3TJAA

Crystal structure of helicobacter pylori uree in the apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
b'MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 35
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tjaA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tjaA02
3AGZA 3TJAA 1GMWA 1C3GA 3I38A 3L9ZA 3AGYA 3LZ8A 1NLTA 3LA0A 2HFVA 1XAOA 3TJ8A 2B26A 1EB0A 3NXZA 1GMUA 3TJ9A 2Q2GA 1EARA 1GMVA 4J80A 3AGXA 4L3KA 3NY0A 2QLDA 1GMWD
chains in the Genus database with same CATH superfamily
2AW0A 1WTFA 2N4DA 3VWSA 4OX8A 4UZBA 1HARA 3T5KA 4L6V3 3FDSA 3DOLA 4ZKAA 5BJRA 4F3OA 4DPTA 1RTJA 4MFBB 1SJ4P 4QZVB 3CJ3A 1NB7A 1RTZA 4DR3J 2E5LF 1BY9A 3V6KA 1BQMB 4IRKA 4KE5A 2J8AA 4K5SA 1RK8A 3I82A 5CZVA 3BB5A 1FO1A 2OGUA 3KLEB 1SJRA 2V2KA 2B26A 2X1BA 2AEFA 3LGNA 5FLXY 3VGSA 1CJUB 2DR9A 2K3IA 1RWWB 1TELA 2FLNA 5F8HA 2ZH1A 4M5DB 1JLCB 1EJ7L 3KLHA 3N0VA 5ETLA 4BBYA 1CJVA 1EP4B 1NZ8A 3IWXA 5F8MA 1N8RT 2VF3A 5IT0A 3WIUA 4CO4A 1GEHA 3FBFA 4OX9J 3FSYA 2C22A 4O3PA 1RHQB 1ZM2A 2DPIA 5ETOA 4WWSA 1WKKA 1KQFB 4WXOA 5KFGA 3ZZRA 2CPYA 4KGXB 5F0UA 2LP4A 4J90A 2R7TA 3EZUA 4CTAB 1FD2A 3CCZA 5IC6B 2H54B 2BZ2A 2GJFA 2C3MA 4J91A 2I2YA 5LSLA 4NLGA 4ZCMA 3HLUA 4ZP7A 3PFOA 3DDNA 2NZ4A 3DYAA 1VC5A 3Q8YA 1X8DA 3NS6A 1JLEB 1WNEA 3O1LA 5M2UA 5GAGU 2W7PA 4FVCA 4N8OA 2JVOA 1VQNS 4ERDA 1U1MA 2OFGX 3PHTA 1D1UA 3NXZA 4C3LA 2BQ3A 2POKA 1T9VA 5E3CA 3WC0A 2OPSB 3QWUA 1NDKA 2CPIA 2BM1A 4L3NA 2PFDA 1FJ7A 3L9ZA 3NGSA 1RAEB 4WU3A 3OUYA 4DF4A 3CCUS 3BS9A 3OR2A 1PKUA 3W7BA 1FVSA 2Q1LA 3I4HX 1QLNA 4ANEA 4I0WA 1YJVA 3ILIA 2DO0A 4I2QA 2UUTA 3QIDA 2LVWA 2YY3A 4ZP8A 4LF8J 4AQYF 1F60B 2GAHC 1GTHA 2QG9B 1UPMB 2NYIA 4Y0FA 2B0GA 2B8PA 1SUQB 3DLLQ 2J5AA 2D41A 1IWAA 1JLAA 1H7WA 4B9TA 3MHYA 1YBUA 1T8EA 1QTNB 3PFEA 4TN2A 4WJBA 1WORA 5A0YB 5EUHA 3OV7A 3BH7B 2GVDA 5DETA 2VA2A 1U45A 3CCTA 2KZZA 1RT5B 2DGVA 1HI1A 4U7CA 4KHMA 2XEXA 1HHQA 2EKNA 3ZZ0A 5HP1B 1H38A 4OI6A 2KDOA 5E3PA 3BREA 4NLDA 2ILZA 2XCAA 4LFAJ 3DKDA 4X4RA 4ZN1A 3TEHB 3KK2A 3OVSA 2HQDA 3PRBA 4RW7A 5BYQA 4DCOB 3TZWA 1H0HB 1GH8A 4USMA 2CPXA 2LXFA 1H2UX 2X1AA 4ZIVA 4MK9A 2CRLA 4RPFA 2EBGA 3FSXA 1NJYA 4RW4B 4B3TJ 4YR2A 1S1TB 2G9OA 3R5BA 4DL0C 4LBPA 1KLNA 4FVMA 2WTFA 1X4DA 2RQMA 1IKXB 2QFIA 1S9EA 1ULRA 3UN2A 2M70A 2XZWA 1HMVA 1N34F 4ZDNA 4ZLJA 2KVIA 3IR7B 4KFBA 1U1OA 4P7TA 1VIXA 5DQHA 2NREA 5IC4B 4B17A 3VAJA 4PXDA 1U0HA 5AJ3F 2JLFA 1FA0A 1BXNA 4USWA 1VRUB 4I6YA 4A8MP 2OSRA 2F65A 3WQPA 4ZJLA 1MWQA 3Q8VA 1AW0A 2W4PA 3OTOJ 1MU2B 3K5OA 2B9YA 3PYDA 3LA0A 4RUCA 1N6QB 2DR8A 4B08A 5FIIA 1C1BA 3Q2SC 1XR5A 2DGOA 2XO7A 4TXSA 4KIAA 1YI2S 5JXSA 3M9OB 4JOUA 1TL3A 2RE1A 2Z2MA 1EKRA 1SV5B 3M2VB 5GAEU 4DQRA 4WCEQ 4KH1B 1RTJB 4CLUA 4X65F 3MD3A 1QAYA 2DGWA 5DQGA 3J81U 3IO1A 3M2UB 2CNLB 2IAJA 1P9QC 1YJNS 2YX4A 3GV8B 3W65A 5D0EA 2EPIA 1HNXJ 4F4AA 4RU2A 1JLGB 1Q86T 1XIQA 2V34A 2YWHA 2ASLA 2I38A 4Q44A 2Y8YA 1RT3B 1Q7LB 1U8WA 1EHWA 3GFXA 3IRWP 2Y1IA 2AGQA 3LZ8A 1D9FA 2CWXA 2COLA 5K14B 4EFAC 3HT3A 1EZZB 4FDFA 5KFAA 4DS5A 1CS4B 1IWGA 2Q79A 1QDUB 1S1UB 4Y28C 3AAWB 2GMLA 4NZ7A 1CJVB 4DCPB 4WFNQ 3TZXA 3LWLA 3W5ZA 4F0HA 3PKMA 2YKNA 1IKYA 2I0XA 2WSCC 1TV6B 2FVQA 3SSSA 3VZHA 1VDHA 3AD8C 4OI3A 4M95A 4N7TA 2AT1B 2PDAA 1S1VB 2C3PA 4FS1A 4RUAA 2ZC4A 1N4LA 1XMOJ 2YWKA 1S10A 2QLDA 3BGOP 2XB2D 4PXEA 2Z57B 2K2PA 3RB6A 2IDEA 2MPUA 1NUEA 1L3UA 3UDVA 3MM8A 4JV1A 3DYAB 2RAQA 3WDOA 1UMJA 3J81Y 2CXEA 1G3OA 3ZTPA 3AFGA 2ZDPA 3FQKA 4AXIA 2AV5A 1T11A 4KAIA 2ZITA 1S0MA 2HRYA 1J2VA 1RTHA 3MAQA 3HSJA 1FF2A 2KT3A 3E3XA 2VPWB 4WFXA 1T05B 2XMMA 1FI4A 2IVMA 3HSGA 4ZITA 1Z1ZA 2OELA 3QLHA 3HHDA 2BJ1A 3N9UC 4DR4F 1SC6A 6FD1A 2RS8A 4M5KA 2J8SA 1JX4A 2DNRA 2OEKA 1HHSA 5CD4A 3OR2B 2YQ1A 1KD1T 4KSEB 4CH7A 1YG0A 2EEYA 5F8JA 1SJQA 4ZN3A 4WP8A 4I2QB 2HHWA 3PEJA 4PYAA 5KTQA 1F9EB 3E8OA 2HBQB 3GMGA 3BH6B 1SC3B 2MKKA 3OHBA 3KJFB 1V6HA 3DHXA 4DG1B 1UETA 5C2GA 1NPPA 3FUYA 4N5SA 5CAAA 3MCOA 2FLLA 2VHGA 2LQBA 4F7VA 3MM6A 3GONA 1M0SA 4PQUA 3FRZA 4NL5A 2A2DA 5F9NA 1KDNA 3OTBA 3T41A 2HS0A 5H1SV 4MTPA 4U96A 4WFAQ 4A8XA 2KM8B 1FE4A 4HYKA 3SDEA 1ZAXA 1RT7A 2G0CA 5HJXA 4V1Ak 3CO9A 4DV3J 2ZWOA 2RD5C 3MECB 4ECZA 1Y4ZB 3QRRA 1ZBTA 3IR6B 2E1MC 4K7QA 2L9WA 3D28A 4FF1A 3RRHA 4KHPF 3NG8A 4Y2IA 5J1NA 2JJ4D 5BR8J 3EWGA 3H42A 1FJEB 3OLBA 4J9MA 2CQ0A 4C8MA 4OZ3A 3QFWA 3KWMA 1HYSB 3LO3A 2KZMA 2OPPB 3T6JA 3I96A 2DJWA 1AFJA 5HO4A 1NZAA 1KQGB 2GGPA 1G6BA 1ZA1B 2XI2A 2XNRA 2ZH4A 1JIHA 1Q8LA 3V4IA 5A2QY 2IC3A 2MTLA 5DO2A 3THTA 2ALZA 3SZ2A 1FDDA 5HN0A 2YPZA 1FFWB 2GHPA 4DQQA 4HACA 1VQYA 4PPDA 3AT1B 2KO1A 4RNFA 4ETXA 4JI6F 4KFBB 5K8MA 2I1RA 2DHXA 3AXKA 1B0PA 1ZM4A 2MHEA 2YBVA 3JS9A 5KFDA 4ZLNA 2FVRA 4DR2J 2V67A 3EVWA 1N52B 2FVSA 1OO0B 4NLWA 3CMES 4FXVA 3G2XA 2JVMA 1K9MT 3AA9A 4NCAA 2NSBA 4CM0A 1C1BB 4UOCA 2MKSA 2VDHA 4RNNA 3L4BC 3JYTA 2EC2A 3VAGA 3CJRA 4O3NA 1X31C 1OPZA 2QL5B 4ZVQB 1CULA 3GV5B 2FIUA 1PBAA 4ED2A 3C6EC 2V4QA 1WJ9A 2HNDB 1K1QA 3AY0A 5KFZA 1LK5A 3LAMA 4R0EA 4A8QA 2E9TA 1NNDA 1LWEA 1S77D 4Q7AA 4CLTA 3HF5A 3QIPB 1T9YA 2W25A 5I42B 3L3CA 3UD4P 2IIHA 4WYLA 1F9FA 1TKXA 2R8KA 1Y5IB 2ZJRQ 2XY6A 4ED1A 3T19A 4LSNA 1VK3A 1RLDA 2AZ1A 2H3EB 2B7BB 2MZJA 4R8UB 1S1WA 4QPTA 4ZIWA 3CO0P 3N79A 4YB7A 1ZAWA 4LF7F 1NKCA 1R0BG 1YRXA 3GJTB 1TU0B 4CO2A 1GXTA 2HHHF 1TTHB 4PQAA 1IJFB 2OUGA 3HM9A 1KNZA 2XM3A 1VQSA 1IKYB 1RISA 4DR7F 1REVB 2QE5A 1KQKA 2W9CA 1KHVA 1HPZA 2J6SA 4B9VA 4AE5A 3PJWA 3CJKB 5LSRA 2MKJA 3DLBA 1SH0A 5F8NA 2W2QP 4QQBA 2DGQA 1IM4A 3R2CJ 1W25A 5JVGQ 3BPSP 4ZP9A 2Q3PA 1J5EF 2FJAB 1R6VA 3SFUA 3A13A 1LXNA 3K8WA 1V5IB 4YY3F 2CVIA 2PA8D 4EK2A 4K2JA 3MM8B 3OPKA 2P9CA 3GCXP 3D6MB 5DM7Q 1BQNA 3IM8A 2E5JA 1D9DA 2IYGA 3R7BB 3Q22A 1VLYA 1VK8A 1OSDA 4L72B 2R7UA 3IBFB 5G4DA 4DSLA 3T5LA 2PC6A 2JRSA 1ZOTA 2GIQA 2W24A 4NYZA 3VGTA 4UQTA 2Q43A 3DCAA 3DRPA 4MIBA 3QLHB 3GYXB 1GMWA 2RRAA 1RBOB 5HATA 4DL3A 5LMNJ 5F8LA 4DBQA 3EVOA 2F9JA 4ED8A 3KHRA 5CYJA 1S79A 1TK0A 2ZUGA 1RLCL 3A3OB 3P6YC 1OY6A 5KFMA 4GO5X 1WHVA 5KG6A 1VCTA 4EGLA 1RWUA 1SL0A 4GO7X 1HW9A 1UFKA 2WB4A 2QN6B 1NK7A 5DZ7A 1RB0A 2CNKB 1CPZA 3OW2R 4MKVA 5J1EA 3F41A 5M2RA 2HSEB 4YMEA 1BLUA 1F9HA 2G2ZA 3M6VA 1SCJB 2YH1A 2E7VA 2FVPA 3PKYA 4DI6A 5ETVA 3SQGB 2V69A 3OD2A 4U67Q 1N33J 1Y5LB 5E41A 1FJGF 2C3UA 2AWZA 1Q8IA 4TY8A 1W2BR 4NXNJ 1N5YA 2BACA 1HBOA 2IBOA 3FBEA 3FRYA 1FRMA 2X3DA 3T1AA 2OPQA 4ZVFA 1DTQB 1KOOA 2F8HA 1WC1A 3SDEB 2DHSA 4C6AA 3NP5A 3C8YA 3HHNB 4P2MA 4J80A 3TX8A 3R97A 2HFNA 3B54A 3VGVA 3GV7B 1XMBA 4F4XA 4K4WA 4CLSA 2QA4G 2YNIA 3I6PA 4I2PA 2NXCA 1M5VC 2UXDF 4IG0A 4OV1A 1APSA 3NS5A 4JI0J 4IG3A 4PRFA 5IFMA 3CCMS 2CNOB 4NZ0A 2BANA 3TAPA 4L74A 3G6ES 1Q95G 2RT3A 1RWNB 4W92B 2GGPB 5D15A 3N28A 2FJVA 5EWFA 1RKJA 1Y5NB 2IC3B 1H73A 5DDRC 3P8BB 2DY1A 3OFHA 4HACB 1H74A 4FYDA 3GTYX 2DBBA 3MWBA 2GHWA 3MPDA 2CZVC 2P6SA 4CLKA 2W2NP 2J76E 1TMMA 2B4OA 3DN9A 4M63A 1S97A 3SCIE 4E0DA 3FMWA 3I0RA 1HNVA 3T1YF 2F8MA 2MQPA 2ODXA 5KFOA 4A8WA 4RNHA 3VAIA 3MURP 3V4MA 3B4MA 1FVQA 2BVZA 4CT9A 3DLKB 2NQPA 4J9OA 2FZGB 2DH7A 4JYAJ 3AB4B 4Q8FA 3DI6A 1B4SA 3EDQB 4M5LA 3JYTB 5EDWA 3H5UA 4FS2A 5C42A 1NJWA 1XWLA 4QPXA 4IH7A 2BKPA 4DUYF 4TLRA 1CULB 2WONA 2RU9A 4FF3A 1HLWA 3ENQA 3CF5Q 4GVBA 4DV2J 3D3CJ 3UDCA 4JI2J 1LWEB 2OPRB 4DV6F 4L75A 1S49A 4HH0A 1RT4A 4UUXA 1DQ8A 2IDLA 3NKYA 2M88A 4IOBA 5CYMB 1TKXB 1O5JA 1YJWS 2HNZA 4FF2A 1VQKS 3BDEA 3H4DA 1DQAA 2DNMA 4LSNB 3MEKA 1R0AA 1QVFR 1V3RA 3TQ1A 2CFXA 1WSRA 4WZQA 1S7HA 3HVAA 2HHXA 3DGPB 3VQSA 2WBRA 3M6UA 4TY9A 3K5MA 3MM7B 5IQ6A 1S5ZA 3PCOB 4ID8A 3RTVA 4ILMA 5KFRA 4H4OB 1N36J 2WB1D 4YFUA 1RBLA 4F4ZA 4ELUA 1HPZB 4UOFA 3CCVS 2PFFB 2FHJD 2MSSA 3QYYA 3BN4A 4G1PA 1UFWA 4IO1A 2VFUA 4P2XA 2XZTB 2WHOA 3ZZUA 3D3BJ 5A8RA 1Q8KA 1MN7A 2CJ9A 1NO8A 5HJYA 5CQGA 2WK4A 2RF2A 2IFXA 4BC9A 2H48B 3UI3A 5KFCA 5E5NA 2OO4A 3H59A 1IBLF 2VQFJ 1C0TA 2N7YA 3UR3C 1BQNB 4Y2AA 2JFKA 1F3VA 1TVRA 3OTCA 5KFEA 1KBRA 4JI7J 3KHHA 1P1TA 1DRZA 2KXNB 1NKBA 1CVJA 3HX9A 3W2WA 3Q8QB 3Q83A 3DRPB 2QSWA 4IUFA 2N3OA 3EX7B 1DHMA 4C0HA 4ED5A 1BC6A 4KR0B 2E7WA 1VFJA 2EFGA 2XG8A 1NK8A 3PW7A 1IQZA 2EC0A 3OL7A 3KK1B 1OWXA 3AD9C 4QIGA 2KB2A 3JAMU 4USJC 3NBPA 2QA2A 2G4BA 1YSJA 1TKDA 2E9RX 2YKMB 3T1HJ 3A4TA 3CEDA 1YLXA 2L9DA 4WP9A 4DX6A 5D4NA 5HBMB 1NXIA 3IN5A 3QT8A 1HR0F 3IBWA 4HDGA 1H2VZ 2C2MB 4X66J 5J1EB 2XS5A 1HHTP 4IOAQ 3AGZA 4DUZF 3T5HA 5IT4A 1FX2A 3PR4A 2JEGA 2HHPA 3D6TB 3HHLA 2OP5A 4CDIA 2H5EA 1HWIA 2O5DA 2AJQA 1S6PA 2MQLA 2FZKB 1HBOB 1AT1B 3P45B 3NCPA 2VQEJ 4QR0A 2OPQB 4EI2A 4LRAA 1L3KA 1U6BA 2M0GB 1ROFA 1RQ0A 2ROEA 2MQOA 1ZAVA 4J9LA 4GKJJ 1LK7A 1N5TA 4JV2A 2AU0A 2ZNZA 4U8YA 4AL6A 1WEYA 1FRKA 2R8GA 4JB8B 2DNQA 2JX2A 3I56S 1M1HA 3GLJA 4EMDA 2AQ4A 2YNIB 2ZBPA 3I0SA 4P71A 1KEKA 1RTDB 3ADAC 3KLGA 4IG0B 1KR4A 2VH7A 4C97A 4Z7YA 4IG3B 2Y0SD 2AYEA 3WC2A 3M32B 3GJRB 3HHLC 2HZAA 3FCVA 3BKFA 2Y1JA 2BANB 1JLBA 3QAUA 2P2CB 3PW0A 3JAMY 4P72A 2VG5A 4X4PA 1KHWA 3SV4A 4ER8A 2ZC3A 1VQPS 4NYPA 2NLWA 4WXWA 2AHOB 1BMQB 1YGYA 4R5PB 1BUXA 1JK9B 1Q78A 2ZZTA 5K8OA 2YKPA 3HVTA 3K89A 4JV0A 5D4OA 4XDDA 4ENOA 2QA4S 4ZLPA 2NSCA 1ZTTA 2CYYA 4ZVEA 5L46A 2MZTA 3CUNA 2YTCA 3MPWA 3PACA 3I0RB 3HKZD 2J7KA 2VOOA 3CIZA 3CB4A 5HVGA 3EDRB 3D1OA 3GB0A 3HPOA 4O44A 4ED7A 4GKKF 2QEXS 5IWAJ 2Z8QA 3TUJC 2QL9B 2QTWA 3DXBA 2BJDA 3E2EA 4YP3A 1Q8BA 1S4EA 4LVOP 2UXCJ 1RYSA 2IM1A 4AL5A 1DTTB 3EPGA 2Z0GA 1T95A 4C8KA 2ZBRA 3UDEA 5C42B 2APOA 2JH3A 1T9WA 2B9WA 3R5DA 2WONB 5KG1A 1C4AA 4TYBA 4B3MJ 2CDQA 3IMQJ 5HVFA 3R9LA 4QWAA 2CQDA 2CJQA 3TZYA 2GIRA 2KTQA 4ATNA 4CLYA 1RT4B 3R5JB 1FXLA 2VD3A 1NDLA 3MXHP 4F02A 3TZZA 1ZPVA 3BBCA 3K5LA 4JI5J 5K9FA 3FC9A 