A;  2FLP A;  1G4C A;  2XMJ A;  5KG2 A;  4P73 A;  1GXT A;  3FMB A;  4KGM A;  1T9X A;  3DHX A;  4RJV A;  4HYK A;  1SH0 A;  3SMZ A;  3PKM A;  2DNN A;  2Y8Y A;  4ZP7 A;  3D7S B;  2VIH A;  4F50 A;  1WNE A;  3TX8 A;  1H0H B;  4ID5 A;  1N5S A;  1KRP A;  3KLF B;  2BQ3 A;  2XNR A;  3NL0 A;  3SQG A;  2QX0 A;  2W25 A;  4CT9 A;  1DBD A;  3DRP A;  1U49 A;  2E5L J;  1KEK A;  3DOM A;  3M30 A;  1FRM A;  1YDL A;  1MMN A;  4YY3 J;  5I3U B;  4DUY F;  4F3M A;  1N5V A;  4BCA A;  1G6B A;  1LW0 B;  2H5J B;  2E44 A;  4LFC F;  4HKQ A;  4KB7 A;  1PIL A;  4RUB A;  3MPW A;  3V6K A;  4YY3 F;  5CQG A;  4FF1 A;  3V6D B;  4RUH A;  2M9K A;  4CO4 A;  3H2U B;  5KFF A;  2J9D E;  2ZBQ A;  2F40 A;  2BJE A;  1NZA A;  2EFO A;  4Q0B B;  1F2G A;  1S7H A;  2WSE C;  4JI6 J;  1OY9 A;  2WVC A;  1HW8 A;  1FFG B;  4DV7 J;  3A8I A;  3ILO A;  3NGU A;  4FVC A;  4PWU A;  4ZVQ B;  2RS2 A;  1HIY A;  1U7L A;  2CPI A;  2Z0G A;  4JB8 B;  4YB5 A;  1O51 A;  2LLZ A;  2DIU A;  4FKY A;  3CJ0 A;  3TAM A;  3FSY A;  3W61 A;  1WI8 A;  5ADZ A;  1ZAW A;  3DLK B;  2AD9 A;  4DV1 F;  1KLM B;  4WCE Q;  4RNM A;  2UXB J;  2ZE2 A;  1UP1 A;  2C2Z B;  2BV3 A;  2RDJ A;  2N4D A;  2WBM A;  5KT5 A;  2ZWP A;  4IFV A;  2UV8 A;  2GNK A;  4HHJ A;  3FUY A;  1ZZN A;  2IRY A;  2R42 A;  3PYD A;  3RRH A;  3R1L A;  4Y00 A;  4LFA J;  4IR1 A;  2DRA A;  3D67 A;  4U7C A;  2XCA A;  3GII A;  2YVS A;  2MZ1 A;  1SL0 A;  1K73 T;  2GVD B;  1F9H A;  2P5V A;  3DXB A;  4HEA 9;  1Y3K A;  2OGU A;  4PQU A;  2QSF A;  4J9Q A;  4ZHR A;  4DL4 A;  1IBK F;  3G86 A;  2IC3 B;  4NLD A;  3ZZY A;  1HWU A;  5GAD U;  1QD1 A;  2AJ4 A;  2W2P P;  1UZH A;  3L7P A;  2LQ9 A;  3DLL Q;  2XLI A;  2PI4 A;  3IC1 A;  2BMB A;  3MMB A;  4O3S A;  1WKL A;  3HHK A;  4Y6I A;  3EXY A;  3GFY A;  3PHT A;  3G87 A;  1RT7 B;  2LDY A;  3UD5 A;  3UDL A;  4MK7 A;  3UQS A;  2AWZ A;  3EXC X;  3BO3 A;  2YNF B;  4DL3 A;  3EIC A;  2QN6 B;  1W2B R;  4OV1 A;  4NCB A;  4FBT A;  1HLW A;  1CBK A;  4NYO A;  4TXS A;  1APS A;  2QE5 A;  3DC2 A;  1QM9 A;  2VFT A;  1VC0 A;  3D6F B;  3M8Q A;  2ZM6 F;  2LXI A;  4HR2 A;  3N6L A;  1RDR A;  3F73 A;  3A13 A;  1VGY A;  2B8P A;  1S72 S;  4LRC A;  4AL5 A;  4Z7C A;  4UOF A;  5EWE A;  3V4M A;  4QU7 A;  3PAC A;  2DRD A;  4OX8 A;  3TA0 A;  3W60 A;  2E66 A;  2EI5 A;  2Q3P A;  2G2Y A;  2WVF A;  5M2U A;  3B4M A;  4DV2 F;  1U1R A;  1JLG B;  2EC2 A;  3M9M B;  4DV3 F;  1DUR A;  1A7G E;  1NHU A;  4NLO A;  3NS6 A;  5HMX A;  1BWV A;  2BE9 B;  2M52 A;  5AXM A;  1BLU A;  3PW4 A;  2XSJ B;  1C4A A;  3QT5 A;  1X8D A;  2R7O A;  2H9Z A;  4CH7 A;  2YQ3 A;  1NDK A;  3ILJ A;  4CLS A;  1S1U B;  4RUA A;  4ZVT B;  5LMN J;  3N5B A;  1IKV B;  1U2C A;  1RTH A;  4LT6 A;  4WTO B;  1DAX A;  3BJY A;  2RKI B;  2NR0 A;  2CA9 A;  1FHT A;  2WZ1 A;  4WE1 A;  3W9J A;  2B0G A;  3NWR A;  3C46 A;  1U26 A;  3N9U C;  2HWH A;  4G1P A;  3AD9 C;  4QOT A;  1HBM B;  1M5V C;  4DL6 A;  4IO1 A;  4YR0 A;  2MQO A;  1VQ9 S;  3A8K A;  4F2R A;  4LF5 F;  2XGQ A;  2LDI A;  5LMN F;  1PO6 A;  4DN9 A;  2PSZ A;  2UVR A;  2IVF B;  2KO1 A;  1S97 A;  4ELU A;  2LP4 A;  2QGF B;  1UFW A;  5KFU A;  3FQK A;  4H4K A;  2HK2 A;  4FXD A;  4RO0 A;  2ZKT A;  1J2V A;  1PKU A;  1CC7 A;  4RW6 A;  4CT8 A;  3GIM A;  2VPW B;  2DO4 A;  3ZZ0 A;  2RS8 A;  3NS5 A;  3PIO Q;  1IUJ A;  3JQM A;  4HAC B;  2F8M A;  4I2P B;  2EPI A;  1VRT B;  4USJ C;  1FER A;  5D0E A;  1Y5I B;  4NML A;  4YDX A;  2POK A;  3G82 A;  5C25 B;  1SL1 A;  3SCL E;  2DY1 A;  2JEI A;  2J0X A;  4X4V A;  1Z2L A;  3NCP A;  4PG5 A;  4ENO A;  5AT1 B;  2E5H A;  3EX7 B;  3PW5 A;  4DR5 J;  3M2V B;  2MJU A;  2F4F A;  1RP5 A;  2Z8Q A;  1DAR A;  3MTK A;  4MAK A;  1WG5 A;  3THP A;  1S57 A;  1XN9 A;  3KDN A;  2A0F B;  4Y2A A;  1F9E B;  3TUP A;  4HAC A;  4KJI A;  1RTJ A;  2VV5 A;  2E9T A;  2FVR A;  3PM9 A;  2J5A A;  3VAJ A;  2VDH A;  1X5P A;  1ZZF A;  2V5H G;  5KFE A;  2DGX A;  3GJQ B;  5HVH A;  1NBE B;  4X65 J;  3MI7 X;  1UMJ A;  2DCL A;  2Z4P A;  3H5U A;  2WVB A;  8RUC A;  3F56 A;  2IPO B;  3NAI A;  1HBM A;  3R1H A;  3CUN A;  1T03 A;  1HQU A;  4MH8 A;  2HHP A;  1T0T V;  1N5T A;  4WE1 B;  2GIQ A;  1FRJ A;  1KQG B;  1U48 A;  4K4S A;  3ULH A;  3EZ5 A;  1XMQ J;  1K47 A;  1HYS A;  2ZZM A;  1SC3 B;  2DGT A;  2UXB F;  1S1U A;  5E3A A;  4F67 A;  4B3O A;  3LP1 B;  2FLN A;  2QT7 A;  2RQC A;  1IN0 A;  2DNH A;  2Y8W A;  1PG5 B;  1UAW A;  2GGP A;  2NXC A;  2OHD A;  4FYW B;  2LU2 A;  3R5B A;  3GP9 A;  4P2X A;  3RZA A;  3H40 A;  3R2C J;  2CNK B;  3ETM A;  4X65 F;  2LEC A;  3FZ2 A;  1RWO B;  4TKT A;  2CRL A;  3VGV A;  1UW4 A;  4OZ1 A;  4C3M A;  4DV7 F;  3QRQ A;  1Q8K A;  3L7U A;  1ZS6 A;  3S6E A;  1I94 F;  4KHP J;  1FEH A;  3R3T A;  4DSK A;  3V6J A;  1C1C B;  2ZBP A;  4KY3 A;  3ZC4 A;  4I67 A;  3HHE A;  5D4O A;  2EKN A;  2DNQ A;  4DQP A;  1JLE B;  1UZD A;  3MM6 B;  3IWN C;  4K4X A;  2V2K A;  5HBM B;  4EYH B;  1R0A A;  1YJV A;  4PPD A;  1N32 J;  4ZCL A;  4IH6 A;  1WHX A;  1M5H A;  2M0G B;  5DET A;  1J5O A;  1RT3 A;  2P6S A;  2L41 A;  3TEH B;  4HH1 A;  2ZH7 A;  5GME A;  1BD6 A;  1YX2 A;  4U67 Q;  2AGO A;  1VJW A;  2DXE A;  4ECR A;  1VI7 A;  2WVD A;  3O2I A;  4O0N A;  2IBK A;  4WBF A;  5KG3 A;  3PZP A;  1TFY A;  4PWW A;  4DFP A;  3RW6 A;  4WKY A;  2QO3 A;  5KFL A;  2HZA A;  5EWF A;  1N4L A;  2BOP A;  3HFV A;  3ZXW A;  2PI5 A;  3P4U B;  3LPY A;  1WC1 A;  3B6B A;  5CH7 B;  3BDE A;  3DRR A;  3OQ2 A;  2HBY B;  3D3B J;  1EJ7 L;  2OSR A;  3EZO A;  5KG4 A;  1U47 A;  1QDU B;  3DMJ B;  4YR3 A;  3RYL A;  4N56 A;  1ZPV A;  2H54 B;  4IKA A;  1L3K A;  1LKZ A;  5ETN A;  4WKR A;  3MD3 A;  3QYY A;  1ZM4 A;  4IUF A;  2RD5 C;  1TL3 B;  3WC2 A;  3AD7 C;  3UWT A;  3C3L A;  1FJG J;  1RHR B;  3MCS A;  2E9R X;  3QNW B;  2CFX A;  2JL9 A;  1RBL A;  3GWC A;  5KT3 A;  4LF9 J;  3QAU A;  2IA6 A;  2KRR A;  3DLK A;  3OTE A;  1OIA A;  2NUH A;  5F41 A;  