3TJAA

Crystal structure of helicobacter pylori uree in the apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 35
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tjaA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tjaA02
3AGYA 2B26A 3AGZA 3TJ9A 3TJAA 2Q2GA 3L9ZA 1GMWD 1GMWA 1GMVA 1EB0A 3TJ8A 2QLDA 3LZ8A 4J80A 1C3GA 3I38A 3NXZA 3NY0A 3AGXA 1NLTA 1XAOA 1GMUA 4L3KA 1EARA 2HFVA 3LA0A
chains in the Genus database with same CATH superfamily
2DJWA 2AHOB 4OZ1A 4X4RA 4R0JA 3VAGA 4GKKF 1TQLA 4KH0B 2RQCA 3J7AN 1WF0A 1KQKA 2YTCA 1WC0A 3SFGA 5ETSA 1UPMB 1S1TA 2OPPB 4QIVA 1H73A 3KK1A 4ID8A 2W9CA 2D3ZA 1KQGB 4J9LA 1VQKS 2AYMA 4KH1B 3EVWA 3IMQJ 2FC9A 2KB2A 5G0RA 1SJ3P 2R7TA 2NUHA 3BKUA 4G65A 2EG2A 1V3RA 3CEDA 2XMJA 1L5UA 3KMQA 2HFNA 5KFKA 1U02A 4IH7A 4TNOA 2XI3A 2NXCA 2X1AA 3DHWC 3MGJA 4DV0J 4K50A 2OJ3A 2MZJA 4FXWA 1SJQA 4YHHJ 4PQUA 2JFDA 3IBWA 4PR6A 1FJ7A 4G1PA 2RQMA 5LXYA 1NPPA 4JI4J 2PIIA 3HZGA 1NDCA 2DITA 4C11B 4DI6A 4TKTA 1TKZB 1PG5B 3PCOB 3LAMA 5HQLA 2M9KA 1IKVA 4IO9Q 2VPZB 1F5AA 5IFMA 3NXZA 3I31A 2BJDA 2PFDA 4A4JA 3AGYA 1FNMA 1FE4A 1FA0A 4ECZA 4LF4F 3IM8A 2MKJA 4CLYA 3CE8A 1TKTA 1JXLA 2WW8A 3SCKE 3UD5A 3BO4A 3AT1B 2ABYA 2QA4G 3TZYA 4WU3A 1Q8KA 4USTA 2YH1A 1HLWA 4F4ZA 1CULA 2DISA 4B3MF 2WRMA 1UAWA 2H5JB 1KONA 2QLDA 3UCUP 4AE5A 4QU6A 1DARA 2HAIA 5E5NA 3HSGA 1VQ4S 5LJ3Y 2WZ1A 4L6V3 5IV4A 2RF2B 4K8RA 5LMUF 5L46A 4FF4A 2D9OA 4UW2A 1QTMA 3VAFA 4X4QA 4OX8A 1DFDA 1HQUB 3V4MA 4LF9F 3OSNA 5HI7A 3ILOA 2EVZA 4RW9B 1FTRA 2F9DA 5SZTA 4JV2A 1UFKA 1U1MA 3BF4A 3MTJA 1GXLA 1EB0A 3SDEB 2BJ8A 3VTIA 4WTYA 3DRXA 5F8NA 4CLLA 4QYRA 5IQQA 3OD2A 2C3OA 1JIHA 1YX2A 3RB4A 4F0KA 1AZSA 4IFVB 3D1OA 4J7CA 2HS4A 1T02A 5KTQA 4OI2A 1WORA 1R8HA 5A8RB 1V5VA 5FDLA 1H2VZ 4NLQA 4BLGA 1FHTA 1NKCA 3M8PB 3MTKA 3I87A 1F2GA 5ITHA 3BN4A 4XDCA 3W61A 4WFBQ 3LAKA 3B4MA 3JQJA 3GG1A 2ZH4A 3H20A 2JZ5A 1U7LA 1N32J 2HNYA 4EUVA 1UVJA 3CCUS 2E29A 2K2PA 3V81A 2QTWA 3EDRB 5IC4B 3W64A 5KAKA 2JRSA 4OYMA 2EFOA 4U8VA 3D7SB 2XULA 3OSPA 2RKIA 1NKEA 3QJJA 1NK7A 1RHJB 3M9OB 2AYBA 1DJ0A 2C2RA 4DU7A 4EEYA 2HVEA 3P49B 4U7UK 4L72B 1UWBA 2YWKA 1RT2B 1FXLA 5U47A 1S0OA 2LMIA 1S1XB 2G9OA 2NCKL 2HHWA 1J27A 1V5IB 1GXTA 1T9VA 1NJWA 1MLAA 2CZVC 3NLCA 1JJ4A 1TMJA 1JJ2R 2Z2MA 3HT3A 2ASYA 2HWIA 2YNHA 2CQ1A 1F6TA 1SKUB 4NEZA 2YNGA 5KFEA 4I4BA 1FT8A 3MMAA 3FUYA 1KLMB 3MUVP 2ZBPA 2KRRA 4RNHA 1ZTTA 2XMMA 3TX0A 4A8MP 1P8GA 1LWFB 1UKUA 1RWUA 4WIQA 3W65A 3RRGA 3A8EA 1GMWA 4B3OB 1CQMA 4B9SA 1MSWD 3HSZA 3VAIA 5E3PA 4AQYJ 2HIYA 2EFPA 4S0MA 4QOTA 4OX9F 3NP5A 3DLEB 5C24B 4LF8F 4WCEQ 1FJCA 2MKSA 2J6UA 3SFUA 2NZCA 4HI1A 2UU9F 1H74A 2P8IA 2F7VA 2BJ9A 4JYAJ 1X4EA 4AYBD 1UCNA 2B7CB 4OFZA 1N5YB 2XGPA 4PWWA 4ITSA 1DLOA 1NMEB 2OEMA 5J2QA 3MZIA 3K5PA 1Y5IB 1I94J 4DBQA 1TP7A 2RUGA 8RUCA 3M2RB 2ZM6F 2DYAA 4F02A 1J5OA 3W2VA 1CS4B 3R5DA 3MDFA 2J0SD 1EIYB 3T5HA 4I2QA 5IXUA 2K1RB 1NUEA 1KS2A 3MEGA 2G4BA 1VI7A 2GIQA 4X64F 4R5PA 1K1SA 1RTIA 3MF5A 3PHEA 4CM2A 4DPUA 1Q95G 2H5IB 2E5IA 5HBMA 1APSA 3OVAA 1EP4A 3IG1A 2DPJA 2XLIA 3PKMA 4ZP7A 1XNRF 4IG3A 4KKOB 1U2CA 2EI5A 1ZS6A 3M8YA 3QFWA 3ZZRA 5HP1A 1QDUB 2EK6A 3BSAA 5ETVA 3PFOA 5DDRC 2E5GA 2UXDJ 3VALA 2IRXA 5CHCB 2E66A 4TN2A 4RUBA 4ZP9A 4ZPWR 1FXDA 1W2BR 4Y2MA 3Q8VA 3D6TB 3ZFVA 1WKLA 2U2FA 4X2BA 2GS8A 5JVHQ 2I5JA 4N41A 4M8LA 5B09A 4DSEA 3V6HA 1LW2B 2LQ9A 4I2PB 1H38A 1QSSA 4X4VA 4URSA 3AD9C 4P2MA 1S6QA 4CO5A 1U49A 1JLAA 3NGRA 3DKDA 2CADA 3C14A 3IR6B 3OR1A 1Q86T 4EK2A 2B9YA 4GVBA 3DOLA 5A6WA 3K89A 3DLJA 3MCSA 1PJ6A 2MZRA 1RAEB 2AW0A 2N7YA 3BPSP 1DAXA 4JI2J 2BDPA 4FYXB 2V4QA 5THWA 4C3KA 2P6SA 2ZZMA 2B5JA 4DV7J 1N56A 2P9CA 3TNVA 5LJ5Y 3GP9A 3MMJA 1FD8A 5K14B 2FJWA 1Z4UA 4RW8A 3V2UC 2JVRA 3EXYA 2OSQA 5GAGU 5B7WA 4QWEA 3AA9A 3GPAA 4WYWA 2W7PA 1RAJA 1OPZA 4ED3A 3TJAA 2JVOA 3P45B 4USUA 1QY7A 2BQUA 1O8BA 5FJ4A 2XSJB 3N9UC 2KZZA 1U0HB 1LWCB 3S1TA 2CNOB 2IAJB 3E51A 5IT9Y 2KJWA 2W9BA 1LNQA 1JLEA 1RWNB 5T7LA 2G0CA 3I6PA 2IC3A 3LGHA 4K4ZA 2XB2D 5DDOC 4PCQA 2YKOA 4PEOA 3QAEA 3IA0A 5CYQB 4MJKA 3RRHA 4USHA 2YWGA 2A10A 4M5HA 4CNZA 2FHMA 5C25A 1HYSB 2OPRA 4DF4A 1SKWA 2Z58B 1IKYB 3DOKB 4G1QA 2ZHAA 2CPXA 2DY9A 1XERA 5DDPC 2M0GB 5I3UA 2FD2A 2IM0A 5B0BA 3R2DJ 2VG7A 1KTQA 4OHYA 2GQQA 2MDAA 3JSBA 3Q8SB 1WG4A 2EXUA 4DV3F 4DV6J 4DR4F 4DR2J 1WEXA 2VASA 4LIRA 2PMHA 2PN6A 1C1BA 3ZZOA 1RU2A 1RAFB 1B3TA 3B8HA 4G1IA 4LSLA 1R7IA 1X4HA 1U1KA 3THTA 3UVJB 4RJVA 2FY8A 1HWKA 1REGX 1NHUA 1YG0A 3KLHB 3C6UA 1KP6A 4C8NA 5F0WA 2COLA 4RBTA 2PEBA 5A8WB 1RWOB 3CJKB 4LJMA 2DGTA 1UA1A 1HMVA 2M88A 5A76A 2BOAA 2HGNA 3SQGA 2XQCA 1IR0A 1REVB 4NOHA 4NMXA 1SL2A 7AT1B 1ELOA 1Z2LA 2LXFA 4ZOSA 5M2RA 2MSSA 2OEKA 4LT6A 3OL9A 1X4AA 2MQOA 5F8GA 3FMBA 5HO4A 5DG8A 3GV7B 2YQ0A 3JSMA 3KNGA 1RT7A 4LRFA 2H48B 4B02A 2AD9A 4P73A 2B4UA 2AX0A 4ZVUB 3W2WB 3OFFA 3H5SA 1JMTA 4X4PA 2CPHA 2UUAJ 1N5SA 3HF5A 5BJRA 2C2EA 2I38A 2QE5A 3T5KA 3R6LB 4H4OB 2LEPA 1NHKL 2M52A 3CO9A 1CPZA 1HARA 4HR2A 2HBYB 4K0KJ 7FDRA 2F4VJ 3MCMA 1P9YA 3R7SB 1X5PA 1IJFB 3MR6A 1LWEA 3Q8UA 4DHVA 1XMQJ 4C9DA 2N3LA 4TY9A 3IS9B 5B0GA 4IR9A 3GV5B 5IT9U 3KUEA 3UCZP 2JHEA 4OV6A 3M32B 3CJRA 4C97A 3MMCB 1H2TZ 4B08A 5BXIA 1IQTA 2IM2A 2C3MA 2DCLA 4PAAA 2I6WA 2DIUA 3CCES 4TY8B 2XCPA 2VPYB 3O5TB 2ZUGA 2GV1A 1N36J 1WC1A 2XBPA 3KG0A 3OTBA 3BGRB 2ZNYA 5I3QA 2DEJA 1RABB 4DCJB 3DRPB 2D41A 3BS9A 1SV5B 1NRKA 3MEEA 2E7VA 3PRDA 5D78A 2F4FA 3V6KA 3TQEA 2CFXA 3NBPB 1RCOB 4EO6A 1UVMA 5AJ3J 4DQRA 4URGA 5DQHA 1VR6A 2QYCA 1UL3A 5BYSA 3HP6A 4UOCA 4N76A 1N33J 1NSPA 1S77D 5HLFB 2GVDB 2MQLA 2XY6A 2QT7A 2IPOB 3HFKA 4ED1A 1OSCA 3CJQA 2PO4A 2AX1A 3GFXA 5AE1A 3MECA 1T11A 1WDTA 3Q89A 3MXHP 4WKRA 4O44B 2W4DA 3IGNA 1FDAA 3HK2A 3T6BA 1C1CA 3BDEA 2RSQA 2VIHA 3G96A 4HVZA 1SH2A 1VHFA 1A7GE 1URRA 2XWXA 2ZVIA 2CJKA 3QO9A 3ISZA 2HQDA 1YRXA 3MAAA 1OQ6A 3DGVA 4CYUA 1D9DA 3O44A 2BOPA 3OUYA 2CIMA 1SQFA 1YJ7A 1ZA1B 3HFVA 2J8SA 4WFZA 1LW0A 4J37A 2FHJD 3K2YA 5KG3A 3OFGA 5KT6A 4YR2A 1AA1B 2CRLA 4MIWA 4DQIA 2QC3A 1SIZA 3CT9A 3UE2A 5G0RB 2XYHB 3H0PA 1R8CA 3CJ8A 1KRPA 5T14A 3DMJB 4OL8A 1HBUB 3ICLA 2V8PA 1WF1A 4PABA 3H4BA 2CPDA 2JFKA 4E0DA 1FVSA 3BM7A 2DVIA 3BGFA 2ZKTA 4FXVA 2F8EX 3GCXP 3H5XA 4TU7A 4A8SA 2Q43A 4C2MA 1N88A 5JMNA 1FKOB 2OIHA 2XMTA 1T9WA 4C8KA 1UEVA 2V69A 1IKVB 3MPUB 5KFTA 1VQMS 4ID5A 3UDVA 3M6VA 3RBEA 1ACMB 1S0NA 1FRHA 3UDLA 1SI9A 1HW8A 3S7RA 2K7KA 4I1TA 3RBXA 2E9ZA 2MYFA 1VRTA 5JVGQ 2RQ4A 4KFBB 2W8KA 1IWAA 3PYGA 2B4OA 3JAMY 1ZETA 5HK4A 4PUOB 3P5BP 3AGZA 1N5VA 4OYBA 2O01C 3QRPA 1L3VA 1IKWA 5D15A 4O3PA 1CULB 3CSKA 4JI7J 3BPDA 4M5LA 1YRUA 3W5ZA 3LANA 3M2VB 4M5MA 2DNNA 3R1LA 4JI0F 2DNGA 3D68A 1Q5VA 2ZDPA 3D28A 3GFZA 3A8JA 2FTRA 4TLQA 2CVEA 4DL4A 2KXFA 2Y1IA 3OJUA 5LM7E 1R43A 1ZPWX 2V34A 1NSKL 4MKVA 1SJ4P 3I0RA 2XM3A 3I32A 1GX6A 4LSNB 1HNIA 2FDNA 3QPIA 2FGOA 1Q8BA 3HHLB 2I0XA 1OSDA 3KDNA 2XMWA 2VFSA 3OJSA 3HHDA 4GO5X 3QYYA 3VF0B 4X4TA 4Q8EA 2HMIA 4IDKA 5D3GB 1AZSB 1G3OA 2KT2A 4EYHB 1R3NA 4WFXA 3G8SA 1IM6A 1B70B 1N8RT 1E6YA 3OXFA 1S1UA 2CA9A 4GKJF 4OZLA 1NKBA 3KLVA 2Q6BA 3BQ1A 4ZKAA 1JLCA 4ED8A 1WOOA 3ILJA 4JUZA 2BXJA 3FEXB 5GAEU 4PXBA 3Q8QB 1SH0A 2AT1B 3CO0P 2FB0A 5EWFA 4EZ6A 2VBZA 2VG6B 1RBOB 4IKAA 3C6TB 2J5AA 2MB0B 3UDEA 2HHPA 4K4WA 3A8KA 2Q3PA 3ELHA 4CLSA 2RKIB 3FNNA 3MM8B 3O3LA 2ZOFA 2VICA 5ETRA 2Z0GA 1HNVB 1LWXA 1PO6A 3TEGA 2ODXA 3C16B 1Q82T 2MLZA 2L9WA 5J2PA 2PSZA 2V94A 3G2XA 3EICA 2APOA 1AUSL 2J7KA 1MWZA 4M5DA 1YQHA 1X0FA 2ZH8A 5AXKA 2HFOA 2CQIA 1UFWA 4RW7A 3SV3A 2W1BA 3UR3C 1D3WA 2L41A 1FRXA 1U26A 2RD5C 5E0OA 5LXRA 4LF4J 1U6ZA 3BO3A 1QM9A 1R0AA 2B4PA 2LEAA 2ZBQA 2KXHA 4DV0F 2MQ8A 1VQLS 4FYYB 1FJGF 2LXUA 1S76D 2YWEA 1P27B 1DQ9A 4YHHF 2JEIA 1HBMA 3FFIA 2V63A 1Y10A 2BW2A 4MFBA 1NH7A 4JI4F 5KT7A 4U67Q 4ECTA 1BC6A 4B9MA 1FE0A 3T19A 2DHHA 5CD4H 2BX6A 2Y0SD 1TL1B 3MURP 2I2YA 3PTWA 1NU4A 2XSFA 4JV0A 3EM1A 2VFTA 4LF9J 1UVNA 2BKPA 5JJBA 2AEJA 5GMEA 2KT3A 3IR5B 2HS3A 1DLOB 4DN0A 3VQTA 5J2QB 3VGUA 1QAJA 2J7WA 1QUPA 2VOOA 2DR6A 2JWNA 1TKXB 2X3GA 1FRLA 1J5OB 4RW6A 3EZUA 4ERDA 2JVMA 4NYZA 1WI8A 3LA0A 1F2HA 3BH7B 3ITHA 2QYGA 2HQ3A 1U1NA 1RTZA 1U48A 1IKXA 3O6QA 4GRSA 4J9QA 1IBCB 3PEJA 2FJXA 3MEGB 3LO3A 3TX8A 3BH6B 2O67A 4PWDB 4N8OA 4R5PB 3CCTA 4CH1A 4WFYA 2F9JA 3PRBA 3DOMB 4M1KA 5HBMB 2O3DA 3G86A 4JI1J 2OD6A 4ZCIA 2Y8WA 1GFWB 3CC2S 4LR8A 4FVMA 1SVDA 3JB9k 3TUPA 1VISA 2P5VA 4ZVRB 2P2CB 4ZMMA 3DRRA 2WK4A 4MYTA 3DYAB 3Q22A 3ULHA 4FVCA 2GO9A 2N82B 3SSQA 2CJ9A 4NLOA 3QJLA 2LVWA 1W26A 2R2TA 4HT7A 3D3CJ 3P96A 3IFEA 1VJWA 1C0TB 1KSPA 4M5GA 2PT0A 3BDPA 4WZMA 4RPFA 4XPCA 3LALA 4ZPAA 2E5JA 1T9UA 1L3UA 3SCLE 2I5JB 3DRYA 4KB7A 2RMLA 4PWUA 1T03A 2IVFB 3OTDA 2KH9A 2UZAA 3A1YG 1VS3A 2KJVA 4ZVPB 1BXNA 2QO3A 2I9SA 3QATA 5HL7Q 1JLAB 1WSVA 3CJ3A 1N34J 2V8DA 2H1YA 3C14B 4ANCA 1WHVA 2R2RA 2QA2A 4YOEA 2WONA 1N32F 1KOHA 3KJQB 4EU0A 2DNHA 2GVZB 4U7CA 2PA3A 4MK8A 1RBAA 5HVFA 4CH0S 3MAHA 1E6VB 1MWQA 2QMXA 3LP2A 3PJWA 2DBBA 2B5JB 1EKSA 4UQTA 4YB5A 4ECVA 1HW9A 1RLCL 5ETOA 3L7OA 2HHVA 3OXGA 3B82A 1C3GA 5I42B 4DL2A 2E5LF 1LV5A 3C15A 2HQIA 4RW8B 2SXLA 2R8HA 1BWVA 4AL6A 2ATCB 3EGNA 1R8BA 2W7OA 4KHMA 3SXLA 3FSIA 4P9SA 4C8LA 4I7FA 2R7WA 2NXNA 2J76E 3N5BA 2OTJS 2UU9J 4UTGA 5HN0A 3TAMB 3R97A 1ZH5A 3HPOA 2W9BB 1FJEB 2MZ1A 2ZNZA 3Q8PB 2IC3B 2W2QP 1NXIA 3G8QA 3HD2A 2ZM6J 1T7PA 3GILA 1KHVA 3M05A 3CWJA 2HBQB 4ZPCA 3PX0A 2CNKB 5AE2A 2R8IA 3AXMA 4DS4A 3DLHA 4QJVA 1FWLA 1TVRA 2HHTA 4AQYF 1I6JA 2H4WB 3DDIA 1IXKA 1JB0C 2Y8YA 2VQEJ 3BB5A 1ZM3A 3CCLS 4DX8H 4A47A 3EZ5A 4JV1A 4G1QB 1B0VA 3G87A 3GU0A 1S9FA 1B7YB 2X1FA 5J1EA 1FKAF 1TUWA 2R4FA 3M8ZA 1QE1A 3HI9A 3VAMA 5IOLA 4DUZJ 4MMOA 1I94F 4NCAA 1GAOA 3AXKA 3MPYA 4DR6J 1RUSA 1RWPB 2DNKA 4WWSA 1LOUA 3KWMA 1IBMF 1B7FA 2GO8A 3MPVA 1KHWA 8ATCB 2LP4A 2B8PA 2PE8A 1NK0A 4OLPA 2EC2A 3SCJE 4F50A 3T5LA 2LQJA 3FCHA 1F5CA 1DTTA 5HVHA 5J2MB 1VQYA 3I9V9 3KLFA 3W60A 2DIVA 2NXJA 2XO6A 5CYJA 3CMAS 4A8WA 1FNXH 3A3PB 2BE9B 2V50A 3KLGB 2DHAA 5KT2A 3WIVA 1FDBA 3SQGB 2NYIA 2KHDA 5L1LA 4J90A 3UN2A 4WU2A 2WVEA 4ANEA 4J9VA 2BKNA 2YNIA 2XYGB 2GAGC 1TKDA 4CP5A 2UXDF 2W7AA 2KG1A 3UFCX 2ZJPQ 1RT7B 2JEJA 2YKPA 1S1WB 2VQFJ 2OPSB 5F3TA 2P9GA 2BA9A 1CJKA 3KLEA 