3AOAA 3QSIA 1R0AB 2HRUA 2HS3A 3D4JA 2ZHOA 5HL7Q 4UTGA 3QT5A 3QQCD 3NNAA 3W5YA 3CTRA 2C3YA 1NRKA 1U25A 5GADU 2YQ3A 3Q89A 1U49A 5D3GB 9ATCB 1TL7A 2HHSA 1SL2A 1NEEA 1BE4A 4NYOA 3JB9k 3V5RA 3TUPA 4DV5F 4ECTA 1I94F 1RAIB 3EPIA 4NXMF 3H0PA 4ZHRB 3ITHB 2BQUA 3KNGA 5J2QA 5CA5A 2X1FA 3ENVA 4OX6A 3DOKA 1V5VA 3H5XA 3EGWB 2E9ZA 4OV6A 2XHWA 4PG7A 2F8EX 5JMNA 4M5HA 4I68A 2P9EA 2J9DE 4YB6A 2A6OA 5A8RB 1XQIA 5CYQA 2NCKL 3W62A 2RF2B 2DXDA 1FDBA 4J9VA 3RW6A 3S6EA 1S0NA 4O0IA 4KQZA 2WVDA 2EFPA 1VQLS 4PWDB 1NK5A 1AZSB 3D5MA 1TVRB 2G1DA 1NH8A 5KFSA 2HFVA 3HSDA 4NRTA 3IXQA 3TUZC 2DO4A 1CLFA 1DZ5A 3DLJA 3KHGA 4IR1A 2HEKA 2LECA 4ZJOA 1R27B 2OAUA 4K5RA 2DIUA 2AJ4A 1U1LA 1FKPB 2J9CA 3OJUA 1NPKA 4P2FA 1GXUA 3HCXA 3K58A 1BWEA 1DLOB 5DLFA 3KJQB 3IG1B 2NR0A 1E6YB 1Q0NA 4I7FA 4JI4J 1SPBP 3MAAA 4S0MA 4K4ZA 2GMHA 2YKQA 5KFFA 2BJ8A 1HI0P 3NBPB 3KNAA 4B3RF 3QGGA 4DR5J 2BE2A 2F63A 4OYAA 3US5A 2UUCJ 4M5MA 3FKBA 2UXBF 1WC6A 1M5HA 5E3QA 2DGSA 2PEBA 4YQWA 4A8FA 3NCQA 4ZVTB 4Y2CA 2KI2A 3WX8A 3QRQA 4O0NA 2MKIA 1FK9B 3F73A 2VFRA 1X4EA 5IZHA 3OSPA 1TL5A 4UOHA 2DY9A 4QWBA 1M1GA 1LW0B 4J9SA 4LF4F 3WX4A 1B0TA 1B7YB 1S6PB 2VU5A 2DXFA 4DN0A 2R7RA 5H9FJ 3EM1A 3AXMA 4ANDA 2UU9J 4CNYA 1BHNA 4G1QA 4DV4F 3TA0A 3EUNA 4CH1A 4NEYA 2H9ZA 4JI8J 3UDLA 2RHQB 2VIHA 3CNQP 5B0AA 3QJPA 3IRXA 1H98A 2VJVA 4QYZJ 3MR6A 1EAYC 5AT1B 1I1GA 1L3TA 3KOAA 3KLGB 3C46A 2CQHA 4QR1A 4NLOA 4N8NA 4ZS6A 1DARA 2PE8A 5AE1A 4B9LA 3IC1A 4DR3F 3MFIA 2WRMA 5DLGA 2MXYA 4RW8B 1VLOA 2OD6A 4ES3A 1WOOA 3SV3A 2DNHA 3RAMA 1RTIA 4F26A 3KUEA 1HI8A 2HVDA 4F67A 1TQLA 3CJSA 3TOQA 1YRTA 3ZZPA 5HROA 1QM9A 2JC1A 2KJWA 4U7UD 1REGX 3VAKA 3OVAA 4BC7A 4I6WA 2W7AA 2CDRB 1QVGR 1F3FA 1XBWA 3I87A 4C8ZA 4USHA 3ZFVA 3A1YG 2AX1A 2UVRA 4EBEA 2YPYA 2E1AA 3D67A 3ZTOA 3F44A 4OX9F 3AJ1A 2XHCA 5AXNA 2OJ3A 4PUOA 5KG7A 3DM2B 4C3MA 2BYCA 3PRVA 2HAFA 4HEA9 3TWZA 5J2MA 2HPUA 3P49B 4C2MA 1F1BB 5HMYA 3BYPA 1JXVA 5HQMA 4PR6A 4JI3J 3CCSS 5DDQC 2QLXA 4ZVHA 1RWXB 3MM5B 5KFBA 1HNWJ 2AIRB 4P10A 1HW8A 3K17A 5GVQA 1X7VA 3T3FA 1MMNA 1IJEB 2RH3A 1NSPA 3ZZYA 2Z2LA 1HNZJ 2O67A 2CADA 1OSCA 1F5CA 3DLEA 3DRRB 2C2OB 1UWBA 3CDWA 2VPZB 3TA1A 2R7QA 4O4RA 3IAS9 1DFDA 4TQSA 1T3NA 2KVQE 1Y7PA 3C6TA 4RU9A 4FBUA 2GO9A 1IUJA 1R3NA 3H20A 3OFGA 3ILLA 4OX7A 1KN6A 4X64J 4RJVA 1LXJA 2R7WA 4USKA 2IJFA 4OYPA 1TL7B 1NPRA 2ZBCA 3DLGA 2LLZA 2JDJA 4YHHJ 5H9EK 4LSZB 4DR4J 1Q5YA 2J9DA 2XI3A 5I3UA 4LF8F 1A0OB 3LUYA 2V2VA 4PYDA 2HKEA 3DOKB 3SYZA 4K4XA 1RWPB 4H4MB 2DNZA 2K06A 3OT9A 2PA3A 1HL6A 2E1RA 2GV1A 3L7OA 5E3AA 2Q6BA 2D7SA 4U9RA 5CYQB 4NEZA 4AT1B 2EFNA 3KG1A 4WFYA 2PEHA 1UA1A 1VQOS 4YOEA 6AT1B 2DVIA 5DG7A 4USUA 2C2DA 1Q5VA 2ZJQQ 3NRBA 1BQXA 4DMZA 5D78A 4RNMA 2V68A 2OI2A 2W9AA 1RT2A 3TA2A 2BKOA 4LFAF 2R7OA 2XWYA 2D3OR 4NLYA 3BO4A 2VL1A 2VDIA 5IM0B 1B64A 1RAJA 3O3LA 3BYRA 1RP5A 1Y9OA 4YR0A 1UEVA 3O8WA 3D0GE 4ES1A 3MOZA 1SI9A 3PYEA 2MZRA 5KT7A 2ZOMA 1JNRB 3HKWA 2HVIA 5L1IA 1C4CA 4KO0B 4G3IA 3RB3A 1YJ7A 3UNGC 3JTPA 4ED6A 2LFVA 3GYGA 5DGBA 4B3TF 1CJTB 4P9SA 1UJ4A 2RUSA 4OYBA 4KKOA 4NZ6A 5K8NA 4KY3A 2EK6A 4DFPA 1HQ2A 4F04B 4LRFA 2JHEA 3HI9A 3TANA 3FEZA 4OHXA 4DU8A 4GC7A 2HK3A 2CWKA 3O5TB 3A3NB 2WCXA 1WHXA 1XNRJ 5AXLA 4ZPWR 4ZCIA 2FD2A 2MZQA 4MAKA 3D2WA 2KRBA 3C3LA 4DV0J 2HAIA 5T7LB 1TZ0A 2W2MP 2YNHA 4ZVRB 3UCGA 3LF0A 4ZCKA 3KFWX 5G0RB 3JSMA 3DLHA 5E7OB 3PXGa 2ROPA 4M8LA 4DF8A 4P2SA 3OTOF 1X9MA 2NXEA 4G1QB 2I9SA 5C7PA 2Y0BB 2GA7A 5KFVA 4WYWA 4EWTA 2QYGA 3FVYA 3R7SB 3J80U 3BPDA 4KB7A 2DIVA 1X60A 3GZ7A 4PG8A 2HQGA 1KFSA 4X2BA 2NYHA 1VJWA 1QD1A 3MUVP 2VG6A 4LF6J 1RU1A 2IHR1 2KKHA 1S1XB 5ADZA 2PGCA 1VC0A 4F4WA 1PYTA 3GSIA 1LWFA 2GHVC 2QLFB 1HNXF 2VONA 1P6TA 2JWNA 1RACB 4QJVA 1AROP 1RT1A 2DB1A 3UPFA 3BO3A 4CO0A 1NSQA 2YWEA 3JQKA 3I31A 2P9GA 2UVWA 4KTQA 1S48A 1R8HA 3EZOA 4NLUA 3NMRA 3W9IA 4XPEA 8RUCA 3QBCA 3TNVA 1HQEB 2FC9A 1NMEB 1FKOA 3R7NB 2R2UA 2IJRA 1LQ9A 2IM3A 1QJHA 3TAQA 1J5OA 3HP6A 2RB7A 2HZCA 1IVZA 2R2SA 4KGKA 4WE1B 4CM2A 1RAFB 5C24A 2V4JB 3TI0A 1Z2ZA 4PUOB 2OMOA 4WF9Q 4P52A 2IYIA 2BE7D 5J2MB 4X62J 1IR0A 2X1GA 3LP1A 5DDPC 1CQMA 4DR7J 1XMOF 3J80Y 3OR1B 1LV5A 1RHKB 2N7CA 3D54A 3JQJA 4NE9C 1Q79A 3I38A 5ETMA 3A12A 4ECVA 1IKVB 4IQMA 2VBWA 2HHTA 4IQXA 4I67A 2LQ5A 2MMYA 2BABA 4YS2A 4NCGA 3NWGA 5F0WA 4IRDA 3CC2S 3KKFA 2NPIA 1CEZA 5SUHA 4HR2A 1NH7A 1T7PA 2NZCA 4B9MA 2M4MA 1SJ1A 4FKXA 3W2VA 3X3UA 1YITS 4DSEA 2KYXA 3NLCA 2A0FB 5LOQA 2D1CA 3Q8SB 2BOAA 3HFKA 2ZFHA 1RUSA 2BE9B 3R1HA 1NJZA 5D0RA 1MMLA 3C14A 3RRGA 3SFGA 2Y9HA 4IFYA 2OFHX 5D4LA 4OZLA 2HFUA 5ITHA 2V9WA 1RHRB 4M1KA 2GX8A 2BR0A 1FWPA 2V8DA 2CJAA 4HDHA 4HI2A 3D1QA 2MYFA 3A8EA 1IN0A 5GAHU 2MB0B 5KOWA 2LA6A 3TX0A 1Q16B 5I3UB 2CQ3A 4XTTA 4PWUA 3NOGA 4OIXA 2KYZA 1U1PA 1WI8A 4MYUA 4NMLA 4U8VA 4K0KF 3RBXA 1U1NA 4OHYA 1AUDA 4J37A 4PG5A 4TQRA 4DSJA 5K5MA 5HLFA 1TFWA 4DR6J 1RA6A 5CABA 4LF5J 1SVDA 5FJ4A 5KT5A 4DS4A 3R1LA 3I4PA 2KG0A 2VKZG 2O66A 5AXMA 2RMLA 4F3QA 4CIOA 3NWRA 1FX4A 3MFHA 3OL9A 3KDNA 2G2YA 4DLEA 2VZ9A 1XR7A 1RT2B 4KV8A 5EHHA 1MWYA 3TAMA 4DV3F 4DPUA 5ETRA 2ZDOA 4HT5A 4LFBJ 2UVUA 1XJWB 3D6FB 2MDAA 4LT6A 4ZVPB 4LFCJ 3SCKE 1JLFB 2FPHX 4PZVA 2ZZNA 4AD6A 2BJ7A 3BQ2A 3VCDA 5BR8F 3MTJA 2ASDA 4Q2MA 3QO9A 5LSOA 3FQLA 3VV2B 1NDCA 3UN3A 2CZ9A 2VC1A 2I5JA 1M5PC 2HFZA 1MG7A 2RNEA 4CT8A 1S12A 3UCZP 4KKOB 1T03A 3TJAA 5AXKA 1UJ6A 3QFHA 1HBNA 2MLYA 1VRTA 3C16A 3E01A 1ZTWA 3R5CA 4QIVA 2V8GA 3MMAB 1SC4B 2F40A 3P4UB 2RVJA 2FLPA 3K2YA 1SH2A 1SQFA 4ZOSA 1U24A 2V63A 4J9PA 1GMVA 3B8HA 2YNHB 4CRJA 5HK4A 2HHUA 3OLAA 1N32J 4WIQA 3N6NA 4ETZA 4DR2F 3AHPA 4NA3A 1SBRA 3JSMB 5K8PA 4OI0A 2F7VA 4OLOA 2XLIA 1KTQA 1FT8A 4QWEA 1WC4A 2JVRA 4MK7A 2EFQA 3OBIA 2FB0A 2MQ8A 2W9BA 1NHUA 2VG6B 5LJ5Y 2ATCB 3MEGA 5B08A 2VICA 1RWKB 3KJVB 2LMIA 5HMWA 4N76A 1JKHA 3RB0A 2MLZA 2M5YA 1H72C 1NSKL 3L09A 3NS7B 3WHIA 2B4PA 3NNCA 5LMUJ 4OI4A 3CJQA 3GP9A 4KJIA 1RT1B 2GIFA 1Y10A 3CDUA 4EU0A 3MCMA 3HFZB 2HRTA 1G7CB 3N6MA 4P73A 2E1PA 5CHCB 5CD4H 1FKOB 4CYUA 5GMKa 3MDFA 4YUDA 2LXIA 1J5OB 2RIJA 2ROGA 3AQOA 2BKNA 3W61A 2U1AA 4EO6A 1SJ3P 5C24B 2UUAJ 3H2VE 3PTWA 3Q8PB 2NXUA 4HHHA 1RXOB 1UFLA 1QUVA 3LP1B 1ZZNA 2QRRA 4NMXA 3W9HA 3BQ1A 2HVHA 2Z2ZA 1KSPA 4RW9A 4ZA1A 4F25A 2WW4A 1NB2A 3NNHA 1LW2A 2BV3A 1LWXA 5A6WA 3GIMA 1VQMS 1K0VA 4RW6A 4WBFA 1A6LA 4J7CA 4ICLA 2QJ3A 1URRA 4KHRA 1HQUA 5KT2A 3ZXWA 4C98A 4L3KA 2PT0A 4NCGB 4OYMA 1TKTA 1Q81T 3JQMA 3ETMA 1IR1A 4BS2A 1EIYB 1P27B 4URSA 3QRPA 1ZM3A 2ACYA 3DOLB 1RT6A 2IBKA 5EWEA 3AQPA 3W2VB 1F6TA 3U02A 1S9GA 3M6XA 2YWFA 4PWWA 3C14B 1FFGB 3TYTA 3HJVA 5LMNF 1UEKA 5F41A 5KFJA 1KKHA 3HT0A 2ZH5A 2IRUA 3B4DA 4OLPA 3CSKA 4I56A 3U1MA 4ELVA 4B02A 1N5SA 4RUHA 5DS7A 2VC0A 1AYEA 3J7YU 3J7ZT 1Q82T 3GWCA 2RJZA 3KLHB 2C3OA 4ECWA 2RILA 1FFSB 2RRBA 5B09A 3H90A 2MEWA 2ATLA 5FD1A 1MROA 3MEEA 3DC2A 2H65B 5GAEI 3IGVA 1B99A 4A48A 2Q2GA 3TQEA 3CJ0A 2QLJB 3GG1A 1S59A 2D74B 4WIIA 4NOHA 1N33F 4LR9A 2RQKA 4NXNF 3ZTQA 3D9BA 2DNLA 2C2RA 4MH8A 4K4UA 2OD4A 2ZD1A 3VAFA 4HLBA 4O3QA 2B4VA 3N6LA 1RKIA 3EZ5A 4KV8B 2Y8WA 4F4YA 4UT4A 4FYVB 3C5XC 2HVEA 4QU7A 3TAMB 3KXDA 4ZPAA 5J2NA 2JLGA 3J7Z5 3G96A 2QLWA 1DQ9A 2XWXA 5KOXA 1UCNA 3HHEA 1WELA 2DR7A 3JXOA 5H9FK 2RDDA 4JI0F 1L3SA 3VHQA 3JTNA 2DCUB 2VFTA 3OFFA 1N0VC 1K1SA 2I5JB 3W8GA 4F8RA 2K1RA 1F5AA 2DTJA 1GX5A 1FRLA 1JWWA 5AE2A 1XEZA 3SI8A 1BQMA 1HBNB 1GMWD 2XNQA 4QYZK 3OUYB 1RZMA 2J6UA 4JI1J 1VRQC 3HFVA 3KK3A 2PN6A 3EICA 2PMHA 3W5XA 3PDNA 4O3OA 4CQ1A 1CC7A 1R8AA 5L1KA 4MIAA 4WTOB 2Y1LB 1XNQJ 1PO6A 1YRUA 1TKZA 1G4CA 4C4WA 4CZCA 1JLCA 2B7CB 5KG0A 5B0EA 3UO0A 5HMXA 2A2CA 3RBDA 4QIFA 1JLAB 1EP4A 4O3RA 4CLFA 4LR7A 3OQ2A 1PBUA 1IBMJ 4JYAF 2KN4A 1KRPA 3BGLA 1SIZA 2BEFA 3GR0A 5L38A 1FKAF 2GVDB 1QSSA 2LKZA 3IM9A 5MLCV 1KWMA 4EZ6A 2P6TA 1H7XA 4X4OA 1VBXA 3K0JA 4HTIA 3HSZA 1RJJA 2QV6A 3DGVA 3VGUA 3QGHA 1Y3KA 2F9DA 3QATA 4DZ6A 4DV2F 4LUBA 1RBAA 9RUBA 2FJDB 2VBYA 4JI2F 3KK2B 1JKHB 1RI7A 4HT7A 4RW7B 2FY1A 1U09A 2GZOA 1U1QA 2JEFA 1KVJA 3RJMB 1O6XA 5KG3A 4C7QA 2DHHA 1Q53A 4WZMA 4IOCQ 2GVZA 3DFEA 1OMSA 3ZTSA 3QJJA 3PX4A 2R3VA 2CQCA 4ZPCA 1NK9A 3LAKA 1WEZA 4X4QA 4BHQA 2OPSA 1WHWA 2CG4A 5HQ8A 1UKUA 3I5BA 2UP1A 1S9EB 3ENAA 3SEOA 4PEOA 1N36F 2E5IA 1HMVB 1DJ0A 2J0SD 2KHCA 3OJSA 1PAUB 5DG9A 4RL1A 1KOHA 4RW9B 3G9CA 3SQOP 3V6JA 1U0HB 1LW2B 2L48A 2RHSB 3IA0A 4ECXA 4RW6B 3PW5A 2D9PA 4ICLB 4QIEA 1SUQA 2VG7A 5C5JA 2VQFF 2GJIA 2CJKA 1C1CA 1FXRA 4C0OC 1TKTB 4J9KA 2QIFA 5IOLA 2N3LA 5A0YA 4JI7F 1TL3B 2MSTA 2DGUA 1XC9A 1IKWA 1HWLA 4OHZA 3H5SA 1RT5A 1RGVA 3AOBA 2IVYA 2LQ9A 2IAJB 5B0BA 2HW3A 1FNMA 3BGFA 5I3PA 4PKDB 2CNNB 5HP1A 2JL9A 3RBZA 2QFJA 4YDDB 4X4NA 3RR7A 3RW7A 4DSIA 3HD1A 3K5NA 1F0XA 4RR5A 3CVKA 3ICLA 1YDLA 2E44A 4RUBA 3T1HF 1H6KX 1RDRA 2J6TA 2AF6A 2H5IB 2HBZB 1FTRA 3MCSA 4ECSA 2I8EA 3TARA 3CPWR 2DHAA 4LRDA 2VFVA 4DDFA 4RW4A 1SL1A 3G82A 1RWMB 4X66F 4DWIA 3K57A 1F5BA 2YKNB 3MEEB 2MKHA 4ID5A 2F4VJ 2PI4A 3AH6A 3I9V9 4ZMMA 3BDPA 1D3WA 5BYRA 3KUHA 2WVBA 2MGZA 3U7JA 4C9DA 4XPCA 1ZYQA 2ACMA 2MQNA 4IYQA 1T94A 4YR3A 4MK8A 3K8VA 3G8TA 2VQEF 1WG1A 4CWBA 4FZVA 1NDPA 1PC4A 4KBIA 5L39A 1WWHA 1Y3JA 4Q5VA 2JZ5A 4GKJF 1C3GA 2KL8A 4W98A 4USVA 5DDOC 3CGIA 2BM0A 2KXHA 4F50A 3IBCB 1MU2A 4CLPA 1WG4A 3O2IA 2JLEA 3FBCA 1QAXA 1N6QA 2AGPA 2HWIA 2YVSA 2DISA 3ISNC 5A6PA 2R8JA 2L3MA 2FJXA 1FRJA 3TEGA 1RTHB 3CMQA 2EI5A 2K1RB 3GU0A 2PIIA 2ZEJA 1IBCB 1TL1A 4B3SJ 1SV5A 3AJDA 3M2VA 2AJ0A 1VQ4S 3M2UA 2DEJA 2G1HA 4ECUA 1U7LA 3LTOA 4PABA 4BWMA 3M8ZA 2FTRA 1W2IA 4LMZA 1X5OA 2MQQA 2RQCA 2QA1A 3ZO7A 3KK3B 1JLGA 2CKWA 2XLKA 4OYZA 2IRYA 1RT3A 1FE0A 2Q66A 2K8GA 3BSNA 2W01A 4LIRA 1AFIA 4DQIA 2EW9A 5K14A 