2VIC A;  3E51 A;  3AGY A;  4NLP A;  2QJ3 A;  2GA7 A;  1JLC B;  3NGS A;  2YX1 A;  2V9K A;  3OR1 A;  2GZO A;  3TP2 A;  2W8L A;  3I5B A;  5G4D A;  4Z2X A;  5CD4 H;  4M5D B;  3Q8S B;  5BR8 F;  2LYV A;  4PUO B;  2B7B B;  5KG5 A;  3THV A;  1RLC L;  2W9C B;  4WFX A;  1M90 T;  4LBI A;  1UA0 A;  3OSP A;  2AZ3 A;  4NI2 B;  2QFJ A;  2RHS B;  1RXO B;  2IFX A;  5B0C A;  5L1I A;  3HPO A;  3O6Q A;  3MCO A;  3PX0 A;  1ZPW X;  2HQG A;  2QLB B;  1OPI A;  4GO5 X;  1M5P C;  4QR0 A;  4DR7 F;  2R7V A;  2F9D A;  4DL0 C;  3DRP B;  3CB4 A;  2D9O A;  2FVC A;  5GAE I;  2WB1 D;  4YB6 A;  1Q7Y T;  2ZD1 B;  1HWI A;  2DNP A;  3GSD A;  1U4B A;  1X0F A;  2DH7 A;  1VYA A;  2YNH B;  3M9N B;  1KSP A;  4F4Z A;  4YDD B;  5IWA F;  2NSC A;  4CNZ A;  4CLF A;  4EBC A;  1NKC A;  5E41 A;  3UW1 A;  4NEY A;  2G2Z A;  1UPM B;  3PW2 A;  1FDN A;  1AYE A;  3PO4 A;  5CAB A;  3QID A;  3EDR B;  2QRR A;  3TVY A;  1X5O A;  3LUY A;  4F2S A;  1RHK B;  3CJR A;  3RB0 A;  4O3O A;  3RGI A;  2DXD A;  4F36 A;  2CJ9 A;  3TAN A;  1QSL A;  2FHK A;  1G2E A;  4LF9 F;  2F1F A;  1RAH B;  2HS3 A;  4NYP A;  4QWB A;  4Z37 A;  3CCE S;  1P1T A;  3Q2S C;  3IN5 A;  2HBZ B;  2Z57 B;  4LRA A;  3T19 A;  4N7T A;  3OUY A;  4O3R A;  3C6T B;  1N52 B;  3UNY A;  3AY0 A;  2R7X A;  1XK8 A;  2AV5 A;  2ZEJ A;  1REV A;  2NYI A;  4RW9 B;  5LOQ A;  1RYS A;  3MAH A;  2Z2L A;  1S6P B;  4O44 B;  1MN9 A;  1BC6 A;  5EN1 A;  3HX9 A;  3DCA A;  3T9Z A;  3NGD A;  3KYL A;  2IDL A;  2E5J A;  4Q45 A;  2IJF A;  2I8E A;  3QGI A;  3HVR A;  1OJ4 A;  4DV5 F;  1TKX B;  3KLH A;  4CTA A;  1KKH A;  3CJK A;  1WDT A;  1BQX A;  1SKW A;  4F7V A;  2LXF A;  1H2U X;  1RAG B;  2C2O B;  1NK8 A;  3Q0A A;  1JKH A;  5J1P A;  2CXE A;  2V4J A;  2JEG A;  3QMQ A;  2FJV A;  1DFD A;  2DNK A;  2FHJ A;  4MFB B;  4UQG A;  4JI4 F;  1Q8L A;  3BH7 B;  2DR7 A;  1TU0 B;  2ZVS A;  4DX5 A;  2C1E B;  1N32 F;  4B17 A;  4J90 A;  2C3O A;  1T9U A;  2PO4 A;  2QLF B;  4LFC J;  4R5P A;  1RCX B;  4ELT A;  1T11 A;  2HQ3 A;  3QLH A;  2BVZ A;  1XR7 A;  1XIQ A;  3FEX B;  3FRZ A;  1HNZ J;  4XPC A;  2EBG A;  3VQS A;  2ALZ A;  3EZU A;  2HQD A;  4OZ3 A;  1SC6 A;  3E3X A;  1R6Y A;  1S5Z A;  2F7V A;  1TKX A;  4QIF A;  4QR2 A;  3LQV A;  5HMY A;  3H4D A;  2JLE A;  5KFR A;  3KG0 A;  1RTD A;  4ZOS A;  1CJV B;  3LA0 A;  3I9V 9;  3KK1 A;  1VQM S;  2IY5 B;  4RL1 A;  1AT1 B;  4TY8 A;  3V4I B;  1YHQ S;  5AJ3 F;  3OL9 A;  1QUP A;  4PG7 A;  1IBM J;  3A8J A;  2ZJP Q;  3CME S;  3K17 A;  2VBW A;  4JBC A;  1CC8 A;  2MHN A;  2PMZ D;  3CXC R;  5GAD I;  2LEB A;  3VVT A;  7AT1 B;  4ECV A;  1HMV A;  2P8I A;  4ECZ A;  2AMC B;  3C8Y A;  4WFZ A;  2XCP A;  1WC0 A;  3R2D J;  1X31 C;  4PWD A;  1NXI A;  3K8V A;  3MEE B;  4WFN Q;  1RTH B;  4QQB A;  4EMD A;  1F5A A;  1Z4U A;  3FFI A;  3HVA A;  4LUB A;  3U1M A;  3GIK A;  5HRO A;  3PEH A;  2ZUG A;  3PJW A;  4TLR A;  2FLO A;  4OMF G;  4K5R A;  3OVA A;  2YWH A;  3PO5 A;  3CPW R;  3K7R A;  5GMD A;  3J7A N;  1FFW B;  2GC8 A;  1D9A A;  2DBB A;  2IM1 A;  4WFA Q;  5CD4 A;  1SV5 A;  3HHD A;  1AXQ A;  1GT8 A;  1RAB B;  2EG2 A;  2Q1L A;  2Z2Y B;  5SUH A;  3WDO A;  4YUD A;  4CIO A;  5KT2 A;  1JB0 C;  2C2N A;  4DR5 F;  1BGX T;  3VHQ A;  1C2P A;  3AH6 A;  2R7T A;  1GMW A;  4WPA A;  4KH1 B;  4O3Q A;  1RKJ A;  3NG8 A;  2Q6B A;  2YPY A;  2EWH A;  3K2Y A;  2KRB A;  3QFW A;  2YKM A;  5C2C A;  3V5R A;  3RAX A;  1CLF A;  1N5Y B;  2AEF A;  1LFP A;  1EP4 B;  4IQM A;  4C0O C;  5MLC V;  4EEY A;  4IOC Q;  1MN7 A;  1DJ0 A;  2FUG 9;  4O4G B;  4RLE A;  5LT5 A;  2JRR A;  1LQ9 A;  5BYS A;  2NPF A;  2ZC4 A;  4RNF A;  3CMA S;  3A1Y G;  4GO7 X;  2HW3 A;  2QSW A;  1LWC A;  1WDD A;  5HN0 A;  2B56 A;  1EET A;  2ZOF A;  2B6A B;  2H48 B;  3OVB A;  4MMO A;  2C28 A;  2Z2Z A;  3N0V A;  2C3P A;  1JLB A;  2AW0 A;  2EFN A;  1TUG B;  3IRX B;  4YB7 A;  5DO2 A;  3RTV A;  4IRD A;  1AB8 A;  4KV8 B;  4P7V A;  2GCF A;  3C14 B;  2QC3 A;  1D9D A;  1DTQ A;  2HBQ B;  2DPJ A;  2OPS A;  2RB7 A;  4JI7 J;  2VG5 B;  2KJW A;  2ZVI A;  1FDB A;  1BUX A;  3OR2 A;  1DQ9 A;  2B8Q A;  1S6Q A;  2VF3 A;  5IT0 A;  3TQE A;  3H4B A;  4FS1 A;  5IC4 B;  5T7L B;  4CLU A;  2MGZ A;  1TK0 A;  1JJH A;  2RUG A;  4IG3 B;  4ZP6 A;  3HD1 A;  2BAN A;  4DU7 A;  2RJZ A;  3FRY A;  3IRX A;  4PG4 A;  3ITH A;  4E8U A;  1KFS A;  2G9O A;  1NDC A;  1HQ2 A;  3DRX A;  3TAM B;  4DHV A;  3VAH A;  4DX6 A;  3WZ0 A;  4XK8 C;  5DM6 Q;  4ELV A;  4RBT A;  2PMW A;  3MMA A;  1QVF R;  3HO1 A;  4ZLL A;  4DV0 F;  2V8G A;  1Q79 A;  3KK3 B;  1TMJ A;  2XUL A;  1H38 A;  3US5 A;  1VRU A;  3R5G A;  3BV8 A;  2VOD A;  5C24 A;  3ZZR A;  1LNQ A;  2FJD B;  1SIZ A;  1OY6 A;  1HPZ A;  4Y65 A;  1BQN B;  4ETX A;  5HJY A;  1DQA A;  2DNR A;  3KG1 A;  2GHV C;  2LKZ A;  3D2W A;  2I5J B;  4LF8 F;  1FVQ A;  2VQE F;  1HBO A;  2XMA A;  1YIT S;  3S1T A;  4ES3 A;  2UUB J;  2L08 A;  5K5M A;  4DPX A;  3UN2 A;  3CIZ A;  5LJ3 Y;  3VAM A;  4WP9 A;  1HKA A;  3K5P A;  3H20 A;  4N8O A;  5LSL A;  2VJV A;  2X1B A;  2DNL A;  3D0I E;  1CJU A;  3A3P B;  1R3N A;  3JSR A;  3NBP B;  4LSZ B;  1WUU A;  2PE8 A;  3WX8 A;  1U1P A;  4DL7 A;  5KFG A;  5DDP C;  5IV3 A;  3AGX A;  1D8Z A;  2OJ3 A;  1NK4 A;  5SZT A;  3A3O B;  1SV5 B;  4ITS A;  4UTG A;  2R8H A;  1PYO B;  4J5O A;  4OYI A;  1JXV A;  4USW A;  5HQM A;  4J91 A;  2RH3 A;  1VHF A;  3ZFV A;  4F0H A;  3PR5 B;  1IBK J;  2D74 B;  3K58 A;  4DV6 J;  2BZ2 A;  2J7W A;  5J2M A;  3UDV A;  3SV3 A;  3LTO A;  1RT2 B;  2VC0 A;  2MB0 B;  2LCW A;  3FFI B;  3KJN B;  4UW2 A;  4K7Q A;  2PFF B;  5B08 A;  4MKV A;  2YH0 A;  2HVZ A;  2KM8 C;  1M5K C;  2HHQ A;  4V19 J;  3B54 A;  1FRL A;  5DZ6 A;  3KLE A;  4B3R F;  3A8E A;  1IKX A;  3EGN A;  3CT9 A;  1K8A T;  2DGQ A;  1T03 B;  1DHM A;  3GZ7 A;  3QO9 A;  3GE9 A;  4JV0 A;  3ZZO A;  2A1B A;  4B9T A;  3I5C A;  5D6G A;  4QIE A;  1ZOT A;  4NA3 A;  3IFE A;  7FD1 A;  2Y3Y