4IG0B 4Q45A 5IM0B 4HTJA 5DZ7A 5F8HA 1YBUA 3I0SB 2KVIA 3TAPA 1WG5A 2ZWOA 5KG6A 4C8MA 1WJ9A 2V4JB 1EETB 2YNFB 1U6BA 2WOMA 3OFEA 3H2UB 2HHQA 3SIPB 1CJUA 1KQSR 3UNYA 4NASA 4ED4A 4R8UA 1BQXA 2BKOA 2K7JA 1LWEB 1Y7PA 4Y2CA 4RU9A 4F4KA 4EBEA 3H40A 5KG7A 4CDIA 1SKSA 1JKHA 1KQFB 2HRTA 4JI2F 1R8PA 1PSDA 2OTLS 4WK1A 2KFNA 4ZVGA 2CDRB 1VQ6S 3FDSA 1FK9B 4DL7A 3IBFB 3WDOA 6AT1B 4DV7F 3AKOB 4QQBA 3W7BA 2FZGB 3AFGA 2HKEA 2MEWA 4WFNQ 1VRUA 4ZIVA 1JLFA 2NUUG 2ZZTA 3DU6A 1FKPB 3GYNA 3MEEB 4DR1J 2VHGA 3BKFA 1S97A 4F2RA 1X7VA 4H4KC 2XG8A 4GVLA 3ZXWA 3GSDA 2OD4A 3LPEA 3IAM9 2GHVC 3MFIA 1RT5B 4DV3J 5KFXA 2V2QA 1SC6A 4K4UA 1BQNA 3IP0A 4C0HA 1X4DA 1T3NA 1VBYA 1KBRA 1XAOA 3US5A 1IVZA 1HHSA 4ECQA 3K17A 3BEGB 1D9AA 2QV6A 3MPDA 4J5OA 1LQ9A 3FQLA 3N6LA 4YY3F 3KG4A 1RWKB 2YPZA 4HHJA 2VFUA 5A6PA 2IJFA 2MQMA 1C1CB 4WBFA 5AXNA 3PHTA 1F3VA 2DTJA 2WVBA 1QVGR 2GQ2A 4HKQA 2MKIA 2NSBA 1VC0A 2BM1A 1OO0B 3FBEA 5K8MA 4JI8J 1RAAB 1UJ5A 3CCJS 4ECUA 3M9MB 4PYAA 3GJRB 3OUYB 2BJEA 2OFGX 2J7UA 5HMYA 1N6QB 4J9OA 2DR7A 2CPYA 3VGVA 1NDKA 1PBAA 4LRBA 5H9EK 2AJ4A 2PMZD 2NPFA 4I0WA 5DM7Q 2RHSB 3AOCA 4X84A 4P10A 1BQMA 3GG0A 4QCLA 4V19J 2BQRA 1S72S 5CXTA 4ICLB 1KVJA 4I56A 5DDQC 1WSRA 1JLQA 4OZJA 2FPHX 2M5YA 1KFSA 4WTOB 1X5TA 3M8RA 4RR5A 1DZ5A 4QR1A 5HROA 4X4UA 4ZITA 1H2UX 1FI4A 4ZLPA 1U45A 1ZOTA 3A3NB 1C0UB 1H6KX 2CPIA 2LQBA 2Q66A 2FVRA 2ZBCA 3P6YC 2LKZA 2HVIA 1HQEB 2ZH1A 3ADAC 2C3UA 2V9WA 2UV8A 2XMVA 1CJVA 4LVOP 1MWYA 4OJ3A 4NLXA 1YJUA 1QSYA 2HVDA 5ADZA 1BGXT 4A8OA 4XPEA 1U25A 2ZVSA 1TR0A 3FZ2A 2Z2LA 3DRSB 4C3LA 2EFNA 2CQ4A 4C8OA 1TTHB 1L3KA 4ECXA 4K4TA 2FJDB 4ID5B 4KGKA 5KG4A 1HNZJ 2WSFC 2AJ2A 1ZAVA 2FJAB 4YMEA 3I56S 4KQZA 4FKYA 2HK2A 2CQ3A 5KG5A 1VRTB 1RAIB 2AYEA 5DLGA 2H5EA 3DM2A 3PW7A 1SJFA 3AQOA 2UVUA 1IR1A 2FVQA 1IQZA 5KFZA 2HS0A 1HPZA 2YVSA 1JLBA 2HLUA 3ILLA 2F4VF 3RW7A 3CD7A 2JDJA 3L09A 1GTHA 2PGCA 4U7UD 1XMQF 1B0TA 5GADU 1HWLA 3LZ8A 4CLTA 1LK7A 4X65J 4H54A 1SUQA 2G0IA 2ALZA 1PIEA 3CCWA 2J6TA 3GYXB 1ZZNA 1NZ8A 2DH8A 1OYDA 2E44A 1R6VA 3NY0A 4CI0B 3KXDA 3I0RB 1F3FA 2WSCC 1N36F 1HNIB 2A1BA 3IBCB 2ILYA 3Q8YA 4RO0A 2ROEA 3QT6A 1FXRA 2F63A 3BGOP 3EVMA 4QIGA 4B17A 2DRAA 4CWBA 2LA6A 4QU7A 5CA5A 3I38A 1PJ5A 2FLOA 2KN4A 2CPJA 5KFOA 5AJ3F 3EXCX 1E6YB 2R2UA 2XMAA 1NJIT 2WTFA 3SV4A 3RR7A 1S1UB 2OPQA 1N33F 3GTYX 5KT3A 3IXQA 3J7ZT 4QZVB 1JLCB 3NAHA 4NLUA 4ECWA 5EWEA 4F3QA 4ECRA 1Y9OA 3R3TA 1UVIA 2LDIA 3EJMA 2QL5B 2C28A 1T95A 2ZJQQ 3TO8A 4WFAQ 1VQPS 3JYTA 4Y2AA 3S6EA 3HLUA 5FLXY 3J81Y 1YVFA 3BYPA 4NLSA 4K4XA 1DBDA 5K8NA 2AJ1A 4ZLJA 3LUYA 4ETXA 1V9OA 1IWGA 2QSWA 2B6AB 3DLGA 1K8AT 2EC0A 4YDXA 4FNIA 4DPYA 3DN9A 3MD3A 1UZHA 1RGVA 3CJ4A 3MM7A 1O5JA 2KU7A 2HPUA 2C3PA 5EX0A 4PYDA 1G6BA 2CQPA 2ZD1A 2E9TA 1S57A 4NA3A 1M1GA 4WE1A 1NNDA 5CYMB 1K44A 1ZZFA 4RW7B 2V9KA 2R7XA 3GIKA 1VIXA 4OI1A 2IA0A 1PGZA 3DLKB 2IM1A 4DL0C 4Y2IA 4ECYA 2CQBA 3THPA 1RISA 1R0AB 5K8OA 1TV6A 2J0QD 2ZH9A 3J7Z5 1R0CB 4ENOA 2C2KB 2OFHX 3M6XA 2NXUA 3LP0B 5D4PA 2ASDA 1HBMB 2DD8S 2Q1LA 3FFIB 3OHAA 4DS5A 3MMBA 4J9KA 3V6DA 3FGVA 2AJ0A 3QLHA 4ZVQB 2OLWA 4G3IA 3T6JA 4NLVA 4JI0J 4YQWA 4LF7J 4JBCA 3TA2A 3MPWA 1RT4A 3ISND 1M5SA 1Q0NA 3RU0A 2RU3A 2QMWA 2A2CA 3K8WA 2UUCJ 2QX0A 1GMWD 1TL7A 3UNGC 3PEHA 3V4IA 2V5HG 1BD6A 3C66A 2W9AA 1S0VA 4YB7A 3QGGA 3CMQA 1A9NB 3SYZA 2DO0A 5E3QA 3QRRA 2FLLA 4UOFA 2OKQA 3RG6A 4AT1B 4NCGA 3ITHB 1U47A 2BUNA 5JXSA 1S0MA 2ZOGA 2G2YA 5L38A 4TQRA 4LQ9A 2VUGA 3KLIB 4Y28C 4XDDA 3C46A 4ED0A 3QWPA 3VGSA 2FVCA 3U1LA 1UTAA 3EWGA 1HI8A 4CTAA 5LSRA 4GKJJ 1NJYA 1NB7A 4UQGA 2GMJA 4K4YA 4Z7YA 2BANA 3MM5A 3BREA 5CZVA 5A8KA 1GNKA 3M2UA 1QUVA 4M95A 4OYIA 3HHEA 4HTIA 4EYIB 2YKNA 4WJBA 1Q53A 3GIRA 5I4MA 4RWXA 3HJFA 4DOZA 5DJBA 4QWDA 1N0VC 3IWXA 3TZZA 4ZPDA 4Z2XA 1R0BG 3ENQA 2DGSA 4WK3A 1PAUB 3MEDB 2ZITA 4TLRA 3BN7A 4DQQA 4L75A 2IM3A 1H0HB 1NPRA 2OPPA 2RDJA 4LRDA 2DH7A 3JQMA 1FWKA 2F8MA 4XO0A 1HWJA 1FFSB 4AXIA 4DV2F 3X3UA 2VL1A 5BR8F 3RBDA 2LU2A 1VQSA 3K57A 1XIQA 1Q7LB 3G8TA 2PI4A 2DXFA 3WIUA 2CKWA 5GAHI 1UETA 3GE9A 4DSIA 4OX7A 2LDYA 1YHQS 3CD0A 4KBIA 1QAYA 1EQ0A 2BABA 3PJXA 3HO1A 2N3OA 3BSOA 2Y1LB 4J9RA 3Q0AA 3LP2B 3TQ1A 1FJGJ 3UPFA 3ISNC 4DPXA 4ZVFA 3T9NA 2W2OP 2WCXA 3TEHB 2VBYA 4F4YA 1FEEA 2ACMA 1YDLA 5GAHU 2OELA 1TKZA 3D3BJ 2A3JA 2L3MA 1JXVA 2X1BA 2IYGA 2OEJA 2HIQA 3GYGA 3LOUA 3ENVA 3N6NA 4OI4A 5E7OB 5H9FK 2LXIA 3DGPB 1RACB 3JSRA 3NGSA 1B99A 1YLXA 3OL6A 2R7VA 4NXMF 3GIMA 3W8GA 1HNWF 2I1RA 4OYAA 2RRBA 2DR8A 4P2SA 4WKYA 2DR5A 4A46A 1U24A 2GQCA 5A2QY 2DNMA 3VVUA 4O3SA 3HM9A 1CEZA 4DV1F 3FKBA 3OTEA 4OI0A 3OFHA 2KM8B 4DF8A 2GX8A 2RF2A 1GX5A 2FJVA 2FVSA 4F25A 1Q4RA 1HFEL 3D6FB 1RT6B 3E01B 1WI6A 1HBNB 3T1HF 4OMFG 1HQUA 2D69A 3NNCA 3IN5A 4WZQA 2FHKA 3H7HB 2ASLA 4RW9A 4CLPA 4UT4A 3R5CA 3K5MA 1XN9A 2M4MA 3AQPA 3LP1B 3OVSA 1VLOA 2RQKA 3QGHA 3GLJA 1PYSB 1U8WA 3TA0A 3SDEA 1P6TA 3TJ8A 1SL0A 3OTOJ 4F36A 1R89A 1EARA 3ZZ0A 2M2BA 3DXBA 4F8RA 1T0TV 4MKYA 3FEZA 4F67A 1U2RA 3K5NA 1FFGB 3HZEA 1WHYA 4F4XA 3EPIA 1DTTB 1DRZA 4YDDB 5F9NA 3M8PA 4H4MB 4LF2A 3KLFB 4Y3CA 2DHGA 2ZBIA 1XR5A 4W4MA 4NLPA 4JI1F 2ADCA 4JI5F 3R5AA 2HW3A 5KG2A 1EKRA 3AJ1A 2KXNB 1NHVA 3VV2B 4YEAA 4DG1A 4BBYA 2ZBRA 3MFHA 1MMLA 4M5KA 1VQNS 2WVDA 1ZM4A 4OI3A 4DMZA 2VC0A 2Q2GA 4NLRA 5CAAA 1BWEA 2HRYA 3OVBA 3Q2TC 3RTVA 1CJKB 3BKTA 1X9WA 2H51B 2E5LJ 4OZ2A 2CG4A 2E7XA 3W66A 1RT1B 1S1XA 3A13A 2AZ3A 2W8LA 3IO1A 4TU9A 2KHCA 2CUYA 4IOAQ 1KTVA 2R7RA 3KFWX 1NCLA 3DLLQ 2HZAA 3PYEA 1N34F 1UEUA 3PW5A 1CLFA 3I96A 4LFBF 3DDNA 1RWVB 4O3OA 2O66A 4UY8T 4ZN1A 2AEMA 3SSSA 1MN9A 4F7VA 3RAMA 1NJXA 2X7IA 2LEBA 4CQ1A 4F4WA 3OTCA 1LWFA 1MN7A 2CJYB 4PG5A 3ZNJ1 3MCNA 4DV5J 5KFRA 4AL5A 2F1FA 1XBWA 4M63A 1GT8A 1F5BA 3NWRA 1AFJA 1V3ZA 4DFMA 2E1MC 3SEOA 1RT3A 5HVGA 3BJYA 4U6PA 2GW8A 2D1CA 3VZHA 3NMRA 4ZN3A 1NPKA 2HQGA 3OR2B 2GA7A 2DRBA 2YY3A 1MNEA 1NDPA 3QT8A 1NK5A 3PYDA 4NZ6A 5E3CA 1VQ8S 1KN6A 1JLFB 3QT7A 1Y5NB 1XR6A 1S6PB 1YZ6A 2RAQA 1PYTA 1N5YA 4LQ3A 4E8UA 1HD0A 2IHR1 1ZYQA 1QAIA 3HVWA 5L9NA 2O5DA 3R5GA 3QWUA 4NL5A 3R1HA 5T41A 4AFFA 1BQNB 2J0WA 1LXJA 2RHQB 3ZC4A 1C4CA 2XLKA 3PW4A 2NS1B 3DHXA 1HI0P 4ZVEA 2FJBB 1U4BA 1RWWB 3GQCA 4C4WA 3UDCA 1IBMJ 1YI2S 5M2PA 3PFEA 4MIAA 3GR1A 1JK9B 2YWWA 3S01A 2MZTA 4UY85 3LW5C 4CH7A 2YQ3A 2DCUB 4JI3J 4CO0A 2YWFA 1HR0F 2DK2A 1SXLA 4CNYA 1B4SA 3TR5A 3IRXB 2VQEF 1XTZA 4C0BA 1W2IA 1VMBA 4KO0A 3HFZB 2AF6A 1NK8A 2X1GA 3KOAA 3ENAA 4RNOA 2HYIB 3A4TA 1S6UA 4UUWA 3SMZA 3W9JA 4YN3B 2ZH5A 2KKHA 2F3JA 4DWIA 2JNJA 4DUZF 1WEYA 2RE1A 2PDAA 3M8QB 5JUMA 4DUTA 3TJ9A 2YKMB 4DR6F 1XMOJ 1TL5A 2AGOA 4LFAF 4U8YA 1UFLA 2BQ3A 3TWZA 1OYEA 1J2VA 2OUGA 1F1BB 1PBUA 5D4NA 5SUHA 2R8JA 5C7PA 1JLGB 1AYEA 1JLQB 1N48A 2CQ0A 1N52B 2GNKA 5E33A 4P6QA 4MK7A 2XMUA 2FC8A 1RHUB 2UV8G 5HATA 3CDAA 2J9CA 2YPYA 1S6OA 4LREA 4KIAA 4ILRA 4IFYA 4NCBA 2VFVA 1LEOA 3RUBL 2V2ZA 4EBDA 3NS5A 4KR0B 2DHSA 1IN0A 4CO4A 1X8DA 4ZCMA 1M5VC 1KR4A 4URQU 4QYZK 1VK3A 1XK8A 2BJ7A 5HSPA 5KFNA 2RILA 1RKJA 4L76A 5GAGI 2GGPB 3CVKA 2CNLB 2VQFF 1VBZA 4RUHA 5M2UA 1HQ2A 5K14A 1L3SA 5HQMA 4UZCA 2PC6A 1S1VB 4NZ7A 3NGTA 2ZE2A 4DPOA 5A0YB 1RTJA 5DQIA 3FVYA 2HSEB 4ZCKA 3G6YA 4DR3J 1QAXA 1I5OB 3BZQA 4HACB 2XSJA 4N56A 3BV8A 1U0HA 1D1UA 1HPZB 2IAJA 2HGLA 1JLBB 3JS9A 4EO8A 3TUJC 1IM4A 3UD3P 1VIOA 5L9XA 2QLXA 1JNZB 3SBMA 3TP2A 2MKYA 2C2OB 4OHVA 4L3NA 4PZVA 2CAJA 2CQDA 4DQSA 4IH6A 4I64A 2LLZA 2GZOA 2IMWP 1WOPA 1KFDA 2NREA 4NRUA 3MR3A 3A12A 2Q6CA 5CYQA 3K5LA 3UN3A 2Z2YB 4J9PA 4RW4B 4NWBA 2IDLA 4KPCA 1WHWA 2FHOB 2BE2A 1X4GA 2QSFA 3ZTSA 4DPTA 5CD4A 3K0JA 3KJVA 5AXLA 1IKYA 3DOKA 4YY3J 2Y1RI 4IOBA 1MU2A 3PV8A 2QEXS 2ZHOA 4HH1A 3RW6A 4DR1F 3GIIA 1TK5A 2HBRB 5HQ8A 3ILIA 1C2PA 2CJBA 3U02A 1C4AA 3SSRA 4NLYA 3KK3B 1FWPA 2C2DA 5DLFA 3NAIA 2KT5A 2HNDB 2Y0BB 4IR1A 1H7WA 3NKYA 1YTYA 4KTQA 3SQOP 1JQGA 3UVJA 3ZZPA 3L9ZA 5IWAF 3T9ZA 3NS7B 3KLHA 2IRYA 2K06A 5B0FA 4JV5J 3OQ2A 1MW7A 1N4LA 2YX4A 2OHDA 1VHIA 5A8WA 2WHOA 4HHHA 2MQQA 3HVRA 1RKIA 3QBCA 2VZ9A 1FRJA 2UXBF 5CCLA 1ROFA 1TELA 2GC8A 1DQ8A 3DLGB 1U8SA 1FX4A 1ZTWA 2QIFA 2XI2A 2ZEJA 2W2NP 4JI8F 4O23A 5IZHA 1HNXJ 1FVQA 4IQMA 5L8RC 2FLNA 2W2MP 4O4GB 1D8YA 2ZD1B 3NNAA 2YWHA 4MKBA 1OWXA 4YR0A 2FVPA 3UO0A 3W2WA 5E3RA 5DO2A 3LWLA 3RGIA 4BWMA 2KZMA 4EI2A 3F0NA 4NE9C 2ZZNA 2F40A 3FZBA 1RYSA 1T05B 4DSLA 1TV6B 3CCRS 1CBKA 4LIWA 4C7QA 3OT9A 2GCFA 2QZ8A 4RBVA 3EGWB 4DSKA 3G6XA 2AGQA 4KHRA 2IVYA 2XHCA 4RLEA 2Y3YA 5H1SV 3QLHB 3IS9A 2D7SA 1ITPA 3FBBA 1S5ZA 2DGUA 1GEHA 3POTB 4TYAA 3KK2B 4DCOB 4B9VA 1YITS 2HAFA 4UZBA 1CJTA 2YKAA 4JP8A 3MMCA 3U27A 5F8MA 2P9EA 3H4DA 3ET6B 1U1PA 3HJVA 2LCWA 1Q79A 2HBZB 1HNZF 2AQ4A 4TY8A 1TL7B 3BSCA 4NEYA 2XGQA 3UI3A 4LFCJ 3ENWA 4ALZA 4C0OC 3CJ5A 3KHRA 4USVA 3CCSS 1M0SA 1UMJA 1SJ1A 3UR0A 2XZDB 2AEFA 2BV3A 1S10A 3J7YU 4B9LA 3OBIA 4TQSA 1D09B 5IT4A 1N54B 3PJ9A 2ALYB 3BR8A 3HVTB 2QN6B 2VBWA 1DTQB 3NBPA 2A6OA 2OSRA 5D0HA 3D1QA 3DI6B 3TUZC 3TUIC 4B3SF 3RJMB 2W01A 1Q7YT 3B6BA 1Q1KA 1HBOB 4X65F 5ETMA 2HHXA 4HHUA 3W5XA 2E1AA 2GVDA 3EVOA 4M5NA 5KFAA 4RZRA 4LMZA 1XMBA 5DGBA 3CNQP 3BQ0A 4D3GA 4KV8A 4ZHRB 3PACA 4XTTA 5A8KB 4FPIA 4O44A 3WX4A 1F60B 3D54A 3OV7A 2UUWA 1YGYA 4A48A 2N4CA 2CYYA 4DU8A 4USMA 3BSNA 3NEKA 3MWBA 4FS2A 5J2NB 1RDRA 2N4DA 1YKWA 1W7WA 2C42A 3EUNA 4CO2A 3B4DA 3M6UA 4ZLNA 3R6GB 5AE3A 1NLTA 2R2SA 4EBCA 1DURA 2HFVA 1CSJA 2XMKA 1SJRA 4DXLA 1S1TB 2MHNA 3MM9A 1F9EB 2IJNA 1FCAA 4QR2A 3KK1B 1ICEB 2W9CB 4P2FA 4RNFA 4WPAA 4BHQA 3N4WA 1R31A 5CZXA 1F0XA 4YB6A 3VWSA 3NCPA 3UN5A 4DSJA 4E98A 3DMJA 4O3NA 1HBUA 3NCQA 2V68A 4DZ6A 3NNHA 2E1PA 4FYDA 4YS2A 2BMBA 2UUBJ 4KJIA 4V19X 4PQUB 4ED5A 4K5RA 2V0NA 4PXCA 3A3OB 2UVVA 2ZDOA 1HL6A 5D0EA 2RNEA 3QIDA 1NO8A 2CZ4A 1FKOA 1FO1A 2Z56B 1AW0A 2GJIA 3RB6A 1WC3A 5D4OA 1X0PA 2MZSA 2YH0A 4ILLA 3DLBA 6FDRA 5HMWA 4YUDA 3ZTQA 1WC5A 3RAQA 3C3LA 2HFSA 4KFBA 2MY8A 3VAJA 7FD1A 3RB0A 1RXOB 4Y65A 4PUOA 1FD2A 1TKTB 2JJ4D 1OS5A 3MUMP 2CXEA 2JZ8A 3CD6S 1KKHA 3QGIA 2HG4A 4A8QA 2HHUA 1RADB 3HX9A 3M2VA 5LL6d 2KI2A 4C6AA 2XZTB 1GMUA 3HXMA 4HYKA 3G4SS 4CO1A 5AT1B 2HRUA 3C6EC 1X4CA 3HSJA 2G0JA 3IC1A 1SPBP 4LF7F 3TOQA 3GB0A 3HMJG 4I6AA 2B3TB 3M6WA 1LK5A 4ED7A 3MI7X 2CDQA 3GJTB 1A6LA 1TZ0A 2UUCF 