2H1YA 3MMJA 1LFWA 1M90T 5DG8A 1JLQA 1TKZB 1R7IA 2NS1B 3IP0A 1PCAA 3A8KA 1CS4A 1S1UA 1D8ZA 3CE8A 2K3KA 3AJ2A 3VZIA 3HD2A 5EGYA 5IWAF 4GMKA 3MD1A 3EGZA 4NASA 4LF9J 4BWJA 2WVCA 3KHLA 3LP0A 3MM6B 3S1TA 4PQUB 4G6VB 2UXCF 1QAIA 1TV6A 2K7KA 4O23A 3T6BA 3TUIC 4DV1J 2NUHA 3HHLD 4JV5J 2ZM6J 4NLRA 4GC6A 3X1LB 5ETTA 2HK2A 1S1VA 3MGJA 2C1EB 1RT7B 4CLLA 4B3MF 4LVNP 1HA1A 4CH0S 4HH1A 2ADCA 2FHMA 1RWVB 1U26A 1LOUA 5IS2A 3E51A 3QMQA 2BW7A 3Q0AA 2V6AA 2ASYA 5E3RA 4K4YA 2B9XA 4D3GA 3JSRA 3PIOQ 3MUMP 2EFOA 4JI5F 2WZ1A 3SBMA 1WF1A 2FUG9 1S99A 2FC8A 2XGPA 2D9OA 1RSCA 5F8GA 3CCRS 2GVZB 4KC5A 1XMQJ 1X4HA 2J0XA 2UUBJ 1Q7YT 4A8SA 3J7AN 1T05A 2WSFC 1I3OB 4DV7J 1R8BA 1S72S 4LBHA 2YKAA 3KLFA 3TVYA 3GIKA 5KFLA 2CZ4A 3V4IB 4Y6IA 5HMZA 3ONQA 3NAHA 4LRCA 2E5HA 5T14A 4K2XA 2MQMA 4KPCA 4QW9A 2QMUB 3NY0A 1O8BA 2YQ0A 3J7A1 1RE1B 1XERA 1DBDA 1FNXH 4USTA 4EYIB 3FBBA 4M5NA 2E5GA 4QYRA 2B9EA 4ZCLA 5EX3A 3CCQS 1ITPA 2QLBB 1S6QA 3H40A 1UZDA 4BCAA 4J9QA 4DL5A 3CC4S 1VC6A 1GXLA 3EXCX 4DG1A 3QJLA 3RR8A 2XSFA 2HGNA 3DXSX 1OYEA 3RRKA 2P5VA 3TR5A 1N54B 2VG7B 3CD0A 3MR5A 4DCJB 2RKIA 2UZAA 4RWWA 1C1CB 3HHKA 3HZEA 3OHAA 2KH9A 4FPIA 1IKWB 3BV8A 5KFHA 1Q1KA 2LA4A 3SIPB 1VJQA 2HZVA 3ZZOA 1SKUB 2UV8G 3J81j 4NWBA 2R7SA 4DEZA 3MECA 2PSZA 4JI4F 2CPFA 2DGTA 1CG2A 3P3DA 2KFZA 1IBKJ 4ZJQA 1EX8A 4DR5F 4LSLA 3NGDA 4DQPA 1CBKA 2UUCF 1S1WB 2DT9A 4DHVA 3MF5A 1PAEX 4WU2A 3K59A 1X5PA 3KTQA 4OHWA 3G82B 4RX6A 5E0OA 4RLEA 1HYSA 2OPPA 4OQJA 2N82B 4K4SA 4X4SA 4NLPA 5IXUA 4ID5B 1YJRA 4PXCA 1PJ6A 3Q86A 4FYYB 2KM8C 4KGZB 3G8SA 2W9CB 2OH2A 2W1BA 2VBZA 1C0UA 1VQ8S 3PX0A 4YB5A 2MGZB 3HVWA 1P9YA 2OHDA 1NM2A 2Z56B 5DZ6A 5I4MA 1X0FA 2BXJA 3F0NA 2HURA 2UU9F 1S6OA 4F2SA 3KYLA 1YIJS 4DZDA 2XMJA 3IS9A 2QMWA 1TFYA 3CD7A 4JI8F 2V5HG 3Q8RB 3AA8A 3QGIA 1UEUA 1UA0A 3R3TA 3M8QA 2F4FA 3U1LA 3CMAS 4EYHB 1RAOA 2KRRA 2DH9A 1TUWA 5C2CA 2A10A 3TW0A 3KDOA 2ZKUA 4RBUA 3BF4A 1RHJB 1SXLA 3QAEA 3MTKA 1UTAA 1TL1B 4JP8A 3H8YA 4OYOA 1RADB 5LXRA 1WKLA 2K7JA 1HWUA 3D7SB 5A76A 2O01C 2HNDA 2XYGB 3D1HA 3LPYA 1UAWA 3IWNC 4Y00A 4A47A 3DU5A 4DPOA 1NKEA 3QIPA 4FF4A 4Y2MA 4X4UA 4K8RA 4R25A 4AL7A 5I42A 1I5OB 4HKQA 1NAQA 5HQLA 4FP9A 4N77A 2UVVA 3HDSA 2ZBQA 2HQFA 2GS8A 3CJ2A 3W64A 4DL4A 3FFIA 4R8UA 3I9ZA 5KFQA 1JLQB 4DX7A 2C2EA 4M94A 2FY8A 2A6MA 4RBVA 3TVZA 1WACA 5MAOA 4TNOA 4DOZA 1PILA 5HVHA 3CXCR 1X0PA 3GFHA 4CLZA 3LP0B 1HFEL 4DSFA 3AGXA 4MIWA 1REVA 3EE3A 2GNKA 4TY8B 1T9TA 4JI3F 2Z58B 4AXJA 1N5YB 1VQ6S 1FDAA 3CJKA 1TMJA 5D4PA 1HNWF 1XAOA 3TJ8A 4LF2A 1EETA 3RBEA 4FYWB 2P8IA 3MPUB 4NPOA 1HKAA 4RZRA 1TAUA 3EJMA 3KG0A 3UVJA 4OYIA 1ZETA 3H2UB 1GAOA 4UOGA 4ITSA 1ZZFA 2XMVA 4V19J 4W90B 1HNZF 4XDCA 2YNGA 4DR1J 4CP5A 5KFPA 2R8IA 2KFNA 2YXLA 1FDNA 5CH7B 2VASA 4I2PB 4LQ3A 2IPOB 2H5JB 2ILYA 2ZH8A 5D0GA 4ILRA 4Z7CA 4QIWD 1NJIT 1RYRA 3QGPA 2V4RA 3NGTA 2GO8A 4Y2KA 3IGNA 3T9NA 1KTVA 1NBEB 3KLFB 1U0SA 4X64F 2DNPA 2E5LJ 2L08A 3LALA 2AYBA 4RBTA 4LRBA 5BYSA 4YHHF 1HWKA 1YBAA 3NGRA 3PRDA 2CPEA 4OHVA 5KFIA 3OTEA 2LQJA 2CUYA 1R8CA 2OSQA 1RWOB 3O6QA 2XCPA 5IV3A 1TP7A 4B3OA 3LWMA 1R0CB 3PR5B 2QZ8A 1K8AT 1HNVB 1S6QB 5A2QU 1AUSL 4C11A 4DFKA 3MPVA 2ZJPQ 4URQU 1NHVA 4K0KJ 2GQQA 1X4FA 3GYNA 2DR6A 2DH8A 3G8QA 5F9LA 3NGKA 4OI2A 3P5TL 2RKIB 2X7IA 1KS2A 3DI6B 3SQGA 1A9NB 3VVTA 1JQGA 3W1YC 1RAGB 3U1NA 2HNYA 2VFSA 1L3VA 3HK2A 3FZ2A 1EQ0A 2JFDA 1KP6A 1U6ZA 1DTQA 1OQ6A 4GVBB 4E8UA 2QMXA 1PYSB 1DAXA 1XN9A 2XMWA 2B4UA 4MMOA 1SH3A 1TUGB 1LNQA 2C2NA 1MN9A 5B0CA 3CCWA 2GW8A 3CW2C 4TYAA 3EGNA 1ICEB 2HNZB 2ZUAA 1IQTA 2HGLA 2RQ4A 4LSLB 4OZ0A 4DFJA 1I51B 1Q4RA 4F3MA 1IR2A 3ELHA 3PV8A 3HVRA 1RAAB 1MMDA 3KG4A 1F2HA 3IWLA 2E66A 1IM6A 1XNRF 2BJEA 3N01A 1D0EA 2H51B 1C0UB 4A46A 4DV0F 5L9NA 3A8JA 5JUMA 1U47A 3CJ8A 2AP6A 1FJCA 3FNNA 4OFZA 4XAKA 5JVHQ 5F3TA 1RCOB 2KU7A 4HTJA 1JNZB 2G2OA 2ZH2A 3CULA 5ETSA 4X84A 4QBUA 4NA1A 1UVLA 4AQYJ 2AGOA 4DU7A 3IS9B 2IRXA 3IAM9 4OZ1A 3UQSA 4U7UK 3BEGB 3CJ4A 3NL0A 2VA3A 2ASJA 5DRKA 1C0TB 3UE2A 3DLKA 2JRRA 3M8QB 5GADI 2KT2A 2PO4A 4OI1A 4LF6F 3BGUA 3LH2S 1ZPWX 1UP1A 4EEYA 5LT5A 3FEYB 4F0KA 3MEDA 3W2WB 5CZXA 1ACMB 2MJUA 4YN3B 3C6UA 5THWA 2Z2YB 2VUGA 4OZJA 5IV4A 5F8IA 5GMDA 2VODA 4ZLLA 1SJFA 5CXTA 4ZPTR 3W60A 3CJ5A 2OPRA 1NJXA 2BA9A 5KG4A 1YK9A 2ZH6A 1N48A 1U48A 1QTMA 4EBDA 1SKSA 2A18A 1PIEA 2OTLS 3VF0B 1UZHA 2CG8A 3BGRA 1LWCA 5CYMA 5HSPA 1OY8A 4HHJA 1UVJA 3S7RA 2W8KA 2HG4A 4USIA 4KRWA 4O4GA 3D66A 5KT3A 4W4MA 4C48A 3FFIB 1Y11A 5C25A 1UVNA 3DGPA 4L76A 2FLOA 4CO5A 4F0MA 3MM7A 3AKOB 4X62F 3Q24A 1SQGA 2V8PA 2HGMA 3HHLB 2G0IA 3L7PA 4EO8A 2QC3A 1H2TZ 4H4OA 3C15A 1N34J 4KT0C 2BW2A 3FMBA 4IH5A 1EETB 1D9AA 2CPDA 1PYOB 2HS4A 2PMWA 2DRDA 5EX0A 2VPXB 2WSEC 2ZVSA 3UVJB 5KT4A 2FJWA 2AYGA 5AJ3J 4OJGA 3BN7A 1XR6A 2W2OP 4BLGA 5DQIA 1MNEA 2IA0A 3UFCX 2CIMA 2LEPA 2CQPA 2YNGB 3RZAA 3RAXA 4A8YA 1YKWA 2BBEA 3I0SB 2EG2A 1UWAA 2WOMA 1K47A 2M9KA 3QZ8A 2LEAA 5GMEA 3GIJA 2MJNA 4TU8A 5H9EJ 2WVFA 3SMZA 3M9NB 1JLBB 1U1RA 2VG5B 4X65J 1OS5A 4QOTA 1Z2LA 2GMJA 3BSAA 3M8RA 2J7UA 3CDAA 2PD1A 1SQEA 2MY8A 4N56A 2ZOFA 1QSLA 3A8IA 2DNGA 2B51A 1K44A 3M8WA 1HBMA 3HVTB 4TLQA 1WC3A 3RGIA 2D3UA 3KK1A 4B3OB 4I6AA 2BRKA 4PAAA 4OL8A 4Y65A 2YKMA 2LU2A 2ZHBA 4WFBQ 1RHUB 2XLJA 2M3DA 2MY7A 2MKCA 1VISA 5D8HB 5HBMA 1R89A 4C11B 2OEMA 2W7OA 3ET6A 4DR6F 1UVIA 4LJMA 3MM9A 2CAJA 4LF5F 2A3JA 2CPHA 2ZE2A 2ZVIA 4O44B 3BO2A 3PO4A 1O51A 1M5SA 5T41A 3CCES 3ZC4A 4IKAA 3PW4A 2Z4PA 5LXYA 1QE1A 1FHTA 2CQIA 3G4SS 1VIOA 3PYFA 7AT1B 3QT6A 4ANCA 2V2QA 1YJTA 4IDKA 4WKYA 2BOPA 3MPYA 3P5BP 4FPRA 7FD1A 3CJTA 2HNYB 3OVBA 3DMJA 4OMFG 2CQ1A 3G6VA 4KPYA 2IA6A 2KT5A 3CDEA 3MMCA 4LFBF 1NHKL 1YQHA 2B43A 2PI5A 4LFCF 1PJ7A 2XBPA 2UUWA 1PJ5A 5IT9U 2O1PA 3DRYA 1NU4A 1WD6A 4OJ1A 3LOUA 4Q0BA 1M5OC 1TK5A 4WPAA 4ZVGA 1X9WA 2EKYA 4A8OA 4OZNA 2DCLA 3M4XA 4QWDA 1UPPA 1VBYA 1JJCB 1GT8A 3MOJB 1RTDA 2NXJA 3PJXA 4NA2A 3ISZA 1RABB 2HIQA 1RHMB 3M32A 4NCBA 1AB8A 1LKZA 1JB0C 4LQ9A 3Q23A 3R27A 3ENWA 3R6GB 3TJ9A 2XULA 2YWGA 1PG5B 2ZKTA 1FTCA 3MR2A 4MKAA 3S8SA 4QWCA 2VKRA 1GQEA 1CSJA 2C2KB 4R5PA 3H5YA 2E7XA 1SC1B 3NOCA 5J2QB 1N32F 4UY8T 2DR5A 1HD1A 1VBKA 3MMBA 5E2QA 3H7HB 4UUWA 4LR8A 2HQ3A 2XMTA 2RDJA 3U27A 4KGMA 3AGYA 3DDIA 1G2EA 2LYVA 3DHWC 3G6XA 4I1TA 1ZA2B 4HHUA 1UL3A 2GFFA 5IT9Y 5F3ZA 2F1FA 2LQ8A 1DTTA 5KFUA 1CJKA 4NLTA 1VOMA 3RB4A 2ALYB 3K7RA 3M8SA 2ZOGA 3BM7A 3PX6A 3MEDB 2VOPA 2JOQA 5E33A 2Z30B 2JSXA 2W2PP 3C6UB 1RU2A 2CQ2A 2JZ8A 1LEOA 3PJ9A 2IM2A 2HHVA 4UY85 3NGUA 5LMUF 1FNOA 8AT1B 1YWXA 3WBZA 4CLWA 1HNIA 4K4VA 3DDKA 3K5PA 4I7FB 1SB6A 3MAAB 3G71S 1SKRA 2VJUA 4KHPJ 3BGRB 1LWCB 3OTDA 3SXLA 1A7GE 1X9SA 2BE2B 1OY9A 4Q45A 4WTYA 3T9ZA 4CI0B 2ZWPA 3H4BA 4O4GB 3W66A 4C8LA 5C25B 2XS7A 3JTOA 2UUAF 2JNJA 3MI7X 3FGVA 1FCAA 1NK4A 1T0TV 3I5CA 3R2DJ 2BMBA 4C0BA 5D3GA 4ZPVR 1EKSA 3TO8A 4ED4A 3O44A 3DU6A 2DPJA 4Z2XA 3C15B 3ILJA 1FWLA 4ZHRA 3ITHA 4J9NA 4JI6J 4WK1A 2FHOB 2QGFB 4FBTA 4OZ2A 3GG0A 1VYAA 1AA1B 2HIYA 4IO9Q 4QU6A 2HFOA 2GAGC 3VVUA 3S01A 1RCXB 1WDDA 3IRXB 5ETNA 2DITA 3LP2A 3UCUP 3FSIA 2WOMB 5L8RC 1W7WA 4PWDA 1AZSA 5LL6d 1Y00A 4RKUC 1VR6A 4B9UA 4YDXA 3HJFA 4O3SA 3FJ2A 1N5QA 5FDLA 1HIYA 1M1KT 1RTIB 2XTJP 1NSAA 3UD3P 4KGVB 3QSYB 4N47A 3I55S 4A8KA 5JJBA 1FKPA 5HROB 1V3ZA 3VAMA 5B7WA 3RUBL 1DLOA 3OXFA 1QSYA 3IG1A 3BZQA 1HBMB 2AZ3A 1E6YA 2LDYA 4J9RA 3WIVA 4P6QA 3TVKA 4ZVUB 4ECRA 2ERRA 4PG6A 2WAQD 3GPAA 3ET6B 3MM9B 4LF7J 3W9JA 2ZE2B 3Q2TC 1UVKA 4MKYA 1AXQA 4PPZA 2HHHJ 2YH0A 3LGMA 4PCQA 1FK9A 2F5GA 2BUNA 1QE1B 4AYBD 2R4FA 4Y34A 2LEBA 3G86A 4K50A 3M7VA 4IDKB 4J5OA 4U6PA 1LW0A 1SIWB 2YKOA 3DMJB 1PGZA 2XGQA 2R42A 3M2RA 2J0QD 1S9FA 1NK6A 4RNOA 2XZDB 3D0HE 4BDPA 1YX2A 4FYXB 4PG4A 3MMCB 2GC8A 1N5VA 4FN5A 5ETKA 3Q8UA 3D0IE 4UW2A 1J5EJ 4HL9A 4LIWA 3UWTA 2CA9A 2O3DA 3GR1A 4M5GA 1OQ3A 3DLEB 4B9NA 3B78A 4YY3J 1QUPA 5L9XA 4DFMA 4Q0BB 5L1LA 1V9OA 2DGXA 2JEIA 1UWBB 3CC7S 2V94A 4QR2A 3BR9A 1VHIA 4DPYA 2Y1RI 2DRBA 5DM6Q 2EG1A 1S76D 2C2ZB 3M1VA 2RU3A 3C6TB 4K59A 5CCLA 2GJ2A 2XY7A 1R8PA 3HMJG 1TAQA 3WZ0A 2DK2A 1B3TA 3CD6S 4RW8A 4DL7A 1MW7A 3C66A 1WC5A 4DL2A 1B70B 1X4GA 3FK4A 2V9KA 4JI1F 3OFEA 4TKTA 3DOMA 1P8GA 1S6UA 2V8VA 3DLGB 8ATCB 4E98A 3JSBA 2QT7A 3R6LB 2IJNA 2DNYA 3THVA 2G0JA 2E1CA 1BWVA 4ED3A 1XNQF 4P7VA 2HQCA 2V2ZA 3MMBB 1ZS6A 4ECQA 3PIPQ 3D6HB 2AX0A 1JJ2R 2FQQB 2VV5A 3OL8A 3QT7A 3FCHA 3MR7A 2IMOA 1IBMF 3DM2A 2HMIA 3VAHA 3UNYA 1U6FA 4TVAB 5SZTA 2HQIA 1T9UA 3PY8A 1T02A 2JC0A 3B6BA 3M8PA 5DGAA 5ETPA 4DX8H 1FJGJ 2DNOA 1S0OA 2CQ4A 1CJKB 5GAHI 5HI7A 2WVEA 1WF2A 4DJBA 3EMTA 3AOCA 3MM5A 5LJ3Y 2CPJA 2L41A 2XQCA 4R0JA 4NLXA 5A8WA 1BGXT 2WW8A 1OIAA 3M6WA 2GCFA 3DNCA 2M8HA 4EZ9A 1JJHA 1G1XA 4NX9A 1HNIB 1S4FA 2CQGA 1WI6A 4WP3A 2ZH3A 3BBFA 3POTA 1FD8A 3PVXA 1RA7A 1WDTA 1QAJA 3V81A 3DRRA 3LQVA 3VQTA 2L9NA 4P75A 2UXDJ 1PC5A 4NLSA 2B5JA 1KVIA 5B0DA 3RAQA 5IQQA 1U02A 4X4TA 1EQMA 5D77A 4MJKA 1VS3A 1VQ9S 2AJFE 3NMAA 3M8YA 1TUVA 2DXEA 3QPIA 3ZZTA 5B0FA 1S57A 3C2PA 4L73A 4LREA 4ES2A 1KVKA 2LXUA 2FHJA 5GAGI 4OJ3A 5A8KA 3LANA 4M5IA 4G65A 2OMLA 3BSOA 1D8YA 4NLQA 5U47A 1VMBA 4Q43A 4MT1A 4H4MA 4J9UE 2FHKA 2DHGA 1T9XA 3T1YJ 5KFWA 1J27A 4WK3A 4YB1P 5HANA 5J2PA 1VI7A 2IY5B 2FDNA 3BBBA 3PG9A 2E29A 2ZBIA 5D0HA 3LP2B 2DRAA 4P74A 3BQ0A 2MLXA 1IXKA 3UW1A 4CO3A 4DLGA 3GFZA 3HXMA 4C3KA 3IR5B 4JUZA 2SXLA 1T3OA 1FRHA 5FDLB 4DUYJ 3ZZZA 1LWFB 1TR0A 4OZ5A 2BJ3A 3QWPA 5ETQA 2GQ2A 1MWZA 2B6AA 4Z37A 5EWGA 2AMCB 2ADBA 5IM0A 3SSQA 1FRXA 2H4YB 2GQCA 4DV6J 3W8PA 1EARA 1WC0A 3MAHA 2DEIA 2XSJA 4I69A 4NI2A 3VALA 1K0TA 4ILLA 4KO0A 2CVEA 4E2FB 2HHQA 2BJ9A 2KJVA 2RSQA 2NUUG 1CJTA 3PYGA 1GX6A 2H4WB 3GSDA 2QX0A 1N56A 1FRIA 