A;  5J2N A;  1S6Q B;  3DKD A;  2V50 A;  3HD2 A;  3OR2 B;  3W63 A;  4ED3 A;  4LF4 J;  2UXC F;  3N79 A;  4ETZ A;  4UZB A;  3T5L A;  3BBF A;  4FF2 A;  3NGT A;  2CQC A;  2XMM A;  5HJX A;  5M2R A;  3QLH B;  4NRU A;  3AJD A;  3IMQ J;  4BC7 A;  2ZH8 A;  3UD3 P;  1FE0 A;  4GKJ F;  3CE8 A;  3CO9 A;  1N33 J;  2MY7 A;  2BOA A;  1VS3 A;  4KC5 A;  1RWM B;  1QTM A;  4ZJO A;  2ZBR A;  2XB2 D;  1LWF B;  3MM9 A;  5KFN A;  2HIQ A;  4HI2 A;  1CJK A;  1XMB A;  1U6Z A;  1SI9 A;  4BC9 A;  1S1X B;  1ZAV A;  5C42 A;  5HO4 A;  3CCS S;  4EYI B;  3MTJ A;  1U1N A;  1HHQ A;  2V4J B;  1HR0 J;  1RAC B;  3KK2 B;  3GON A;  3M8R A;  4DR7 J;  2IVY A;  3W5Y A;  3T6B A;  1RK8 A;  3KLH B;  1NZ8 A;  2CQ3 A;  1SCJ B;  1CQM A;  4UY8 5;  2BJ8 A;  3PFO A;  1HBN A;  1JX4 A;  2U1A A;  3Q22 A;  3QBC A;  2XLJ A;  5EX0 A;  2B9Y A;  4OHZ A;  4Y28 C;  2DR6 A;  5AXK A;  1T9W A;  4R8U B;  2E9Z A;  3I38 A;  4J9N A;  3MF5 A;  3H5S A;  1R8C A;  3G2X A;  3JTN A;  4USV A;  4ED4 A;  2BYC A;  3LP2 B;  4A4J A;  1BQM B;  3J7Y I;  4PRF A;  4K50 A;  4J9R A;  2ZNZ A;  2RQM A;  1CG2 A;  2C3Y A;  1IKX B;  3HHL C;  1U6F A;  5T41 A;  3BSN A;  1TAQ A;  4K5S A;  4DQQ A;  1QVG R;  5KFP A;  3HM9 A;  1T3O A;  4JI5 F;  1CQN A;  5L9N A;  1PGZ A;  4OYA A;  1BXN A;  1RU2 A;  1HI1 A;  4DI6 A;  1NU4 A;  4HT7 A;  1CVJ A;  4GRS A;  1IKV A;  1XR6 A;  2K1R A;  2M88 A;  1JJ4 A;  3FK4 A;  2HLT A;  4I4B A;  2Q79 A;  3TUI C;  3CDB A;  4CM0 A;  1FDA A;  3QGH A;  3HVT B;  3MED A;  1WOO A;  3NGR A;  1HMV B;  5DGB A;  4LQ9 A;  4DBQ A;  3GJS B;  2HZC A;  2V8V A;  1FKO A;  3SBM A;  3NNH A;  1RYR A;  4MYU A;  4DQI A;  3P5B P;  5ITH A;  4KGX B;  4CNY A;  5GAE U;  1VDH A;  2AYE A;  1PJ5 A;  3B4D A;  3NP5 A;  4WFY A;  1V5V A;  2O1P A;  3I82 A;  4XO0 A;  4Q43 A;  2QA4 S;  2FJE B;  3HDS A;  3QJJ A;  1F9F A;  5BXI A;  3ET6 A;  3CDE A;  4DPT A;  1PC4 A;  1YRU A;  4I6W A;  4K8R A;  3QZ7 A;  1PYS B;  1BHN A;  4A47 A;  5ETT A;  2B3T B;  1EKS A;  1S6O A;  1XBW A;  4KH0 B;  4OV6 A;  2HFU A;  5KFJ A;  1VRQ C;  4ED0 A;  1D9F A;  2ZOG A;  1XNR J;  1VHI A;  3KOA A;  2M7S A;  4L73 A;  4CLT A;  5LSO A;  1ZAX A;  2LXU A;  2UU9 J;  1W7W A;  4P2F A;  2BJD A;  1S1V B;  1UWA A;  2IM2 A;  4DX8 H;  3KNG A;  4JI1 F;  4X4T A;  2Y1I A;  4OI6 A;  3K0J A;  3CCZ A;  3QAT A;  2MQQ A;  2JEF A;  1NSQ A;  1FJ7 A;  3FCH A;  1VBK A;  3R5D A;  1VIS A;  1WC5 A;  2H5E A;  3T5J A;  1X4F A;  3VAL A;  3HFZ B;  4CO3 A;  2QMX A;  3I87 A;  4F04 B;  2CIM A;  2I0X A;  3M6W A;  2W9C A;  5K9F A;  2A6O A;  1JKH B;  2D41 A;  5A8K A;  2IC3 A;  3JYT A;  1HNV A;  4OHX A;  1K44 A;  4J9P A;  2R7W A;  2ZFH A;  3D68 A;  1DLO B;  3CUL A;  1U1Q A;  1JIH A;  2ATC B;  3CIM A;  4AQY F;  2CPZ A;  4L72 B;  1GX6 A;  3HJV A;  5D0R A;  3T9N A;  3TA2 A;  1M1K T;  2DIT A;  2FZC B;  2RRN A;  5CCM A;  3G9C A;  4JI3 J;  1ACM B;  1X4A A;  2CQ0 A;  4LSL A;  3R7S B;  4C0B A;  4J37 A;  3R9L A;  1C0U A;  2KN4 A;  5KFK A;  1DTQ B;  2ZE2 B;  4DR6 J;  5EHH A;  1VBX A;  3R5J B;  2MST A;  2IYI A;  3DNC A;  4ZPA A;  4B9V A;  5LMU F;  4JI8 F;  4Q8F A;  3PKY A;  3CJT A;  3FVY A;  2YWK A;  4QR1 A;  3OHA A;  1IM6 A;  4FPI A;  3SSR A;  5KFV A;  5AE1 A;  5EWG A;  3HHN B;  1VQN S;  3PFE A;  3BB5 A;  1V9O A;  2XQC A;  2FQQ B;  3MHY A;  5FD1 A;  4RU9 A;  2F8H A;  3GFX A;  4F26 A;  4MK9 A;  4YFU A;  3ISZ A;  1U25 A;  2WOM A;  1VJQ A;  3BO2 A;  4WJB A;  4J9M A;  4X84 A;  3EYZ A;  1R0A B;  2AJ1 A;  3LP0 A;  4C2M A;  3M8Z A;  2YNH A;  2CQB A;  5KFW A;  4OJG A;  1GQE A;  4KGZ B;  4RWW A;  3SXL A;  2OIH A;  3KUG A;  2KG1 A;  1C1C A;  3WC0 A;  5GAH U;  3NXZ A;  4CWB A;  2QIF A;  3MM6 A;  2IMO A;  2I5J A;  4LBH A;  2QYC A;  2KXF A;  4NL5 A;  4QPT A;  4AYB D;  5D0H A;  1S9F A;  3RRG A;  1F3F A;  1MU2 A;  3A12 A;  4LBP A;  4ZVH A;  4NWB A;  2XS5 A;  1X4H A;  4DL2 A;  4RBU A;  1PBA A;  1UA1 A;  1VBZ A;  4N5S A;  2DKO B;  2DO0 A;  2EC0 A;  3UD4 P;  2RSQ A;  2XNQ A;  1R0B G;  2AJF E;  4F3Q A;  3KJV B;  1OO0 B;  1B3T A;  3KK3 A;  3H5X A;  4ILL A;  1KHW A;  9RUB A;  2VG6 B;  1WOR A;  2C3U A;  4NI2 A;  4ZVP B;  3CCM S;  1X9S A;  1FEE A;  1N36 J;  2W9B A;  2BDP A;  2X7I A;  2ZWO A;  2GGP B;  4OX9 J;  2FDN A;  2MKC A;  5DS7 A;  3VR1 A;  3FQL A;  4TYA A;  4KRW A;  1F5C A;  3TI0 A;  2YXL A;  2PII A;  2YTC A;  2AQ4 A;  1R8A A;  2DGV A;  1CSJ A;  3KFW X;  4NXN J;  4IH7 A;  2BE2 A;  3QWP A;  4BDP A;  3EVM A;  2ZDO A;  4I1T A;  1WI6 A;  5AE2 A;  4O23 A;  2VPZ B;  5E0O A;  5D0G A;  1S59 A;  2N7C A;  1RAF B;  4A8Y A;  2ZKU A;  3DLE A;  4ILR A;  3ZTO A;  4EBE A;  1WD6 A;  3DOL A;  3KDO A;  4NEZ A;  3GJR B;  3OSN A;  3CCU S;  1TL3 A;  4B3S F;  3TNV A;  4F0K A;  3IM9 A;  4CP5 A;  1QE1 A;  2V8H A;  2ZDP A;  4BLG A;  4ES2 A;  2YBV A;  3PDN A;  5ETL A;  1P8G A;  2XMU A;  3DMJ A;  4NLY A;  3PYF A;  2HSE B;  2BJ7 A;  4Y3C A;  3OT9 A;  2Z30 B;  4ZMM A;  4CI0 B;  3RU0 A;  4PG8 A;  1H2V Z;  2JZ5 A;  1OMS A;  2KT5 A;  4P7T A;  3ZZT A;  1YI2 S;  1AUS L;  2MKH A;  4CRJ A;  1IJF B;  4P6Q A;  2NXJ A;  4U95 A;  3CW2 C;  5D4L A;  2OFH X;  1C0T B;  4TY9 A;  3W9I A;  2R7U A;  2FHM A;  4X4O A;  2NRE A;  1H73 A;  2XYH B;  4KQZ A;  5IT9 Y;  3AOA A;  2ASJ A;  1CS4 B;  4G1Q A;  4I64 A;  2M70 A;  2VOP A;  3MDF A;  1B64 A;  2UZA A;  2FPH X;  1HWJ A;  2CUY A;  2YKM B;  4ER8 A;  1N0U A;  2QA2 A;  3W9H A;  1IR2 A;  2K06 A;  4H4O A;  2F4V F;  3I0S A;  2NS1 B;  1X4E A;  3CJK B;  1LK7 A;  2RIL A;  1WEL A;  3IO1 A;  3M32 A;  2KM8 B;  4UQT A;  1Y5L B;  3HT3 A;  4ZVS B;  2ZH1 A;  1RUS A;  2JJ4 D;  3PV8 A;  2XHW A;  3CVK A;  2GIF A;  4L75 A;  2MLZ A;  1FK9 B;  4WII A;  4F4X A;  3L09 A;  4WFB Q;  2FZG B;  3UFC X;  3OXF A;  3VAG A;  4WWS A;  1V3S A;  1UET A;  2XTJ P;  2CQ4 A;  1S0O A;  4JV2 A;  1IWA A;  1S1W B;  2DPI A;  4DR4 J;  2BW2 A;  1JLQ A;  3GCW P;  2XWY A;  2KT3 A;  4FNH A;  3JS9 A;  3VV2 