3VGTA 4ELTA 3H25A 3QSIA 1M1HA 4LSNA 2WBRA 1PILA 3HHLA 3W9IA 3MOZA 2PA8D 4LF6F 5MLCV 2HWHA 3PKYA 2W24A 3BO2A 2IY5B 5D3GA 5KFCA 4DR7F 1KVKA 1VDHA 3OL7A 1NSQA 2DNRA 1N0UA 2VC1A 1S59A 5GAEI 3RAXA 4ETZA 3Q83A 3O1LA 5FDLB 4X62F 3M30A 2MLXA 2QFIA 3QQCD 2E1RA 2VH7A 4DV2J 1XWLA 3G9CA 2ZH6A 3T5JA 1I51B 4Q8FA 4G6VB 5BR8J 3L95X 4R25A 1QLNA 1WTBA 2RT3A 1M5PC 1M5HA 1PC4A 2HNYB 4ZVHA 1RTDA 3P3DA 3EYZA 4K5SA 4DG1B 2VG6A 2QA1A 3V81B 3C6TA 1WD6A 3E8OA 3MOJB 3FSXA 3ZZYA 3DC2A 4LF1A 3W3SA 3MD1A 1CQNA 3TA1A 5C2CA 4HH0A 3MM8A 1RI7A 2BW7A 3WBZA 4W90B 2W4CA 4CLUA 1HNVA 1YJ9S 1NSAA 1J5EJ 5IC6B 4KGZB 3EE3A 3C16A 3CULA 1UWBB 5DG9A 1UVLA 1WDDA 3CIZA 3LPYA 1YJRA 2LQ8A 2VDHA 2OI2A 4M5JA 1Y5LB 1RBLA 4F3MA 2ZHBA 4EGLA 4ZA1A 1TUGB 2GHWA 2YNHB 3D0GE 5B0EA 3NG8A 3ZTRA 1NDLA 3GJSB 2EK1A 2YNGB 3U1MA 4ECSA 2RU9A 3MMAB 4NXMJ 2GIRA 1FDDA 1HNWJ 4B3TJ 2X3DA 4DX5A 2AIRB 3F73A 4QR0A 3AJDA 1Q16B 4ZJLA 4ZK7M 1MROA 3N6MA 4LRAA 3Q24A 3VAKA 5KG1A 2UVWA 2QMUB 3JAMU 5D8HB 1RT3B 5LSOA 4DV1J 2ILZA 2IIHA 3BBBA 2EEYA 3KHHA 1IUJA 5E3AA 2RRNA 5D4LA 2KFYA 4DV4J 4FS1A 2J8AA 2HNZA 2V2KA 5HMXA 1TL1A 2BZ2A 3T1HJ 2BE7D 1YJVA 3MR7A 2KM8C 1UP1A 2D74B 5EX3A 4U9RA 1SC3B 4J80A 3GONA 1Z2ZA 2CJAA 3PG9A 3TW0A 1X4FA 1FRKA 2Y1JA 2CZ9A 1TKXA 4I69A 1VRQC 2BJ1A 4DL3A 3Q2SC 1YJTA 3R2CJ 2XEXA 1M5KC 3W2VB 1KWMA 5KFBA 2H3EB 1SH3A 5KOXA 3IM9A 5D77A 1YJWS 2VFRA 4I2QB 4Q2MA 4B9TA 4FP9A 3KNAA 4PWDA 2OGUA 2R42A 3AGXA 2B43A 1RTIB 3DOMA 4KO0B 1QD1A 3ZZZA 2XZWA 3CCZA 1GXUA 3O8WA 1EP4B 4JI5J 1SCJB 3IG1B 4Q44A 3CW2C 1DY3A 4IG3B 3MAQA 2JLGA 1U1QA 1WKJA 2JRRA 3FEYB 3DYAA 2ROGA 5HP1B 1XC9A 3OTOF 3D0IE 1C0TA 2XLJA 2ZUAA 4JOUA 5KFYA 2B7BB 4D3HA 5KFDA 3TYTA 2IBKA 2XHWA 4NXNJ 4C8YA 3UW1A 3OW2R 2I8EA 5HMZA 2DNZA 3PO5A 2MLYA 4LR9A 1S6QB 4EWTA 1TUVA 3L3CA 4IFYB 2XCAA 3FRZA 4PG4A 4WXWA 1Y4ZB 3OR1B 3EZOA 3TRGA 5C42A 4LFBJ 3GV8B 1K9MT 1WUUA 4Y2KA 2FJEB 1O6XA 1OJ4A 4GVBB 2MGZA 2HZVA 3DOLB 2QRRA 2GVZA 1TMMA 3LWMA 1FESA 2Z8QA 1RB0A 1E6VA 3Q86A 5C5JA 4CO3A 2AP6A 3B78A 2E9RX 4GC6A 5I42A 3W62A 5DZ6A 1Q8IA 1Z1ZA 5LMNF 4J9MA 2ZE2B 1T8EA 1RTJB 4KHPJ 5CH7B 4PXEA 1Q81T 2EBGA 3TAMA 1KC8T 4JI6F 4OJGA 5DGAA 3CGIA 1EJ7L 1JLEB 3X1LB 3AH6A 4ZLLA 5T7LB 1PAEX 3IR7B 2ZKUA 5IV3A 4OJ1A 3D66A 4QWAA 5L1JA 5KFGA 2PFFB 1S49A 4MIBA 3VHQA 2LECA 4DLEA 4DV5F 3CC7S 1NBEB 3I4PA 5EHHA 1M5OC 2W25A 3GSIA 4OI6A 1ZM2A 2DGOA 3PW0A 4OYZA 2BE2B 2DNQA 2OO4A 4KGVB 1WELA 5K5MA 3KJVB 1HR0J 1FNOA 4I6WA 5C25B 3KUGA 1Y0HA 1Q78A 2OPRB 3GIJA 4FF3A 1UPPA 1MU2B 4BWJA 2B4VA 1BE4A 3VQSA 5I3UB 2DY1A 2VG7B 3CPWR 5KFMA 1ZA2B 4Y00A 3CCVS 2KRBA 2MMYA 1RHKB 4LUBA 3PZPA 2M8DB 3QAUA 2L9DA 3FMWA 4I6YA 1PCAA 4I67A 4FN5A 1SL1A 1C1BB 2F8HA 1B64A 4LFAJ 3D6HB 4LSLB 3KHLA 1RTHA 2DNYA 2GJ2A 1VLYA 4TXSA 4DCPB 3FJ2A 1YBAA 1BMQB 1QTNB 2VV5A 1QJHA 1JNRB 3G82A 4JI3F 3QNWB 2V2VA 3CDEA 5J2MA 3C6UB 4PKDB 3D0HE 2E1CA 3A8IA 2BACA 3LQVA 4DL6A 3KLGA 1HMVB 2V67A 2MHEA 2R7SA 3IWLA 3MM6A 4O3RA 4NX9A 4ZJOA 2KTQA 2M3DA 5HAOA 2IBOA 2OMLA 3TI0A 2VPXB 1JJCB 3P8BB 1KOOA 1S48A 4FYVB 1UJ4A 3UWTA 2VA2A 4DUYF 3BGLA 3MR2A 4KYZA 4LRCA 3HULA 1XMOF 4ZPVR 2EBEA 1S1WA 3JSMB 5ETQA 2R7OA 2OPSA 5K20B 4WYLA 1OY8A 3MCOA 5KFJA 5L1KA 4ZPBA 5F0UA 1Q8LA 2J9DE 3J81j 4K2XA 1BLUA 5GMKa 4QW9A 4IG0A 2PI5A 5IM0A 5KT5A 2KFZA 3LGNA 3FSYA 2JC0A 1HHTP 3I0SA 1S4EA 1R6YA 4MK9A 2DGVA 4E2FB 2V4JA 1EETA 1I3OB 2YNFA 5DETA 3VCDA 3ZTPA 3W9HA 1IJEB 2A6MA 1S7HA 4FYWB 1S4FA 2Z4PA 2IFXA 2WB4A 3CC4S 2QL7B 3AD8C 1K1QA 5D0GA 5E2QA 4U95A 3WQPA 3WHIA 2DGWA 2OAUA 4ZJQA 2EFVA 3H5YA 1I1GA 2DT9A 1CJTB 1S99A 1VOMA 1TAUA 1Q5YA 1VQOS 1FK9A 2B9EA 4FBUA 4HDGA 8AT1B 5LT5A 2RUSA 3K59A 2LQ5A 3ONQA 2UXCJ 3Q23A 1WHXA 2QLBB 5ETPA 4F0MA 2AKWB 4KRWA 1G2EA 5L1IA 1EAYC 3F56A 2DNOA 4NLTA 4DR3F 3NCRA 1FKPA 3LH2S 1GTEA 1HA1A 5CCMA 5KFWA 4DEZA 4DFKA 2HHHF 2CG8A 3G6ES 3JTNA 1RAOA 1RT5A 4ZP6A 5H9EJ 4USIA 2R7QA 2KL8A 2L9NA 4Q0BA 3MUTP 2Z30B 4ZVSB 1GMVA 3PX4A 1X31C 4NA1A 1NM2A 3GFHA 4OQJA 4Q2LA 2HQFA 3AA8A 5IWAJ 3QRQA 4KV8B 1N5QA 1EQMA 2CWKA 2VBXA 2ZWPA 1RWMB 3V6JA 4QWCA 1LXNA 2LA4A 3MECB 1AUDA 2HURA 3DDKA 4YP3A 4DJBA 1IR2A 3D5MA 2M70A 4DR5F 2UXBJ 3KJNB 4YFUA 2MZQA 2AZ1A 3M9NB 1RCXB 1IBKF 1SQEA 3C8YA 3PY8A 2FLPA 1VYAA 1T9XA 2Z57B 3QO9B 3MAAB 4CYUB 2C2MB 1U2FA 3FQKA 2VODA 2RS2A 1N6QA 3FBFA 4IH5A 2F5GA 3RBZA 3OPKA 4B9NA 3MM9B 1UZDA 1LW0B 2POKA 2VJVA 2PD1A 1U1LA 2UUTA 1JXEA 4ICLA 2WBMA 4USJC 2FIUA 4MT1A 1WACA 3AD7C 3GJQB 3E3XA 4K7QA 3KTQA 4JV5F 4N8NA 4PXDA 3D67A 2XNRA 5FD1A 1KEKA 1C0UA 4X66J 4BDPA 2K3KA 3HKWA 2DEIA 2ZH7A 1HQEA 3KUHA 3UQSA 4MKAA 3U7JA 3GR0A 5ETKA 1RHMB 3PO4A 5KFIA 4DSFA 2CWXA 4AD6A 2FQQB 3CD5A 4NZ0A 3EMTA 3DRSA 1HNXF 4P7TA 2V4RA 3PYFA 2G1DA 4P7VA 4MH8A 4TYBA 3UCGA 4Q7AA 3VR1A 3QJPA 2VKZG 1U1RA 1KNZA 1LKZA 3T3FA 1ZPVA 2DRDA 2NR0A 1X9SA 4Y34A 4WP9A 2XY7A 1X5SA 5GADI 3TARA 2E7WA 2XWYA 5GMDA 5FIIA 2JLEA 4MTPA 1SC4B 2XO7A 1IKWB 4A8KA 2AJQA 4A8YA 2QG9B 1TFWA 1K0VA 1FDNA 4B3SJ 2GIFA 3C2PA 2GHPA 4IQXA 2NQPA 2R8GA 3NL0A 3T1YF 1X9MA 4NA2A 2FZCB 1EX8A 3KG1A 1RLDA 4XIUA 2PEHA 3PIOQ 2BVZA 5IT0A 3D9BA 3V5RA 4P74A 3AHPA 5GVQA 4CLWA 1XNQJ 4DQPA 2C2ZB 3RRKA 2HWTA 2XC9A 4LFCF 4LF5F 1JJHA 2CQ2A 2VG5A 3TVZA 4JB8B 2CQHA 1IBLJ 3U1NA 5B08A 4B3RJ 2B9WA 1VK8A 2G2ZA 1WNEA 2IRUA 3K7RA 4GKKJ 1OQ3A 3RZAA 4X4OA 2HMIB 4IDKB 4A8XA 1JWWA 2VONA 3NGKA 2B56A 2E5HA 2EWHA 1KVIA 1X5OA 4WF9Q 2K8GA 4NMLA 3M30B 9RUBA 1SKRA 2DNLA 4P72A 2MJUA 1S9EA 4KGMA 2PMWA 4GMKA 2QJ3A 2VU5A 1FF2A 5J1PA 1ZAXA 1RTDB 3K5OA 4UF4A 4N47A 2ZOMA 1RU1A 1SB6A 1NK6A 4IRCA 2H4YB 4RUCA 4F04B 2MKHA 4NYOA 3DFEA 4C48A 2B6AA 3M1VA 3CDBA 2M8HA 3W8PA 3WX8A 1ZAWA 3O2IA 4I68A 5K9FA 3ZZUA 3BQ2A 4F3OA 1FEHA 4L74A 3CJSA 2P6TA 2RVJA 1YJNS 3FCWA 2DO4A 4DPWA 1FFWB 3H2VE 3H90A 3ETMA 5J2PB 3G71S 5J1NA 4KC5A 1G1XA 1GK8A 3THVA 3PX6A 5BYRA 5MAOA 2IYIA 5DM6Q 2RRAA 4XAKA 5CYMA 1ULRA 4M5DB 4P2XA 2N7CA 3BGUA 4IOCQ 3TZWA 4ER8A 4W92B 1TFYA 1HIYA 2NSCA 4OZNA 2K3IA 4TU8A 4OJHA 5G4DA 2DXEA 3GZ7A 3KDOA 3DLKA 3L7UA 3H8YA 4W98A 2KG0A 3EPGA 4P52A 4OV1A 4QBUA 1Y00A 2WVFA 4WP3A 2MQNA 1HWIA 2H54B 4Z37A 2UUBF 3LP0A 1TL3A 1MROB 1OY9A 4B3MJ 4KT0C 3VZIA 3FRYA 2AMCB 1UWAA 3JTPA 4MFBB 4PPDA 1FX2A 3NGUA 5LMUJ 5DS7A 3AB4B 2HNZB 2R3VA 4NLGA 1HD1A 2RDIA 1TK0A 4WP8A 1S9GA 2DR9A 1TAQA 2RH3A 3R9LA 1WC6A 2MXYA 2UVRA 3MR5A 4WXOA 2C2NA 1CVJA 4BCAA 2KYXA 2FGCA 2FY1A 2LYVA 5EDWA 1R8AA 5K8PA 4FXDA 1TK8A 5KFQA 2D3O1 1WWHA 3IAS9 3KJFB 4LF6J 3QZ7A 2D9PA 3QFHA 3K58A 2CVIA 3C5XC 2BRLA 5EUHA 4USWA 4RW6B 3QT5A 1WG1A 3M8SA 4MYUA 1NH8A 1G4CA 4FF2A 4RUAA 4DR7J 5L39A 4ZP8A 4DN9A 1S79A 3KLIA 2DGQA 1IKXB 3PR5B 2V8HA 2G1HA 2O1PA 2DPIA 1F9HA 2QA4S 4FBTA 4DX6A 1WF2A 2J9DA 4X62J 2Y9HA 4NI2A 2A18A 4KE5A 2VD3A 5RUBA 2HGMA 2NYHA 3D1HA 1F9FA 3UD4P 4IRDA 2EPIA 1BUXA 3J7A1 3P5TL 1VCTA 1JX4A 2FHJA 4M94A 3AAWB 1ZM9A 2XS5A 3CIMA 3DRRB 4XK8C 1RWXB 5KT4A 3R7NB 5KFSA 2OH2A 4EFAC 5D6GA 3HD1A 2EFQA 3QIPA 4NYPA 2Z2ZA 1KLNA 3MEDA 5H9FJ 5FLXU 3J81U 2A0FB 1P9QC 2L48A 3K8VA 1G7CB 1SQGA 1T03B 4ELVA 1K47A 1SIWB 3EGZA 3N28A 4O0NA 5KOWA 3SZ2A 4ZPTR 1HKAA 5C42B 3ZZTA 2G13A 5F8JA 3G6VA 3OXLA 2NXEA 4LBIA 1TL4A 2MGZB 2CPEA 2WONB 4O0IA 4RL1A 3QGPA 2BEFA 3J80Y 2JLFA 3HKZD 4ES3A 1H98A 1V3SA 3N01A 2EFGA 3AOBA 1AXQA 1WOSA 1J5EF 4FF1A 2B8QA 5AXMA 4OX9J 3CDUA 2WAQD 2ACYA 4LBPA 2JX2A 3C15B 4LF8J 4X4NA 2C22A 4C11A 3CUNA 5B0AA 1RA6A 3OLBA 1P1TA 1RK8A 5IQ6A 3OHBA 4CIOA 3AOAA 4I7FB 3DGPA 3N79A 4KY3A 2LFVA 2LU1A 4MAKA 2B0GA 3CB4A 4F0HA 1RJJA 3EGVA 2QL9B 4RBUA 2CJXB 4OHXA 1SC1B 3D6MB 4HT5A 4B3TF 1NB2A 2XTJP 3CJ2A 2CPFA 3PM9A 4A8FA 3HHKA 2IMOA 4B9UA 2DHXA 4QIFA 1TVRB 2IA6A 3OLAA 3JXOA 1YRTA 3TAQA 3DNCA 4DDFA 3F41A 2WB1D 1CC8A 2KDOA 2ZJRQ 4X64J 3T41A 3N0VA 1RT6A 3CCMS 3E01A 2HVZA 1HBNA 3HDSA 4DV4F 2XNQA 1MMNA 4OLOA 1UVKA 3JSYA 4JYAF 4EZ9A 2MQPA 4KGXB 1OIAA 2VDIA 3I5AA 5J1EB 1XNRJ 4OZ0A 3HHNB 2YQ1A 4OHWA 3LP1A 1QE1B 4OZ5A 2DNPA 1M1KT 4J91A 1K73T 2EKNA 5KG0A 4DX7A 1T9YA 4PQAA 5C2GA 3N5FA 5CABA 2OMOA 3CXCR 3HCXA 1RTHB 2ADBA 3H98A 3G82B 4IFVA 1D9FA 1U09A 1QSLA 3JTOA 3Q8RB 1V6HA 2MPUA 3TZXA 3VAHA 3WC2A 3B54A 5A8RA 4H4MA 4CLKA 3W5YA 4OIXA 1UJ6A 5ETLA 4NPOA 2GMLA 3ZTOA 1T3OA 5DQGA 1VQ7S 5LOQA 2ATLA 4F4AA 2VA3A 1FRMA 3MM6B 2WSEC 4FDFA 3GMGA 4J9NA 4OYOA 3ZNUA 4LVNP 1DHMA 2FZKB 2RB7A 2YNIB 5CQGA 4C98A 1RE1B 2HZCA 4DL5A 2YXLA 3WZ0A 1N5TA 3T1AA 3J80U 3I4HX 3ZO7A 2BJ3A 1CG2A 1D0EA 3KLEB 4IRKA 1WTFA 2ERRA 1X60A 5LMNJ 1RT1A 1VBXA 2BR0A 3I5CA 1TU0B 1RT2A 4NXNF 4DZDA 4DLGA 3AY0A 1VQ9S 3KKFA 3D2WA 4OX6A 1MG7A 2GMHA 3CJ0A 2WOMB 2HK3A 3HT0A 2KO1A 1CJUB 3KYLA 1NLKL 4JI6J 4R8UB 2WVCA 3MEKA 1NEEA 4PRFA 4PPZA 2AYGA 4RX6A 1HWUA 1H7XA 1KLMA 3BBCA 4Q43A 1VC5A 2B51A 1UW9A 5ETNA 1JKHB 3AB2B 1XR7A 3R8YA 3NOGA 4B3OA 2R7UA 2HVHA 3SI8A 4RNNA 4BS2A 3BYRA 2W4PA 1BY9A 2ZC3A 3MHYA 3NWGA 1RP5A 4K59A 2H65B 3OR2A 1PYOB 4QIWD 5F9LA 2DKOB 5IS2A 1Y3KA 3DLEA 5C24A 1O0PA 4KAIA 5A2QU 1OY6A 1VRUB 4KHPF 1XEZA 4FPRA 4AXJA 5B0CA 4CLFA 1S6PA 3NMAA 4N5SA 3PXGa 2HQCA 1YK9A 1RHQB 4EMDA 4OYWA 1U1OA 2QLJB 3NGDA 1VFJA 4YB1P 5DG7A 2A2DA 4ZCLA 1GQEA 3AODA 2VB6A 4DR4J 3AJ2A 2AWZA 4Q0BB 3M2RA 4ZVOB 1RAGB 5KFHA 3W1YC 1FTCA 1VC6A 1CS4A 4RNMA 2W2PP 2F65A 4LSZB 4CT8A 2AV5A 4ZS6A 2HHSA 2CJQA 4PG6A 2K1RA 3R5JB 2YX7A 1URNA 3IRXA 3R7BB 3M7VA 2XY5A 3GCWP 4N7TA 4CRJA 2OP5A 3HVAA 2BYCA 1GH8A 2MSTA 4AUKA 4QYZJ 2FUG9 2BBEA 2RS8A 2ZFHA 4QIEA 2B9XA 4CM0A 1ZBTA 4ATNA 4KKOA 3H59A 4M5IA 1PJ7A 3HSDA 5HJYA 1FERA 4DV6F 2DH9A 4DR2F 2KYZA 1YWXA 2CQGA 2FYXA 3M8QA 4HL9A 2MJNA 2AGPA 4LBHA 1WKKA 2YKMA 4QPTA 2V8GA 4DUYJ 1W25A 4RKUC 4Y0FA 2C3YA 4K2JA 3NRBA 3FK4A 1VQ5S 4J9SA 4QWBA 3DXSX 3H2LA 1FRIA 3PIPQ 1BQMB 1JLGA 2H9ZA 1T9TA 4R0EA 5KFLA 2ZH3A 1LW2A 2NZ4A 2VJUA 4I2PA 5EGYA 3I82A 3IRWP 5HROB 1RSCA 1AT1B 3ETOA 4RWWA 4IUFA 4K4VA 3JQKA 5KFFA 1H3DA 4ED2A 1VJQA 2JH3A 3PDNA 3VVTA 1PKUA 4WIIA 4OHZA 1CJVB 4HEA9 3KHGA 1SBRA 2DGXA 4Q5VA 1UEKA 2JSXA 2ASJA 5LSLA 1WC4A 2GGPA 5F8IA 1RZMA 4PG8A 4TVAB 3NS6A 2YBVA 3WC0A 4NRTA 3FCVA 3PW2A 3M4XA 1D8ZA 2HEKA 1S1VA 2X51A 4NLDA 2R9LA 1NK4A 2B26A 2CQCA 2UUAF 3TANA 5A0YA 2JOQA 4QW8A 4FZVA 4RU2A 4HACA 3DM2B 3LTOA 1O51A 4K0KF 1RHRB 1AB8A 1LWCA 4P71A 1VGYA 2HHHJ 1YIJS 2QFJA 3NOCA 1HI1A 2RJZA 4ILMA 