2FJEB 3PZPA 4G1IA 2F4VF 4CCHA 4ELTA 1LFPA 4UQGA 3CDBA 3PNIA 2XYHB 3FZBA 3H2LA 1N88A 2BDPA 1UVMA 4Q2LA 1HBUA 2V0NA 1X5TA 2VB6A 3OL6A 4TU9A 1YZ7A 3M05A 4MYTA 1U1KA 1F2GA 2M7SA 2IM0A 1WOPA 5T7LA 2FZCB 2Y3YA 4OYWA 1CC8A 1WEXA 1WKJA 4F2RA 1UW9A 4OYXA 3M2RB 2EFVA 1WSVA 3IFEA 1R6YA 2AD9A 1U4BA 5G0RA 2QL7B 2YX7A 1VQ5S 3DRSA 4LBIA 3LPEA 3N5BA 4IRCA 3L7UA 2F3JA 2J9EA 4FNIA 3KMSA 3N5FA 3PM9A 1MLAA 1OYDA 2PMZD 3HULA 1IBLJ 4XK8C 3OXLA 4JBCA 4IH6A 3GJSB 4C8OA 2A1BA 3TP2A 3VTIA 3BSCA 2DNKA 2R9LA 2XMKA 4B3SF 3HO1A 3M1VB 3NAIA 2OLWA 4DUTA 2QSFA 4AFFA 2HBYB 1DURA 3BJYA 4N41A 3R5GA 3KLIA 1S1XA 4IFYB 3UR0A 4ZVOB 3ULHA 2RRNA 2LDIA 4IFVA 3T5JA 1EB0A 2B3TB 3EYZA 1ZH5A 1KQSR 3DOMB 3SCLE 2EWHA 3G87A 3RU0A 1CQNA 1OPIA 2J0WA 3GE9A 1UW4A 2RS2A 4ZPDA 1WTBA 3RG6A 1Z4UA 2EVZA 5LM7E 1U2RA 2HWHA 2AYMA 3W3SA 2JEJA 4EUVA 2FGOA 1M5KC 2KG1A 1HQEA 4GRSA 4Y3CA 3MCNA 2YNFA 4B9SA 3CCJS 4LF9F 1O0PA 4TU7A 5HLFB 1HR0J 4DPWA 1RAHB 5HAOA 3V6DA 3ISND 4KYZA 2EXUA 4WE1A 1KLMA 5L1JA 7FDRA 2V4JA 3GIRA 4I4BA 3VR1A 2HMIB 3GQCA 2X51A 1K73T 4DUZJ 4DV1F 1H3DA 3DRXA 4JV5F 2LCWA 3CD5A 1D09B 2ZM6F 3H25A 3V6HA 4URGA 3AB2B 1I6JA 2HWTA 2XMAA 3KUGA 4OJHA 4X4VA 4XIUA 1V3SA 2XS2A 3M30A 3M8PB 2CJYB 1S7IA 3CIMA 4RO0A 3SSRA 1WHYA 2YWWA 1E6VA 2BX6A 3OR1A 3B82A 2J7WA 3CCLS 1NCLA 4UZCA 1NLKL 5J1PA 3ZTRA 5KG2A 6FDRA 4A4JA 3J7YI 5A8WB 1BD6A 1S0VA 3GCWP 3BR8A 2ABYA 1FERA 1IKVA 3PO5A 4WKRA 2B8QA 4ZVSB 2AEMA 3LGHA 5KFNA 4PXBA 5K20B 4F36A 3GIIA 2MKYA 1GNKA 3QO9B 3POTB 1XMQF 4FKYA 2UUBF 4AUKA 3PHEA 3V81B 4GVLA 1VQ7S 3LW5C 2B5JB 3CT9A 4DV7F 4MFBA 2R2TA 3ETOA 1T03B 2U2FA 2MHNA 2NXNA 4ED0A 1VRTB 3C16B 3E01B 1SKWA 1WUUA 1YBTA 2AEJA 1NLTA 4FNHA 3NEKA 1GMUA 3MR3A 2OEJA 2FVCA 3KJNB 2ZH7A 3KLEA 1YZ6A 3P96A 4LF1A 5M2PA 3ZNJ1 3FCWA 5EN1A 2BQRA 2R7XA 2OKQA 1CJUA 4C8YA 3R8YA 5D6GA 5A8KB 3PW2A 1MSWD 1FESA 4M5DA 3KLVA 2VPYB 5KFXA 3EXYA 1NK0A 2AJ1A 3EGVA 1U8SA 4NRUA 1ELOA 4U95A 4DPXA 5J2PB 2V8HA 2XMUA 2LU1A 1FEEA 4HI1A 1ZM9A 4ZPBA 4GKKJ 5KFTA 1YTYA 2N4CA 3I5AA 3NCRA 2W9BB 2EK1A 2D3O1 1W26A 4ZK7M 2FYXA 2M8DB 4DXLA 2NPFA 1FWKA 5B0GA 4CTAA 3A3PB 3MEGB 4DN9A 1JJ4A 2HLTA 1VBZA 2KFYA 2EBEA 5KFKA 1DY3A 4DSKA 3BKUA 2AJ2A 1JMTA 1U2FA 1WOSA 4H54A 3I32A 1XK8A 1KFDA 2B6AB 1YHQS 2CJXB 1XTZA 1JLEA 1PSDA 1QY7A 1IBKF 1JLFA 4WFZA 2W8LA 4DL6A 1X4CA 2XSJB 4NI2B 4IR9A 4ZP6A 4HVZA 1GFWB 1X5SA 4CYUB 2VBXA 5AE3A 3OXGA 2I6WA 2AKWB 1TK8A 3GJQB 4YEAA 2D69A 3TRGA 3W63A 2W4CA 4FXWA 2ZZMA 4I64A 1P1LA 4KH0B 5KG5A 2WBMA 1WG5A 1C2PA 1HBUB 1KONA 3JSYA 4QCLA 3MMAA 2DD8S 1FEHA 3GILA 3C19A 4DV5J 3ILOA 5DJBA 1HD0A 1I94J 2R8HA 2XC9A 4NXMJ 2MZSA 4D3HA 2FGCA 2M52A 2QYCA 2OTJS 3L95X 3AD7C 2XY5A 1Y0HA 4H4KA 3DRSB 1KC8T 2G13A 2X3GA 5KT6A 3MZIA 1OJ4A 1HQUB 3HZGA 1L5UA 4EBCA 2B56A 1FXDA 1HWJA 3UN5A 2MZ1A 1TL4A 2Q6CA 4XO0A 3D68A 5KAKA 1VGYA 2ZH9A 2W4DA 2KHDA 2XO6A 1RT6B 1UJ5A 3UD5A 1YJUA 4QW8A 5KFYA 2BRLA 4CNZA 2IMWP 3EVMA 1S9GB 2DNNA 3MUTP 2R2RA 3KLIB 4C8NA 3V2UC 4MKBA 4IFVB 3KJVA 3ZNUA 2C28A 1JXLA 1X4BA 3RYLA 3OSNA 3QNWB 4H4KC 3THPA 3QZ7A 4DX5A 1GK8A 2HVZA 2HLUA 2DYAA 2KXFA 2UV8A 2OIHA 3M9MB 4K4TA 2CQBA 3N4WA 2CPZA 1S1TA 2HFSA 1GTEA 2QO3A 4B3RJ 4DQSA 3PEHA 2D3ZA 1X4AA 1MROB 1R31A 1B7FA 2YNFB 3AODA 3H98A 4FXDA 5I3QA 1B0VA 3G6YA 2UXBJ 5FLXU 3V6DB 3KMQA 1KLMB 1IKXA 2FJBB 2ZNYA 2HYIB 1URNA 2CJBA 3GFYA 4Q8EA 1JXEA 4ALZA 4V19X 4RWXA 4ECYA 1U2CA 2XYPB 3F56A 2ZHAA 2ZD1B 2C42A 3M30B 4UF4A 2IVFB 4M5JA 2M2BA 2YX1A 5RUBA 4CO1A 1E6VB 4LF4J 2DKOB 1R43A 1VRUA 5BXIA 2RUGA 2RDIA 1VHFA 5J2NB 2HBRB 2R7VA 3FEXB 5CCMA 4F4KA 4DR1F 1YVFA 3SCJE 1WF0A 1N0UA 1YJ9S 3R5AA 4DV4J 3CWJA 4NLVA 2V50A 3BKTA
chains in the Genus database with same CATH topology
3AGZA 3TJAA 1GMWA 1C3GA 3I38A 3L9ZA 3AGYA 3LZ8A 1NLTA 3LA0A 2HFVA 1XAOA 3TJ8A 2B26A 1EB0A 3NXZA 1GMUA 3TJ9A 2Q2GA 1EARA 1GMVA 4J80A 3AGXA 4L3KA 3NY0A 2QLDA 1GMWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGZ A;  3TJA A;  1GMW A;  1C3G A;  3I38 A;  3L9Z A;  3AGY A;  3LZ8 A;  1NLT A;  3LA0 A;  2HFV A;  1XAO A;  3TJ8 A;  2B26 A;  1EB0 A;  3NXZ A;  1GMU A;  3TJ9 A;  2Q2G A;  1EAR A;  1GMV A;  4J80 A;  3AGX A;  4L3K A;  3NY0 A;  2QLD A;  1GMW D; 
#chains in the Genus database with same CATH topology
 2AW0 A;  1WTF A;  2N4D A;  3VWS A;  4OX8 A;  4UZB A;  1HAR A;  3T5K A;  4L6V 3;  3FDS A;  3DOL A;  4ZKA A;  5BJR A;  4F3O A;  4DPT A;  1RTJ A;  4MFB B;  1SJ4 P;  4QZV B;  3CJ3 A;  1NB7 A;  1RTZ A;  4DR3 J;  2E5L F;  1BY9 A;  3V6K A;  1BQM B;  4IRK A;  4KE5 A;  2J8A A;  4K5S A;  1RK8 A;  3I82 A;  5CZV A;  3BB5 A;  1FO1 A;  2OGU A;  3KLE B;  1SJR A;  2V2K A;  2B26 A;  2X1B A;  2AEF A;  3LGN A;  5FLX Y;  3VGS A;  1CJU B;  2DR9 A;  2K3I A;  1RWW B;  1TEL A;  2FLN A;  5F8H A;  2ZH1 A;  4M5D B;  1JLC B;  1EJ7 L;  3KLH A;  3N0V A;  5ETL A;  4BBY A;  1CJV A;  1EP4 B;  1NZ8 A;  3IWX A;  5F8M A;  1N8R T;  2VF3 A;  5IT0 A;  3WIU A;  4CO4 A;  1GEH A;  3FBF A;  4OX9 J;  3FSY A;  2C22 A;  4O3P A;  1RHQ B;  1ZM2 A;  2DPI A;  5ETO A;  4WWS A;  1WKK A;  1KQF B;  4WXO A;  5KFG A;  3ZZR A;  2CPY A;  4KGX B;  5F0U A;  2LP4 A;  4J90 A;  2R7T A;  3EZU A;  4CTA B;  1FD2 A;  3CCZ A;  5IC6 B;  2H54 B;  2BZ2 A;  2GJF A;  2C3M A;  4J91 A;  2I2Y A;  5LSL A;  4NLG A;  4ZCM A;  3HLU A;  4ZP7 A;  3PFO A;  3DDN A;  2NZ4 A;  3DYA A;  1VC5 A;  3Q8Y A;  1X8D A;  3NS6 A;  1JLE B;  1WNE A;  3O1L A;  5M2U A;  5GAG U;  2W7P A;  4FVC A;  4N8O A;  2JVO A;  1VQN S;  4ERD A;  1U1M A;  2OFG X;  3PHT A;  1D1U A;  3NXZ A;  4C3L A;  2BQ3 A;  2POK A;  1T9V A;  5E3C A;  3WC0 A;  2OPS B;  3QWU A;  1NDK A;  2CPI A;  2BM1 A;  4L3N A;  2PFD A;  1FJ7 A;  3L9Z A;  3NGS A;  1RAE B;  4WU3 A;  3OUY A;  4DF4 A;  3CCU S;  3BS9 A;  3OR2 A;  1PKU A;  3W7B A;  1FVS A;  2Q1L A;  3I4H X;  1QLN A;  4ANE A;  4I0W A;  1YJV A;  3ILI A;  2DO0 A;  4I2Q A;  2UUT A;  3QID A;  2LVW A;  2YY3 A;  4ZP8 A;  4LF8 J;  4AQY F;  1F60 B;  2GAH C;  1GTH A;  2QG9 B;  1UPM B;  2NYI A;  4Y0F A;  2B0G A;  2B8P A;  1SUQ B;  3DLL Q;  2J5A A;  2D41 A;  1IWA A;  1JLA A;  1H7W A;  4B9T A;  3MHY A;  1YBU A;  1T8E A;  1QTN B;  3PFE A;  4TN2 A;  4WJB A;  1WOR A;  5A0Y B;  5EUH A;  3OV7 A;  3BH7 B;  2GVD A;  5DET A;  2VA2 A;  1U45 A;  3CCT A;  2KZZ A;  1RT5 B;  2DGV A;  1HI1 A;  4U7C A;  4KHM A;  2XEX A;  1HHQ A;  2EKN A;  3ZZ0 A;  5HP1 B;  1H38 A;  4OI6 A;  2KDO A;  5E3P A;  3BRE A;  4NLD A;  2ILZ A;  2XCA A;  4LFA J;  3DKD A;  4X4R A;  4ZN1 A;  3TEH B;  3KK2 A;  3OVS A;  2HQD A;  3PRB A;  4RW7 A;  5BYQ A;  4DCO B;  3TZW A;  1H0H B;  1GH8 A;  4USM A;  2CPX A;  2LXF A;  1H2U X;  2X1A A;  4ZIV A;  4MK9 A;  2CRL A;  4RPF A;  2EBG A;  3FSX A;  1NJY A;  4RW4 B;  4B3T J;  4YR2 A;  1S1T B;  2G9O A;  3R5B A;  4DL0 C;  4LBP A;  1KLN A;  4FVM A;  2WTF A;  1X4D A;  2RQM A;  1IKX B;  2QFI A;  1S9E A;  1ULR A;  3UN2 A;  2M70 A;  2XZW A;  1HMV A;  1N34 F;  4ZDN A;  4ZLJ A;  2KVI A;  3IR7 B;  4KFB A;  1U1O A;  4P7T A;  1VIX A;  5DQH A;  2NRE A;  5IC4 B;  4B17 A;  3VAJ A;  4PXD A;  1U0H A;  5AJ3 F;  2JLF A;  1FA0 A;  1BXN A;  4USW A;  1VRU B;  4I6Y A;  4A8M P;  2OSR A;  2F65 A;  3WQP A;  4ZJL A;  1MWQ A;  3Q8V A;  1AW0 A;  2W4P A;  3OTO J;  1MU2 B;  3K5O A;  2B9Y A;  3PYD A;  3LA0 A;  4RUC A;  1N6Q B;  2DR8 A;  4B08 A;  5FII A;  1C1B A;  3Q2S C;  1XR5 A;  2DGO A;  2XO7 A;  4TXS A;  4KIA A;  1YI2 S;  5JXS A;  3M9O B;  4JOU A;  1TL3 A;  2RE1 A;  2Z2M A;  1EKR A;  1SV5 B;  3M2V B;  5GAE U;  4DQR A;  4WCE Q;  4KH1 B;  1RTJ B;  4CLU A;  4X65 F;  3MD3 A;  1QAY A;  2DGW A;  5DQG A;  3J81 U;  3IO1 A;  3M2U B;  2CNL B;  2IAJ A;  1P9Q C;  1YJN S;  2YX4 A;  3GV8 B;  3W65 A;  5D0E A;  2EPI A;  1HNX J;  4F4A A;  4RU2 A;  1JLG B;  1Q86 T;  1XIQ A;  2V34 A;  2YWH A;  2ASL A;  2I38 A;  4Q44 A;  2Y8Y A;  1RT3 B;  1Q7L B;  1U8W A;  1EHW A;  3GFX A;  3IRW P;  2Y1I A;  2AGQ A;  3LZ8 A;  1D9F A;  2CWX A;  2COL A;  5K14 B;  4EFA C;  3HT3 A;  1EZZ B;  4FDF A;  5KFA A;  4DS5 A;  1CS4 B;  1IWG A;  2Q79 A;  1QDU B;  1S1U B;  4Y28 C;  3AAW B;  2GML A;  4NZ7 A;  1CJV B;  4DCP B;  4WFN Q;  3TZX A;  3LWL A;  3W5Z A;  4F0H A;  3PKM A;  2YKN A;  1IKY A;  2I0X A;  2WSC C;  1TV6 B;  2FVQ A;  3SSS A;  3VZH A;  1VDH A;  3AD8 C;  4OI3 A;  4M95 A;  4N7T A;  2AT1 B;  2PDA A;  1S1V B;  2C3P A;  4FS1 A;  4RUA A;  2ZC4 A;  1N4L A;  1XMO J;  2YWK A;  1S10 A;  2QLD A;  3BGO P;  2XB2 D;  4PXE A;  2Z57 B;  2K2P A;  3RB6 A;  2IDE A;  2MPU A;  1NUE A;  1L3U A;  3UDV A;  3MM8 A;  4JV1 A;  3DYA B;  2RAQ A;  3WDO A;  1UMJ A;  3J81 Y;  2CXE A;  1G3O A;  3ZTP A;  3AFG A;  2ZDP A;  3FQK A;  4AXI A;  2AV5 A;  1T11 A;  4KAI A;  2ZIT A;  1S0M A;  2HRY A;  1J2V A;  1RTH A;  3MAQ A;  3HSJ A;  1FF2 A;  2KT3 A;  3E3X A;  2VPW B;  4WFX A;  1T05 B;  2XMM A;  1FI4 A;  2IVM A;  3HSG A;  4ZIT A;  1Z1Z A;  2OEL A;  3QLH A;  3HHD A;  2BJ1 A;  3N9U C;  4DR4 F;  1SC6 A;  6FD1 A;  2RS8 A;  4M5K A;  2J8S A;  1JX4 A;  2DNR A;  2OEK A;  1HHS A;  5CD4 A;  3OR2 B;  2YQ1 A;  1KD1 T;  4KSE B;  4CH7 A;  1YG0 A;  2EEY A;  5F8J A;  1SJQ A;  4ZN3 A;  4WP8 A;  4I2Q B;  2HHW A;  3PEJ A;  4PYA A;  5KTQ A;  1F9E B;  3E8O A;  2HBQ B;  3GMG A;  3BH6 B;  1SC3 B;  2MKK A;  3OHB A;  3KJF B;  1V6H A;  3DHX A;  4DG1 B;  1UET A;  5C2G A;  1NPP A;  3FUY A;  4N5S A;  5CAA A;  3MCO A;  2FLL A;  2VHG A;  2LQB A;  4F7V A;  3MM6 A;  3GON A;  1M0S A;  4PQU A;  3FRZ A;  4NL5 A;  2A2D A;  5F9N A;  1KDN A;  3OTB A;  3T41 A;  2HS0 A;  5H1S V;  4MTP A;  4U96 A;  4WFA Q;  4A8X A;  2KM8 B;  1FE4 A;  4HYK A;  3SDE A;  1ZAX A;  1RT7 A;  