B;  3CCJ S;  1HBU B;  4PXB A;  5CZV A;  2H4W B;  1GK8 A;  1P6T A;  2BAB A;  3BGU A;  3S8S A;  1WWH A;  3M6V A;  3LP1 A;  4RWX A;  4L76 A;  2RKI A;  1TL7 A;  2CQD A;  2OI2 A;  2WCX A;  2ASL A;  2PD1 A;  1FJC A;  1Q78 A;  3O44 A;  3OV7 A;  1UWB A;  1NKB A;  4DV1 J;  1RAJ A;  3OXL A;  3AA9 A;  2W7O A;  4EBD A;  5ETP A;  1LWE A;  1FDD A;  1LFW A;  3OL7 A;  3DGP B;  2CQH A;  1RT6 A;  3ENV A;  1XNQ J;  3MUV P;  4I2Q A;  1MU2 B;  5CYJ A;  1FCA A;  2CQ2 A;  2K2P A;  2CPH A;  1QAY A;  3KKF A;  1IKW A;  3GSI A;  2EEY A;  2H65 B;  3Q8P B;  1U1M A;  5E7O B;  1RT5 A;  3HI9 A;  1ZM3 A;  2M8H A;  3DFE A;  4HLB A;  4NLV A;  3VCD A;  4UUW A;  2BRL A;  4NLU A;  3W66 A;  2W7P A;  2QMW A;  4PYD A;  5LL6 d;  2GJF A;  2JVM A;  4XTT A;  2FGO A;  2OUG A;  4B08 A;  2FVS A;  3LWL A;  3GJT B;  1KQS R;  4DSL A;  3M1V B;  4TU9 A;  2CJX B;  4F0M A;  3KMQ A;  3VQT A;  3MEK A;  4X66 F;  3PNI A;  2KFY A;  2KHD A;  4MKB A;  4OIX A;  2HWI A;  3T1H F;  2EKY A;  2EXU A;  5IM0 A;  1L3T A;  4OHY A;  4JYA J;  2NQP A;  1CJT A;  2OPR B;  1HQE B;  4ZCK A;  1P27 B;  4OI1 A;  1F6T A;  1IXK A;  1FX4 A;  3T5K A;  2CG8 A;  3G82 B;  4NMX A;  2QYG A;  3PW7 A;  1I94 J;  3ISN D;  2GFF A;  4C8N A;  3VGT A;  5L39 A;  2N3O A;  2D69 A;  3L9Z A;  1FT8 A;  1PJ7 A;  2HQF A;  3M2U A;  2V4Q A;  2J0W A;  1WF0 A;  2XGP A;  1QE1 B;  4ZP9 A;  2XWX A;  3BQ1 A;  4EI2 A;  3CCR S;  2MTL A;  4NYZ A;  5H9E K;  3OTD A;  3POT A;  3DDK A;  3CC2 S;  3TJ8 A;  1U02 A;  2OPQ B;  2DJW A;  3AHP A;  2OPQ A;  4IH5 A;  4M5K A;  1YJT A;  3D4J A;  3BR9 A;  2DGS A;  4XPE A;  1M0S A;  2KI2 A;  5AXN A;  5KFH A;  3G71 S;  5F8G A;  1VQP S;  3G96 A;  2CPD A;  2HFV A;  2IJN A;  1MML A;  3AGZ A;  1IQZ A;  1MG7 A;  4USM A;  3J80 Y;  3DRS B;  4QWA A;  1VLY A;  4DPW A;  3A3N B;  2R8K A;  2G2O A;  5JXS A;  1NJI T;  3H90 A;  3IR5 B;  1TP7 A;  2COL A;  4OJ1 A;  4HHH A;  1FWP A;  4CQ1 A;  2WTF A;  2Q43 A;  2VG6 A;  3V6D A;  2GAH C;  3QT6 A;  4HI1 A;  4J9U E;  3U1L A;  4QYZ K;  1HHS A;  1LW2 B;  3ENW A;  3MMC B;  2CKW A;  3NKY A;  2N7Y A;  3D0G E;  4P75 A;  3R6G B;  1LW0 A;  2GMH A;  2R7Q A;  5F9N A;  2UUA J;  1CUL B;  4RZR A;  3KUE A;  2XSJ A;  1RT3 B;  5G0R A;  5B0E A;  3HZE A;  2L9W A;  1HWL A;  2NXN A;  4C11 A;  2ZD1 A;  3AOC A;  1S0M A;  3GFZ A;  3E01 B;  2LQJ A;  5C2G A;  2CPF A;  3KLF A;  3CC7 S;  2M8D B;  2YQ1 A;  1Q5V A;  5E33 A;  3AD8 C;  1VK3 A;  4ED2 A;  1IKW B;  1SQG A;  2P9E A;  2V2Q A;  1XMO J;  1DZ5 A;  4B3T F;  4UY8 T;  1KQK A;  3ET6 B;  4C11 B;  1VOM A;  2JVR A;  3M9O B;  5I42 A;  1NJY A;  4IRK A;  3MUM P;  3M8Q B;  2VFS A;  3LAN A;  4IOA Q;  1S9E A;  1MW7 A;  4KAI A;  4N8N A;  3DGV A;  3DU6 A;  3AXK A;  3BKT A;  3OXG A;  2KU7 A;  2J6U A;  2W2Q P;  4PXE A;  2XI2 A;  3GV8 B;  3MMC A;  3G4S S;  1NSK L;  2HND B;  5FDL A;  1S10 A;  5IT4 A;  2GS8 A;  2BAC A;  3LZ8 A;  3BKU A;  3CSK A;  4M5D A;  5KFM A;  3HUL A;  1JLQ B;  4DUY J;  4NCA A;  1BWE A;  3MMB B;  5FJ4 A;  2B5J B;  1SBR A;  2ILZ A;  4O4R A;  1F5B A;  4LIR A;  1Q5Y A;  2YWE A;  5JVG Q;  1NRK A;  3GMG A;  3AT1 B;  4F25 A;  4X4N A;  3OLA A;  3GIR A;  2V6A A;  3ZTP A;  4YME A;  2E5L F;  3JSY A;  3O8W A;  3QGP A;  4OYX A;  1ZA2 B;  1S49 A;  2GVD A;  2SXL A;  2XZT B;  1OQ6 A;  3D6M B;  3EWG A;  2WAQ D;  3POT B;  4FVM A;  4I0W A;  4QIG A;  4ZPB A;  2NZC A;  2QLJ B;  2B51 A;  2VUG A;  1SJQ A;  5HAT A;  4DPU A;  5KTQ A;  3MR6 A;  2AZ1 A;  1EHW A;  1RTJ B;  2GV1 A;  3NWG A;  4M63 A;  2J6T A;  4B02 A;  2BRK A;  1NLT A;  2CVI A;  5K8M A;  1DLO A;  4P74 A;  1F2H A;  4QWC A;  3DM2 A;  4LSN A;  3T41 A;  3CJ2 A;  1HW9 A;  4DV3 J;  1J5E F;  4BBY A;  2W4C A;  1P1L A;  2VA3 A;  2EBE A;  1PJ6 A;  1JNR B;  2IRX A;  4J9K A;  5KFB A;  2J0S D;  1WOS A;  2FC8 A;  2BM1 A;  1HI0 P;  3BM7 A;  3EJM A;  2MQN A;  3BYP A;  1P9Q C;  1RT1 B;  1H7X A;  2AEJ A;  2BBE A;  2ROP A;  3ELH A;  3NCR A;  5F8H A;  5KFO A;  3K5N A;  3VZH A;  1C3G A;  1T9T A;  4MKA A;  1YBT A;  2ZZN A;  4HTI A;  3TAR A;  2F9J A;  3HZG A;  1KTQ A;  2ZIT A;  4XIU A;  5RUB A;  2HLU A;  2I1R A;  4DV4 F;  2ROG A;  4U7U K;  2O66 A;  4EFA C;  3W1Y C;  2XYP B;  1NUE A;  2OFG X;  1NH7 A;  1RI7 A;  2W2O P;  4IOB A;  4KBI A;  1TZ0 A;  4OZ0 A;  1X4C A;  3M6X A;  4EK2 A;  1HI8 A;  4FYV B;  3DLE B;  3WHI A;  4I2Q B;  2QEX S;  4QW9 A;  3N01 A;  3SQG B;  2VHG A;  3OTO F;  4A8F A;  5D77 A;  2BUN A;  4KHM A;  2VJU A;  1H2T Z;  1YRX A;  2UVW A;  1X60 A;  2QMU B;  1MNE A;  1UWB B;  1XC9 A;  5A8R B;  1ZM2 A;  4LR9 A;  4DSI A;  4IDK A;  2ZC3 A;  4FYD A;  3DGP A;  1RTZ A;  3MPU B;  4GC7 A;  3BS9 A;  3HVT A;  2HHH F;  5C5J A;  1HBU A;  3MOZ A;  4I6Y A;  4ZVE A;  5E3C A;  2K3K A;  3R6L B;  1HYS B;  4DR6 F;  1TMM A;  4TVA B;  1QTN B;  4UOC A;  3T1A A;  1VMB A;  3MEC B;  1KQF B;  1T8E A;  4JV5 J;  1WHY A;  2Z2M A;  3Q8R B;  1HQU B;  3HK2 A;  3TEG A;  4L74 A;  4WK3 A;  2AYB A;  4IFY B;  2EG1 A;  1FJE B;  1ARO P;  4DF8 A;  1BQM A;  1JLG A;  2J8A A;  4CLZ A;  4QBU A;  2OEM A;  4O0I A;  4C97 A;  2AP6 A;  4RW4 B;  3HJF A;  2PEB A;  4DG1 A;  2HFN A;  2IVM A;  1RBO B;  1SQE A;  2DNZ A;  2A18 A;  3UVJ A;  1HNX F;  1URN A;  3RBX A;  1XAO A;  2ROE A;  2YNI A;  3I0S B;  4YHH F;  3T1H J;  3SIP B;  3QRP A;  2WB4 A;  1SIW B;  3EE3 A;  5THW A;  4QWD A;  4DFK A;  1JMT A;  3PX6 A;  1RCO B;  2P2C B;  5DLG A;  4X62 F;  4IRC A;  3T5H A;  3RR8 A;  1HNW F;  1AFJ A;  4LF6 F;  1EZZ B;  1EQM A;  1TL4 A;  4AXJ A;  1ZET A;  3GV7 B;  2CDR B;  4C6A A;  4G1Q B;  1RT7 A;  5J2P B;  2DH9 A;  2GO9 A;  1RT4 A;  3GV5 B;  2WON B;  2VFR A;  1NK0 A;  4A46 A;  4X64 F;  5K8O A;  4BS2 A;  3DLG B;  1IVZ A;  1B4S A;  2BE7 D;  3BF4 A;  1SB6 A;  4DCO B;  3C2P A;  3T6J A;  3D3C J;  2WVE A;  1C0U B;  2AIR B;  3CJ5 A;  4DSJ A;  3KG4 A;  8AT1 B;  1JLF A;  1SKR A;  1KN6 A;  2BAN B;  5HVF A;  2CQP A;  4UT4 A;  1WF2 A;  