4X4SA 5I3PA 3LGMA 2JEGA 2VPWB 4AL7A 4GC7A 3QMQA 9ATCB 1NJZA 3IWNC 1SUQB 5EN1A 4V1Ak 4L73A 3C19A 5F41A 2WW4A 5D0RA 1HHQA 4RW4A 2IDEA 1KD1T 4QPXA 3I55S 2UXCF 4U96A 4YR3A 2NLWA 2VOPA 4Z7CA 1UW4A 5F3ZA 2VG5B 3E2EA 2GAHC 1HYSA 2UP1A 5DRKA 4H4KA 2R8KA 4ELUA 1U0SA 1YZ7A 5KFUA 3L4BC 4UOGA 3QZ8A 1AFIA 4ES1A 4DR5J 2NPIA 1Y3JA 4LR7A 2XYPB 1IBKJ 3H5UA 4FNHA 3DCAA 3KK3A 4F26A 1QVFR 3PRVA 3D4JA 2HNDA 5KFPA 1RYRA 1YSJA 5B0DA 4F2SA 3CTRA 2C1EB 3HHLD 4KSEB 2OPQB 4IYQA 2VKRA 2ROPA 1S9EB 4IO1A 3IGVA 1T94A 3PR4A 5ETTA 3DU5A 3I9ZA 4GO7X 2GJFA 1OPIA 3PNIA 3KMSA 4USKA 5HANA 3F44A 1CC7A 4K4SA 3JYTB 4O4RA 2J0XA 4P75A 3CJKA 3L7PA 2CNNB 4OYXA 2JEFA 4UOHA 4ZVTB 2V8VA 4DFJA 5BYQA 3M1VB 1REVA 2XS2A 4O3QA 2G2OA 2Q79A 3MM7B 3GWCA 4OYPA 4BC9A 3SCIE 4O4GA 1H72C 2AU0A 1PC5A 2QLFB 3W63A 1WEZA 5E41A 2EW9A 4WE1B 3CMES 1KDNA 2HLTA 1X4BA 1M90T 4BC7A 2RIJA 1UA0A 1R27B 1YBTA 2AJFE 3RR8A 2IJRA 2JL9A 4FKXA 2XS7A 1S12A 2DB1A 1A0OB 2RDDA 4CCHA 2YKQA 1BHNA 2MTLA 1T05A 2JC1A 1S7IA 2DXDA 4H4OA 3QSYB 5HJXA 4C8ZA 4ZDNA 2IVMA 4X66F 3M8WA 1NK9A 1TL3B 1DQAA 3R5BA 6FD1A 3H42A 4UUXA 3MMBB 3V6DB 3RYLA 1U6FA 3POTA 4PG7A 3KK2A 3FC9A 5F8LA 3T1YJ 2HFUA 3BBFA 3EDQB 3M32A 1P1LA 1S9GB 3BR9A 4L3KA 1XJWB 3CDWA 1NAQA 2ZC4A 1RT4B 3ET6A 1RAHB 3P4UB 1EHWA 1EZZB 4HLBA 3J7YI 2VF3A 4KPYA 2MKKA 3V4IB 3FBCA 4LF5J 4NLWA 3CCQS 2EKYA 1AROP 3BGRA 2CPZA 4Y6IA 3GFYA 2J6SA 3R27A 2KVQE 3DRPA 4ES2A 4C3MA 1SV5A 3OL8A 4CLZA 2YX1A 3S8SA 1K0TA 3HHLC 3CF5Q 4NCGB 4JI7F 4DFPA 1L3TA 3HVTA 1OMSA 1DTQA 4ED6A 2D3OR 3DI6A 4CZCA 4ZIWA 4OZ3A 3PVXA 1HBOA 5KFVA 2QLWA 1LFWA 1Y11A 2QGFB 2MKCA 2ZH2A 2MY7A 2L08A 2J9EA 1NZAA 3CJTA 4NI2B 4CTAB 1RA7A 5HLFA 2HFZA 3LF0A 2V6AA 1RQ0A 1XNQF 2BM0A 4N77A 4ZHRA 4CT9A 5EWGA 3EX7B 2BANB 3MM5B 2EG1A 3TVKA 2D3UA 3TVYA 4ANDA 1LFPA 3M2UB 1MMDA 1B0PA 2YKNB 1IBLF 2M7SA 1VBKA 2GFFA 1XQIA 2U1AA 4J9UE 4B3RF 3RB3A 2BRKA 4HDHA 4HI2A 5J2NA 3QIPB 3I5BA
chains in the Genus database with same CATH topology
3AGYA 2B26A 3AGZA 3TJ9A 3TJAA 2Q2GA 3L9ZA 1GMWD 1GMWA 1GMVA 1EB0A 3TJ8A 2QLDA 3LZ8A 4J80A 1C3GA 3I38A 3NXZA 3NY0A 3AGXA 1NLTA 1XAOA 1GMUA 4L3KA 1EARA 2HFVA 3LA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGY A;  2B26 A;  3AGZ A;  3TJ9 A;  3TJA A;  2Q2G A;  3L9Z A;  1GMW D;  1GMW A;  1GMV A;  1EB0 A;  3TJ8 A;  2QLD A;  3LZ8 A;  4J80 A;  1C3G A;  3I38 A;  3NXZ A;  3NY0 A;  3AGX A;  1NLT A;  1XAO A;  1GMU A;  4L3K A;  1EAR A;  2HFV A;  3LA0 A; 
#chains in the Genus database with same CATH topology
 2DJW A;  2AHO B;  4OZ1 A;  4X4R A;  4R0J A;  3VAG A;  4GKK F;  1TQL A;  4KH0 B;  2RQC A;  3J7A N;  1WF0 A;  1KQK A;  2YTC A;  1WC0 A;  3SFG A;  5ETS A;  1UPM B;  1S1T A;  2OPP B;  4QIV A;  1H73 A;  3KK1 A;  4ID8 A;  2W9C A;  2D3Z A;  1KQG B;  4J9L A;  1VQK S;  2AYM A;  4KH1 B;  3EVW A;  3IMQ J;  2FC9 A;  2KB2 A;  5G0R A;  1SJ3 P;  2R7T A;  2NUH A;  3BKU A;  4G65 A;  2EG2 A;  1V3R A;  3CED A;  2XMJ A;  1L5U A;  3KMQ A;  2HFN A;  5KFK A;  1U02 A;  4IH7 A;  4TNO A;  2XI3 A;  2NXC A;  2X1A A;  3DHW C;  3MGJ A;  4DV0 J;  4K50 A;  2OJ3 A;  2MZJ A;  4FXW A;  1SJQ A;  4YHH J;  4PQU A;  2JFD A;  3IBW A;  4PR6 A;  1FJ7 A;  4G1P A;  2RQM A;  5LXY A;  1NPP A;  4JI4 J;  2PII A;  3HZG A;  1NDC A;  2DIT A;  4C11 B;  4DI6 A;  4TKT A;  1TKZ B;  1PG5 B;  3PCO B;  3LAM A;  5HQL A;  2M9K A;  1IKV A;  4IO9 Q;  2VPZ B;  1F5A A;  5IFM A;  3NXZ A;  3I31 A;  2BJD A;  2PFD A;  4A4J A;  3AGY A;  1FNM A;  1FE4 A;  1FA0 A;  4ECZ A;  4LF4 F;  3IM8 A;  2MKJ A;  4CLY A;  3CE8 A;  1TKT A;  1JXL A;  2WW8 A;  3SCK E;  3UD5 A;  3BO4 A;  3AT1 B;  2ABY A;  2QA4 G;  3TZY A;  4WU3 A;  1Q8K A;  4UST A;  2YH1 A;  1HLW A;  4F4Z A;  1CUL A;  2DIS A;  4B3M F;  2WRM A;  1UAW A;  2H5J B;  1KON A;  2QLD A;  3UCU P;  4AE5 A;  4QU6 A;  1DAR A;  2HAI A;  5E5N A;  3HSG A;  1VQ4 S;  5LJ3 Y;  2WZ1 A;  4L6V 3;  5IV4 A;  2RF2 B;  4K8R A;  5LMU F;  5L46 A;  4FF4 A;  2D9O A;  4UW2 A;  1QTM A;  3VAF A;  4X4Q A;  4OX8 A;  1DFD A;  1HQU B;  3V4M A;  4LF9 F;  3OSN A;  5HI7 A;  3ILO A;  2EVZ A;  4RW9 B;  1FTR A;  2F9D A;  5SZT A;  4JV2 A;  1UFK A;  1U1M A;  3BF4 A;  3MTJ A;  1GXL A;  1EB0 A;  3SDE B;  2BJ8 A;  3VTI A;  4WTY A;  3DRX A;  5F8N A;  4CLL A;  4QYR A;  5IQQ A;  3OD2 A;  2C3O A;  1JIH A;  1YX2 A;  3RB4 A;  4F0K A;  1AZS A;  4IFV B;  3D1O A;  4J7C A;  2HS4 A;  1T02 A;  5KTQ A;  4OI2 A;  1WOR A;  1R8H A;  5A8R B;  1V5V A;  5FDL A;  1H2V Z;  4NLQ A;  4BLG A;  1FHT A;  1NKC A;  3M8P B;  3MTK A;  3I87 A;  1F2G A;  5ITH A;  3BN4 A;  4XDC A;  3W61 A;  4WFB Q;  3LAK A;  3B4M A;  3JQJ A;  3GG1 A;  2ZH4 A;  3H20 A;  2JZ5 A;  1U7L A;  1N32 J;  2HNY A;  4EUV A;  1UVJ A;  3CCU S;  2E29 A;  2K2P A;  3V81 A;  2QTW A;  3EDR B;  5IC4 B;  3W64 A;  5KAK A;  2JRS A;  4OYM A;  2EFO A;  4U8V A;  3D7S B;  2XUL A;  3OSP A;  2RKI A;  1NKE A;  3QJJ A;  1NK7 A;  1RHJ B;  3M9O B;  2AYB A;  1DJ0 A;  2C2R A;  4DU7 A;  4EEY A;  2HVE A;  3P49 B;  4U7U K;  4L72 B;  1UWB A;  2YWK A;  1RT2 B;  1FXL A;  5U47 A;  1S0O A;  2LMI A;  1S1X B;  2G9O A;  2NCK L;  2HHW A;  1J27 A;  1V5I B;  1GXT A;  1T9V A;  1NJW A;  1MLA A;  2CZV C;  3NLC A;  1JJ4 A;  1TMJ A;  1JJ2 R;  2Z2M A;  3HT3 A;  2ASY A;  2HWI A;  2YNH A;  2CQ1 A;  1F6T A;  1SKU B;  4NEZ A;  2YNG A;  5KFE A;  4I4B A;  1FT8 A;  3MMA A;  3FUY A;  1KLM B;  3MUV P;  2ZBP A;  2KRR A;  4RNH A;  1ZTT A;  2XMM A;  3TX0 A;  4A8M P;  1P8G A;  1LWF B;  1UKU A;  1RWU A;  4WIQ A;  3W65 A;  3RRG A;  3A8E A;  1GMW A;  4B3O B;  1CQM A;  4B9S A;  1MSW D;  3HSZ A;  3VAI A;  5E3P A;  4AQY J;  2HIY A;  2EFP A;  4S0M A;  4QOT A;  4OX9 F;  3NP5 A;  3DLE B;  5C24 B;  4LF8 F;  4WCE Q;  1FJC A;  2MKS A;  2J6U A;  3SFU A;  2NZC A;  4HI1 A;  2UU9 F;  1H74 A;  2P8I A;  2F7V A;  2BJ9 A;  4JYA J;  1X4E A;  4AYB D;  1UCN A;  2B7C B;  4OFZ A;  1N5Y B;  2XGP A;  4PWW A;  4ITS A;  1DLO A;  1NME B;  2OEM A;  5J2Q A;  3MZI A;  3K5P A;  1Y5I B;  1I94 J;  4DBQ A;  1TP7 A;  2RUG A;  8RUC A;  3M2R B;  2ZM6 F;  2DYA A;  4F02 A;  1J5O A;  3W2V A;  1CS4 B;  3R5D A;  3MDF A;  2J0S D;  1EIY B;  3T5H A;  4I2Q A;  5IXU A;  2K1R B;  1NUE A;  1KS2 A;  3MEG A;  2G4B A;  1VI7 A;  2GIQ A;  4X64 F;  4R5P A;  1K1S A;  1RTI A;  3MF5 A;  3PHE A;  4CM2 A;  4DPU A;  1Q95 G;  2H5I B;  2E5I A;  5HBM A;  1APS A;  3OVA A;  1EP4 A;  3IG1 A;  2DPJ A;  2XLI A;  3PKM A;  4ZP7 A;  1XNR F;  4IG3 A;  4KKO B;  1U2C A;  2EI5 A;  1ZS6 A;  3M8Y A;  3QFW A;  3ZZR A;  5HP1 A;  1QDU B;  2EK6 A;  3BSA A;  5ETV A;  3PFO A;  5DDR C;  2E5G A;  2UXD J;  3VAL A;  2IRX A;  5CHC B;  2E66 A;  4TN2 A;  4RUB A;  4ZP9 A;  4ZPW R;  1FXD A;  1W2B R;  4Y2M A;  3Q8V A;  3D6T B;  3ZFV A;  1WKL A;  2U2F A;  4X2B A;  2GS8 A;  5JVH Q;  2I5J A;  4N41 A;  4M8L A;  5B09 A;  4DSE A;  3V6H A;  1LW2 B;  2LQ9 A;  4I2P B;  1H38 A;  1QSS A;  4X4V A;  4URS A;  3AD9 C;  4P2M A;  1S6Q A;  4CO5 A;  1U49 A;  1JLA A;  3NGR A;  3DKD A;  2CAD A;  3C14 A;  3IR6 B;  3OR1 A;  1Q86 T;  4EK2 A;  2B9Y A;  4GVB A;  3DOL A;  5A6W A;  3K89 A;  3DLJ A;  3MCS A;  1PJ6 A;  2MZR A;  1RAE B;  2AW0 A;  2N7Y A;  3BPS P;  1DAX A;  4JI2 J;  2BDP A;  4FYX B;  2V4Q A;  5THW A;  4C3K A;  2P6S A;  2ZZM A;  2B5J A;  4DV7 J;  1N56 A;  2P9C A;  3TNV A;  5LJ5 Y;  3GP9 A;  3MMJ A;  1FD8 A;  5K14 B;  2FJW A;  1Z4U A;  4RW8 A;  3V2U C;  2JVR A;  3EXY A;  2OSQ A;  5GAG U;  5B7W A;  4QWE A;  3AA9 A;  3GPA A;  4WYW A;  2W7P A;  1RAJ A;  1OPZ A;  4ED3 A;  3TJA A;  2JVO A;  3P45 B;  4USU A;  1QY7 A;  2BQU A;  1O8B A;  5FJ4 A;  2XSJ B;  3N9U C;  2KZZ A;  1U0H B;  1LWC B;  3S1T A;  2CNO B;  2IAJ B;  3E51 A;  5IT9 Y;  2KJW A;  2W9B A;  1LNQ A;  1JLE A;  1RWN B;  5T7L A;  2G0C A;  3I6P A;  2IC3 A;  3LGH A;  4K4Z A;  2XB2 D;  5DDO C;  4PCQ A;  2YKO A;  4PEO A;  3QAE A;  3IA0 A;  5CYQ B;  4MJK A;  3RRH A;  4USH A;  2YWG A;  2A10 A;  4M5H A;  4CNZ A;  2FHM A;  5C25 A;  1HYS B;  2OPR A;  4DF4 A;  1SKW A;  2Z58 B;  1IKY B;  3DOK B;  4G1Q A;  2ZHA A;  2CPX A;  2DY9 A;  1XER A;  5DDP C;  2M0G B;  5I3U A;  2FD2 A;  2IM0 A;  5B0B A;  3R2D J;  2VG7 A;  1KTQ A;  4OHY A;  2GQQ A;  2MDA A;  3JSB A;  3Q8S B;  1WG4 A;  2EXU A;  4DV3 F;  4DV6 J;  4DR4 F;  4DR2 J;  1WEX A;  2VAS A;  4LIR A;  2PMH A;  2PN6 A;  1C1B A;  3ZZO A;  1RU2 A;  1RAF B;  1B3T A;  3B8H A;  4G1I A;  4LSL A;  1R7I A;  1X4H A;  1U1K A;  3THT A;  3UVJ B;  4RJV A;  2FY8 A;  1HWK A;  1REG X;  1NHU A;  1YG0 A;  3KLH B;  3C6U A;  1KP6 A;  4C8N A;  5F0W A;  2COL A;  4RBT A;  2PEB A;  5A8W B;  1RWO B;  3CJK B;  4LJM A;  2DGT A;  1UA1 A;  1HMV A;  2M88 A;  5A76 A;  2BOA A;  2HGN A;  3SQG A;  2XQC A;  1IR0 A;  1REV B;  4NOH A;  4NMX A;  1SL2 A;  7AT1 B;  1ELO A;  1Z2L A;  2LXF A;  4ZOS A;  5M2R A;  2MSS A;  2OEK A;  4LT6 A;  3OL9 A;  1X4A A;  2MQO A;  5F8G A;  3FMB A;  5HO4 A;  5DG8 A;  3GV7 B;  2YQ0 A;  3JSM A;  3KNG A;  1RT7 A;  4LRF A;  2H48 B;  4B02 A;  2AD9 A;  4P73 A;  2B4U A;  2AX0 A;  4ZVU B;  3W2W B;  3OFF A;  3H5S A;  1JMT A;  4X4P A;  2CPH A;  2UUA J;  1N5S A;  3HF5 A;  5BJR A;  2C2E A;  2I38 A;  2QE5 A;  3T5K A;  3R6L B;  4H4O B;  2LEP A;  1NHK L;  2M52 A;  3CO9 A;  1CPZ A;  1HAR A;  4HR2 A;  2HBY B;  4K0K J;  7FDR A;  2F4V J;  3MCM A;  1P9Y A;  3R7S B;  1X5P A;  1IJF B;  3MR6 A;  1LWE A;  3Q8U A;  4DHV A;  1XMQ J;  4C9D A;  2N3L A;  4TY9 A;  3IS9 B;  5B0G A;  4IR9 A;  3GV5 B;  5IT9 U;  3KUE A;  3UCZ P;  2JHE A;  4OV6 A;  3M32 B;  3CJR A;  4C97 A;  3MMC B;  1H2T Z;  4B08 A;  5BXI A;  1IQT A;  2IM2 A;  2C3M A;  2DCL A;  4PAA A;  2I6W A;  2DIU A;  3CCE S;  4TY8 B;  2XCP A;  2VPY B;  3O5T B;  2ZUG A;  2GV1 A;  1N36 J;  1WC1 A;  2XBP A;  3KG0 A;  3OTB A;  3BGR B;  2ZNY A;  5I3Q A;  2DEJ A;  1RAB B;  4DCJ B;  3DRP B;  2D41 A;  3BS9 A;  1SV5 B;  1NRK A;  3MEE A;  2E7V A;  3PRD A;  5D78 A;  2F4F A;  3V6K A;  3TQE A;  2CFX A;  3NBP B;  1RCO B;  4EO6 A;  1UVM A;  5AJ3 J;  4DQR A;  4URG A;  5DQH A;  1VR6 A;  2QYC A;  1UL3 A;  5BYS A;  3HP6 A;  4UOC A;  4N76 A;  1N33 J;  1NSP A;  1S77 D;  5HLF B;  2GVD B;  2MQL A;  2XY6 A;  