2G0C A;  5HJX A;  4V1A k;  3CO9 A;  4DV3 J;  2ZWO A;  2RD5 C;  3MEC B;  4ECZ A;  1Y4Z B;  3QRR A;  1ZBT A;  3IR6 B;  2E1M C;  4K7Q A;  2L9W A;  3D28 A;  4FF1 A;  3RRH A;  4KHP F;  3NG8 A;  4Y2I A;  5J1N A;  2JJ4 D;  5BR8 J;  3EWG A;  3H42 A;  1FJE B;  3OLB A;  4J9M A;  2CQ0 A;  4C8M A;  4OZ3 A;  3QFW A;  3KWM A;  1HYS B;  3LO3 A;  2KZM A;  2OPP B;  3T6J A;  3I96 A;  2DJW A;  1AFJ A;  5HO4 A;  1NZA A;  1KQG B;  2GGP A;  1G6B A;  1ZA1 B;  2XI2 A;  2XNR A;  2ZH4 A;  1JIH A;  1Q8L A;  3V4I A;  5A2Q Y;  2IC3 A;  2MTL A;  5DO2 A;  3THT A;  2ALZ A;  3SZ2 A;  1FDD A;  5HN0 A;  2YPZ A;  1FFW B;  2GHP A;  4DQQ A;  4HAC A;  1VQY A;  4PPD A;  3AT1 B;  2KO1 A;  4RNF A;  4ETX A;  4JI6 F;  4KFB B;  5K8M A;  2I1R A;  2DHX A;  3AXK A;  1B0P A;  1ZM4 A;  2MHE A;  2YBV A;  3JS9 A;  5KFD A;  4ZLN A;  2FVR A;  4DR2 J;  2V67 A;  3EVW A;  1N52 B;  2FVS A;  1OO0 B;  4NLW A;  3CME S;  4FXV A;  3G2X A;  2JVM A;  1K9M T;  3AA9 A;  4NCA A;  2NSB A;  4CM0 A;  1C1B B;  4UOC A;  2MKS A;  2VDH A;  4RNN A;  3L4B C;  3JYT A;  2EC2 A;  3VAG A;  3CJR A;  4O3N A;  1X31 C;  1OPZ A;  2QL5 B;  4ZVQ B;  1CUL A;  3GV5 B;  2FIU A;  1PBA A;  4ED2 A;  3C6E C;  2V4Q A;  1WJ9 A;  2HND B;  1K1Q A;  3AY0 A;  5KFZ A;  1LK5 A;  3LAM A;  4R0E A;  4A8Q A;  2E9T A;  1NND A;  1LWE A;  1S77 D;  4Q7A A;  4CLT A;  3HF5 A;  3QIP B;  1T9Y A;  2W25 A;  5I42 B;  3L3C A;  3UD4 P;  2IIH A;  4WYL A;  1F9F A;  1TKX A;  2R8K A;  1Y5I B;  2ZJR Q;  2XY6 A;  4ED1 A;  3T19 A;  4LSN A;  1VK3 A;  1RLD A;  2AZ1 A;  2H3E B;  2B7B B;  2MZJ A;  4R8U B;  1S1W A;  4QPT A;  4ZIW A;  3CO0 P;  3N79 A;  4YB7 A;  1ZAW A;  4LF7 F;  1NKC A;  1R0B G;  1YRX A;  3GJT B;  1TU0 B;  4CO2 A;  1GXT A;  2HHH F;  1TTH B;  4PQA A;  1IJF B;  2OUG A;  3HM9 A;  1KNZ A;  2XM3 A;  1VQS A;  1IKY B;  1RIS A;  4DR7 F;  1REV B;  2QE5 A;  1KQK A;  2W9C A;  1KHV A;  1HPZ A;  2J6S A;  4B9V A;  4AE5 A;  3PJW A;  3CJK B;  5LSR A;  2MKJ A;  3DLB A;  1SH0 A;  5F8N A;  2W2Q P;  4QQB A;  2DGQ A;  1IM4 A;  3R2C J;  1W25 A;  5JVG Q;  3BPS P;  4ZP9 A;  2Q3P A;  1J5E F;  2FJA B;  1R6V A;  3SFU A;  3A13 A;  1LXN A;  3K8W A;  1V5I B;  4YY3 F;  2CVI A;  2PA8 D;  4EK2 A;  4K2J A;  3MM8 B;  3OPK A;  2P9C A;  3GCX P;  3D6M B;  5DM7 Q;  1BQN A;  3IM8 A;  2E5J A;  1D9D A;  2IYG A;  3R7B B;  3Q22 A;  1VLY A;  1VK8 A;  1OSD A;  4L72 B;  2R7U A;  3IBF B;  5G4D A;  4DSL A;  3T5L A;  2PC6 A;  2JRS A;  1ZOT A;  2GIQ A;  2W24 A;  4NYZ A;  3VGT A;  4UQT A;  2Q43 A;  3DCA A;  3DRP A;  4MIB A;  3QLH B;  3GYX B;  1GMW A;  2RRA A;  1RBO B;  5HAT A;  4DL3 A;  5LMN J;  5F8L A;  4DBQ A;  3EVO A;  2F9J A;  4ED8 A;  3KHR A;  5CYJ A;  1S79 A;  1TK0 A;  2ZUG A;  1RLC L;  3A3O B;  3P6Y C;  1OY6 A;  5KFM A;  4GO5 X;  1WHV A;  5KG6 A;  1VCT A;  4EGL A;  1RWU A;  1SL0 A;  4GO7 X;  1HW9 A;  1UFK A;  2WB4 A;  2QN6 B;  1NK7 A;  5DZ7 A;  1RB0 A;  2CNK B;  1CPZ A;  3OW2 R;  4MKV A;  5J1E A;  3F41 A;  5M2R A;  2HSE B;  4YME A;  1BLU A;  1F9H A;  2G2Z A;  3M6V A;  1SCJ B;  2YH1 A;  2E7V A;  2FVP A;  3PKY A;  4DI6 A;  5ETV A;  3SQG B;  2V69 A;  3OD2 A;  4U67 Q;  1N33 J;  1Y5L B;  5E41 A;  1FJG F;  2C3U A;  2AWZ A;  1Q8I A;  4TY8 A;  1W2B R;  4NXN J;  1N5Y A;  2BAC A;  1HBO A;  2IBO A;  3FBE A;  3FRY A;  1FRM A;  2X3D A;  3T1A A;  2OPQ A;  4ZVF A;  1DTQ B;  1KOO A;  2F8H A;  1WC1 A;  3SDE B;  2DHS A;  4C6A A;  3NP5 A;  3C8Y A;  3HHN B;  4P2M A;  4J80 A;  3TX8 A;  3R97 A;  2HFN A;  3B54 A;  3VGV A;  3GV7 B;  1XMB A;  4F4X A;  4K4W A;  4CLS A;  2QA4 G;  2YNI A;  3I6P A;  4I2P A;  2NXC A;  1M5V C;  2UXD F;  4IG0 A;  4OV1 A;  1APS A;  3NS5 A;  4JI0 J;  4IG3 A;  4PRF A;  5IFM A;  3CCM S;  2CNO B;  4NZ0 A;  2BAN A;  3TAP A;  4L74 A;  3G6E S;  1Q95 G;  2RT3 A;  1RWN B;  4W92 B;  2GGP B;  5D15 A;  3N28 A;  2FJV A;  5EWF A;  1RKJ A;  1Y5N B;  2IC3 B;  1H73 A;  5DDR C;  3P8B B;  2DY1 A;  3OFH A;  4HAC B;  1H74 A;  4FYD A;  3GTY X;  2DBB A;  3MWB A;  2GHW A;  3MPD A;  2CZV C;  2P6S A;  4CLK A;  2W2N P;  2J76 E;  1TMM A;  2B4O A;  3DN9 A;  4M63 A;  1S97 A;  3SCI E;  4E0D A;  3FMW A;  3I0R A;  1HNV A;  3T1Y F;  2F8M A;  2MQP A;  2ODX A;  5KFO A;  4A8W A;  4RNH A;  3VAI A;  3MUR P;  3V4M A;  3B4M A;  1FVQ A;  2BVZ A;  4CT9 A;  3DLK B;  2NQP A;  4J9O A;  2FZG B;  2DH7 A;  4JYA J;  3AB4 B;  4Q8F A;  3DI6 A;  1B4S A;  3EDQ B;  4M5L A;  3JYT B;  5EDW A;  3H5U A;  4FS2 A;  5C42 A;  1NJW A;  1XWL A;  4QPX A;  4IH7 A;  2BKP A;  4DUY F;  4TLR A;  1CUL B;  2WON A;  2RU9 A;  4FF3 A;  1HLW A;  3ENQ A;  3CF5 Q;  4GVB A;  4DV2 J;  3D3C J;  3UDC A;  4JI2 J;  1LWE B;  2OPR B;  4DV6 F;  4L75 A;  1S49 A;  4HH0 A;  1RT4 A;  4UUX A;  1DQ8 A;  2IDL A;  3NKY A;  2M88 A;  4IOB A;  5CYM B;  1TKX B;  1O5J A;  1YJW S;  2HNZ A;  4FF2 A;  1VQK S;  3BDE A;  3H4D A;  1DQA A;  2DNM A;  4LSN B;  3MEK A;  1R0A A;  1QVF R;  1V3R A;  3TQ1 A;  2CFX A;  1WSR A;  4WZQ A;  1S7H A;  3HVA A;  2HHX A;  3DGP B;  3VQS A;  2WBR A;  3M6U A;  4TY9 A;  3K5M A;  3MM7 B;  5IQ6 A;  1S5Z A;  3PCO B;  4ID8 A;  3RTV A;  4ILM A;  5KFR A;  4H4O B;  1N36 J;  2WB1 D;  4YFU A;  1RBL A;  4F4Z A;  4ELU A;  1HPZ B;  4UOF A;  3CCV S;  2PFF B;  2FHJ D;  2MSS A;  3QYY A;  3BN4 A;  4G1P A;  1UFW A;  4IO1 A;  2VFU A;  4P2X A;  2XZT B;  2WHO A;  3ZZU A;  3D3B J;  5A8R A;  1Q8K A;  1MN7 A;  2CJ9 A;  1NO8 A;  5HJY A;  5CQG A;  2WK4 A;  2RF2 A;  2IFX A;  4BC9 A;  2H48 B;  3UI3 A;  5KFC A;  5E5N A;  2OO4 A;  3H59 A;  1IBL F;  2VQF J;  1C0T A;  2N7Y A;  3UR3 C;  1BQN B;  4Y2A A;  2JFK A;  1F3V A;  1TVR A;  3OTC A;  5KFE A;  1KBR A;  4JI7 J;  3KHH A;  1P1T A;  1DRZ A;  2KXN B;  1NKB A;  1CVJ A;  3HX9 A;  3W2W A;  3Q8Q B;  3Q83 A;  3DRP B;  2QSW A;  4IUF A;  2N3O A;  3EX7 B;  1DHM A;  4C0H A;  4ED5 A;  1BC6 A;  4KR0 B;  2E7W A;  1VFJ A;  2EFG A;  2XG8 A;  1NK8 A;  3PW7 A;  1IQZ A;  2EC0 A;  3OL7 A;  3KK1 B;  1OWX A;  3AD9 C;  4QIG A;  2KB2 A;  3JAM U;  4USJ C;  3NBP A;  2QA2 A;  2G4B A;  1YSJ A;  1TKD A;  2E9R X;  2YKM B;  3T1H J;  3A4T A;  3CED A;  1YLX A;  2L9D A;  4WP9 A;  4DX6 A;  5D4N A;  5HBM B;  1NXI A;  3IN5 A;  3QT8 A;  1HR0 F;  3IBW A;  4HDG A;  1H2V Z;  2C2M B;  4X66 J;  5J1E B;  2XS5 A;  1HHT P;  4IOA Q;  3AGZ A;  4DUZ F;  3T5H A;  5IT4 A;  1FX2 A;  3PR4 A;  2JEG A;  2HHP A;  3D6T B;  3HHL A;  2OP5 A;  4CDI A;  2H5E A;  1HWI A;  2O5D A;  2AJQ A;  1S6P A;  2MQL A;  2FZK B;  1HBO B;  1AT1 B;  3P45 B;  3NCP A;  2VQE J;  4QR0 A;  2OPQ B;  4EI2 A;  4LRA A;  1L3K A;  1U6B A;  2M0G B;  1ROF A;  1RQ0 A;  2ROE A;  2MQO A;  1ZAV A;  4J9L A;  4GKJ J;  1LK7 A;  1N5T A;  4JV2 A;  2AU0 A;  2ZNZ A;  4U8Y A;  4AL6 A;  1WEY A;  1FRK A;  2R8G A;  4JB8 B;  2DNQ A;  2JX2 A;  3I56 S;  1M1H A;  3GLJ A;  4EMD A;  2AQ4 A;  2YNI B;  2ZBP A;  3I0S A;  4P71 A;  1KEK A;  1RTD B;  3ADA C;  3KLG A;  4IG0 B;  1KR4 A;  2VH7 A;  4C97 A;  4Z7Y A;  4IG3 B;  2Y0S D;  2AYE A;  3WC2 A;  3M32 B;  3GJR B;  3HHL C;  2HZA A;  3FCV A;  3BKF A;  2Y1J A;  2BAN B;  1JLB A;  3QAU A;  2P2C B;  3PW0 A;  3JAM Y;  4P72 A;  2VG5 A;  4X4P A;  1KHW A;  3SV4 A;  4ER8 A;  2ZC3 A;  1VQP S;  4NYP A;  2NLW A;  4WXW A;  2AHO B;  1BMQ B;  1YGY A;  4R5P B;  1BUX A;  1JK9 B;  1Q78 A;  2ZZT A;  5K8O A;  2YKP A;  3HVT A;  3K89 A;  4JV0 A;  5D4O A;  4XDD A;  4ENO A;  2QA4 S;  4ZLP A;  2NSC A;  1ZTT A;  2CYY A;  4ZVE A;  5L46 A;  2MZT A;  3CUN A;  2YTC A;  3MPW A;  3PAC A;  3I0R B;  3HKZ D;  2J7K A;  2VOO A;  3CIZ A;  3CB4 A;  5HVG A;  3EDR B;  3D1O A;  3GB0 A;  3HPO A;  4O44 A;  4ED7 A;  4GKK F;  2QEX S;  5IWA J;  2Z8Q A;  3TUJ C;  2QL9 B;  2QTW A;  3DXB A;  2BJD A;  3E2E A;  4YP3 A;  1Q8B A;  1S4E A;  4LVO P;  2UXC J;  1RYS A;  2IM1 A;  4AL5 A;  1DTT B;  3EPG A;  2Z0G A;  1T95 A;  4C8K A;  2ZBR A;  3UDE A;  5C42 B;  2APO A;  2JH3 A;  1T9W A;  2B9W A;  3R5D A;  2WON B;  5KG1 A;  1C4A A;  4TYB A;  4B3M J;  2CDQ A;  3IMQ J;  5HVF A;  3R9L A;  4QWA A;  2CQD A;  2CJQ A;  3TZY A;  2GIR A;  2KTQ A;  4ATN A;  4CLY A;  1RT4 B;  3R5J B;  1FXL A;  2VD3 A;  1NDL A;  3MXH P;  4F02 A;  3TZZ A;  1ZPV A;  3BBC A;  3K5L A;  4JI5 J;  5K9F A;  3FC9 A;  3AOA A;  3QSI A;  1R0A B;  2HRU A;  2HS3 A;  3D4J A;  2ZHO A;  5HL7 Q;  4UTG A;  3QT5 A;  3QQC D;  3NNA A;  3W5Y A;  3CTR A;  2C3Y A;  1NRK A;  1U25 A;  5GAD U;  2YQ3 A;  3Q89 A;  1U49 A;  5D3G B;  9ATC B;  1TL7 A;  2HHS A;  1SL2 A;  1NEE A;  1BE4 A;  4NYO A;  3JB9 k;  3V5R A;  3TUP A;  4DV5 F;  4ECT A;  1I94 F;  1RAI B;  3EPI A;  4NXM F;  3H0P A;  4ZHR B;  3ITH B;  2BQU A;  3KNG A;  5J2Q A;  5CA5 A;  2X1F A;  3ENV A;  4OX6 A;  3DOK A;  1V5V A;  3H5X A;  3EGW B;  2E9Z A;  4OV6 A;  2XHW A;  4PG7 A;  2F8E X;  5JMN A;  4M5H A;  4I68 A;  2P9E A;  2J9D E;  4YB6 A;  2A6O A;  5A8R B;  1XQI A;  5CYQ A;  2NCK L;  3W62 A;  2RF2 B;  2DXD A;  1FDB A;  4J9V A;  3RW6 A;  3S6E A;  1S0N A;  4O0I A;  4KQZ A;  2WVD A;  2EFP A;  1VQL S;  4PWD B;  1NK5 A;  1AZS B;  3D5M A;  1TVR B;  2G1D A;  1NH8 A;  5KFS A;  2HFV A;  3HSD A;  4NRT A;  3IXQ A;  3TUZ C;  2DO4 A;  1CLF A;  1DZ5 A;  3DLJ A;  3KHG A;  4IR1 A;  2HEK A;  2LEC A;  4ZJO A;  1R27 B;  2OAU A;  4K5R A;  2DIU A;  2AJ4 A;  1U1L A;  1FKP B;  2J9C A;  3OJU A;  1NPK A;  4P2F A;  1GXU A;  3HCX A;  3K58 A;  1BWE A;  1DLO B;  5DLF A;  3KJQ B;  3IG1 B;  2NR0 A;  1E6Y B;  1Q0N A;  4I7F A;  4JI4 J;  1SPB P;  3MAA A;  4S0M A;  4K4Z A;  2GMH A;  2YKQ A;  5KFF A;  2BJ8 A;  1HI0 P;  3NBP B;  3KNA A;  4B3R F;  3QGG A;  4DR5 J;  2BE2 A;  2F63 A;  