2VG7 B;  2HNY B;  3Q8V A;  5EUH A;  2HFZ A;  3CD5 A;  2BEF A;  2CJB A;  1TK8 A;  2CNO B;  2ZHA A;  1XTZ A;  3AAW B;  3NAH A;  1U2F A;  2AT1 B;  3FBB A;  4IFV B;  4JP8 A;  4LVN P;  4ZVF A;  4A8Q A;  2CPJ A;  2OPS B;  3PJ9 A;  2PDA A;  4CO0 A;  4CLP A;  1ZYQ A;  3M8Y A;  1AA1 B;  3C5X C;  4CH1 A;  3H59 A;  3SSS A;  4EGL A;  5A2Q Y;  3FCW A;  4LVO P;  2BM0 A;  4NLS A;  4YN3 B;  4DLE A;  1L3U A;  2FY1 A;  2K8G A;  1OYE A;  2CZ9 A;  2HS4 A;  4PKD B;  1MWZ A;  1KC8 T;  1BMQ B;  2YKP A;  1TUW A;  4KGV B;  4TLQ A;  3O5T B;  1S0N A;  2CZV C;  2QLX A;  2DIV A;  3QJL A;  4CM2 A;  1OWX A;  3VZI A;  3DRY A;  2XHC A;  2RNE A;  4KR0 B;  3L7O A;  4KPC A;  3SSQ A;  2MKI A;  2CG4 A;  3ZZP A;  4JI0 J;  1I1G A;  5BYR A;  4DQS A;  3WBZ A;  3LAM A;  3DHW C;  5I42 B;  5JVH Q;  3I56 S;  3GR0 A;  1N34 F;  3LW5 C;  3S01 A;  5J2Q A;  2VBX A;  1I3O B;  2E5G A;  4AL6 A;  1TFW A;  2HHW A;  1X4D A;  3G8S A;  3UCU P;  1EB0 A;  5U47 A;  1U09 A;  5KFQ A;  4ED8 A;  1N54 B;  1WF1 A;  2ODX A;  3E01 A;  4DLG A;  4B3M F;  4LF2 A;  2YWG A;  4B9N A;  4CZC A;  1JXE A;  2G1H A;  1S4F A;  3MPY A;  2MXY A;  1CUL A;  1DQ8 A;  3DI6 A;  3MMJ A;  2BW7 A;  3MED B;  4QPX A;  2V0N A;  4RU2 A;  2MLX A;  4GKJ J;  5JMN A;  4KGK A;  2FYX A;  4OI0 A;  2CWK A;  5F8M A;  4ICL B;  4NA2 A;  1WC6 A;  3SCJ E;  1Q1K A;  2JC1 A;  2NZ4 A;  2J9D A;  4RBV A;  4ANC A;  3TAP A;  1K0T A;  4LF1 A;  2NPI A;  3CCT A;  4K2J A;  5DG9 A;  4K0K F;  1T05 A;  4OJH A;  4CCH A;  3FSX A;  2EW9 A;  2XM3 A;  3DRS A;  4IQX A;  3R7N B;  1S4E A;  2CJK A;  2CDQ A;  2ABY A;  4PCQ A;  2EFG A;  3PJX A;  3QWU A;  3QGG A;  1VK8 A;  4KT0 C;  2ALY B;  2YWF A;  4LFB F;  3T1Y J;  2E7X A;  3M8P A;  4WYL A;  1R8H A;  2HHH J;  3OTC A;  2OD6 A;  2VG7 A;  3V4I A;  5H9F J;  2AYM A;  3HSZ A;  1WTB A;  1N36 F;  4KTQ A;  3CDU A;  2ZH4 A;  1EKR A;  2JFK A;  3QZ8 A;  3N4W A;  4J7C A;  1DRZ A;  3UI3 A;  3PEJ A;  1WKK A;  4H4M A;  4QJV A;  4RW8 A;  5D8H B;  4KV8 A;  3C6U B;  2R2S A;  3KNA A;  4PG6 A;  1UVK A;  3MM8 A;  1NSP A;  3M6U A;  2VKR A;  2R9L A;  3TAQ A;  2PN6 A;  4MIW A;  1ZH5 A;  4CH0 S;  2AF6 A;  3QT8 A;  1NEE A;  3CCQ S;  5C42 B;  1CJT B;  2OPR A;  1R8P A;  1TKZ A;  3GTY X;  5KOW A;  1N6Q B;  2HRY A;  4RUC A;  3J7Y U;  4LRD A;  3KLG A;  5CYM B;  4OZJ A;  4X4R A;  4DV4 J;  4BWM A;  5DQH A;  1R43 A;  4ECQ A;  3Q8Y A;  4OJ3 A;  2ILY A;  4MFB A;  2JOQ A;  3MM7 B;  4ECW A;  5A6W A;  3AB4 B;  2PC6 A;  3HT0 A;  3M30 B;  1S48 A;  2GHW A;  3GQC A;  4H54 A;  1E6V B;  1GNK A;  1FA0 A;  3TR5 A;  1U45 A;  3JSM A;  1FI4 A;  1O8B A;  2BKP A;  2FD2 A;  2XMK A;  1TL1 A;  1YJW S;  4ID5 B;  1RWU A;  5F0U A;  1RT5 B;  1RZM A;  5C7P A;  4OX7 A;  3H25 A;  5DM7 Q;  2IAJ A;  4FKX A;  2X1F A;  2DGU A;  4GVL A;  3FMW A;  2V2V A;  5KG0 A;  5CA5 A;  1GH8 A;  3IXQ A;  3NCQ A;  5HSP A;  4KPY A;  3MM5 A;  3HHL D;  4JI2 F;  2QA4 G;  2V4R A;  5H9E J;  1VQ7 S;  1SVD A;  3MEG B;  4DV0 J;  4PAB A;  1NDP A;  2KVQ E;  3I32 A;  4IFY A;  1TTH B;  2IA0 A;  4NZ6 A;  1X0P A;  2VC1 A;  3GG1 A;  4WIQ A;  1REV B;  5B0F A;  3GPA A;  5A0Y B;  1G3O A;  1Y7P A;  2RIJ A;  1RAA B;  1FNM A;  5ETQ A;  4JI3 F;  2V2Z A;  3MAQ A;  2KJV A;  3QQC D;  3CC4 S;  3PCO B;  3MEE A;  1LEO A;  4ZP8 A;  3TX0 A;  5J2M B;  4AQY J;  4ZJL A;  5KFX A;  4ED1 A;  1LOU A;  1FRK A;  2K1R B;  4R0E A;  2UP1 A;  2HHV A;  5KFY A;  1T94 A;  3NMA A;  3I5A A;  3QSY B;  3HKW A;  1L3V A;  3ILI A;  3PR4 A;  3BSA A;  1T95 A;  1Q95 G;  4OYM A;  2E1C A;  2F4V J;  2B4P A;  2P9C A;  3L95 X;  5A8R A;  3H0P A;  1UW9 A;  1HD1 A;  4DCP B;  5A0Y A;  3MUT P;  3DOK A;  1FK9 A;  3I4P A;  2ZJQ Q;  1VQ4 S;  3Q83 A;  4NPO A;  2RF2 B;  3OD2 A;  2MKK A;  5HP1 B;  4LF7 J;  5F8L A;  2IHR 1;  3C16 A;  4WP8 A;  3MR3 A;  3RB6 A;  2XS7 A;  3RB4 A;  1DTT A;  1LK5 A;  2EFP A;  1E6V A;  3CCW A;  1TAU A;  4K4V A;  1KVK A;  2MYF A;  2HKE A;  3M32 B;  1RHM B;  7FDR A;  4DU8 A;  2GHP A;  2QG9 B;  3D6H B;  1U8S A;  2KVI A;  3DU5 A;  4Q2L A;  1ZBT A;  4FXW A;  1MRO A;  2YNG A;  5MAO A;  3GYN A;  4WZM A;  1PCA A;  3LAK A;  2QZ8 A;  4FPR A;  4WTY A;  2MKS A;  1HPZ B;  2W9A A;  1W26 A;  4YQW A;  3THT A;  3HSG A;  5BJR A;  2C3M A;  2NCK L;  1T7P A;  3HCX A;  3I4H X;  4JI0 F;  1NDL A;  2DHH A;  4A8W A;  1RJJ A;  1PAE X;  5LJ5 Y;  2RE1 A;  2DR9 A;  2VD3 A;  3I55 S;  3MMA B;  3UPF A;  4NLT A;  4ZN1 A;  2RAQ A;  5FLX Y;  2FY8 A;  2ZNY A;  2O5D A;  1FWK A;  1B0V A;  1KOO A;  1YBU A;  1NND A;  2E5I A;  3IAM 9;  3DN9 A;  3IS9 A;  3ISN C;  2VU5 A;  3NLC A;  4C7Q A;  4OFZ A;  2VQF J;  4ECY A;  2XY5 A;  4FN5 A;  4K2X A;  3FBF A;  3IGV A;  5GAG I;  1NK7 A;  2H4Y B;  4IG0 A;  2RDD A;  2M3D A;  4K4Y A;  2VH7 A;  2D3O R;  4HVZ A;  4H4M B;  4RW8 B;  2CZ4 A;  2PT0 A;  2DCU B;  2MQM A;  4NLG A;  1VQ5 S;  4QW8 A;  3C6E C;  1M5O C;  2VFU A;  3HF5 A;  4PXD A;  1TL5 A;  1U1K A;  4OYP A;  2CAJ A;  3QO9 B;  4I6A A;  1E6Y A;  2MQ8 A;  2DHG A;  2E1M C;  2PMH A;  2V68 A;  3BGO P;  3C14 A;  2JEJ A;  1JLA B;  4XDD A;  2QV6 A;  4WXW A;  2XEX A;  2Y9H A;  3LO3 A;  4USH A;  2OSQ A;  2DT9 A;  3PYE A;  2IDE A;  3W8P A;  1N0V C;  5AE3 A;  4DFM A;  1JLB B;  4OLP A;  1L5U A;  2YKN B;  5D78 A;  5E5N A;  4TQR A;  3VGS A;  5HI7 A;  2K3I A;  3NOC A;  3C19 A;  4GVB A;  1KR4 A;  4Y2I A;  2MLY A;  1Y3J A;  4OZL A;  5EGY A;  4DXL A;  3OW2 R;  2KZM A;  3QIP B;  1T9Y A;  4ICL A;  3BGL A;  5T14 A;  5HMW A;  2DTJ A;  3TZY A;  2G4B A;  5F8I A;  4X64 J;  1CPZ A;  2ADC A;  1WC3 A;  3ZO7 A;  3M2R A;  1U0S A;  3BGR B;  1S9E B;  4P2S A;  4DR2 F;  4TU7 A;  1YJU A;  2UXD J;  2OEK A;  4LRF A;  3F41 A;  4WP3 A;  3HSD A;  1HNZ F;  4X4P A;  4K4Z A;  1S79 A;  1YZ6 A;  1F1B B;  4ZPC A;  3CGI A;  5J2Q B;  1OQ3 A;  2ZJR Q;  3BGF A;  3CCL S;  1HNW J;  1ZA1 B;  3R8Y A;  2DHS A;  5E3P A;  1FXD A;  3IG1 A;  4M94 A;  2F65 A;  1CJU B;  1XQI