2QT7 A;  2IPO B;  3HFK A;  4ED1 A;  1OSC A;  3CJQ A;  2PO4 A;  2AX1 A;  3GFX A;  5AE1 A;  3MEC A;  1T11 A;  1WDT A;  3Q89 A;  3MXH P;  4WKR A;  4O44 B;  2W4D A;  3IGN A;  1FDA A;  3HK2 A;  3T6B A;  1C1C A;  3BDE A;  2RSQ A;  2VIH A;  3G96 A;  4HVZ A;  1SH2 A;  1VHF A;  1A7G E;  1URR A;  2XWX A;  2ZVI A;  2CJK A;  3QO9 A;  3ISZ A;  2HQD A;  1YRX A;  3MAA A;  1OQ6 A;  3DGV A;  4CYU A;  1D9D A;  3O44 A;  2BOP A;  3OUY A;  2CIM A;  1SQF A;  1YJ7 A;  1ZA1 B;  3HFV A;  2J8S A;  4WFZ A;  1LW0 A;  4J37 A;  2FHJ D;  3K2Y A;  5KG3 A;  3OFG A;  5KT6 A;  4YR2 A;  1AA1 B;  2CRL A;  4MIW A;  4DQI A;  2QC3 A;  1SIZ A;  3CT9 A;  3UE2 A;  5G0R B;  2XYH B;  3H0P A;  1R8C A;  3CJ8 A;  1KRP A;  5T14 A;  3DMJ B;  4OL8 A;  1HBU B;  3ICL A;  2V8P A;  1WF1 A;  4PAB A;  3H4B A;  2CPD A;  2JFK A;  4E0D A;  1FVS A;  3BM7 A;  2DVI A;  3BGF A;  2ZKT A;  4FXV A;  2F8E X;  3GCX P;  3H5X A;  4TU7 A;  4A8S A;  2Q43 A;  4C2M A;  1N88 A;  5JMN A;  1FKO B;  2OIH A;  2XMT A;  1T9W A;  4C8K A;  1UEV A;  2V69 A;  1IKV B;  3MPU B;  5KFT A;  1VQM S;  4ID5 A;  3UDV A;  3M6V A;  3RBE A;  1ACM B;  1S0N A;  1FRH A;  3UDL A;  1SI9 A;  1HW8 A;  3S7R A;  2K7K A;  4I1T A;  3RBX A;  2E9Z A;  2MYF A;  1VRT A;  5JVG Q;  2RQ4 A;  4KFB B;  2W8K A;  1IWA A;  3PYG A;  2B4O A;  3JAM Y;  1ZET A;  5HK4 A;  4PUO B;  3P5B P;  3AGZ A;  1N5V A;  4OYB A;  2O01 C;  3QRP A;  1L3V A;  1IKW A;  5D15 A;  4O3P A;  1CUL B;  3CSK A;  4JI7 J;  3BPD A;  4M5L A;  1YRU A;  3W5Z A;  3LAN A;  3M2V B;  4M5M A;  2DNN A;  3R1L A;  4JI0 F;  2DNG A;  3D68 A;  1Q5V A;  2ZDP A;  3D28 A;  3GFZ A;  3A8J A;  2FTR A;  4TLQ A;  2CVE A;  4DL4 A;  2KXF A;  2Y1I A;  3OJU A;  5LM7 E;  1R43 A;  1ZPW X;  2V34 A;  1NSK L;  4MKV A;  1SJ4 P;  3I0R A;  2XM3 A;  3I32 A;  1GX6 A;  4LSN B;  1HNI A;  2FDN A;  3QPI A;  2FGO A;  1Q8B A;  3HHL B;  2I0X A;  1OSD A;  3KDN A;  2XMW A;  2VFS A;  3OJS A;  3HHD A;  4GO5 X;  3QYY A;  3VF0 B;  4X4T A;  4Q8E A;  2HMI A;  4IDK A;  5D3G B;  1AZS B;  1G3O A;  2KT2 A;  4EYH B;  1R3N A;  4WFX A;  3G8S A;  1IM6 A;  1B70 B;  1N8R T;  1E6Y A;  3OXF A;  1S1U A;  2CA9 A;  4GKJ F;  4OZL A;  1NKB A;  3KLV A;  2Q6B A;  3BQ1 A;  4ZKA A;  1JLC A;  4ED8 A;  1WOO A;  3ILJ A;  4JUZ A;  2BXJ A;  3FEX B;  5GAE U;  4PXB A;  3Q8Q B;  1SH0 A;  2AT1 B;  3CO0 P;  2FB0 A;  5EWF A;  4EZ6 A;  2VBZ A;  2VG6 B;  1RBO B;  4IKA A;  3C6T B;  2J5A A;  2MB0 B;  3UDE A;  2HHP A;  4K4W A;  3A8K A;  2Q3P A;  3ELH A;  4CLS A;  2RKI B;  3FNN A;  3MM8 B;  3O3L A;  2ZOF A;  2VIC A;  5ETR A;  2Z0G A;  1HNV B;  1LWX A;  1PO6 A;  3TEG A;  2ODX A;  3C16 B;  1Q82 T;  2MLZ A;  2L9W A;  5J2P A;  2PSZ A;  2V94 A;  3G2X A;  3EIC A;  2APO A;  1AUS L;  2J7K A;  1MWZ A;  4M5D A;  1YQH A;  1X0F A;  2ZH8 A;  5AXK A;  2HFO A;  2CQI A;  1UFW A;  4RW7 A;  3SV3 A;  2W1B A;  3UR3 C;  1D3W A;  2L41 A;  1FRX A;  1U26 A;  2RD5 C;  5E0O A;  5LXR A;  4LF4 J;  1U6Z A;  3BO3 A;  1QM9 A;  1R0A A;  2B4P A;  2LEA A;  2ZBQ A;  2KXH A;  4DV0 F;  2MQ8 A;  1VQL S;  4FYY B;  1FJG F;  2LXU A;  1S76 D;  2YWE A;  1P27 B;  1DQ9 A;  4YHH F;  2JEI A;  1HBM A;  3FFI A;  2V63 A;  1Y10 A;  2BW2 A;  4MFB A;  1NH7 A;  4JI4 F;  5KT7 A;  4U67 Q;  4ECT A;  1BC6 A;  4B9M A;  1FE0 A;  3T19 A;  2DHH A;  5CD4 H;  2BX6 A;  2Y0S D;  1TL1 B;  3MUR P;  2I2Y A;  3PTW A;  1NU4 A;  2XSF A;  4JV0 A;  3EM1 A;  2VFT A;  4LF9 J;  1UVN A;  2BKP A;  5JJB A;  2AEJ A;  5GME A;  2KT3 A;  3IR5 B;  2HS3 A;  1DLO B;  4DN0 A;  3VQT A;  5J2Q B;  3VGU A;  1QAJ A;  2J7W A;  1QUP A;  2VOO A;  2DR6 A;  2JWN A;  1TKX B;  2X3G A;  1FRL A;  1J5O B;  4RW6 A;  3EZU A;  4ERD A;  2JVM A;  4NYZ A;  1WI8 A;  3LA0 A;  1F2H A;  3BH7 B;  3ITH A;  2QYG A;  2HQ3 A;  1U1N A;  1RTZ A;  1U48 A;  1IKX A;  3O6Q A;  4GRS A;  4J9Q A;  1IBC B;  3PEJ A;  2FJX A;  3MEG B;  3LO3 A;  3TX8 A;  3BH6 B;  2O67 A;  4PWD B;  4N8O A;  4R5P B;  3CCT A;  4CH1 A;  4WFY A;  2F9J A;  3PRB A;  3DOM B;  4M1K A;  5HBM B;  2O3D A;  3G86 A;  4JI1 J;  2OD6 A;  4ZCI A;  2Y8W A;  1GFW B;  3CC2 S;  4LR8 A;  4FVM A;  1SVD A;  3JB9 k;  3TUP A;  1VIS A;  2P5V A;  4ZVR B;  2P2C B;  4ZMM A;  3DRR A;  2WK4 A;  4MYT A;  3DYA B;  3Q22 A;  3ULH A;  4FVC A;  2GO9 A;  2N82 B;  3SSQ A;  2CJ9 A;  4NLO A;  3QJL A;  2LVW A;  1W26 A;  2R2T A;  4HT7 A;  3D3C J;  3P96 A;  3IFE A;  1VJW A;  1C0T B;  1KSP A;  4M5G A;  2PT0 A;  3BDP A;  4WZM A;  4RPF A;  4XPC A;  3LAL A;  4ZPA A;  2E5J A;  1T9U A;  1L3U A;  3SCL E;  2I5J B;  3DRY A;  4KB7 A;  2RML A;  4PWU A;  1T03 A;  2IVF B;  3OTD A;  2KH9 A;  2UZA A;  3A1Y G;  1VS3 A;  2KJV A;  4ZVP B;  1BXN A;  2QO3 A;  2I9S A;  3QAT A;  5HL7 Q;  1JLA B;  1WSV A;  3CJ3 A;  1N34 J;  2V8D A;  2H1Y A;  3C14 B;  4ANC A;  1WHV A;  2R2R A;  2QA2 A;  4YOE A;  2WON A;  1N32 F;  1KOH A;  3KJQ B;  4EU0 A;  2DNH A;  2GVZ B;  4U7C A;  2PA3 A;  4MK8 A;  1RBA A;  5HVF A;  4CH0 S;  3MAH A;  1E6V B;  1MWQ A;  2QMX A;  3LP2 A;  3PJW A;  2DBB A;  2B5J B;  1EKS A;  4UQT A;  4YB5 A;  4ECV A;  1HW9 A;  1RLC L;  5ETO A;  3L7O A;  2HHV A;  3OXG A;  3B82 A;  1C3G A;  5I42 B;  4DL2 A;  2E5L F;  1LV5 A;  3C15 A;  2HQI A;  4RW8 B;  2SXL A;  2R8H A;  1BWV A;  4AL6 A;  2ATC B;  3EGN A;  1R8B A;  2W7O A;  4KHM A;  3SXL A;  3FSI A;  4P9S A;  4C8L A;  4I7F A;  2R7W A;  2NXN A;  2J76 E;  3N5B A;  2OTJ S;  2UU9 J;  4UTG A;  5HN0 A;  3TAM B;  3R97 A;  1ZH5 A;  3HPO A;  2W9B B;  1FJE B;  2MZ1 A;  2ZNZ A;  3Q8P B;  2IC3 B;  2W2Q P;  1NXI A;  3G8Q A;  3HD2 A;  2ZM6 J;  1T7P A;  3GIL A;  1KHV A;  3M05 A;  3CWJ A;  2HBQ B;  4ZPC A;  3PX0 A;  2CNK B;  5AE2 A;  2R8I A;  3AXM A;  4DS4 A;  3DLH A;  4QJV A;  1FWL A;  1TVR A;  2HHT A;  4AQY F;  1I6J A;  2H4W B;  3DDI A;  1IXK A;  1JB0 C;  2Y8Y A;  2VQE J;  3BB5 A;  1ZM3 A;  3CCL S;  4DX8 H;  4A47 A;  3EZ5 A;  4JV1 A;  4G1Q B;  1B0V A;  3G87 A;  3GU0 A;  1S9F A;  1B7Y B;  2X1F A;  5J1E A;  1FKA F;  1TUW A;  2R4F A;  3M8Z A;  1QE1 A;  3HI9 A;  3VAM A;  5IOL A;  4DUZ J;  4MMO A;  1I94 F;  4NCA A;  1GAO A;  3AXK A;  3MPY A;  4DR6 J;  1RUS A;  1RWP B;  2DNK A;  4WWS A;  1LOU A;  3KWM A;  1IBM F;  1B7F A;  2GO8 A;  3MPV A;  1KHW A;  8ATC B;  2LP4 A;  2B8P A;  2PE8 A;  1NK0 A;  4OLP A;  2EC2 A;  3SCJ E;  4F50 A;  3T5L A;  2LQJ A;  3FCH A;  1F5C A;  1DTT A;  5HVH A;  5J2M B;  1VQY A;  3I9V 9;  3KLF A;  3W60 A;  2DIV A;  2NXJ A;  2XO6 A;  5CYJ A;  3CMA S;  4A8W A;  1FNX H;  3A3P B;  2BE9 B;  2V50 A;  3KLG B;  2DHA A;  5KT2 A;  3WIV A;  1FDB A;  3SQG B;  2NYI A;  2KHD A;  5L1L A;  4J90 A;  3UN2 A;  4WU2 A;  2WVE A;  4ANE A;  4J9V A;  2BKN A;  2YNI A;  2XYG B;  2GAG C;  1TKD A;  4CP5 A;  2UXD F;  2W7A A;  2KG1 A;  3UFC X;  2ZJP Q;  1RT7 B;  2JEJ A;  2YKP A;  1S1W B;  2VQF J;  2OPS B;  5F3T A;  2P9G A;  2BA9 A;  1CJK A;  3KLE A;  4IG0 B;  4Q45 A;  5IM0 B;  4HTJ A;  5DZ7 A;  5F8H A;  1YBU A;  3I0S B;  2KVI A;  3TAP A;  1WG5 A;  2ZWO A;  5KG6 A;  4C8M A;  1WJ9 A;  2V4J B;  1EET B;  2YNF B;  1U6B A;  2WOM A;  3OFE A;  3H2U B;  2HHQ A;  3SIP B;  1CJU A;  1KQS R;  3UNY A;  4NAS A;  4ED4 A;  4R8U A;  1BQX A;  2BKO A;  2K7J A;  1LWE B;  1Y7P A;  4Y2C A;  4RU9 A;  4F4K A;  4EBE A;  3H40 A;  5KG7 A;  4CDI A;  1SKS A;  1JKH A;  1KQF B;  2HRT A;  4JI2 F;  1R8P A;  1PSD A;  2OTL S;  4WK1 A;  2KFN A;  4ZVG A;  2CDR B;  1VQ6 S;  3FDS A;  1FK9 B;  4DL7 A;  3IBF B;  3WDO A;  6AT1 B;  4DV7 F;  3AKO B;  4QQB A;  3W7B A;  2FZG B;  3AFG A;  2HKE A;  2MEW A;  4WFN Q;  1VRU A;  4ZIV A;  1JLF A;  2NUU G;  2ZZT A;  3DU6 A;  1FKP B;  3GYN A;  3MEE B;  4DR1 J;  2VHG A;  3BKF A;  1S97 A;  4F2R A;  1X7V A;  4H4K C;  2XG8 A;  4GVL A;  3ZXW A;  3GSD A;  2OD4 A;  3LPE A;  3IAM 9;  2GHV C;  3MFI A;  1RT5 B;  4DV3 J;  5KFX A;  2V2Q A;  1SC6 A;  4K4U A;  1BQN A;  3IP0 A;  4C0H A;  1X4D A;  1T3N A;  1VBY A;  1KBR A;  1XAO A;  3US5 A;  1IVZ A;  1HHS A;  4ECQ A;  3K17 A;  3BEG B;  1D9A A;  2QV6 A;  3MPD A;  4J5O A;  1LQ9 A;  3FQL A;  3N6L A;  4YY3 F;  3KG4 A;  1RWK B;  2YPZ A;  4HHJ A;  2VFU A;  5A6P A;  2IJF A;  2MQM A;  1C1C B;  4WBF A;  5AXN A;  3PHT A;  1F3V A;  2DTJ A;  2WVB A;  1QVG R;  2GQ2 A;  4HKQ A;  2MKI A;  2NSB A;  1VC0 A;  2BM1 A;  1OO0 B;  3FBE A;  5K8M A;  4JI8 J;  1RAA B;  1UJ5 A;  3CCJ S;  4ECU A;  3M9M B;  4PYA A;  3GJR B;  3OUY B;  2BJE A;  2OFG X;  2J7U A;  5HMY A;  1N6Q B;  4J9O A;  2DR7 A;  2CPY A;  3VGV A;  1NDK A;  1PBA A;  4LRB A;  5H9E K;  2AJ4 A;  2PMZ D;  2NPF A;  4I0W A;  5DM7 Q;  2RHS B;  3AOC A;  4X84 A;  4P10 A;  1BQM A;  3GG0 A;  4QCL A;  4V19 J;  2BQR A;  1S72 S;  5CXT A;  4ICL B;  1KVJ A;  4I56 A;  5DDQ C;  1WSR A;  1JLQ A;  4OZJ A;  2FPH X;  2M5Y A;  1KFS A;  4WTO B;  1X5T A;  3M8R A;  4RR5 A;  1DZ5 A;  4QR1 A;  5HRO A;  4X4U A;  4ZIT A;  1H2U X;  1FI4 A;  4ZLP A;  1U45 A;  1ZOT A;  3A3N B;  1C0U B;  1H6K X;  2CPI A;  2LQB A;  2Q66 A;  2FVR A;  2ZBC A;  3P6Y C;  2LKZ A;  2HVI A;  1HQE B;  2ZH1 A;  3ADA C;  2C3U A;  2V9W A;  2UV8 A;  2XMV A;  1CJV A;  4LVO P;  1MWY A;  4OJ3 A;  4NLX A;  1YJU A;  1QSY A;  2HVD A;  5ADZ A;  1BGX T;  4A8O A;  4XPE A;  1U25 A;  2ZVS A;  1TR0 A;  3FZ2 A;  2Z2L A;  3DRS B;  4C3L A;  2EFN A;  2CQ4 A;  4C8O A;  1TTH B;  1L3K A;  4ECX A;  4K4T A;  2FJD B;  4ID5 B;  4KGK A;  5KG4 A;  1HNZ J;  2WSF C;  2AJ2 A;  1ZAV A;  2FJA B;  4YME A;  3I56 S;  4KQZ A;  4FKY A;  2HK2 A;  2CQ3 A;  5KG5 A;  1VRT B;  1RAI B;  2AYE A;  5DLG A;  2H5E A;  3DM2 A;  3PW7 A;  1SJF A;  3AQO A;  2UVU A;  1IR1 A;  2FVQ A;  1IQZ A;  5KFZ A;  2HS0 A;  1HPZ A;  2YVS A;  1JLB A;  2HLU A;  3ILL A;  2F4V F;  3RW7 A;  3CD7 A;  2JDJ A;  3L09 A;  1GTH A;  2PGC A;  4U7U D;  1XMQ F;  1B0T A;  5GAD U;  1HWL A;  3LZ8 A;  4CLT A;  1LK7 A;  4X65 J;  4H54 A;  1SUQ A;  2G0I A;  2ALZ A;  1PIE A;  3CCW A;  2J6T A;  3GYX B;  1ZZN A;  1NZ8 A;  2DH8 A;  1OYD A;  2E44 A;  1R6V A;  3NY0 A;  4CI0 B;  3KXD A;  3I0R B;  1F3F A;  2WSC C;  1N36 F;  1HNI B;  2A1B A;  3IBC B;  2ILY A;  3Q8Y A;  4RO0 A;  2ROE A;  3QT6 A;  1FXR A;  2F63 A;  3BGO P;  3EVM A;  