4OYA A;  3US5 A;  2UUC J;  4M5M A;  3FKB A;  2UXB F;  1WC6 A;  1M5H A;  5E3Q A;  2DGS A;  2PEB A;  4YQW A;  4A8F A;  3NCQ A;  4ZVT B;  4Y2C A;  2KI2 A;  3WX8 A;  3QRQ A;  4O0N A;  2MKI A;  1FK9 B;  3F73 A;  2VFR A;  1X4E A;  5IZH A;  3OSP A;  1TL5 A;  4UOH A;  2DY9 A;  4QWB A;  1M1G A;  1LW0 B;  4J9S A;  4LF4 F;  3WX4 A;  1B0T A;  1B7Y B;  1S6P B;  2VU5 A;  2DXF A;  4DN0 A;  2R7R A;  5H9F J;  3EM1 A;  3AXM A;  4AND A;  2UU9 J;  4CNY A;  1BHN A;  4G1Q A;  4DV4 F;  3TA0 A;  3EUN A;  4CH1 A;  4NEY A;  2H9Z A;  4JI8 J;  3UDL A;  2RHQ B;  2VIH A;  3CNQ P;  5B0A A;  3QJP A;  3IRX A;  1H98 A;  2VJV A;  4QYZ J;  3MR6 A;  1EAY C;  5AT1 B;  1I1G A;  1L3T A;  3KOA A;  3KLG B;  3C46 A;  2CQH A;  4QR1 A;  4NLO A;  4N8N A;  4ZS6 A;  1DAR A;  2PE8 A;  5AE1 A;  4B9L A;  3IC1 A;  4DR3 F;  3MFI A;  2WRM A;  5DLG A;  2MXY A;  4RW8 B;  1VLO A;  2OD6 A;  4ES3 A;  1WOO A;  3SV3 A;  2DNH A;  3RAM A;  1RTI A;  4F26 A;  3KUE A;  1HI8 A;  2HVD A;  4F67 A;  1TQL A;  3CJS A;  3TOQ A;  1YRT A;  3ZZP A;  5HRO A;  1QM9 A;  2JC1 A;  2KJW A;  4U7U D;  1REG X;  3VAK A;  3OVA A;  4BC7 A;  4I6W A;  2W7A A;  2CDR B;  1QVG R;  1F3F A;  1XBW A;  3I87 A;  4C8Z A;  4USH A;  3ZFV A;  3A1Y G;  2AX1 A;  2UVR A;  4EBE A;  2YPY A;  2E1A A;  3D67 A;  3ZTO A;  3F44 A;  4OX9 F;  3AJ1 A;  2XHC A;  5AXN A;  2OJ3 A;  4PUO A;  5KG7 A;  3DM2 B;  4C3M A;  2BYC A;  3PRV A;  2HAF A;  4HEA 9;  3TWZ A;  5J2M A;  2HPU A;  3P49 B;  4C2M A;  1F1B B;  5HMY A;  3BYP A;  1JXV A;  5HQM A;  4PR6 A;  4JI3 J;  3CCS S;  5DDQ C;  2QLX A;  4ZVH A;  1RWX B;  3MM5 B;  5KFB A;  1HNW J;  2AIR B;  4P10 A;  1HW8 A;  3K17 A;  5GVQ A;  1X7V A;  3T3F A;  1MMN A;  1IJE B;  2RH3 A;  1NSP A;  3ZZY A;  2Z2L A;  1HNZ J;  2O67 A;  2CAD A;  1OSC A;  1F5C A;  3DLE A;  3DRR B;  2C2O B;  1UWB A;  3CDW A;  2VPZ B;  3TA1 A;  2R7Q A;  4O4R A;  3IAS 9;  1DFD A;  4TQS A;  1T3N A;  2KVQ E;  1Y7P A;  3C6T A;  4RU9 A;  4FBU A;  2GO9 A;  1IUJ A;  1R3N A;  3H20 A;  3OFG A;  3ILL A;  4OX7 A;  1KN6 A;  4X64 J;  4RJV A;  1LXJ A;  2R7W A;  4USK A;  2IJF A;  4OYP A;  1TL7 B;  1NPR A;  2ZBC A;  3DLG A;  2LLZ A;  2JDJ A;  4YHH J;  5H9E K;  4LSZ B;  4DR4 J;  1Q5Y A;  2J9D A;  2XI3 A;  5I3U A;  4LF8 F;  1A0O B;  3LUY A;  2V2V A;  4PYD A;  2HKE A;  3DOK B;  3SYZ A;  4K4X A;  1RWP B;  4H4M B;  2DNZ A;  2K06 A;  3OT9 A;  2PA3 A;  1HL6 A;  2E1R A;  2GV1 A;  3L7O A;  5E3A A;  2Q6B A;  2D7S A;  4U9R A;  5CYQ B;  4NEZ A;  4AT1 B;  2EFN A;  3KG1 A;  4WFY A;  2PEH A;  1UA1 A;  1VQO S;  4YOE A;  6AT1 B;  2DVI A;  5DG7 A;  4USU A;  2C2D A;  1Q5V A;  2ZJQ Q;  3NRB A;  1BQX A;  4DMZ A;  5D78 A;  4RNM A;  2V68 A;  2OI2 A;  2W9A A;  1RT2 A;  3TA2 A;  2BKO A;  4LFA F;  2R7O A;  2XWY A;  2D3O R;  4NLY A;  3BO4 A;  2VL1 A;  2VDI A;  5IM0 B;  1B64 A;  1RAJ A;  3O3L A;  3BYR A;  1RP5 A;  1Y9O A;  4YR0 A;  1UEV A;  3O8W A;  3D0G E;  4ES1 A;  3MOZ A;  1SI9 A;  3PYE A;  2MZR A;  5KT7 A;  2ZOM A;  1JNR B;  3HKW A;  2HVI A;  5L1I A;  1C4C A;  4KO0 B;  4G3I A;  3RB3 A;  1YJ7 A;  3UNG C;  3JTP A;  4ED6 A;  2LFV A;  3GYG A;  5DGB A;  4B3T F;  1CJT B;  4P9S A;  1UJ4 A;  2RUS A;  4OYB A;  4KKO A;  4NZ6 A;  5K8N A;  4KY3 A;  2EK6 A;  4DFP A;  1HQ2 A;  4F04 B;  4LRF A;  2JHE A;  3HI9 A;  3TAN A;  3FEZ A;  4OHX A;  4DU8 A;  4GC7 A;  2HK3 A;  2CWK A;  3O5T B;  3A3N B;  2WCX A;  1WHX A;  1XNR J;  5AXL A;  4ZPW R;  4ZCI A;  2FD2 A;  2MZQ A;  4MAK A;  3D2W A;  2KRB A;  3C3L A;  4DV0 J;  2HAI A;  5T7L B;  1TZ0 A;  2W2M P;  2YNH A;  4ZVR B;  3UCG A;  3LF0 A;  4ZCK A;  3KFW X;  5G0R B;  3JSM A;  3DLH A;  5E7O B;  3PXG a;  2ROP A;  4M8L A;  4DF8 A;  4P2S A;  3OTO F;  1X9M A;  2NXE A;  4G1Q B;  2I9S A;  5C7P A;  2Y0B B;  2GA7 A;  5KFV A;  4WYW A;  4EWT A;  2QYG A;  3FVY A;  3R7S B;  3J80 U;  3BPD A;  4KB7 A;  2DIV A;  1X60 A;  3GZ7 A;  4PG8 A;  2HQG A;  1KFS A;  4X2B A;  2NYH A;  1VJW A;  1QD1 A;  3MUV P;  2VG6 A;  4LF6 J;  1RU1 A;  2IHR 1;  2KKH A;  1S1X B;  5ADZ A;  2PGC A;  1VC0 A;  4F4W A;  1PYT A;  3GSI A;  1LWF A;  2GHV C;  2QLF B;  1HNX F;  2VON A;  1P6T A;  2JWN A;  1RAC B;  4QJV A;  1ARO P;  1RT1 A;  2DB1 A;  3UPF A;  3BO3 A;  4CO0 A;  1NSQ A;  2YWE A;  3JQK A;  3I31 A;  2P9G A;  2UVW A;  4KTQ A;  1S48 A;  1R8H A;  3EZO A;  4NLU A;  3NMR A;  3W9I A;  4XPE A;  8RUC A;  3QBC A;  3TNV A;  1HQE B;  2FC9 A;  1NME B;  1FKO A;  3R7N B;  2R2U A;  2IJR A;  1LQ9 A;  2IM3 A;  1QJH A;  3TAQ A;  1J5O A;  3HP6 A;  2RB7 A;  2HZC A;  1IVZ A;  2R2S A;  4KGK A;  4WE1 B;  4CM2 A;  1RAF B;  5C24 A;  2V4J B;  3TI0 A;  1Z2Z A;  4PUO B;  2OMO A;  4WF9 Q;  4P52 A;  2IYI A;  2BE7 D;  5J2M B;  4X62 J;  1IR0 A;  2X1G A;  3LP1 A;  5DDP C;  1CQM A;  4DR7 J;  1XMO F;  3J80 Y;  3OR1 B;  1LV5 A;  1RHK B;  2N7C A;  3D54 A;  3JQJ A;  4NE9 C;  1Q79 A;  3I38 A;  5ETM A;  3A12 A;  4ECV A;  1IKV B;  4IQM A;  2VBW A;  2HHT A;  4IQX A;  4I67 A;  2LQ5 A;  2MMY A;  2BAB A;  4YS2 A;  4NCG A;  3NWG A;  5F0W A;  4IRD A;  3CC2 S;  3KKF A;  2NPI A;  1CEZ A;  5SUH A;  4HR2 A;  1NH7 A;  1T7P A;  2NZC A;  4B9M A;  2M4M A;  1SJ1 A;  4FKX A;  3W2V A;  3X3U A;  1YIT S;  4DSE A;  2KYX A;  3NLC A;  2A0F B;  5LOQ A;  2D1C A;  3Q8S B;  2BOA A;  3HFK A;  2ZFH A;  1RUS A;  2BE9 B;  3R1H A;  1NJZ A;  5D0R A;  1MML A;  3C14 A;  3RRG A;  3SFG A;  2Y9H A;  4IFY A;  2OFH X;  5D4L A;  4OZL A;  2HFU A;  5ITH A;  2V9W A;  1RHR B;  4M1K A;  2GX8 A;  2BR0 A;  1FWP A;  2V8D A;  2CJA A;  4HDH A;  4HI2 A;  3D1Q A;  2MYF A;  3A8E A;  1IN0 A;  5GAH U;  2MB0 B;  5KOW A;  2LA6 A;  3TX0 A;  1Q16 B;  5I3U B;  2CQ3 A;  4XTT A;  4PWU A;  3NOG A;  4OIX A;  2KYZ A;  1U1P A;  1WI8 A;  4MYU A;  4NML A;  4U8V A;  4K0K F;  3RBX A;  1U1N A;  4OHY A;  1AUD A;  4J37 A;  4PG5 A;  4TQR A;  4DSJ A;  5K5M A;  5HLF A;  1TFW A;  4DR6 J;  1RA6 A;  5CAB A;  4LF5 J;  1SVD A;  5FJ4 A;  5KT5 A;  4DS4 A;  3R1L A;  3I4P A;  2KG0 A;  2VKZ G;  2O66 A;  5AXM A;  2RML A;  4F3Q A;  4CIO A;  3NWR A;  1FX4 A;  3MFH A;  3OL9 A;  3KDN A;  2G2Y A;  4DLE A;  2VZ9 A;  1XR7 A;  1RT2 B;  4KV8 A;  5EHH A;  1MWY A;  3TAM A;  4DV3 F;  4DPU A;  5ETR A;  2ZDO A;  4HT5 A;  4LFB J;  2UVU A;  1XJW B;  3D6F B;  2MDA A;  4LT6 A;  4ZVP B;  4LFC J;  3SCK E;  1JLF B;  2FPH X;  4PZV A;  2ZZN A;  4AD6 A;  2BJ7 A;  3BQ2 A;  3VCD A;  5BR8 F;  3MTJ A;  2ASD A;  4Q2M A;  3QO9 A;  5LSO A;  3FQL A;  3VV2 B;  1NDC A;  3UN3 A;  2CZ9 A;  2VC1 A;  2I5J A;  1M5P C;  2HFZ A;  1MG7 A;  2RNE A;  4CT8 A;  1S12 A;  3UCZ P;  4KKO B;  1T03 A;  3TJA A;  5AXK A;  1UJ6 A;  3QFH A;  1HBN A;  2MLY A;  1VRT A;  3C16 A;  3E01 A;  1ZTW A;  3R5C A;  4QIV A;  2V8G A;  3MMA B;  1SC4 B;  2F40 A;  3P4U B;  2RVJ A;  2FLP A;  3K2Y A;  1SH2 A;  1SQF A;  4ZOS A;  1U24 A;  2V63 A;  4J9P A;  1GMV A;  3B8H A;  2YNH B;  4CRJ A;  5HK4 A;  2HHU A;  3OLA A;  1N32 J;  4WIQ A;  3N6N A;  4ETZ A;  4DR2 F;  3AHP A;  4NA3 A;  1SBR A;  3JSM B;  5K8P A;  4OI0 A;  2F7V A;  4OLO A;  2XLI A;  1KTQ A;  1FT8 A;  4QWE A;  1WC4 A;  2JVR A;  4MK7 A;  2EFQ A;  3OBI A;  2FB0 A;  2MQ8 A;  2W9B A;  1NHU A;  2VG6 B;  5LJ5 Y;  2ATC B;  3MEG A;  5B08 A;  2VIC A;  1RWK B;  3KJV B;  2LMI A;  5HMW A;  4N76 A;  1JKH A;  3RB0 A;  2MLZ A;  2M5Y A;  1H72 C;  1NSK L;  3L09 A;  3NS7 B;  3WHI A;  2B4P A;  3NNC A;  5LMU J;  4OI4 A;  3CJQ A;  3GP9 A;  4KJI A;  1RT1 B;  2GIF A;  1Y10 A;  3CDU A;  4EU0 A;  3MCM A;  3HFZ B;  2HRT A;  1G7C B;  3N6M A;  4P73 A;  2E1P A;  5CHC B;  5CD4 H;  1FKO B;  4CYU A;  5GMK a;  3MDF A;  4YUD A;  2LXI A;  1J5O B;  2RIJ A;  2ROG A;  3AQO A;  2BKN A;  3W61 A;  2U1A A;  4EO6 A;  1SJ3 P;  5C24 B;  2UUA J;  3H2V E;  3PTW A;  3Q8P B;  2NXU A;  4HHH A;  1RXO B;  1UFL A;  1QUV A;  3LP1 B;  1ZZN A;  2QRR A;  4NMX A;  3W9H A;  3BQ1 A;  2HVH A;  2Z2Z A;  1KSP A;  4RW9 A;  4ZA1 A;  4F25 A;  2WW4 A;  1NB2 A;  3NNH A;  1LW2 A;  2BV3 A;  1LWX A;  5A6W A;  3GIM A;  1VQM S;  1K0V A;  4RW6 A;  4WBF A;  1A6L A;  4J7C A;  4ICL A;  2QJ3 A;  1URR A;  4KHR A;  1HQU A;  5KT2 A;  3ZXW A;  4C98 A;  4L3K A;  2PT0 A;  4NCG B;  4OYM A;  1TKT A;  1Q81 T;  3JQM A;  3ETM A;  1IR1 A;  4BS2 A;  1EIY B;  1P27 B;  4URS A;  3QRP A;  1ZM3 A;  2ACY A;  3DOL B;  1RT6 A;  2IBK A;  5EWE A;  3AQP A;  3W2V B;  1F6T A;  3U02 A;  1S9G A;  3M6X A;  2YWF A;  4PWW A;  3C14 B;  1FFG B;  3TYT A;  3HJV A;  5LMN F;  1UEK A;  5F41 A;  5KFJ A;  1KKH A;  3HT0 A;  2ZH5 A;  2IRU A;  3B4D A;  4OLP A;  3CSK A;  4I56 A;  3U1M A;  4ELV A;  4B02 A;  1N5S A;  4RUH A;  5DS7 A;  2VC0 A;  1AYE A;  3J7Y U;  3J7Z T;  1Q82 T;  3GWC A;  2RJZ A;  3KLH B;  2C3O A;  4ECW A;  2RIL A;  1FFS B;  2RRB A;  5B09 A;  3H90 A;  2MEW A;  2ATL A;  5FD1 A;  1MRO A;  3MEE A;  3DC2 A;  2H65 B;  5GAE I;  3IGV A;  1B99 A;  4A48 A;  2Q2G A;  3TQE A;  3CJ0 A;  2QLJ B;  3GG1 A;  1S59 A;  2D74 B;  4WII A;  4NOH A;  1N33 F;  4LR9 A;  2RQK A;  4NXN F;  3ZTQ A;  3D9B A;  2DNL A;  2C2R A;  4MH8 A;  4K4U A;  2OD4 A;  2ZD1 A;  3VAF A;  4HLB A;  4O3Q A;  2B4V A;  3N6L A;  1RKI A;  3EZ5 A;  4KV8 B;  2Y8W A;  4F4Y A;  4UT4 A;  4FYV B;  3C5X C;  2HVE A;  4QU7 A;  3TAM B;  3KXD A;  4ZPA A;  5J2N A;  2JLG A;  3J7Z 5;  3G96 A;  2QLW A;  1DQ9 A;  2XWX A;  5KOX A;  1UCN A;  3HHE A;  1WEL A;  2DR7 A;  3JXO A;  5H9F K;  2RDD A;  4JI0 F;  1L3S A;  3VHQ A;  3JTN A;  2DCU B;  2VFT A;  3OFF A;  1N0V C;  1K1S A;  2I5J B;  3W8G A;  4F8R A;  2K1R A;  1F5A A;  2DTJ A;  1GX5 A;  1FRL A;  1JWW A;  5AE2 A;  1XEZ A;  3SI8 A;  1BQM A;  