A;  3W8G A;  2CPE A;  5DDQ C;  1AZS B;  2KDO A;  3D1Q A;  2VKZ G;  3UN3 A;  1SJ1 A;  2DVI A;  1IBC B;  3WIU A;  4G3I A;  4QU6 A;  5F8J A;  1SC4 B;  2MHE A;  3AB2 B;  3W64 A;  2AGQ A;  1QUV A;  1WEY A;  1N33 F;  4YB1 P;  1RWK B;  1S1T A;  2QFI A;  4MYT A;  1MWY A;  5HRO B;  2XSF A;  4ZPW R;  4C3K A;  1GMW D;  2ZH3 A;  4NZ7 A;  1K1Q A;  1BQN A;  2NSB A;  4LF4 F;  1H3D A;  2BQR A;  1XNQ F;  3VVU A;  5E3Q A;  2BR0 A;  1IR1 A;  2J8S A;  5IXU A;  1Y4Z B;  2E1R A;  4HT5 A;  3J7Z 5;  1FKP A;  3RJM B;  1VC6 A;  2VOO A;  2B9X A;  4ALZ A;  1YJ9 S;  3H5Y A;  3V6H A;  3T1Y F;  3OR1 B;  2WSC C;  4HDH A;  4LF6 J;  1KP6 A;  4Z7Y A;  2GJI A;  5I4M A;  1PC5 A;  1E6Y B;  3CJS A;  3IBF B;  4I68 A;  2LEA A;  3BN7 A;  4CDI A;  4DPO A;  2PEH A;  2FVQ A;  1BY9 A;  3R5C A;  4URQ U;  3I6P A;  3K8W A;  4J9S A;  1RTD B;  1YGY A;  1Q8I A;  5KFA A;  3AXM A;  4ZPT R;  4DFJ A;  3AKO B;  2G0J A;  5KFT A;  4A48 A;  1Y11 A;  3ENQ A;  3K5O A;  2D3U A;  2FVP A;  3GYX B;  5J1N A;  3JYT B;  1NH8 A;  4C9D A;  1RWV B;  1C1B B;  5KFC A;  4R5P B;  4YR2 A;  2XY6 A;  1S76 D;  1EX8 A;  1U6B A;  2XMT A;  4C8L A;  2LA4 A;  1HQE A;  1Z1Z A;  5E3R A;  1N56 A;  4PR6 A;  2HGL A;  2B6A A;  2KHC A;  4WU3 A;  2Y0S D;  5M2P A;  4Q8E A;  4P71 A;  2XYG B;  2JX2 A;  2HUR A;  1D3W A;  4MIA A;  4ZPD A;  2EFV A;  5HVG A;  2VQE J;  4ED7 A;  1FNX H;  2HYI B;  2KZZ A;  1FXL A;  1Y10 A;  3JQJ A;  4I2P A;  4FYX B;  2X51 A;  3PVX A;  1N34 J;  5KG7 A;  4V1A k;  4X4Q A;  5EX3 A;  3OHB A;  2XS2 A;  1VFJ A;  4DR2 J;  2VON A;  4GKK J;  3UVJ B;  1KNZ A;  1EP4 A;  2KFN A;  2BKO A;  1R7I A;  3LGH A;  4UZC A;  5IFM A;  1VQ6 S;  4X4U A;  5IZH A;  1VQK S;  5ETR A;  2R8J A;  4O3P A;  1Q8B A;  4HDG A;  1TQL A;  1UL3 A;  2D9P A;  4O44 A;  4QIV A;  4P10 A;  5K14 A;  1RGV A;  1S6U A;  2MJN A;  1UKU A;  2MMY A;  4ZLP A;  3W7B A;  2YQ0 A;  3M4X A;  2HFS A;  3UDE A;  2MZT A;  4K59 A;  1S9G B;  4M5H A;  5F3Z A;  4NLR A;  4AD6 A;  2AGP A;  3G6E S;  4FF4 A;  2YWW A;  1Y9O A;  3EUN A;  4KO0 B;  2B43 A;  1UTA A;  3EVW A;  1REG X;  4CLY A;  2XI3 A;  5L38 A;  1Q0N A;  3V81 A;  4JI7 F;  2CVE A;  4QCL A;  3Q8U A;  4DS4 A;  1S7I A;  1S1W A;  2WK4 A;  4PWD B;  3JQK A;  5F3T A;  2HIY A;  1URR A;  3IM8 A;  1I5O B;  3UN5 A;  3AQO A;  4C8K A;  1GEH A;  4GC6 A;  4U6P A;  4U8Y A;  4UUX A;  4HHU A;  4IDK B;  2VQF F;  4K4T A;  2OEJ A;  3KHH A;  4J9O A;  2R8G A;  1EAR A;  1KHV A;  4B9U A;  3B82 A;  5DG7 A;  4TY8 B;  3TJ9 A;  2HG4 A;  1PYT A;  1HBN B;  1O0P A;  2MQL A;  3AA8 A;  1A6L A;  2KL8 A;  3VF0 B;  4CYU A;  1VBY A;  2F5G A;  3JSB A;  2Z58 B;  3GYG A;  2K7J A;  5KFS A;  3OFH A;  3OTB A;  3KLG B;  4CO5 A;  4K4W A;  2FB0 A;  5B0B A;  4C8Y A;  4W92 B;  2A2C A;  3D66 A;  5KFI A;  2VBY A;  2HZV A;  1HL6 A;  3D28 A;  8ATC B;  2YNF A;  2ASY A;  3G8Q A;  5IV4 A;  2UVU A;  2NXE A;  4MJK A;  2HEK A;  2VL1 A;  4PUO A;  3W5X A;  3BDP A;  3I0R A;  2QL7 B;  3RBE A;  4OI3 A;  4J80 A;  4MIB A;  4NCG A;  4A8S A;  3TVZ A;  2LQ8 A;  2MQP A;  2XMV A;  2MY8 A;  3Q23 A;  5A8W A;  4WU2 A;  1L3S A;  3BRE A;  2DY9 A;  2DHX A;  3DM2 B;  1VCT A;  4LSN B;  5GVQ A;  1UJ4 A;  4QWE A;  2ZH2 A;  3KLI A;  2P6T A;  1D09 B;  4EZ6 A;  2B9E A;  5DZ7 A;  1LWX A;  1BE4 A;  1O5J A;  4U8V A;  4AXI A;  2XO6 A;  4USK A;  4JV5 F;  4RW9 A;  5LXR A;  1R27 B;  3C6T A;  4F4A A;  4N41 A;  2B26 A;  3F0N A;  2IRU A;  1JJC B;  2OMO A;  1S6P A;  2FC9 A;  1KLM A;  5DDR C;  5GAG U;  5FDL B;  1HNI B;  2W4D A;  4LIW A;  3Q24 A;  4OYB A;  3IBW A;  5DJB A;  4AE5 A;  4JI2 J;  2W9B B;  1KLN A;  1SH2 A;  4DMZ A;  2E1A A;  1RHU B;  3PG9 A;  2MSS A;  1RLD A;  2AHO B;  2O01 C;  4M5M A;  4O3N A;  1WKJ A;  3KJV A;  3NEK A;  3W2W B;  1RTI B;  2UVV A;  3TWZ A;  4ZVR B;  1WC4 A;  1ZTT A;  4M1K A;  2YKQ A;  4W98 A;  2IYG A;  4ZA1 A;  2GAG C;  1GFW B;  1FRI A;  1SJF A;  1X9M A;  2BX6 A;  4LJM A;  5D15 A;  2OML A;  4FP9 A;  4ZVG A;  4RNO A;  3JAM Y;  2IM3 A;  3PRV A;  9ATC B;  2ASD A;  1U1O A;  1JK9 B;  2CQG A;  4X4S A;  1UJ5 A;  4X66 J;  4OI2 A;  4JI1 J;  4ZDN A;  3J81 j;  3DOM B;  1GAO A;  2OTL S;  4M5L A;  2Q66 A;  5IQQ A;  3KXD A;  3TRG A;  1OYD A;  1DY3 A;  1WEZ A;  4P72 A;  2OKQ A;  2G13 A;  3CJ3 A;  2JVO A;  3K59 A;  1PAU B;  2ZUA A;  1SH3 A;  2C2D A;  3M2R B;  1YIJ S;  1RU1 A;  2WSF C;  1CEZ A;  1KVI A;  1OY8 A;  3CD7 A;  4DS5 A;  1KBR A;  3QFH A;  4USI A;  2EFQ A;  4FYY B;  1A9N B;  2DRB A;  1NHV A;  2C42 A;  1TV6 B;  3W2W A;  1RHJ B;  4NA1 A;  5IOL A;  4FF3 A;  2NXU A;  1J5E J;  2P9G A;  3L3C A;  3TO8 A;  1R6V A;  2PA3 A;  2WHO A;  3H2V E;  4NLX A;  3RAM A;  1UVN A;  3IRW P;  3HHL A;  4LRB A;  2RML A;  3I31 A;  1NSA A;  4OYZ A;  2HQC A;  2W2M P;  3UCG A;  2HBR B;  2R4F A;  2YKA A;  3HMJ G;  2D1C A;  4DR3 J;  1JXL A;  4B9S A;  2AYG A;  4PQU B;  3SDE A;  3R7B B;  1Q4R A;  4LQ3 A;  3M7V A;  3O1L A;  4ZKA A;  2KG0 A;  2JFD A;  5DG8 A;  2FLL A;  4YEA A;  1IBL F;  2GVZ B;  3EGW B;  4UOG A;  2GVZ A;  1ELO A;  1RKI A;  3OVS A;  6FDR A;  3CMQ A;  3GIL A;  3MR2 A;  2QLD A;  1RWP B;  1VLO A;  2ZOM A;  4B9M A;  4WF9 Q;  2XZD B;  2DR8 A;  2IMW P;  4CO1 A;  2BXJ A;  3DRR B;  1YQH A;  5B0D A;  1LXN A;  3QT7 A;  2H1Y A;  1H74 A;  1VQS A;  2B4V A;  3MR7 A;  3R27 A;  4IR9 A;  1MWQ A;  3E8O A;  5IWA J;  1RB0 A;  1IKY A;  3JAM U;  3KHR A;  2VAS A;  1KWM A;  2KYX A;  3DLG A;  1IR0 A;  2AJQ A;  2HGN A;  1X5S A;  4NCG B;  1W2I A;  2ZBI A;  4B3M J;  3LWM A;  1K9M T;  5J2P A;  1LWC B;  2HVD A;  3RR7 A;  2Q2G A;  2CJY B;  2CWX A;  2HVH A;  1OSC A;  5C25 A;  1Q86 T;  2LEP A;  4BHQ A;  4F8R A;  4GKK F;  1U24 A;  5IM0 B;  2J7K A;  1SJR A;  4B3T J;  1AW0 A;  1NLK L;  3MGJ A;  5LXY A;  1YKW A;  1EAY C;  3BKF A;  2N4C A;  5HBM A;  4E98 A;  3M1V A;  4M5J A;  3KHL A;  1QLN A;  3OPK A;  5A76 A;  4RKU C;  4NRT A;  1VQL S;  1D1U A;  2V8D A;  3MOJ B;  