4QIG A;  4B17 A;  2DRA A;  4CWB A;  2LA6 A;  4QU7 A;  5CA5 A;  3I38 A;  1PJ5 A;  2FLO A;  2KN4 A;  2CPJ A;  5KFO A;  5AJ3 F;  3EXC X;  1E6Y B;  2R2U A;  2XMA A;  1NJI T;  2WTF A;  3SV4 A;  3RR7 A;  1S1U B;  2OPQ A;  1N33 F;  3GTY X;  5KT3 A;  3IXQ A;  3J7Z T;  4QZV B;  1JLC B;  3NAH A;  4NLU A;  4ECW A;  5EWE A;  4F3Q A;  4ECR A;  1Y9O A;  3R3T A;  1UVI A;  2LDI A;  3EJM A;  2QL5 B;  2C28 A;  1T95 A;  2ZJQ Q;  3TO8 A;  4WFA Q;  1VQP S;  3JYT A;  4Y2A A;  3S6E A;  3HLU A;  5FLX Y;  3J81 Y;  1YVF A;  3BYP A;  4NLS A;  4K4X A;  1DBD A;  5K8N A;  2AJ1 A;  4ZLJ A;  3LUY A;  4ETX A;  1V9O A;  1IWG A;  2QSW A;  2B6A B;  3DLG A;  1K8A T;  2EC0 A;  4YDX A;  4FNI A;  4DPY A;  3DN9 A;  3MD3 A;  1UZH A;  1RGV A;  3CJ4 A;  3MM7 A;  1O5J A;  2KU7 A;  2HPU A;  2C3P A;  5EX0 A;  4PYD A;  1G6B A;  2CQP A;  2ZD1 A;  2E9T A;  1S57 A;  4NA3 A;  1M1G A;  4WE1 A;  1NND A;  5CYM B;  1K44 A;  1ZZF A;  4RW7 B;  2V9K A;  2R7X A;  3GIK A;  1VIX A;  4OI1 A;  2IA0 A;  1PGZ A;  3DLK B;  2IM1 A;  4DL0 C;  4Y2I A;  4ECY A;  2CQB A;  3THP A;  1RIS A;  1R0A B;  5K8O A;  1TV6 A;  2J0Q D;  2ZH9 A;  3J7Z 5;  1R0C B;  4ENO A;  2C2K B;  2OFH X;  3M6X A;  2NXU A;  3LP0 B;  5D4P A;  2ASD A;  1HBM B;  2DD8 S;  2Q1L A;  3FFI B;  3OHA A;  4DS5 A;  3MMB A;  4J9K A;  3V6D A;  3FGV A;  2AJ0 A;  3QLH A;  4ZVQ B;  2OLW A;  4G3I A;  3T6J A;  4NLV A;  4JI0 J;  4YQW A;  4LF7 J;  4JBC A;  3TA2 A;  3MPW A;  1RT4 A;  3ISN D;  1M5S A;  1Q0N A;  3RU0 A;  2RU3 A;  2QMW A;  2A2C A;  3K8W A;  2UUC J;  2QX0 A;  1GMW D;  1TL7 A;  3UNG C;  3PEH A;  3V4I A;  2V5H G;  1BD6 A;  3C66 A;  2W9A A;  1S0V A;  4YB7 A;  3QGG A;  3CMQ A;  1A9N B;  3SYZ A;  2DO0 A;  5E3Q A;  3QRR A;  2FLL A;  4UOF A;  2OKQ A;  3RG6 A;  4AT1 B;  4NCG A;  3ITH B;  1U47 A;  2BUN A;  5JXS A;  1S0M A;  2ZOG A;  2G2Y A;  5L38 A;  4TQR A;  4LQ9 A;  2VUG A;  3KLI B;  4Y28 C;  4XDD A;  3C46 A;  4ED0 A;  3QWP A;  3VGS A;  2FVC A;  3U1L A;  1UTA A;  3EWG A;  1HI8 A;  4CTA A;  5LSR A;  4GKJ J;  1NJY A;  1NB7 A;  4UQG A;  2GMJ A;  4K4Y A;  4Z7Y A;  2BAN A;  3MM5 A;  3BRE A;  5CZV A;  5A8K A;  1GNK A;  3M2U A;  1QUV A;  4M95 A;  4OYI A;  3HHE A;  4HTI A;  4EYI B;  2YKN A;  4WJB A;  1Q53 A;  3GIR A;  5I4M A;  4RWX A;  3HJF A;  4DOZ A;  5DJB A;  4QWD A;  1N0V C;  3IWX A;  3TZZ A;  4ZPD A;  4Z2X A;  1R0B G;  3ENQ A;  2DGS A;  4WK3 A;  1PAU B;  3MED B;  2ZIT A;  4TLR A;  3BN7 A;  4DQQ A;  4L75 A;  2IM3 A;  1H0H B;  1NPR A;  2OPP A;  2RDJ A;  4LRD A;  2DH7 A;  3JQM A;  1FWK A;  2F8M A;  4XO0 A;  1HWJ A;  1FFS B;  4AXI A;  4DV2 F;  3X3U A;  2VL1 A;  5BR8 F;  3RBD A;  2LU2 A;  1VQS A;  3K57 A;  1XIQ A;  1Q7L B;  3G8T A;  2PI4 A;  2DXF A;  3WIU A;  2CKW A;  5GAH I;  1UET A;  3GE9 A;  4DSI A;  4OX7 A;  2LDY A;  1YHQ S;  3CD0 A;  4KBI A;  1QAY A;  1EQ0 A;  2BAB A;  3PJX A;  3HO1 A;  2N3O A;  3BSO A;  2Y1L B;  4J9R A;  3Q0A A;  3LP2 B;  3TQ1 A;  1FJG J;  3UPF A;  3ISN C;  4DPX A;  4ZVF A;  3T9N A;  2W2O P;  2WCX A;  3TEH B;  2VBY A;  4F4Y A;  1FEE A;  2ACM A;  1YDL A;  5GAH U;  2OEL A;  1TKZ A;  3D3B J;  2A3J A;  2L3M A;  1JXV A;  2X1B A;  2IYG A;  2OEJ A;  2HIQ A;  3GYG A;  3LOU A;  3ENV A;  3N6N A;  4OI4 A;  5E7O B;  5H9F K;  2LXI A;  3DGP B;  1RAC B;  3JSR A;  3NGS A;  1B99 A;  1YLX A;  3OL6 A;  2R7V A;  4NXM F;  3GIM A;  3W8G A;  1HNW F;  2I1R A;  4OYA A;  2RRB A;  2DR8 A;  4P2S A;  4WKY A;  2DR5 A;  4A46 A;  1U24 A;  2GQC A;  5A2Q Y;  2DNM A;  3VVU A;  4O3S A;  3HM9 A;  1CEZ A;  4DV1 F;  3FKB A;  3OTE A;  4OI0 A;  3OFH A;  2KM8 B;  4DF8 A;  2GX8 A;  2RF2 A;  1GX5 A;  2FJV A;  2FVS A;  4F25 A;  1Q4R A;  1HFE L;  3D6F B;  1RT6 B;  3E01 B;  1WI6 A;  1HBN B;  3T1H F;  4OMF G;  1HQU A;  2D69 A;  3NNC A;  3IN5 A;  4WZQ A;  2FHK A;  3H7H B;  2ASL A;  4RW9 A;  4CLP A;  4UT4 A;  3R5C A;  3K5M A;  1XN9 A;  2M4M A;  3AQP A;  3LP1 B;  3OVS A;  1VLO A;  2RQK A;  3QGH A;  3GLJ A;  1PYS B;  1U8W A;  3TA0 A;  3SDE A;  1P6T A;  3TJ8 A;  1SL0 A;  3OTO J;  4F36 A;  1R89 A;  1EAR A;  3ZZ0 A;  2M2B A;  3DXB A;  4F8R A;  1T0T V;  4MKY A;  3FEZ A;  4F67 A;  1U2R A;  3K5N A;  1FFG B;  3HZE A;  1WHY A;  4F4X A;  3EPI A;  1DTT B;  1DRZ A;  4YDD B;  5F9N A;  3M8P A;  4H4M B;  4LF2 A;  3KLF B;  4Y3C A;  2DHG A;  2ZBI A;  1XR5 A;  4W4M A;  4NLP A;  4JI1 F;  2ADC A;  4JI5 F;  3R5A A;  2HW3 A;  5KG2 A;  1EKR A;  3AJ1 A;  2KXN B;  1NHV A;  3VV2 B;  4YEA A;  4DG1 A;  4BBY A;  2ZBR A;  3MFH A;  1MML A;  4M5K A;  1VQN S;  2WVD A;  1ZM4 A;  4OI3 A;  4DMZ A;  2VC0 A;  2Q2G A;  4NLR A;  5CAA A;  1BWE A;  2HRY A;  3OVB A;  3Q2T C;  3RTV A;  1CJK B;  3BKT A;  1X9W A;  2H51 B;  2E5L J;  4OZ2 A;  2CG4 A;  2E7X A;  3W66 A;  1RT1 B;  1S1X A;  3A13 A;  2AZ3 A;  2W8L A;  3IO1 A;  4TU9 A;  2KHC A;  2CUY A;  4IOA Q;  1KTV A;  2R7R A;  3KFW X;  1NCL A;  3DLL Q;  2HZA A;  3PYE A;  1N34 F;  1UEU A;  3PW5 A;  1CLF A;  3I96 A;  4LFB F;  3DDN A;  1RWV B;  4O3O A;  2O66 A;  4UY8 T;  4ZN1 A;  2AEM A;  3SSS A;  1MN9 A;  4F7V A;  3RAM A;  1NJX A;  2X7I A;  2LEB A;  4CQ1 A;  4F4W A;  3OTC A;  1LWF A;  1MN7 A;  2CJY B;  4PG5 A;  3ZNJ 1;  3MCN A;  4DV5 J;  5KFR A;  4AL5 A;  2F1F A;  1XBW A;  4M63 A;  1GT8 A;  1F5B A;  3NWR A;  1AFJ A;  1V3Z A;  4DFM A;  2E1M C;  3SEO A;  1RT3 A;  5HVG A;  3BJY A;  4U6P A;  2GW8 A;  2D1C A;  3VZH A;  3NMR A;  4ZN3 A;  1NPK A;  2HQG A;  3OR2 B;  2GA7 A;  2DRB A;  2YY3 A;  1MNE A;  1NDP A;  3QT8 A;  1NK5 A;  3PYD A;  4NZ6 A;  5E3C A;  1VQ8 S;  1KN6 A;  1JLF B;  3QT7 A;  1Y5N B;  1XR6 A;  1S6P B;  1YZ6 A;  2RAQ A;  1PYT A;  1N5Y A;  4LQ3 A;  4E8U A;  1HD0 A;  2IHR 1;  1ZYQ A;  1QAI A;  3HVW A;  5L9N A;  2O5D A;  3R5G A;  3QWU A;  4NL5 A;  3R1H A;  5T41 A;  4AFF A;  1BQN B;  2J0W A;  1LXJ A;  2RHQ B;  3ZC4 A;  1C4C A;  2XLK A;  3PW4 A;  2NS1 B;  3DHX A;  1HI0 P;  4ZVE A;  2FJB B;  1U4B A;  1RWW B;  3GQC A;  4C4W A;  3UDC A;  1IBM J;  1YI2 S;  5M2P A;  3PFE A;  4MIA A;  3GR1 A;  1JK9 B;  2YWW A;  3S01 A;  2MZT A;  4UY8 5;  3LW5 C;  4CH7 A;  2YQ3 A;  2DCU B;  4JI3 J;  4CO0 A;  2YWF A;  1HR0 F;  2DK2 A;  1SXL A;  4CNY A;  1B4S A;  3TR5 A;  3IRX B;  2VQE F;  1XTZ A;  4C0B A;  1W2I A;  1VMB A;  4KO0 A;  3HFZ B;  2AF6 A;  1NK8 A;  2X1G A;  3KOA A;  3ENA A;  4RNO A;  2HYI B;  3A4T A;  1S6U A;  4UUW A;  3SMZ A;  3W9J A;  4YN3 B;  2ZH5 A;  2KKH A;  2F3J A;  4DWI A;  2JNJ A;  4DUZ F;  1WEY A;  2RE1 A;  2PDA A;  3M8Q B;  5JUM A;  4DUT A;  3TJ9 A;  2YKM B;  4DR6 F;  1XMO J;  1TL5 A;  2AGO A;  4LFA F;  4U8Y A;  1UFL A;  2BQ3 A;  3TWZ A;  1OYE A;  1J2V A;  2OUG A;  1F1B B;  1PBU A;  5D4N A;  5SUH A;  2R8J A;  5C7P A;  1JLG B;  1AYE A;  1JLQ B;  1N48 A;  2CQ0 A;  1N52 B;  2GNK A;  5E33 A;  4P6Q A;  4MK7 A;  2XMU A;  2FC8 A;  1RHU B;  2UV8 G;  5HAT A;  3CDA A;  2J9C A;  2YPY A;  1S6O A;  4LRE A;  4KIA A;  4ILR A;  4IFY A;  4NCB A;  2VFV A;  1LEO A;  3RUB L;  2V2Z A;  4EBD A;  3NS5 A;  4KR0 B;  2DHS A;  1IN0 A;  4CO4 A;  1X8D A;  4ZCM A;  1M5V C;  1KR4 A;  4URQ U;  4QYZ K;  1VK3 A;  1XK8 A;  2BJ7 A;  5HSP A;  5KFN A;  2RIL A;  1RKJ A;  4L76 A;  5GAG I;  2GGP B;  3CVK A;  2CNL B;  2VQF F;  1VBZ A;  4RUH A;  5M2U A;  1HQ2 A;  5K14 A;  1L3S A;  5HQM A;  4UZC A;  2PC6 A;  1S1V B;  4NZ7 A;  3NGT A;  2ZE2 A;  4DPO A;  5A0Y B;  1RTJ A;  5DQI A;  3FVY A;  2HSE B;  4ZCK A;  3G6Y A;  4DR3 J;  1QAX A;  1I5O B;  3BZQ A;  4HAC B;  2XSJ A;  4N56 A;  3BV8 A;  1U0H A;  1D1U A;  1HPZ B;  2IAJ A;  2HGL A;  1JLB B;  3JS9 A;  4EO8 A;  3TUJ C;  1IM4 A;  3UD3 P;  1VIO A;  5L9X A;  2QLX A;  1JNZ B;  3SBM A;  3TP2 A;  2MKY A;  2C2O B;  4OHV A;  4L3N A;  4PZV A;  2CAJ A;  2CQD A;  4DQS A;  4IH6 A;  4I64 A;  2LLZ A;  2GZO A;  2IMW P;  1WOP A;  1KFD A;  2NRE A;  4NRU A;  3MR3 A;  3A12 A;  2Q6C A;  5CYQ A;  3K5L A;  3UN3 A;  2Z2Y B;  4J9P A;  4RW4 B;  4NWB A;  2IDL A;  4KPC A;  1WHW A;  2FHO B;  2BE2 A;  1X4G A;  2QSF A;  3ZTS A;  4DPT A;  5CD4 A;  3K0J A;  3KJV A;  5AXL A;  1IKY A;  3DOK A;  4YY3 J;  2Y1R I;  4IOB A;  1MU2 A;  3PV8 A;  2QEX S;  2ZHO A;  4HH1 A;  3RW6 A;  4DR1 F;  3GII A;  1TK5 A;  2HBR B;  5HQ8 A;  3ILI A;  1C2P A;  2CJB A;  3U02 A;  1C4A A;  3SSR A;  4NLY A;  3KK3 B;  1FWP A;  2C2D A;  5DLF A;  3NAI A;  2KT5 A;  2HND B;  2Y0B B;  4IR1 A;  1H7W A;  3NKY A;  1YTY A;  4KTQ A;  3SQO P;  1JQG A;  3UVJ A;  3ZZP A;  3L9Z A;  5IWA F;  3T9Z A;  3NS7 B;  3KLH A;  2IRY A;  2K06 A;  5B0F A;  4JV5 J;  3OQ2 A;  1MW7 A;  1N4L A;  2YX4 A;  2OHD A;  1VHI A;  5A8W A;  2WHO A;  4HHH A;  2MQQ A;  3HVR A;  1RKI A;  3QBC A;  2VZ9 A;  1FRJ A;  2UXB F;  5CCL A;  1ROF A;  1TEL A;  2GC8 A;  1DQ8 A;  3DLG B;  1U8S A;  1FX4 A;  1ZTW A;  2QIF A;  2XI2 A;  2ZEJ A;  2W2N P;  4JI8 F;  4O23 A;  5IZH A;  1HNX J;  1FVQ A;  4IQM A;  5L8R C;  2FLN A;  2W2M P;  4O4G B;  1D8Y A;  2ZD1 B;  3NNA A;  2YWH A;  4MKB A;  1OWX A;  4YR0 A;  2FVP A;  3UO0 A;  3W2W A;  5E3R A;  5DO2 A;  3LWL A;  3RGI A;  4BWM A;  2KZM A;  4EI2 A;  3F0N A;  4NE9 C;  2ZZN A;  2F40 A;  3FZB A;  1RYS A;  1T05 B;  4DSL A;  1TV6 B;  3CCR S;  1CBK A;  4LIW A;  4C7Q A;  3OT9 A;  2GCF A;  2QZ8 A;  4RBV A;  3EGW B;  4DSK A;  3G6X A;  2AGQ A;  4KHR A;  2IVY A;  2XHC A;  4RLE A;  2Y3Y A;  5H1S V;  3QLH B;  3IS9 A;  2D7S A;  1ITP A;  3FBB A;  1S5Z A;  2DGU A;  1GEH A;  3POT B;  4TYA A;  3KK2 B;  4DCO B;  4B9V A;  1YIT S;  2HAF A;  4UZB A;  1CJT A;  2YKA A;  4JP8 A;  3MMC A;  3U27 A;  5F8M A;  2P9E A;  3H4D A;  3ET6 B;  1U1P A;  3HJV A;  2LCW A;  1Q79 A;  2HBZ B;  1HNZ F;  2AQ4 A;  4TY8 A;  1TL7 B;  3BSC A;  4NEY A;  2XGQ A;  3UI3 A;  4LFC J;  3ENW A;  4ALZ A;  4C0O C;  3CJ5 A;  3KHR A;  4USV A;  3CCS S;  1M0S A;  1UMJ A;  1SJ1 A;  3UR0 A;  2XZD B;  2AEF A;  2BV3 A;  1S10 A;  3J7Y U;  4B9L A;  3OBI A;  4TQS A;  1D09 B;  5IT4 A;  1N54 B;  3PJ9 A;  2ALY B;  3BR8 A;  3HVT B;  2QN6 B;  2VBW A;  1DTQ B;  3NBP A;  2A6O A;  2OSR A;  5D0H A;  3D1Q A;  3DI6 B;  3TUZ C;  3TUI C;  4B3S F;  3RJM B;  2W01 A;  1Q7Y T;  3B6B A;  1Q1K A;  1HBO B;  4X65 F;  5ETM A;  2HHX