1HBN B;  1GMW D;  2XNQ A;  4QYZ K;  3OUY B;  1RZM A;  2J6U A;  4JI1 J;  1VRQ C;  3HFV A;  3KK3 A;  2PN6 A;  3EIC A;  2PMH A;  3W5X A;  3PDN A;  4O3O A;  4CQ1 A;  1CC7 A;  1R8A A;  5L1K A;  4MIA A;  4WTO B;  2Y1L B;  1XNQ J;  1PO6 A;  1YRU A;  1TKZ A;  1G4C A;  4C4W A;  4CZC A;  1JLC A;  2B7C B;  5KG0 A;  5B0E A;  3UO0 A;  5HMX A;  2A2C A;  3RBD A;  4QIF A;  1JLA B;  1EP4 A;  4O3R A;  4CLF A;  4LR7 A;  3OQ2 A;  1PBU A;  1IBM J;  4JYA F;  2KN4 A;  1KRP A;  3BGL A;  1SIZ A;  2BEF A;  3GR0 A;  5L38 A;  1FKA F;  2GVD B;  1QSS A;  2LKZ A;  3IM9 A;  5MLC V;  1KWM A;  4EZ6 A;  2P6T A;  1H7X A;  4X4O A;  1VBX A;  3K0J A;  4HTI A;  3HSZ A;  1RJJ A;  2QV6 A;  3DGV A;  3VGU A;  3QGH A;  1Y3K A;  2F9D A;  3QAT A;  4DZ6 A;  4DV2 F;  4LUB A;  1RBA A;  9RUB A;  2FJD B;  2VBY A;  4JI2 F;  3KK2 B;  1JKH B;  1RI7 A;  4HT7 A;  4RW7 B;  2FY1 A;  1U09 A;  2GZO A;  1U1Q A;  2JEF A;  1KVJ A;  3RJM B;  1O6X A;  5KG3 A;  4C7Q A;  2DHH A;  1Q53 A;  4WZM A;  4IOC Q;  2GVZ A;  3DFE A;  1OMS A;  3ZTS A;  3QJJ A;  3PX4 A;  2R3V A;  2CQC A;  4ZPC A;  1NK9 A;  3LAK A;  1WEZ A;  4X4Q A;  4BHQ A;  2OPS A;  1WHW A;  2CG4 A;  5HQ8 A;  1UKU A;  3I5B A;  2UP1 A;  1S9E B;  3ENA A;  3SEO A;  4PEO A;  1N36 F;  2E5I A;  1HMV B;  1DJ0 A;  2J0S D;  2KHC A;  3OJS A;  1PAU B;  5DG9 A;  4RL1 A;  1KOH A;  4RW9 B;  3G9C A;  3SQO P;  3V6J A;  1U0H B;  1LW2 B;  2L48 A;  2RHS B;  3IA0 A;  4ECX A;  4RW6 B;  3PW5 A;  2D9P A;  4ICL B;  4QIE A;  1SUQ A;  2VG7 A;  5C5J A;  2VQF F;  2GJI A;  2CJK A;  1C1C A;  1FXR A;  4C0O C;  1TKT B;  4J9K A;  2QIF A;  5IOL A;  2N3L A;  5A0Y A;  4JI7 F;  1TL3 B;  2MST A;  2DGU A;  1XC9 A;  1IKW A;  1HWL A;  4OHZ A;  3H5S A;  1RT5 A;  1RGV A;  3AOB A;  2IVY A;  2LQ9 A;  2IAJ B;  5B0B A;  2HW3 A;  1FNM A;  3BGF A;  5I3P A;  4PKD B;  2CNN B;  5HP1 A;  2JL9 A;  3RBZ A;  2QFJ A;  4YDD B;  4X4N A;  3RR7 A;  3RW7 A;  4DSI A;  3HD1 A;  3K5N A;  1F0X A;  4RR5 A;  3CVK A;  3ICL A;  1YDL A;  2E44 A;  4RUB A;  3T1H F;  1H6K X;  1RDR A;  2J6T A;  2AF6 A;  2H5I B;  2HBZ B;  1FTR A;  3MCS A;  4ECS A;  2I8E A;  3TAR A;  3CPW R;  2DHA A;  4LRD A;  2VFV A;  4DDF A;  4RW4 A;  1SL1 A;  3G82 A;  1RWM B;  4X66 F;  4DWI A;  3K57 A;  1F5B A;  2YKN B;  3MEE B;  2MKH A;  4ID5 A;  2F4V J;  2PI4 A;  3AH6 A;  3I9V 9;  4ZMM A;  3BDP A;  1D3W A;  5BYR A;  3KUH A;  2WVB A;  2MGZ A;  3U7J A;  4C9D A;  4XPC A;  1ZYQ A;  2ACM A;  2MQN A;  4IYQ A;  1T94 A;  4YR3 A;  4MK8 A;  3K8V A;  3G8T A;  2VQE F;  1WG1 A;  4CWB A;  4FZV A;  1NDP A;  1PC4 A;  4KBI A;  5L39 A;  1WWH A;  1Y3J A;  4Q5V A;  2JZ5 A;  4GKJ F;  1C3G A;  2KL8 A;  4W98 A;  4USV A;  5DDO C;  3CGI A;  2BM0 A;  2KXH A;  4F50 A;  3IBC B;  1MU2 A;  4CLP A;  1WG4 A;  3O2I A;  2JLE A;  3FBC A;  1QAX A;  1N6Q A;  2AGP A;  2HWI A;  2YVS A;  2DIS A;  3ISN C;  5A6P A;  2R8J A;  2L3M A;  2FJX A;  1FRJ A;  3TEG A;  1RTH B;  3CMQ A;  2EI5 A;  2K1R B;  3GU0 A;  2PII A;  2ZEJ A;  1IBC B;  1TL1 A;  4B3S J;  1SV5 A;  3AJD A;  3M2V A;  2AJ0 A;  1VQ4 S;  3M2U A;  2DEJ A;  2G1H A;  4ECU A;  1U7L A;  3LTO A;  4PAB A;  4BWM A;  3M8Z A;  2FTR A;  1W2I A;  4LMZ A;  1X5O A;  2MQQ A;  2RQC A;  2QA1 A;  3ZO7 A;  3KK3 B;  1JLG A;  2CKW A;  2XLK A;  4OYZ A;  2IRY A;  1RT3 A;  1FE0 A;  2Q66 A;  2K8G A;  3BSN A;  2W01 A;  4LIR A;  1AFI A;  4DQI A;  2EW9 A;  5K14 A;  2H1Y A;  3MMJ A;  1LFW A;  1M90 T;  5DG8 A;  1JLQ A;  1TKZ B;  1R7I A;  2NS1 B;  3IP0 A;  1PCA A;  3A8K A;  1CS4 A;  1S1U A;  1D8Z A;  3CE8 A;  2K3K A;  3AJ2 A;  3VZI A;  3HD2 A;  5EGY A;  5IWA F;  4GMK A;  3MD1 A;  3EGZ A;  4NAS A;  4LF9 J;  4BWJ A;  2WVC A;  3KHL A;  3LP0 A;  3MM6 B;  3S1T A;  4PQU B;  4G6V B;  2UXC F;  1QAI A;  1TV6 A;  2K7K A;  4O23 A;  3T6B A;  3TUI C;  4DV1 J;  2NUH A;  3HHL D;  4JV5 J;  2ZM6 J;  4NLR A;  4GC6 A;  3X1L B;  5ETT A;  2HK2 A;  1S1V A;  3MGJ A;  2C1E B;  1RT7 B;  4CLL A;  4B3M F;  4LVN P;  1HA1 A;  4CH0 S;  4HH1 A;  2ADC A;  2FHM A;  1RWV B;  1U26 A;  1LOU A;  5IS2 A;  3E51 A;  3QMQ A;  2BW7 A;  3Q0A A;  2V6A A;  2ASY A;  5E3R A;  4K4Y A;  2B9X A;  4D3G A;  3JSR A;  3PIO Q;  3MUM P;  2EFO A;  4JI5 F;  2WZ1 A;  3SBM A;  1WF1 A;  2FUG 9;  1S99 A;  2FC8 A;  2XGP A;  2D9O A;  1RSC A;  5F8G A;  3CCR S;  2GVZ B;  4KC5 A;  1XMQ J;  1X4H A;  2J0X A;  2UUB J;  1Q7Y T;  4A8S A;  3J7A N;  1T05 A;  2WSF C;  1I3O B;  4DV7 J;  1R8B A;  1S72 S;  4LBH A;  2YKA A;  3KLF A;  3TVY A;  3GIK A;  5KFL A;  2CZ4 A;  3V4I B;  4Y6I A;  5HMZ A;  3ONQ A;  3NAH A;  4LRC A;  2E5H A;  5T14 A;  4K2X A;  2MQM A;  4KPC A;  4QW9 A;  2QMU B;  3NY0 A;  1O8B A;  2YQ0 A;  3J7A 1;  1RE1 B;  1XER A;  1DBD A;  1FNX H;  4UST A;  4EYI B;  3FBB A;  4M5N A;  2E5G A;  4QYR A;  2B9E A;  4ZCL A;  5EX3 A;  3CCQ S;  1ITP A;  2QLB B;  1S6Q A;  3H40 A;  1UZD A;  4BCA A;  4J9Q A;  4DL5 A;  3CC4 S;  1VC6 A;  1GXL A;  3EXC X;  4DG1 A;  3QJL A;  3RR8 A;  2XSF A;  2HGN A;  3DXS X;  1OYE A;  3RRK A;  2P5V A;  3TR5 A;  1N54 B;  2VG7 B;  3CD0 A;  3MR5 A;  4DCJ B;  2RKI A;  2UZA A;  4RWW A;  1C1C B;  3HHK A;  3HZE A;  3OHA A;  2KH9 A;  4FPI A;  1IKW B;  3BV8 A;  5KFH A;  1Q1K A;  2LA4 A;  3SIP B;  1VJQ A;  2HZV A;  3ZZO A;  1SKU B;  2UV8 G;  3J81 j;  4NWB A;  2R7S A;  4DEZ A;  3MEC A;  2PSZ A;  4JI4 F;  2CPF A;  2DGT A;  1CG2 A;  3P3D A;  2KFZ A;  1IBK J;  4ZJQ A;  1EX8 A;  4DR5 F;  4LSL A;  3NGD A;  4DQP A;  1CBK A;  2UUC F;  1S1W B;  2DT9 A;  4DHV A;  3MF5 A;  1PAE X;  4WU2 A;  3K59 A;  1X5P A;  3KTQ A;  4OHW A;  3G82 B;  4RX6 A;  5E0O A;  4RLE A;  1HYS A;  2OPP A;  4OQJ A;  2N82 B;  4K4S A;  4X4S A;  4NLP A;  5IXU A;  4ID5 B;  1YJR A;  4PXC A;  1PJ6 A;  3Q86 A;  4FYY B;  2KM8 C;  4KGZ B;  3G8S A;  2W9C B;  2OH2 A;  2W1B A;  2VBZ A;  1C0U A;  1VQ8 S;  3PX0 A;  4YB5 A;  2MGZ B;  3HVW A;  1P9Y A;  2OHD A;  1NM2 A;  2Z56 B;  5DZ6 A;  5I4M A;  1X0F A;  2BXJ A;  3F0N A;  2HUR A;  2UU9 F;  1S6O A;  4F2S A;  3KYL A;  1YIJ S;  4DZD A;  2XMJ A;  3IS9 A;  2QMW A;  1TFY A;  3CD7 A;  4JI8 F;  2V5H G;  3Q8R B;  3AA8 A;  3QGI A;  1UEU A;  1UA0 A;  3R3T A;  3M8Q A;  2F4F A;  3U1L A;  3CMA S;  4EYH B;  1RAO A;  2KRR A;  2DH9 A;  1TUW A;  5C2C A;  2A10 A;  3TW0 A;  3KDO A;  2ZKU A;  4RBU A;  3BF4 A;  1RHJ B;  1SXL A;  3QAE A;  3MTK A;  1UTA A;  1TL1 B;  4JP8 A;  3H8Y A;  4OYO A;  1RAD B;  5LXR A;  1WKL A;  2K7J A;  1HWU A;  3D7S B;  5A76 A;  2O01 C;  2HND A;  2XYG B;  3D1H A;  3LPY A;  1UAW A;  3IWN C;  4Y00 A;  4A47 A;  3DU5 A;  4DPO A;  1NKE A;  3QIP A;  4FF4 A;  4Y2M A;  4X4U A;  4K8R A;  4R25 A;  4AL7 A;  5I42 A;  1I5O B;  4HKQ A;  1NAQ A;  5HQL A;  4FP9 A;  4N77 A;  2UVV A;  3HDS A;  2ZBQ A;  2HQF A;  2GS8 A;  3CJ2 A;  3W64 A;  4DL4 A;  3FFI A;  4R8U A;  3I9Z A;  5KFQ A;  1JLQ B;  4DX7 A;  2C2E A;  4M94 A;  2FY8 A;  2A6M A;  4RBV A;  3TVZ A;  1WAC A;  5MAO A;  4TNO A;  4DOZ A;  1PIL A;  5HVH A;  3CXC R;  1X0P A;  3GFH A;  4CLZ A;  3LP0 B;  1HFE L;  4DSF A;  3AGX A;  4MIW A;  1REV A;  3EE3 A;  2GNK A;  4TY8 B;  1T9T A;  4JI3 F;  2Z58 B;  4AXJ A;  1N5Y B;  1VQ6 S;  1FDA A;  3CJK A;  1TMJ A;  5D4P A;  1HNW F;  1XAO A;  3TJ8 A;  4LF2 A;  1EET A;  3RBE A;  4FYW B;  2P8I A;  3MPU B;  4NPO A;  1HKA A;  4RZR A;  1TAU A;  3EJM A;  3KG0 A;  3UVJ A;  4OYI A;  1ZET A;  3H2U B;  1GAO A;  4UOG A;  4ITS A;  1ZZF A;  2XMV A;  4V19 J;  4W90 B;  1HNZ F;  4XDC A;  2YNG A;  4DR1 J;  4CP5 A;  5KFP A;  2R8I A;  2KFN A;  2YXL A;  1FDN A;  5CH7 B;  2VAS A;  4I2P B;  4LQ3 A;  2IPO B;  2H5J B;  2ILY A;  2ZH8 A;  5D0G A;  4ILR A;  4Z7C A;  4QIW D;  1NJI T;  1RYR A;  3QGP A;  2V4R A;  3NGT A;  2GO8 A;  4Y2K A;  3IGN A;  3T9N A;  1KTV A;  1NBE B;  3KLF B;  1U0S A;  4X64 F;  2DNP A;  2E5L J;  2L08 A;  3LAL A;  2AYB A;  4RBT A;  4LRB A;  5BYS A;  4YHH F;  1HWK A;  1YBA A;  3NGR A;  3PRD A;  2CPE A;  4OHV A;  5KFI A;  3OTE A;  2LQJ A;  2CUY A;  1R8C A;  2OSQ A;  1RWO B;  3O6Q A;  2XCP A;  5IV3 A;  1TP7 A;  4B3O A;  3LWM A;  1R0C B;  3PR5 B;  2QZ8 A;  1K8A T;  1HNV B;  1S6Q B;  5A2Q U;  1AUS L;  4C11 A;  4DFK A;  3MPV A;  2ZJP Q;  4URQ U;  1NHV A;  4K0K J;  2GQQ A;  1X4F A;  3GYN A;  2DR6 A;  2DH8 A;  3G8Q A;  5F9L A;  3NGK A;  4OI2 A;  3P5T L;  2RKI B;  2X7I A;  1KS2 A;  3DI6 B;  3SQG A;  1A9N B;  3VVT A;  1JQG A;  3W1Y C;  1RAG B;  3U1N A;  2HNY A;  2VFS A;  1L3V A;  3HK2 A;  3FZ2 A;  1EQ0 A;  2JFD A;  1KP6 A;  1U6Z A;  1DTQ A;  1OQ6 A;  4GVB B;  4E8U A;  2QMX A;  1PYS B;  1DAX A;  1XN9 A;  2XMW A;  2B4U A;  4MMO A;  1SH3 A;  1TUG B;  1LNQ A;  2C2N A;  1MN9 A;  5B0C A;  3CCW A;  2GW8 A;  3CW2 C;  4TYA A;  3EGN A;  1ICE B;  2HNZ B;  2ZUA A;  1IQT A;  2HGL A;  2RQ4 A;  4LSL B;  4OZ0 A;  4DFJ A;  1I51 B;  1Q4R A;  4F3M A;  1IR2 A;  3ELH A;  3PV8 A;  3HVR A;  1RAA B;  1MMD A;  3KG4 A;  1F2H A;  3IWL A;  2E66 A;  1IM6 A;  1XNR F;  2BJE A;  3N01 A;  1D0E A;  2H51 B;  1C0U B;  4A46 A;  4DV0 F;  5L9N A;  3A8J A;  5JUM A;  1U47 A;  3CJ8 A;  2AP6 A;  1FJC A;  3FNN A;  4OFZ A;  4XAK A;  5JVH Q;  5F3T A;  1RCO B;  2KU7 A;  4HTJ A;  1JNZ B;  2G2O A;  2ZH2 A;  3CUL A;  5ETS A;  4X84 A;  4QBU A;  4NA1 A;  1UVL A;  4AQY J;  2AGO A;  4DU7 A;  3IS9 B;  2IRX A;  3IAM 9;  4OZ1 A;  3UQS A;  4U7U K;  3BEG B;  3CJ4 A;  3NL0 A;  2VA3 A;  2ASJ A;  5DRK A;  1C0T B;  3UE2 A;  3DLK A;  2JRR A;  3M8Q B;  5GAD I;  2KT2 A;  2PO4 A;  4OI1 A;  4LF6 F;  3BGU A;  3LH2 S;  1ZPW X;  1UP1 A;  4EEY A;  5LT5 A;  3FEY B;  4F0K A;  3MED A;  3W2W B;  5CZX A;  1ACM B;  2MJU A;  4YN3 