1H6K X;  2JDJ A;  3HFK A;  4DDF A;  2G1D A;  1NAQ A;  3U02 A;  2R7R A;  1AFI A;  3MFI A;  4JV1 A;  3D5M A;  2CNN B;  3HKZ D;  3TQ1 A;  1KVJ A;  3KJQ B;  2XY7 A;  1HD0 A;  1NPR A;  4RR5 A;  1NME B;  3UCZ P;  4DOZ A;  2CQ1 A;  4B3S J;  3IWX A;  4KFB B;  3HP6 A;  4LRE A;  3LF0 A;  3PIP Q;  3ENA A;  3CO0 P;  1LWE B;  3Q89 A;  3AOD A;  4U96 A;  3BSO A;  3V81 B;  2WW8 A;  1RTI A;  3BO4 A;  2YH1 A;  2K7K A;  3SFU A;  1IBL J;  4F4Y A;  3TOQ A;  4M95 A;  4B3O B;  2UXC J;  4KO0 A;  3MD1 A;  4HL9 A;  2V69 A;  1HAR A;  5KT6 A;  1IJE B;  3MXH P;  3X1L B;  3QAE A;  2YKO A;  3OL8 A;  3J80 U;  4Y2M A;  2KXN B;  1D8Y A;  3GR1 A;  4DR3 F;  3DDN A;  4ZLN A;  3GB0 A;  4DZD A;  5J1E A;  2PGC A;  3RRK A;  2MZR A;  2EVZ A;  3IAS 9;  2I2Y A;  4J9V A;  2JLF A;  3BZQ A;  1UEK A;  2W4P A;  3ETO A;  3ZTR A;  3LP2 A;  3SV4 A;  5D3G B;  2UV8 G;  2KKH A;  3VTI A;  2DH8 A;  5ETM A;  3Q86 A;  1Q7L B;  2HVI A;  4DV6 F;  4R8U A;  2IAJ B;  2W2N P;  4OHV A;  5HQL A;  3KHG A;  4ZCM A;  2ERR A;  4CLK A;  2MEW A;  3KLI B;  4ED5 A;  3LPE A;  4H4O B;  2HRU A;  5L1L A;  2JRS A;  4OL8 A;  3JSM B;  1RSC A;  4JI6 F;  3WX4 A;  1NHK L;  3FSI A;  3RAQ A;  5H9F K;  3SEO A;  2R8I A;  3BQ2 A;  1RWW B;  3X3U A;  1K0V A;  2AKW B;  3GG0 A;  2A6M A;  3FJ2 A;  2LQ5 A;  3E2E A;  1NB2 A;  3RW7 A;  5CYM A;  3I0R B;  2QLW A;  5L46 A;  4WK1 A;  3T3F A;  2L9D A;  2BJ1 A;  2HFO A;  4OLO A;  4N76 A;  4V19 X;  2HHX A;  3CJ4 A;  3LGM A;  2HHU A;  4YHH J;  3O3L A;  3UR3 C;  2RU9 A;  3D54 A;  2XC9 A;  3RBD A;  4PXC A;  3FCV A;  1HNX J;  2WRM A;  2XZW A;  4LF8 J;  1LWF A;  3MM9 B;  1AUD A;  2ACM A;  2NYH A;  1WSV A;  1IM4 A;  1RWX B;  1SKU B;  5DLF A;  2HAI A;  3SCK E;  4DPY A;  2UXD F;  4S0M A;  1SJ4 P;  2Y1R I;  1K1S A;  3DOL B;  4CYU B;  2AU0 A;  2NLW A;  3D0H E;  2ZH5 A;  4PQA A;  4CTA B;  3CNQ P;  4M5I A;  4JI8 J;  4XAK A;  5J2N B;  1S77 D;  3CCV S;  5EDW A;  2J6S A;  1M5S A;  2QTW A;  2V94 A;  4W4M A;  4LMZ A;  3SDE B;  1GMV A;  2A2D A;  3QSI A;  1ROF A;  2I6W A;  1LXJ A;  1NJX A;  4D3G A;  3SZ2 A;  1ULR A;  3TUJ C;  2KXH A;  2V63 A;  3BSC A;  1OPZ A;  3ADA C;  3CTR A;  3FEY B;  4OQJ A;  2B5J A;  2V34 A;  1UVM A;  4HTJ A;  2IJR A;  1WHV A;  2ACY A;  4A8O A;  1S12 A;  1GXU A;  1JNZ B;  1ITP A;  4CLW A;  3IR6 B;  3MCM A;  2V9W A;  2CAD A;  1RT2 A;  2HND A;  2JHE A;  2J9E A;  3SQO P;  5DQI A;  4L3N A;  5GAH I;  3GLJ A;  4YP3 A;  2C2E A;  1PIE A;  4PPZ A;  4D3H A;  2VB6 A;  1KON A;  1FX2 A;  2KT2 A;  4LR8 A;  1S9G A;  4CLL A;  5CCL A;  5KT4 A;  2XMW A;  4R25 A;  3PXG a;  2FGC A;  1XJW B;  5HAO A;  3P6Y C;  3NNC A;  3LGN A;  2AJ2 A;  1WJ9 A;  1MMD A;  1NPP A;  2GJ2 A;  5K14 B;  1YLX A;  3VWS A;  2U2F A;  5IT9 U;  4M8L A;  1OS5 A;  2XBP A;  3CD6 S;  2IM0 A;  4X2B A;  2FJW A;  5KAK A;  4PZV A;  4RNN A;  1NJW A;  1IQT A;  3IG1 B;  3H42 A;  3PYG A;  3NS7 B;  3ICL A;  4C48 A;  1TR0 A;  3NY0 A;  2WOM B;  4IYQ A;  1RA6 A;  1NB7 A;  5G0R B;  5ETK A;  3NNA A;  2CPY A;  3K57 A;  2GML A;  3D1O A;  4FNI A;  4ANE A;  1XER A;  3ILL A;  3LP0 B;  1NCL A;  1SPB P;  5D4N A;  4ZIT A;  5K8P A;  4F3O A;  1VR6 A;  1LW2 A;  5KFD A;  2HRT A;  3GU0 A;  5GMK a;  4GVB B;  2G0C A;  3CF5 Q;  1F3V A;  1VQY A;  1HHT P;  1N88 A;  3H8Y A;  2KTQ A;  2CJA A;  4KHR A;  3QIP A;  4RW7 B;  3F44 A;  2GW8 A;  4LF7 F;  4DL5 A;  1HNI A;  4NXM F;  5L1K A;  1FVS A;  4K4U A;  2YX4 A;  1JLA A;  1JJ2 R;  4LF5 J;  4DSF A;  5IS2 A;  1FES A;  2HS0 A;  4PYA A;  1YRT A;  2RQ4 A;  3RG6 A;  2ZHO A;  3TVK A;  2F63 A;  3IA0 A;  1JLC A;  1RIS A;  3BEG B;  3ITH B;  2H51 B;  4IO9 Q;  3SI8 A;  1NKE A;  3N5F A;  3N6N A;  5HAN A;  3S7R A;  3M8S A;  3W5Z A;  2N3L A;  2OAU A;  2J76 E;  4ZHR B;  4G6V B;  1FF2 A;  1HWK A;  1YZ7 A;  4H4K C;  4XDC A;  3MR5 A;  4LSL B;  1TUV A;  1V3R A;  4ED6 A;  1JLF B;  2E29 A;  5HMZ A;  2UUT A;  4EZ9 A;  3TYT A;  2OLW A;  2GX8 A;  3RBZ A;  2IBO A;  1ICE B;  3IS9 B;  4OYO A;  4OX9 F;  2I9S A;  4ECS A;  1EIY B;  3Q2T C;  1KOH A;  3HHL B;  3M2U B;  1IBM F;  1Q16 B;  3LOU A;  4TNO A;  1C4C A;  1R8B A;  1WG1 A;  1YVF A;  2V67 A;  1FKP B;  1FE4 A;  4C8Z A;  1PSD A;  3U1N A;  4DV2 J;  1MSW D;  3M8W A;  2V8P A;  3CD0 A;  1NK6 A;  2XLK A;  1HA1 A;  1GTE A;  4HH0 A;  1Q82 T;  3G6Y A;  2KB2 A;  1XMO F;  3K89 A;  3OLB A;  4Y34 A;  1VC5 A;  2RU3 A;  1SXL A;  2CQI A;  3TZX A;  2ZM6 J;  1HR0 F;  1S1V A;  3TZW A;  4DN0 A;  3HVW A;  3HXM A;  4DZ6 A;  3P45 B;  2DR5 A;  2DK2 A;  5FII A;  1XR5 A;  2CYY A;  1YK9 A;  1SJ3 P;  2HHT A;  1DTT B;  2CJQ A;  2HPU A;  1V5I B;  1AZS A;  3SFG A;  2L3M A;  3C16 B;  4WYW A;  3P49 B;  4ZIW A;  2EK6 A;  3CWJ A;  1A0O B;  4P2M A;  3DLH A;  4JI4 J;  1M1G A;  2DNG A;  3DOK B;  4FXV A;  1X4B A;  3DXS X;  1H98 A;  2GQ2 A;  2HAF A;  5KG6 A;  1NK9 A;  5IC6 B;  3ZNU A;  4ZIV A;  3NRB A;  4G65 A;  1NJZ A;  5HP1 A;  1WG4 A;  3KWM A;  4ZVO B;  1FRH A;  4ILM A;  3KTQ A;  1WTF A;  4TU8 A;  4A8K A;  4L3K A;  1R31 A;  1FWL A;  1YSJ A;  2JWN A;  1TL7 B;  3I96 A;  4OI4 A;  1X9W A;  2JLG A;  1F60 B;  2ATL A;  3CJQ A;  2Y0B B;  4EWT A;  4LFA F;  2GMJ A;  3QJP A;  2VPY B;  1H7W A;  2AX1 A;  2C2M B;  2G0I A;  2HQI A;  2UUW A;  2RRA A;  1Y0H A;  2E7V A;  2YKN A;  5A6P A;  3VAK A;  3DDI A;  4A8X A;  3JXO A;  5KFZ A;  5CAA A;  1Z2Z A;  2KFZ A;  3DLJ A;  3UNG C;  1U1L A;  3I9Z A;  3C15 A;  3FNN A;  3W65 A;  1VIO A;  4K0K J;  2LU1 A;  3FBC A;  3MPV A;  3MEG A;  1TVR B;  2FTR A;  2R2R A;  1XWL A;  2M2B A;  1FXR A;  3VGU A;  3AOB A;  3K5L A;  3PRD A;  3L4B C;  5A8W B;  4AND A;  3OJS A;  3FKB A;  4I7F B;  4NLW A;  4Q7A A;  3TW0 A;  3ZZU A;  4CO2 A;  4Q44 A;  4JYA F;  1B7Y B;  1Q81 T;  1UEU A;  1TL1 B;  2APO A;  3AJ2 A;  5KG1 A;  3KK2 A;  3MPD A;  2MPU A;  2FHO B;  3QRR A;  2D3O 1;  1N6Q A;  2OP5 A;  1S99 A;  2AEM A;  2Q6C A;  1QJH A;  2X1G A;  4KKO B;  5B0A A;  3W2V