A;  4HHU A;  3W5X A;  2E1A A;  2GVD A;  3EVO A;  4M5N A;  5KFA A;  4RZR A;  4LMZ A;  1XMB A;  5DGB A;  3CNQ P;  3BQ0 A;  4D3G A;  4KV8 A;  4ZHR B;  3PAC A;  4XTT A;  5A8K B;  4FPI A;  4O44 A;  3WX4 A;  1F60 B;  3D54 A;  3OV7 A;  2UUW A;  1YGY A;  4A48 A;  2N4C A;  2CYY A;  4DU8 A;  4USM A;  3BSN A;  3NEK A;  3MWB A;  4FS2 A;  5J2N B;  1RDR A;  2N4D A;  1YKW A;  1W7W A;  2C42 A;  3EUN A;  4CO2 A;  3B4D A;  3M6U A;  4ZLN A;  3R6G B;  5AE3 A;  1NLT A;  2R2S A;  4EBC A;  1DUR A;  2HFV A;  1CSJ A;  2XMK A;  1SJR A;  4DXL A;  1S1T B;  2MHN A;  3MM9 A;  1F9E B;  2IJN A;  1FCA A;  4QR2 A;  3KK1 B;  1ICE B;  2W9C B;  4P2F A;  4RNF A;  4WPA A;  4BHQ A;  3N4W A;  1R31 A;  5CZX A;  1F0X A;  4YB6 A;  3VWS A;  3NCP A;  3UN5 A;  4DSJ A;  4E98 A;  3DMJ A;  4O3N A;  1HBU A;  3NCQ A;  2V68 A;  4DZ6 A;  3NNH A;  2E1P A;  4FYD A;  4YS2 A;  2BMB A;  2UUB J;  4KJI A;  4V19 X;  4PQU B;  4ED5 A;  4K5R A;  2V0N A;  4PXC A;  3A3O B;  2UVV A;  2ZDO A;  1HL6 A;  5D0E A;  2RNE A;  3QID A;  1NO8 A;  2CZ4 A;  1FKO A;  1FO1 A;  2Z56 B;  1AW0 A;  2GJI A;  3RB6 A;  1WC3 A;  5D4O A;  1X0P A;  2MZS A;  2YH0 A;  4ILL A;  3DLB A;  6FDR A;  5HMW A;  4YUD A;  3ZTQ A;  1WC5 A;  3RAQ A;  3C3L A;  2HFS A;  4KFB A;  2MY8 A;  3VAJ A;  7FD1 A;  3RB0 A;  1RXO B;  4Y65 A;  4PUO A;  1FD2 A;  1TKT B;  2JJ4 D;  1OS5 A;  3MUM P;  2CXE A;  2JZ8 A;  3CD6 S;  1KKH A;  3QGI A;  2HG4 A;  4A8Q A;  2HHU A;  1RAD B;  3HX9 A;  3M2V A;  5LL6 d;  2KI2 A;  4C6A A;  2XZT B;  1GMU A;  3HXM A;  4HYK A;  3G4S S;  4CO1 A;  5AT1 B;  2HRU A;  3C6E C;  1X4C A;  3HSJ A;  2G0J A;  3IC1 A;  1SPB P;  4LF7 F;  3TOQ A;  3GB0 A;  3HMJ G;  4I6A A;  2B3T B;  3M6W A;  1LK5 A;  4ED7 A;  3MI7 X;  2CDQ A;  3GJT B;  1A6L A;  1TZ0 A;  2UUC F;  3VGT A;  4ELT A;  3H25 A;  3QSI A;  1M1H A;  4LSN A;  2WBR A;  1PIL A;  3HHL A;  3W9I A;  3MOZ A;  2PA8 D;  4LF6 F;  5MLC V;  2HWH A;  3PKY A;  2W24 A;  3BO2 A;  2IY5 B;  5D3G A;  5KFC A;  4DR7 F;  1KVK A;  1VDH A;  3OL7 A;  1NSQ A;  2DNR A;  1N0U A;  2VC1 A;  1S59 A;  5GAE I;  3RAX A;  4ETZ A;  3Q83 A;  3O1L A;  5FDL B;  4X62 F;  3M30 A;  2MLX A;  2QFI A;  3QQC D;  2E1R A;  2VH7 A;  4DV2 J;  1XWL A;  3G9C A;  2ZH6 A;  3T5J A;  1I51 B;  4Q8F A;  4G6V B;  5BR8 J;  3L95 X;  4R25 A;  1QLN A;  1WTB A;  2RT3 A;  1M5P C;  1M5H A;  1PC4 A;  2HNY B;  4ZVH A;  1RTD A;  3P3D A;  3EYZ A;  4K5S A;  4DG1 B;  2VG6 A;  2QA1 A;  3V81 B;  3C6T A;  1WD6 A;  3E8O A;  3MOJ B;  3FSX A;  3ZZY A;  3DC2 A;  4LF1 A;  3W3S A;  3MD1 A;  1CQN A;  3TA1 A;  5C2C A;  4HH0 A;  3MM8 A;  1RI7 A;  2BW7 A;  3WBZ A;  4W90 B;  2W4C A;  4CLU A;  1HNV A;  1YJ9 S;  1NSA A;  1J5E J;  5IC6 B;  4KGZ B;  3EE3 A;  3C16 A;  3CUL A;  1UWB B;  5DG9 A;  1UVL A;  1WDD A;  3CIZ A;  3LPY A;  1YJR A;  2LQ8 A;  2VDH A;  2OI2 A;  4M5J A;  1Y5L B;  1RBL A;  4F3M A;  2ZHB A;  4EGL A;  4ZA1 A;  1TUG B;  2GHW A;  2YNH B;  3D0G E;  5B0E A;  3NG8 A;  3ZTR A;  1NDL A;  3GJS B;  2EK1 A;  2YNG B;  3U1M A;  4ECS A;  2RU9 A;  3MMA B;  4NXM J;  2GIR A;  1FDD A;  1HNW J;  4B3T J;  2X3D A;  4DX5 A;  2AIR B;  3F73 A;  4QR0 A;  3AJD A;  1Q16 B;  4ZJL A;  4ZK7 M;  1MRO A;  3N6M A;  4LRA A;  3Q24 A;  3VAK A;  5KG1 A;  2UVW A;  2QMU B;  3JAM U;  5D8H B;  1RT3 B;  5LSO A;  4DV1 J;  2ILZ A;  2IIH A;  3BBB A;  2EEY A;  3KHH A;  1IUJ A;  5E3A A;  2RRN A;  5D4L A;  2KFY A;  4DV4 J;  4FS1 A;  2J8A A;  2HNZ A;  2V2K A;  5HMX A;  1TL1 A;  2BZ2 A;  3T1H J;  2BE7 D;  1YJV A;  3MR7 A;  2KM8 C;  1UP1 A;  2D74 B;  5EX3 A;  4U9R A;  1SC3 B;  4J80 A;  3GON A;  1Z2Z A;  2CJA A;  3PG9 A;  3TW0 A;  1X4F A;  1FRK A;  2Y1J A;  2CZ9 A;  1TKX A;  4I69 A;  1VRQ C;  2BJ1 A;  4DL3 A;  3Q2S C;  1YJT A;  3R2C J;  2XEX A;  1M5K C;  3W2V B;  1KWM A;  5KFB A;  2H3E B;  1SH3 A;  5KOX A;  3IM9 A;  5D77 A;  1YJW S;  2VFR A;  4I2Q B;  4Q2M A;  4B9T A;  4FP9 A;  3KNA A;  4PWD A;  2OGU A;  2R42 A;  3AGX A;  2B43 A;  1RTI B;  3DOM A;  4KO0 B;  1QD1 A;  3ZZZ A;  2XZW A;  3CCZ A;  1GXU A;  3O8W A;  1EP4 B;  4JI5 J;  1SCJ B;  3IG1 B;  4Q44 A;  3CW2 C;  1DY3 A;  4IG3 B;  3MAQ A;  2JLG A;  1U1Q A;  1WKJ A;  2JRR A;  3FEY B;  3DYA A;  2ROG A;  5HP1 B;  1XC9 A;  3OTO F;  3D0I E;  1C0T A;  2XLJ A;  2ZUA A;  4JOU A;  5KFY A;  2B7B B;  4D3H A;  5KFD A;  3TYT A;  2IBK A;  2XHW A;  4NXN J;  4C8Y A;  3UW1 A;  3OW2 R;  2I8E A;  5HMZ A;  2DNZ A;  3PO5 A;  2MLY A;  4LR9 A;  1S6Q B;  4EWT A;  1TUV A;  3L3C A;  4IFY B;  2XCA A;  3FRZ A;  4PG4 A;  4WXW A;  1Y4Z B;  3OR1 B;  3EZO A;  3TRG A;  5C42 A;  4LFB J;  3GV8 B;  1K9M T;  1WUU A;  4Y2K A;  2FJE B;  1O6X A;  1OJ4 A;  4GVB B;  2MGZ A;  2HZV A;  3DOL B;  2QRR A;  2GVZ A;  1TMM A;  3LWM A;  1FES A;  2Z8Q A;  1RB0 A;  1E6V A;  3Q86 A;  5C5J A;  4CO3 A;  2AP6 A;  3B78 A;  2E9R X;  4GC6 A;  5I42 A;  3W62 A;  5DZ6 A;  1Q8I A;  1Z1Z A;  5LMN F;  4J9M A;  2ZE2 B;  1T8E A;  1RTJ B;  4KHP J;  5CH7 B;  4PXE A;  1Q81 T;  2EBG A;  3TAM A;  1KC8 T;  4JI6 F;  4OJG A;  5DGA A;  3CGI A;  1EJ7 L;  1JLE B;  3X1L B;  3AH6 A;  4ZLL A;  5T7L B;  1PAE X;  3IR7 B;  2ZKU A;  5IV3 A;  4OJ1 A;  3D66 A;  4QWA A;  5L1J A;  5KFG A;  2PFF B;  1S49 A;  4MIB A;  3VHQ A;  2LEC A;  4DLE A;  4DV5 F;  3CC7 S;  1NBE B;  3I4P A;  5EHH A;  1M5O C;  2W25 A;  3GSI A;  4OI6 A;  1ZM2 A;  2DGO A;  3PW0 A;  4OYZ A;  2BE2 B;  2DNQ A;  2OO4 A;  4KGV B;  1WEL A;  5K5M A;  3KJV B;  1HR0 J;  1FNO A;  4I6W A;  5C25 B;  3KUG A;  1Y0H A;  1Q78 A;  2OPR B;  3GIJ A;  4FF3 A;  1UPP A;  1MU2 B;  4BWJ A;  2B4V A;  1BE4 A;  3VQS A;  5I3U B;  2DY1 A;  2VG7 B;  3CPW R;  5KFM A;  1ZA2 B;  4Y00 A;  3CCV S;  2KRB A;  2MMY A;  1RHK B;  4LUB A;  3PZP A;  2M8D B;  3QAU A;  2L9D A;  3FMW A;  4I6Y A;  1PCA A;  4I67 A;  4FN5 A;  1SL1 A;  1C1B B;  2F8H A;  1B64 A;  4LFA J;  3D6H B;  4LSL B;  3KHL A;  1RTH A;  2DNY A;  2GJ2 A;  1VLY A;  4TXS A;  4DCP B;  3FJ2 A;  1YBA A;  1BMQ B;  1QTN B;  2VV5 A;  1QJH A;  1JNR B;  3G82 A;  4JI3 F;  3QNW B;  2V2V A;  3CDE A;  5J2M A;  3C6U B;  4PKD B;  3D0H E;  2E1C A;  3A8I A;  2BAC A;  3LQV A;  4DL6 A;  3KLG A;  1HMV B;  2V67 A;  2MHE A;  2R7S A;  3IWL A;  3MM6 A;  4O3R A;  4NX9 A;  4ZJO A;  2KTQ A;  2M3D A;  5HAO A;  2IBO A;  2OML A;  3TI0 A;  2VPX B;  1JJC B;  3P8B B;  1KOO A;  1S48 A;  4FYV B;  1UJ4 A;  3UWT A;  2VA2 A;  4DUY F;  3BGL A;  3MR2 A;  4KYZ A;  4LRC A;  3HUL A;  1XMO F;  4ZPV R;  2EBE A;  1S1W A;  3JSM B;  5ETQ A;  2R7O A;  2OPS A;  5K20 B;  4WYL A;  1OY8 A;  3MCO A;  5KFJ A;  5L1K A;  4ZPB A;  5F0U A;  1Q8L A;  2J9D E;  3J81 j;  4K2X A;  1BLU A;  5GMK a;  4QW9 A;  4IG0 A;  2PI5 A;  5IM0 A;  5KT5 A;  2KFZ A;  3LGN A;  3FSY A;  2JC0 A;  1HHT P;  3I0S A;  1S4E A;  1R6Y A;  4MK9 A;  2DGV A;  4E2F B;  2V4J A;  1EET A;  1I3O B;  2YNF A;  5DET A;  3VCD A;  3ZTP A;  3W9H A;  1IJE B;  2A6M A;  1S7H A;  4FYW B;  1S4F A;  2Z4P A;  2IFX A;  2WB4 A;  3CC4 S;  2QL7 B;  3AD8 C;  1K1Q A;  5D0G A;  5E2Q A;  4U95 A;  3WQP A;  3WHI A;  2DGW A;  2OAU A;  4ZJQ A;  2EFV A;  3H5Y A;  1I1G A;  2DT9 A;  1CJT B;  1S99 A;  1VOM A;  1TAU A;  1Q5Y A;  1VQO S;  1FK9 A;  2B9E A;  4FBU A;  4HDG A;  8AT1 B;  5LT5 A;  2RUS A;  3K59 A;  2LQ5 A;  3ONQ A;  2UXC J;  3Q23 A;  1WHX A;  2QLB B;  5ETP A;  4F0M A;  2AKW B;  4KRW A;  1G2E A;  5L1I A;  1EAY C;  3F56 A;  2DNO A;  4NLT A;  4DR3 F;  3NCR A;  1FKP A;  3LH2 S;  1GTE A;  1HA1 A;  5CCM A;  5KFW A;  4DEZ A;  4DFK A;  2HHH F;  2CG8 A;  3G6E S;  3JTN A;  1RAO A;  1RT5 A;  4ZP6 A;  5H9E J;  4USI A;  2R7Q A;  2KL8 A;  2L9N A;  4Q0B A;  3MUT P;  2Z30 B;  4ZVS B;  1GMV A;  3PX4 A;  1X31 C;  4NA1 A;  1NM2 A;  3GFH A;  4OQJ A;  4Q2L A;  2HQF A;  3AA8 A;  5IWA J;  3QRQ A;  4KV8 B;  1N5Q A;  1EQM A;  2CWK A;  2VBX A;  2ZWP A;  1RWM B;  3V6J A;  4QWC A;  1LXN A;  2LA4 A;  3MEC B;  1AUD A;  2HUR A;  3DDK A;  4YP3 A;  4DJB A;  1IR2 A;  3D5M A;  2M70 A;  4DR5 F;  2UXB J;  3KJN B;  4YFU A;  2MZQ A;  2AZ1 A;  3M9N B;  1RCX B;  1IBK F;  1SQE A;  3C8Y A;  3PY8 A;  2FLP A;  1VYA A;  1T9X A;  2Z57 B;  3QO9 B;  3MAA B;  4CYU B;  2C2M B;  1U2F A;  3FQK A;  2VOD A;  2RS2 A;  1N6Q A;  3FBF A;  4IH5 A;  2F5G A;  3RBZ A;  3OPK A;  4B9N A;  3MM9 B;  1UZD A;  1LW0 B;  2POK A;  2VJV A;  2PD1 A;  1U1L A;  2UUT A;  1JXE A;  4ICL A;  2WBM A;  4USJ C;  2FIU A;  4MT1 A;  1WAC A;  3AD7 C;  3GJQ B;  3E3X A;  4K7Q A;  3KTQ A;  4JV5 F;  4N8N A;  4PXD A;  3D67 A;  2XNR A;  5FD1 A;  1KEK A;  1C0U A;  4X66 J;  4BDP A;  2K3K A;  3HKW A;  2DEI A;  2ZH7 A;  1HQE A;  3KUH A;  3UQS A;  4MKA A;  3U7J A;  3GR0 A;  5ETK A;  1RHM B;  3PO4 A;  5KFI A;  4DSF A;  2CWX A;  4AD6 A;  2FQQ B;  3CD5 A;  4NZ0 A;  3EMT A;  3DRS A;  1HNX F;  4P7T A;  2V4R A;  3PYF A;  2G1D A;  4P7V A;  4MH8 A;  4TYB A;  3UCG A;  4Q7A A;  3VR1 A;  3QJP A;  2VKZ G;  1U1R A;  1KNZ A;  1LKZ A;  3T3F A;  1ZPV A;  2DRD A;  2NR0 A;  1X9S A;  4Y34 A;  4WP9 A;  2XY7 A;  1X5S A;  5GAD I;  3TAR A;  2E7W A;  2XWY A;  5GMD A;  5FII A;  2JLE A;  4MTP A;  1SC4 B;  2XO7 A;  1IKW B;  4A8K A;  2AJQ A;  4A8Y A;  2QG9 B;  1TFW A;  1K0V A;  1FDN A;  4B3S J;  2GIF A;  3C2P A;  2GHP A;  4IQX A;  2NQP A;  2R8G A;  3NL0 A;  3T1Y F;  1X9M A;  4NA2 A;  2FZC B;  1EX8 A;  3KG1 A;  1RLD A;  4XIU A;  2PEH A;  3PIO Q;  2BVZ A;  5IT0 A;  3D9B A;  3V5R A;  4P74 A;  3AHP A;  5GVQ A;  4CLW A;  1XNQ J;  4DQP A;  2C2Z B;  3RRK A;  2HWT A;  2XC9 A;  4LFC F;  4LF5 F;  1JJH A;  2CQ2 A;  2VG5 A;  3TVZ A;  4JB8 B;  2CQH A;  1IBL J;  3U1N A;  5B08 A;  4B3R J;  2B9W A;  1VK8 A;  2G2Z A;  1WNE A;  2IRU A;  3K7R A;  4GKK J;  1OQ3 A;  3RZA A;  4X4O A;  2HMI B;  4IDK B;  4A8X A;  1JWW A;  2VON A;  3NGK A;  2B56 A;  2E5H A;  2EWH A;  1KVI A;  1X5O A;  4WF9 Q;  2K8G A;  4NML A;  3M30 B;  9RUB A;  1SKR A;  2DNL A;  4P72 A;  2MJU A;  1S9E A;  4KGM A;  2PMW A;  4GMK A;  2QJ3 A;  2VU5 A;  1FF2 A;  5J1P A;  1ZAX A;  1RTD B;  3K5O A;  4UF4 A;  4N47 A;  2ZOM A;  1RU1 A;  1SB6 A;  1NK6 A;  4IRC A;  2H4Y B;  4RUC A;  4F04 B;  2MKH A;  4NYO A;  3DFE A;  4C48 A;  2B6A