B;  5I3Q A;  3R5A A;  1YBA A;  1CJK B;  3FEZ A;  1UCN A;  4NLQ A;  2UU9 F;  2UUB F;  4ZN3 A;  1YG0 A;  1R89 A;  4QYZ J;  3BYR A;  5H1S V;  3PHE A;  2J9C A;  2WBR A;  3IWL A;  3BPS P;  3K5M A;  3J7A 1;  1TKZ B;  4I56 A;  2DYA A;  1VRT A;  3W2V A;  3RB3 A;  1TKD A;  4UOH A;  3OFF A;  4ZK7 M;  4GMK A;  1YTY A;  3BQ0 A;  4EUV A;  3M05 A;  2EK1 A;  4L6V 3;  2JH3 A;  3MM8 B;  3J81 Y;  3IGN A;  5L9X A;  4Q5V A;  2Y1J A;  2B4U A;  4F4W A;  2UUC J;  4I69 A;  3Q8Q B;  2HK3 A;  1T02 A;  3BBC A;  3RUB L;  3ZNJ 1;  1U8W A;  2B4O A;  4OZ2 A;  4EO8 A;  1UVL A;  4YOE A;  3P8B B;  5LSR A;  2YPZ A;  2GQQ A;  3C66 A;  3CJ8 A;  1KDN A;  1O6X A;  4N47 A;  2N82 B;  2X3D A;  3KMS A;  2RF2 A;  2DGW A;  1RQ0 A;  2HWT A;  4N77 A;  3U7J A;  5IQ6 A;  3HSJ A;  3G6X A;  2JZ8 A;  4FBU A;  4DR4 F;  2CNL B;  2BJ9 A;  3FZB A;  4KYZ A;  3DYA B;  1B99 A;  1T9V A;  1WEX A;  4JUZ A;  4ID8 A;  3KLE B;  1QAI A;  2XG8 A;  4ECX A;  3OBI A;  5HL7 Q;  4EU0 A;  5CYQ B;  3CDW A;  4MTP A;  3EM1 A;  3UO0 A;  4KE5 A;  2RUS A;  5HK4 A;  4MK8 A;  3ZTQ A;  4WXO A;  1UVI A;  1TKT B;  1N8R T;  3BPD A;  4ERD A;  2F3J A;  3DI6 B;  4URS A;  2X3G A;  2F8E X;  4G1I A;  4ZS6 A;  3OJU A;  3NBP A;  2HHS A;  4QYR A;  1SQF A;  1FD2 A;  1M1H A;  1RE1 B;  4EO6 A;  4Y0F A;  2HMI B;  3B78 A;  1NPK A;  2DXF A;  4KIA A;  5DGA A;  4C4W A;  1YJR A;  1N48 A;  2I38 A;  3HLU A;  5DQG A;  2PFD A;  4ZJQ A;  5LM7 E;  5F0W A;  3GCX P;  4FZV A;  3BH6 B;  4TQS A;  1WOP A;  1FO1 A;  2H5I B;  1SUQ A;  3OL6 A;  4C98 A;  2AJ0 A;  3JTO A;  4NZ0 A;  3J7Z T;  1WAC A;  1QAX A;  2J7U A;  3G8T A;  1UJ6 A;  4ECT A;  1RAD B;  3MM7 A;  1HBO B;  4DX7 A;  5C24 B;  5HQ8 A;  4X62 J;  2RQK A;  1X4G A;  2C2K B;  2LQB A;  1VQO S;  2GQC A;  4Y2K A;  1G7C B;  2D7S A;  6FD1 A;  2L9N A;  1FNO A;  5CYQ A;  3P96 A;  4UF4 A;  4AL7 A;  4DF4 A;  2RDI A;  2NUU G;  4BWJ A;  3EPG A;  3PX4 A;  4QIW D;  3P3D A;  2VBZ A;  4F4K A;  1C1B A;  1VRU B;  2AX0 A;  3D9B A;  4USU A;  1RAO A;  4R0J A;  1RHQ B;  1U0H B;  5ETV A;  4KHP F;  2FHJ D;  3GIJ A;  4DUZ J;  3MFH A;  4IG3 A;  1IWG A;  4C8M A;  3MZI A;  4LR7 A;  4F02 A;  1XEZ A;  1N5Q A;  2DNY A;  2JSX A;  2HNZ B;  2MGZ B;  2PA8 D;  1B0P A;  4ECU A;  2W24 A;  3D1H A;  4NXN F;  2HNY A;  2DD8 S;  4DR1 J;  4DQR A;  3ONQ A;  3CDA A;  3PY8 A;  4NX9 A;  4PEO A;  4ZVU B;  1XMQ F;  4B3R J;  2MKY A;  1QY7 A;  3M8P B;  5T7L A;  1NO8 A;  2FJA B;  3TZZ A;  3QPI A;  1KD1 T;  1B7F A;  2VPX B;  3CED A;  3H7H B;  3PRB A;  1SL2 A;  5AJ3 J;  1J27 A;  2VG5 A;  4DUT A;  3NMR A;  3UDC A;  3D6T B;  1HNV B;  2IIH A;  4Y2C A;  3BR8 A;  2QL9 B;  5A8K B;  4B9L A;  5DDO C;  3AFG A;  1GMU A;  2WON A;  4U7U D;  2MKJ A;  1G1X A;  2HNZ A;  1F0X A;  1EET B;  2B9W A;  3ZZZ A;  4M5N A;  2OO4 A;  5FLX U;  1FD8 A;  2BKN A;  4OZ5 A;  2BJ3 A;  2ADB A;  2M5Y A;  3N6M A;  3WQP A;  3J81 U;  3FGV A;  1U0H A;  2W1B A;  4RPF A;  3TA1 A;  3OTO J;  2VDI A;  4RNH A;  2W8K A;  2DNO A;  2FZK B;  2R3V A;  1RT4 B;  3MWB A;  1S1T B;  2VFV A;  1FKA F;  4KKO A;  3V2U C;  2J0Q D;  2W7A A;  3MUR P;  2DEI A;  4NOH A;  4J9L A;  4DWI A;  1SUQ B;  2ZZT A;  1ZTW A;  4W90 B;  3IR7 B;  4O4G A;  2B7C B;  4E2F B;  5I3U A;  4I7F A;  4JOU A;  3EGV A;  4DG1 B;  4QZV B;  5K20 B;  1N5Y A;  4RW4 A;  1J5O B;  3ZTS A;  2FJX A;  1SKS A;  1RAE B;  2HMI A;  3TUZ C;  3G6V A;  1JLE A;  2HGM A;  1TVR A;  5JJB A;  1KS2 A;  2YNI B;  5L8R C;  1S0V A;  1YJ7 A;  2OD4 A;  1YJN S;  1RBA A;  4WZQ A;  1RT6 B;  1TKT A;  3BGR A;  1B0T A;  4MT1 A;  3LH2 S;  4FDF A;  2KH9 A;  2E7W A;  3C15 B;  4DV5 J;  1JWW A;  2ZBC A;  4KSE B;  5B0G A;  1FKO B;  1KFD A;  1GXL A;  3KUH A;  4YS2 A;  5LMU J;  2VA2 A;  3MAA A;  2Y1L B;  3UR0 A;  2A10 A;  2R7S A;  1UPP A;  2LA6 A;  3R97 A;  2ZH9 A;  2LMI A;  5BYQ A;  1UFK A;  5J1E B;  3FC9 A;  2E1P A;  2A3J A;  3TJA A;  5HLF A;  2ZHB A;  4LFB J;  4P9S A;  3EPI A;  4Q2M A;  1UEV A;  2JC0 A;  2C22 A;  3PTW A;  4DJB A;  2R2T A;  4DR1 F;  3JTP A;  2R2U A;  3DYA A;  2WW4 A;  2H3E B;  4DCJ B;  1VIX A;  2XO7 A;  3BN4 A;  2MZQ A;  1GX5 A;  5F8N A;  5CHC B;  4DUZ F;  3KLV A;  2YY3 A;  4TN2 A;  4AFF A;  3EGZ A;  2DHA A;  2HVE A;  2C2R A;  3MM5 B;  3FDS A;  4UST A;  3SYZ A;  2OEL A;  4KFB A;  5AXL A;  1RWN B;  4ES1 A;  6AT1 B;  3KJF B;  1YWX A;  3OFE A;  4AUK A;  4DSE A;  2VZ9 A;  2RHQ B;  5A2Q U;  1B70 B;  4NXM J;  4ATN A;  4DEZ A;  4OHW A;  3MCN A;  1R0C B;  1TK5 A;  2MZJ A;  1H72 C;  4IG0 B;  1CJV A;  1FTR A;  4AT1 B;  3KK1 B;  5CZX A;  2O3D A;  2QL5 B;  2M4M A;  2MDA A;  2BA9 A;  1PBU A;  1U2R A;  2X1A A;  1UVJ A;  1W25 A;  1EQ0 A;  4ZCI A;  2L48 A;  4A8M P;  5L1J A;  3H98 A;  1TEL A;  1ZM9 A;  4MKY A;  1CS4 A;  5E2Q A;  3M2V A;  2OPP B;  3AQP A;  4C0H A;  3W62 A;  4NE9 C;  1HFE L;  2DNM A;  3IP0 A;  3OFG A;  3PW0 A;  1XNR F;  2BQU A;  5I3P A;  1C0T A;  2LFV A;  1S1X A;  2MZS A;  3WIV A;  1X5T A;  4RX6 A;  1FRX A;  1Q53 A;  1Y00 A;  4NAS A;  4OYW A;  5CXT A;  5B7W A;  3H2L A;  2OPP A;  1RT1 A;  2RVJ A;  1MRO B;  2YNG B;  4M5G A;  4Q0B A;  5B09 A;  2DEJ A;  1P9Y A;  3C6U A;  2QA1 A;  3P5T L;  1FFS B;  1IKY B;  3EDQ B;  1NM2 A;  5KOX A;  2UUA F;  2OH2 A;  1VQ8 S;  4E0D A;  2D3Z A;  1OSD A;  1RAI B;  3A4T A;  3EVO A;  2DGO A;  3BBB A;  1RA7 A;  1WHW A;  3FBE A;  1WSR A;  4RW6 B;  5BR8 J;  1T3N A;  1QSS A;  3LAL A;  4OZN A;  3VAI A;  1SC1 B;  3B8H A;  1V6H A;  2GO8 A;  2RT3 A;  4TYB A;  3SCI E;  2DB1 A;  3IBC B;  2LVW A;  1JQG A;  5D3G A;  1UFL A; 
#chains in the Genus database with same CATH homology
 1C3G A;  3AGX A;  3NXZ A;  1EAR A;  2HFV A;  3AGZ A;  3LA0 A;  3TJ9 A;  3I38 A;  1EB0 A;  1GMW A;  2Q2G A;  1GMU A;  1NLT A;  3L9Z A;  2B26 A;  4L3K A;  3AGY A;  1GMV A;  3LZ8 A;  3TJ8 A;  1XAO A;  1GMW D;  2QLD A;  3TJA A;  3NY0 A;  4J80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...