A;  3M1V A;  3CDB A;  2M8H A;  3W8P A;  3WX8 A;  1ZAW A;  3O2I A;  4I68 A;  5K9F A;  3ZZU A;  3BQ2 A;  4F3O A;  1FEH A;  4L74 A;  3CJS A;  2P6T A;  2RVJ A;  1YJN S;  3FCW A;  2DO4 A;  4DPW A;  1FFW B;  3H2V E;  3H90 A;  3ETM A;  5J2P B;  3G71 S;  5J1N A;  4KC5 A;  1G1X A;  1GK8 A;  3THV A;  3PX6 A;  5BYR A;  5MAO A;  2IYI A;  5DM6 Q;  2RRA A;  4XAK A;  5CYM A;  1ULR A;  4M5D B;  4P2X A;  2N7C A;  3BGU A;  4IOC Q;  3TZW A;  4ER8 A;  4W92 B;  1TFY A;  1HIY A;  2NSC A;  4OZN A;  2K3I A;  4TU8 A;  4OJH A;  5G4D A;  2DXE A;  3GZ7 A;  3KDO A;  3DLK A;  3L7U A;  3H8Y A;  4W98 A;  2KG0 A;  3EPG A;  4P52 A;  4OV1 A;  4QBU A;  1Y00 A;  2WVF A;  4WP3 A;  2MQN A;  1HWI A;  2H54 B;  4Z37 A;  2UUB F;  3LP0 A;  1TL3 A;  1MRO B;  1OY9 A;  4B3M J;  4KT0 C;  3VZI A;  3FRY A;  2AMC B;  1UWA A;  3JTP A;  4MFB B;  4PPD A;  1FX2 A;  3NGU A;  5LMU J;  5DS7 A;  3AB4 B;  2HNZ B;  2R3V A;  4NLG A;  1HD1 A;  2RDI A;  1TK0 A;  4WP8 A;  1S9G A;  2DR9 A;  1TAQ A;  2RH3 A;  3R9L A;  1WC6 A;  2MXY A;  2UVR A;  3MR5 A;  4WXO A;  2C2N A;  1CVJ A;  4BCA A;  2KYX A;  2FGC A;  2FY1 A;  2LYV A;  5EDW A;  1R8A A;  5K8P A;  4FXD A;  1TK8 A;  5KFQ A;  2D3O 1;  1WWH A;  3IAS 9;  3KJF B;  4LF6 J;  3QZ7 A;  2D9P A;  3QFH A;  3K58 A;  2CVI A;  3C5X C;  2BRL A;  5EUH A;  4USW A;  4RW6 B;  3QT5 A;  1WG1 A;  3M8S A;  4MYU A;  1NH8 A;  1G4C A;  4FF2 A;  4RUA A;  4DR7 J;  5L39 A;  4ZP8 A;  4DN9 A;  1S79 A;  3KLI A;  2DGQ A;  1IKX B;  3PR5 B;  2V8H A;  2G1H A;  2O1P A;  2DPI A;  1F9H A;  2QA4 S;  4FBT A;  4DX6 A;  1WF2 A;  2J9D A;  4X62 J;  2Y9H A;  4NI2 A;  2A18 A;  4KE5 A;  2VD3 A;  5RUB A;  2HGM A;  2NYH A;  3D1H A;  1F9F A;  3UD4 P;  4IRD A;  2EPI A;  1BUX A;  3J7A 1;  3P5T L;  1VCT A;  1JX4 A;  2FHJ A;  4M94 A;  3AAW B;  1ZM9 A;  2XS5 A;  3CIM A;  3DRR B;  4XK8 C;  1RWX B;  5KT4 A;  3R7N B;  5KFS A;  2OH2 A;  4EFA C;  5D6G A;  3HD1 A;  2EFQ A;  3QIP A;  4NYP A;  2Z2Z A;  1KLN A;  3MED A;  5H9F J;  5FLX U;  3J81 U;  2A0F B;  1P9Q C;  2L48 A;  3K8V A;  1G7C B;  1SQG A;  1T03 B;  4ELV A;  1K47 A;  1SIW B;  3EGZ A;  3N28 A;  4O0N A;  5KOW A;  3SZ2 A;  4ZPT R;  1HKA A;  5C42 B;  3ZZT A;  2G13 A;  5F8J A;  3G6V A;  3OXL A;  2NXE A;  4LBI A;  1TL4 A;  2MGZ B;  2CPE A;  2WON B;  4O0I A;  4RL1 A;  3QGP A;  2BEF A;  3J80 Y;  2JLF A;  3HKZ D;  4ES3 A;  1H98 A;  1V3S A;  3N01 A;  2EFG A;  3AOB A;  1AXQ A;  1WOS A;  1J5E F;  4FF1 A;  2B8Q A;  5AXM A;  4OX9 J;  3CDU A;  2WAQ D;  2ACY A;  4LBP A;  2JX2 A;  3C15 B;  4LF8 J;  4X4N A;  2C22 A;  4C11 A;  3CUN A;  5B0A A;  1RA6 A;  3OLB A;  1P1T A;  1RK8 A;  5IQ6 A;  3OHB A;  4CIO A;  3AOA A;  4I7F B;  3DGP A;  3N79 A;  4KY3 A;  2LFV A;  2LU1 A;  4MAK A;  2B0G A;  3CB4 A;  4F0H A;  1RJJ A;  3EGV A;  2QL9 B;  4RBU A;  2CJX B;  4OHX A;  1SC1 B;  3D6M B;  4HT5 A;  4B3T F;  1NB2 A;  2XTJ P;  3CJ2 A;  2CPF A;  3PM9 A;  4A8F A;  3HHK A;  2IMO A;  4B9U A;  2DHX A;  4QIF A;  1TVR B;  2IA6 A;  3OLA A;  3JXO A;  1YRT A;  3TAQ A;  3DNC A;  4DDF A;  3F41 A;  2WB1 D;  1CC8 A;  2KDO A;  2ZJR Q;  4X64 J;  3T41 A;  3N0V A;  1RT6 A;  3CCM S;  3E01 A;  2HVZ A;  1HBN A;  3HDS A;  4DV4 F;  2XNQ A;  1MMN A;  4OLO A;  1UVK A;  3JSY A;  4JYA F;  4EZ9 A;  2MQP A;  4KGX B;  1OIA A;  2VDI A;  3I5A A;  5J1E B;  1XNR J;  4OZ0 A;  3HHN B;  2YQ1 A;  4OHW A;  3LP1 A;  1QE1 B;  4OZ5 A;  2DNP A;  1M1K T;  4J91 A;  1K73 T;  2EKN A;  5KG0 A;  4DX7 A;  1T9Y A;  4PQA A;  5C2G A;  3N5F A;  5CAB A;  2OMO A;  3CXC R;  3HCX A;  1RTH B;  2ADB A;  3H98 A;  3G82 B;  4IFV A;  1D9F A;  1U09 A;  1QSL A;  3JTO A;  3Q8R B;  1V6H A;  2MPU A;  3TZX A;  3VAH A;  3WC2 A;  3B54 A;  5A8R A;  4H4M A;  4CLK A;  3W5Y A;  4OIX A;  1UJ6 A;  5ETL A;  4NPO A;  2GML A;  3ZTO A;  1T3O A;  5DQG A;  1VQ7 S;  5LOQ A;  2ATL A;  4F4A A;  2VA3 A;  1FRM A;  3MM6 B;  2WSE C;  4FDF A;  3GMG A;  4J9N A;  4OYO A;  3ZNU A;  4LVN P;  1DHM A;  2FZK B;  2RB7 A;  2YNI B;  5CQG A;  4C98 A;  1RE1 B;  2HZC A;  4DL5 A;  2YXL A;  3WZ0 A;  1N5T A;  3T1A A;  3J80 U;  3I4H X;  3ZO7 A;  2BJ3 A;  1CG2 A;  1D0E A;  3KLE B;  4IRK A;  1WTF A;  2ERR A;  1X60 A;  5LMN J;  1RT1 A;  1VBX A;  2BR0 A;  3I5C A;  1TU0 B;  1RT2 A;  4NXN F;  4DZD A;  4DLG A;  3AY0 A;  1VQ9 S;  3KKF A;  3D2W A;  4OX6 A;  1MG7 A;  2GMH A;  3CJ0 A;  2WOM B;  2HK3 A;  3HT0 A;  2KO1 A;  1CJU B;  3KYL A;  1NLK L;  4JI6 J;  4R8U B;  2WVC A;  3MEK A;  1NEE A;  4PRF A;  4PPZ A;  2AYG A;  4RX6 A;  1HWU A;  1H7X A;  1KLM A;  3BBC A;  4Q43 A;  1VC5 A;  2B51 A;  1UW9 A;  5ETN A;  1JKH B;  3AB2 B;  1XR7 A;  3R8Y A;  3NOG A;  4B3O A;  2R7U A;  2HVH A;  3SI8 A;  4RNN A;  4BS2 A;  3BYR A;  2W4P A;  1BY9 A;  2ZC3 A;  3MHY A;  3NWG A;  1RP5 A;  4K59 A;  2H65 B;  3OR2 A;  1PYO B;  4QIW D;  5F9L A;  2DKO B;  5IS2 A;  1Y3K A;  3DLE A;  5C24 A;  1O0P A;  4KAI A;  5A2Q U;  1OY6 A;  1VRU B;  4KHP F;  1XEZ A;  4FPR A;  4AXJ A;  5B0C A;  4CLF A;  1S6P A;  3NMA A;  4N5S A;  3PXG a;  2HQC A;  1YK9 A;  1RHQ B;  4EMD A;  4OYW A;  1U1O A;  2QLJ B;  3NGD A;  1VFJ A;  4YB1 P;  5DG7 A;  2A2D A;  4ZCL A;  1GQE A;  3AOD A;  2VB6 A;  4DR4 J;  3AJ2 A;  2AWZ A;  4Q0B B;  3M2R A;  4ZVO B;  1RAG B;  5KFH A;  3W1Y C;  1FTC A;  1VC6 A;  1CS4 A;  4RNM A;  2W2P P;  2F65 A;  4LSZ B;  4CT8 A;  2AV5 A;  4ZS6 A;  2HHS A;  2CJQ A;  4PG6 A;  2K1R A;  3R5J B;  2YX7 A;  1URN A;  3IRX A;  3R7B B;  3M7V A;  2XY5 A;  3GCW P;  4N7T A;  4CRJ A;  2OP5 A;  3HVA A;  2BYC A;  1GH8 A;  2MST A;  4AUK A;  4QYZ J;  2FUG 9;  2BBE A;  2RS8 A;  2ZFH A;  4QIE A;  2B9X A;  4CM0 A;  1ZBT A;  4ATN A;  4KKO A;  3H59 A;  4M5I A;  1PJ7 A;  3HSD A;  5HJY A;  1FER A;  4DV6 F;  2DH9 A;  4DR2 F;  2KYZ A;  1YWX A;  2CQG A;  2FYX A;  3M8Q A;  4HL9 A;  2MJN A;  2AGP A;  4LBH A;  1WKK A;  2YKM A;  4QPT A;  2V8G A;  4DUY J;  1W25 A;  4RKU C;  4Y0F A;  2C3Y A;  4K2J A;  3NRB A;  3FK4 A;  1VQ5 S;  4J9S A;  4QWB A;  3DXS X;  3H2L A;  1FRI A;  3PIP Q;  1BQM B;  1JLG A;  2H9Z A;  1T9T A;  4R0E A;  5KFL A;  2ZH3 A;  1LW2 A;  2NZ4 A;  2VJU A;  4I2P A;  5EGY A;  3I82 A;  3IRW P;  5HRO B;  1RSC A;  1AT1 B;  3ETO A;  4RWW A;  4IUF A;  4K4V A;  3JQK A;  5KFF A;  1H3D A;  4ED2 A;  1VJQ A;  2JH3 A;  3PDN A;  3VVT A;  1PKU A;  4WII A;  4OHZ A;  1CJV B;  4HEA 9;  3KHG A;  1SBR A;  2DGX A;  4Q5V A;  1UEK A;  2JSX A;  2ASJ A;  5LSL A;  1WC4 A;  2GGP A;  5F8I A;  1RZM A;  4PG8 A;  4TVA B;  3NS6 A;  2YBV A;  3WC0 A;  4NRT A;  3FCV A;  3PW2 A;  3M4X A;  1D8Z A;  2HEK A;  1S1V A;  2X51 A;  4NLD A;  2R9L A;  1NK4 A;  2B26 A;  2CQC A;  2UUA F;  3TAN A;  5A0Y A;  2JOQ A;  4QW8 A;  4FZV A;  4RU2 A;  4HAC A;  3DM2 B;  3LTO A;  1O51 A;  4K0K F;  1RHR B;  1AB8 A;  1LWC A;  4P71 A;  1VGY A;  2HHH J;  1YIJ S;  2QFJ A;  3NOC A;  1HI1 A;  2RJZ A;  4ILM A;  4X4S A;  5I3P A;  3LGM A;  2JEG A;  2VPW B;  4AL7 A;  4GC7 A;  3QMQ A;  9ATC B;  1NJZ A;  3IWN C;  1SUQ B;  5EN1 A;  4V1A k;  4L73 A;  3C19 A;  5F41 A;  2WW4 A;  5D0R A;  1HHQ A;  4RW4 A;  2IDE A;  1KD1 T;  4QPX A;  3I55 S;  2UXC F;  4U96 A;  4YR3 A;  2NLW A;  2VOP A;  4Z7C A;  1UW4 A;  5F3Z A;  2VG5 B;  3E2E A;  2GAH C;  1HYS A;  2UP1 A;  5DRK A;  4H4K A;  2R8K A;  4ELU A;  1U0S A;  1YZ7 A;  5KFU A;  3L4B C;  4UOG A;  3QZ8 A;  1AFI A;  4ES1 A;  4DR5 J;  2NPI A;  1Y3J A;  4LR7 A;  2XYP B;  1IBK J;  3H5U A;  4FNH A;  3DCA A;  3KK3 A;  4F26 A;  1QVF R;  3PRV A;  3D4J A;  2HND A;  5KFP A;  1RYR A;  1YSJ A;  5B0D A;  4F2S A;  3CTR A;  2C1E B;  3HHL D;  4KSE B;  2OPQ B;  4IYQ A;  2VKR A;  2ROP A;  1S9E B;  4IO1 A;  3IGV A;  1T94 A;  3PR4 A;  5ETT A;  3DU5 A;  3I9Z A;  4GO7 X;  2GJF A;  1OPI A;  3PNI A;  3KMS A;  4USK A;  5HAN A;  3F44 A;  1CC7 A;  4K4S A;  3JYT B;  4O4R A;  2J0X A;  4P75 A;  3CJK A;  3L7P A;  2CNN B;  4OYX A;  2JEF A;  4UOH A;  4ZVT B;  2V8V A;  4DFJ A;  5BYQ A;  3M1V B;  1REV A;  2XS2 A;  4O3Q A;  2G2O A;  2Q79 A;  3MM7 B;  3GWC A;  4OYP A;  4BC9 A;  3SCI E;  4O4G A;  1H72 C;  2AU0 A;  1PC5 A;  2QLF B;  3W63 A;  1WEZ A;  5E41 A;  2EW9 A;  4WE1 B;  3CME S;  1KDN A;  2HLT A;  1X4B A;  1M90 T;  4BC7 A;  2RIJ A;  1UA0 A;  1R27 B;  1YBT A;  2AJF E;  3RR8 A;  2IJR A;  2JL9 A;  4FKX A;  2XS7 A;  1S12 A;  2DB1 A;  1A0O B;  2RDD A;  4CCH A;  2YKQ A;  1BHN A;  2MTL A;  1T05 A;  2JC1 A;  1S7I A;  2DXD A;  4H4O A;  3QSY B;  5HJX A;  4C8Z A;  4ZDN A;  2IVM A;  4X66 F;  3M8W A;  1NK9 A;  1TL3 B;  1DQA A;  3R5B A;  6FD1 A;  3H42 A;  4UUX A;  3MMB B;  3V6D B;  3RYL A;  1U6F A;  3POT A;  4PG7 A;  3KK2 A;  3FC9 A;  5F8L A;  3T1Y J;  2HFU A;  3BBF A;  3EDQ B;  3M32 A;  1P1L A;  1S9G B;  3BR9 A;  4L3K A;  1XJW B;  3CDW A;  1NAQ A;  2ZC4 A;  1RT4 B;  3ET6 A;  1RAH B;  3P4U B;  1EHW A;  1EZZ B;  4HLB A;  3J7Y I;  2VF3 A;  4KPY A;  2MKK A;  3V4I B;  3FBC A;  4LF5 J;  4NLW A;  3CCQ S;  2EKY A;  1ARO P;  3BGR A;  2CPZ A;  4Y6I A;  3GFY A;  2J6S A;  3R27 A;  2KVQ E;  3DRP A;  4ES2 A;  4C3M A;  1SV5 A;  3OL8 A;  4CLZ A;  2YX1 A;  3S8S A;  1K0T A;  3HHL C;  3CF5 Q;  4NCG B;  4JI7 F;  4DFP A;  1L3T A;  3HVT A;  1OMS A;  1DTQ A;  4ED6 A;  2D3O R;  3DI6 A;  4CZC A;  4ZIW A;  4OZ3 A;  3PVX A;  1HBO A;  5KFV A;  2QLW A;  1LFW A;  1Y11 A;  2QGF B;  2MKC A;  2ZH2 A;  2MY7 A;  2L08 A;  2J9E A;  1NZA A;  3CJT A;  4NI2 B;  4CTA B;  1RA7 A;  5HLF A;  2HFZ A;  3LF0 A;  2V6A A;  1RQ0 A;  1XNQ F;  2BM0 A;  4N77 A;  4ZHR A;  4CT9 A;  5EWG A;  3EX7 B;  2BAN B;  3MM5 B;  2EG1 A;  3TVK A;  2D3U A;  3TVY A;  4AND A;  1LFP A;  3M2U B;  1MMD A;  1B0P A;  2YKN B;  1IBL F;  2M7S A;  1VBK A;  2GFF A;  1XQI A;  2U1A A;  4J9U E;  4B3R F;  3RB3 A;  2BRK A;  4HDH A;  4HI2 A;  5J2N A;  3QIP B;  3I5B A; 
#chains in the Genus database with same CATH homology
 3AGY A;  2B26 A;  3AGZ A;  3TJ9 A;  3TJA A;  2Q2G A;  3L9Z A;  1GMW D;  1GMW A;  1GMV A;  1EB0 A;  3TJ8 A;  2QLD A;  3LZ8 A;  4J80 A;  1C3G A;  3I38 A;  3NXZ A;  3NY0 A;  3AGX A;  1NLT A;  1XAO A;  1GMU A;  4L3K A;  1EAR A;  2HFV A;  3LA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...