B;  3C6U A;  5THW A;  2Z2Y B;  2VUG A;  4OZJ A;  5IV4 A;  5F8I A;  5GMD A;  2VOD A;  4ZLL A;  1SJF A;  5CXT A;  4ZPT R;  3W60 A;  3CJ5 A;  2OPR A;  1NJX A;  2BA9 A;  5KG4 A;  1YK9 A;  2ZH6 A;  1N48 A;  1U48 A;  1QTM A;  4EBD A;  1SKS A;  2A18 A;  1PIE A;  2OTL S;  3VF0 B;  1UZH A;  2CG8 A;  3BGR A;  1LWC A;  5CYM A;  5HSP A;  1OY8 A;  4HHJ A;  1UVJ A;  3S7R A;  2W8K A;  2HG4 A;  4USI A;  4KRW A;  4O4G A;  3D66 A;  5KT3 A;  4W4M A;  4C48 A;  3FFI B;  1Y11 A;  5C25 A;  1UVN A;  3DGP A;  4L76 A;  2FLO A;  4CO5 A;  4F0M A;  3MM7 A;  3AKO B;  4X62 F;  3Q24 A;  1SQG A;  2V8P A;  2HGM A;  3HHL B;  2G0I A;  3L7P A;  4EO8 A;  2QC3 A;  1H2T Z;  4H4O A;  3C15 A;  1N34 J;  4KT0 C;  2BW2 A;  3FMB A;  4IH5 A;  1EET B;  1D9A A;  2CPD A;  1PYO B;  2HS4 A;  2PMW A;  2DRD A;  5EX0 A;  2VPX B;  2WSE C;  2ZVS A;  3UVJ B;  5KT4 A;  2FJW A;  2AYG A;  5AJ3 J;  4OJG A;  3BN7 A;  1XR6 A;  2W2O P;  4BLG A;  5DQI A;  1MNE A;  2IA0 A;  3UFC X;  2CIM A;  2LEP A;  2CQP A;  2YNG B;  3RZA A;  3RAX A;  4A8Y A;  1YKW A;  2BBE A;  3I0S B;  2EG2 A;  1UWA A;  2WOM A;  1K47 A;  2M9K A;  3QZ8 A;  2LEA A;  5GME A;  3GIJ A;  2MJN A;  4TU8 A;  5H9E J;  2WVF A;  3SMZ A;  3M9N B;  1JLB B;  1U1R A;  2VG5 B;  4X65 J;  1OS5 A;  4QOT A;  1Z2L A;  2GMJ A;  3BSA A;  3M8R A;  2J7U A;  3CDA A;  2PD1 A;  1SQE A;  2MY8 A;  4N56 A;  2ZOF A;  1QSL A;  3A8I A;  2DNG A;  2B51 A;  1K44 A;  3M8W A;  1HBM A;  3HVT B;  4TLQ A;  1WC3 A;  3RGI A;  2D3U A;  3KK1 A;  4B3O B;  4I6A A;  2BRK A;  4PAA A;  4OL8 A;  4Y65 A;  2YKM A;  2LU2 A;  2ZHB A;  4WFB Q;  1RHU B;  2XLJ A;  2M3D A;  2MY7 A;  2MKC A;  1VIS A;  5D8H B;  5HBM A;  1R89 A;  4C11 B;  2OEM A;  2W7O A;  3ET6 A;  4DR6 F;  1UVI A;  4LJM A;  3MM9 A;  2CAJ A;  4LF5 F;  2A3J A;  2CPH A;  2ZE2 A;  2ZVI A;  4O44 B;  3BO2 A;  3PO4 A;  1O51 A;  1M5S A;  5T41 A;  3CCE S;  3ZC4 A;  4IKA A;  3PW4 A;  2Z4P A;  5LXY A;  1QE1 A;  1FHT A;  2CQI A;  3G4S S;  1VIO A;  3PYF A;  7AT1 B;  3QT6 A;  4ANC A;  2V2Q A;  1YJT A;  4IDK A;  4WKY A;  2BOP A;  3MPY A;  3P5B P;  4FPR A;  7FD1 A;  3CJT A;  2HNY B;  3OVB A;  3DMJ A;  4OMF G;  2CQ1 A;  3G6V A;  4KPY A;  2IA6 A;  2KT5 A;  3CDE A;  3MMC A;  4LFB F;  1NHK L;  1YQH A;  2B43 A;  2PI5 A;  4LFC F;  1PJ7 A;  2XBP A;  2UUW A;  1PJ5 A;  5IT9 U;  2O1P A;  3DRY A;  1NU4 A;  1WD6 A;  4OJ1 A;  3LOU A;  4Q0B A;  1M5O C;  1TK5 A;  4WPA A;  4ZVG A;  1X9W A;  2EKY A;  4A8O A;  4OZN A;  2DCL A;  3M4X A;  4QWD A;  1UPP A;  1VBY A;  1JJC B;  1GT8 A;  3MOJ B;  1RTD A;  2NXJ A;  3PJX A;  4NA2 A;  3ISZ A;  1RAB B;  2HIQ A;  1RHM B;  3M32 A;  4NCB A;  1AB8 A;  1LKZ A;  1JB0 C;  4LQ9 A;  3Q23 A;  3R27 A;  3ENW A;  3R6G B;  3TJ9 A;  2XUL A;  2YWG A;  1PG5 B;  2ZKT A;  1FTC A;  3MR2 A;  4MKA A;  3S8S A;  4QWC A;  2VKR A;  1GQE A;  1CSJ A;  2C2K B;  4R5P A;  3H5Y A;  2E7X A;  1SC1 B;  3NOC A;  5J2Q B;  1N32 F;  4UY8 T;  2DR5 A;  1HD1 A;  1VBK A;  3MMB A;  5E2Q A;  3H7H B;  4UUW A;  4LR8 A;  2HQ3 A;  2XMT A;  2RDJ A;  3U27 A;  4KGM A;  3AGY A;  3DDI A;  1G2E A;  2LYV A;  3DHW C;  3G6X A;  4I1T A;  1ZA2 B;  4HHU A;  1UL3 A;  2GFF A;  5IT9 Y;  5F3Z A;  2F1F A;  2LQ8 A;  1DTT A;  5KFU A;  1CJK A;  4NLT A;  1VOM A;  3RB4 A;  2ALY B;  3K7R A;  3M8S A;  2ZOG A;  3BM7 A;  3PX6 A;  3MED B;  2VOP A;  2JOQ A;  5E33 A;  2Z30 B;  2JSX A;  2W2P P;  3C6U B;  1RU2 A;  2CQ2 A;  2JZ8 A;  1LEO A;  3PJ9 A;  2IM2 A;  2HHV A;  4UY8 5;  3NGU A;  5LMU F;  1FNO A;  8AT1 B;  1YWX A;  3WBZ A;  4CLW A;  1HNI A;  4K4V A;  3DDK A;  3K5P A;  4I7F B;  1SB6 A;  3MAA B;  3G71 S;  1SKR A;  2VJU A;  4KHP J;  3BGR B;  1LWC B;  3OTD A;  3SXL A;  1A7G E;  1X9S A;  2BE2 B;  1OY9 A;  4Q45 A;  4WTY A;  3T9Z A;  4CI0 B;  2ZWP A;  3H4B A;  4O4G B;  3W66 A;  4C8L A;  5C25 B;  2XS7 A;  3JTO A;  2UUA F;  2JNJ A;  3MI7 X;  3FGV A;  1FCA A;  1NK4 A;  1T0T V;  3I5C A;  3R2D J;  2BMB A;  4C0B A;  5D3G A;  4ZPV R;  1EKS A;  3TO8 A;  4ED4 A;  3O44 A;  3DU6 A;  2DPJ A;  4Z2X A;  3C15 B;  3ILJ A;  1FWL A;  4ZHR A;  3ITH A;  4J9N A;  4JI6 J;  4WK1 A;  2FHO B;  2QGF B;  4FBT A;  4OZ2 A;  3GG0 A;  1VYA A;  1AA1 B;  2HIY A;  4IO9 Q;  4QU6 A;  2HFO A;  2GAG C;  3VVU A;  3S01 A;  1RCX B;  1WDD A;  3IRX B;  5ETN A;  2DIT A;  3LP2 A;  3UCU P;  3FSI A;  2WOM B;  5L8R C;  1W7W A;  4PWD A;  1AZS A;  5LL6 d;  1Y00 A;  4RKU C;  1VR6 A;  4B9U A;  4YDX A;  3HJF A;  4O3S A;  3FJ2 A;  1N5Q A;  5FDL A;  1HIY A;  1M1K T;  1RTI B;  2XTJ P;  1NSA A;  3UD3 P;  4KGV B;  3QSY B;  4N47 A;  3I55 S;  4A8K A;  5JJB A;  1FKP A;  5HRO B;  1V3Z A;  3VAM A;  5B7W A;  3RUB L;  1DLO A;  3OXF A;  1QSY A;  3IG1 A;  3BZQ A;  1HBM B;  2AZ3 A;  1E6Y A;  2LDY A;  4J9R A;  3WIV A;  4P6Q A;  3TVK A;  4ZVU B;  4ECR A;  2ERR A;  4PG6 A;  2WAQ D;  3GPA A;  3ET6 B;  3MM9 B;  4LF7 J;  3W9J A;  2ZE2 B;  3Q2T C;  1UVK A;  4MKY A;  1AXQ A;  4PPZ A;  2HHH J;  2YH0 A;  3LGM A;  4PCQ A;  1FK9 A;  2F5G A;  2BUN A;  1QE1 B;  4AYB D;  2R4F A;  4Y34 A;  2LEB A;  3G86 A;  4K50 A;  3M7V A;  4IDK B;  4J5O A;  4U6P A;  1LW0 A;  1SIW B;  2YKO A;  3DMJ B;  1PGZ A;  2XGQ A;  2R42 A;  3M2R A;  2J0Q D;  1S9F A;  1NK6 A;  4RNO A;  2XZD B;  3D0H E;  4BDP A;  1YX2 A;  4FYX B;  4PG4 A;  3MMC B;  2GC8 A;  1N5V A;  4FN5 A;  5ETK A;  3Q8U A;  3D0I E;  4UW2 A;  1J5E J;  4HL9 A;  4LIW A;  3UWT A;  2CA9 A;  2O3D A;  3GR1 A;  4M5G A;  1OQ3 A;  3DLE B;  4B9N A;  3B78 A;  4YY3 J;  1QUP A;  5L9X A;  4DFM A;  4Q0B B;  5L1L A;  1V9O A;  2DGX A;  2JEI A;  1UWB B;  3CC7 S;  2V94 A;  4QR2 A;  3BR9 A;  1VHI A;  4DPY A;  2Y1R I;  2DRB A;  5DM6 Q;  2EG1 A;  1S76 D;  2C2Z B;  3M1V A;  2RU3 A;  3C6T B;  4K59 A;  5CCL A;  2GJ2 A;  2XY7 A;  1R8P A;  3HMJ G;  1TAQ A;  3WZ0 A;  2DK2 A;  1B3T A;  3CD6 S;  4RW8 A;  4DL7 A;  1MW7 A;  3C66 A;  1WC5 A;  4DL2 A;  1B70 B;  1X4G A;  3FK4 A;  2V9K A;  4JI1 F;  3OFE A;  4TKT A;  3DOM A;  1P8G A;  1S6U A;  2V8V A;  3DLG B;  8ATC B;  4E98 A;  3JSB A;  2QT7 A;  3R6L B;  2IJN A;  2DNY A;  3THV A;  2G0J A;  2E1C A;  1BWV A;  4ED3 A;  1XNQ F;  4P7V A;  2HQC A;  2V2Z A;  3MMB B;  1ZS6 A;  4ECQ A;  3PIP Q;  3D6H B;  2AX0 A;  1JJ2 R;  2FQQ B;  2VV5 A;  3OL8 A;  3QT7 A;  3FCH A;  3MR7 A;  2IMO A;  1IBM F;  3DM2 A;  2HMI A;  3VAH A;  3UNY A;  1U6F A;  4TVA B;  5SZT A;  2HQI A;  1T9U A;  3PY8 A;  1T02 A;  2JC0 A;  3B6B A;  3M8P A;  5DGA A;  5ETP A;  4DX8 H;  1FJG J;  2DNO A;  1S0O A;  2CQ4 A;  1CJK B;  5GAH I;  5HI7 A;  2WVE A;  1WF2 A;  4DJB A;  3EMT A;  3AOC A;  3MM5 A;  5LJ3 Y;  2CPJ A;  2L41 A;  2XQC A;  4R0J A;  4NLX A;  5A8W A;  1BGX T;  2WW8 A;  1OIA A;  3M6W A;  2GCF A;  3DNC A;  2M8H A;  4EZ9 A;  1JJH A;  1G1X A;  4NX9 A;  1HNI B;  1S4F A;  2CQG A;  1WI6 A;  4WP3 A;  2ZH3 A;  3BBF A;  3POT A;  1FD8 A;  3PVX A;  1RA7 A;  1WDT A;  1QAJ A;  3V81 A;  3DRR A;  3LQV A;  3VQT A;  2L9N A;  4P75 A;  2UXD J;  1PC5 A;  4NLS A;  2B5J A;  1KVI A;  5B0D A;  3RAQ A;  5IQQ A;  1U02 A;  4X4T A;  1EQM A;  5D77 A;  4MJK A;  1VS3 A;  1VQ9 S;  2AJF E;  3NMA A;  3M8Y A;  1TUV A;  2DXE A;  3QPI A;  3ZZT A;  5B0F A;  1S57 A;  3C2P A;  4L73 A;  4LRE A;  4ES2 A;  1KVK A;  2LXU A;  2FHJ A;  5GAG I;  4OJ3 A;  5A8K A;  3LAN A;  4M5I A;  4G65 A;  2OML A;  3BSO A;  1D8Y A;  4NLQ A;  5U47 A;  1VMB A;  4Q43 A;  4MT1 A;  4H4M A;  4J9U E;  2FHK A;  2DHG A;  1T9X A;  3T1Y J;  5KFW A;  1J27 A;  4WK3 A;  4YB1 P;  5HAN A;  5J2P A;  1VI7 A;  2IY5 B;  2FDN A;  3BBB A;  3PG9 A;  2E29 A;  2ZBI A;  5D0H A;  3LP2 B;  2DRA A;  4P74 A;  3BQ0 A;  2MLX A;  1IXK A;  3UW1 A;  4CO3 A;  4DLG A;  3GFZ A;  3HXM A;  4C3K A;  3IR5 B;  4JUZ A;  2SXL A;  1T3O A;  1FRH A;  5FDL B;  4DUY J;  3ZZZ A;  1LWF B;  1TR0 A;  4OZ5 A;  2BJ3 A;  3QWP A;  5ETQ A;  2GQ2 A;  1MWZ A;  2B6A A;  4Z37 A;  5EWG A;  2AMC B;  2ADB A;  5IM0 A;  3SSQ A;  1FRX A;  2H4Y B;  2GQC A;  4DV6 J;  3W8P A;  1EAR A;  1WC0 A;  3MAH A;  2DEI A;  2XSJ A;  4I69 A;  4NI2 A;  3VAL A;  1K0T A;  4ILL A;  4KO0 A;  2CVE A;  4E2F B;  2HHQ A;  2BJ9 A;  2KJV A;  2RSQ A;  2NUU G;  1CJT A;  3PYG A;  1GX6 A;  2H4W B;  3GSD A;  2QX0 A;  1N56 A;  1FRI A;  2FJE B;  3PZP A;  4G1I A;  2F4V F;  4CCH A;  4ELT A;  1LFP A;  4UQG A;  3CDB A;  3PNI A;  2XYH B;  3FZB A;  3H2L A;  1N88 A;  2BDP A;  1UVM A;  4Q2L A;  1HBU A;  2V0N A;  1X5T A;  2VB6 A;  3OL6 A;  4TU9 A;  1YZ7 A;  3M05 A;  4MYT A;  1U1K A;  1F2G A;  2M7S A;  2IM0 A;  1WOP A;  5T7L A;  2FZC B;  2Y3Y A;  4OYW A;  1CC8 A;  1WEX A;  1WKJ A;  4F2R A;  1UW9 A;  4OYX A;  3M2R B;  2EFV A;  1WSV A;  3IFE A;  1R6Y A;  2AD9 A;  1U4B A;  5G0R A;  2QL7 B;  2YX7 A;  1VQ5 S;  3DRS A;  4LBI A;  3LPE A;  3N5B A;  4IRC A;  3L7U A;  2F3J A;  2J9E A;  4FNI A;  3KMS A;  3N5F A;  3PM9 A;  1MLA A;  1OYD A;  2PMZ D;  3HUL A;  1IBL J;  4XK8 C;  3OXL A;  4JBC A;  4IH6 A;  3GJS B;  4C8O A;  2A1B A;  3TP2 A;  3VTI A;  3BSC A;  2DNK A;  2R9L A;  2XMK A;  4B3S F;  3HO1 A;  3M1V B;  3NAI A;  2OLW A;  4DUT A;  2QSF A;  4AFF A;  2HBY B;  1DUR A;  3BJY A;  4N41 A;  3R5G A;  3KLI A;  1S1X A;  4IFY B;  3UR0 A;  4ZVO B;  3ULH A;  2RRN A;  2LDI A;  4IFV A;  3T5J A;  1EB0 A;  2B3T B;  3EYZ A;  1ZH5 A;  1KQS R;  3DOM B;  3SCL E;  2EWH A;  3G87 A;  3RU0 A;  1CQN A;  1OPI A;  2J0W A;  3GE9 A;  1UW4 A;  2RS2 A;  4ZPD A;  1WTB A;  3RG6 A;  1Z4U A;  2EVZ A;  5LM7 E;  1U2R A;  2HWH A;  2AYM A;  3W3S A;  2JEJ A;  4EUV A;  2FGO A;  1M5K C;  2KG1 A;  1HQE A;  4GRS A;  4Y3C A;  3MCN A;  2YNF A;  4B9S A;  3CCJ S;  4LF9 F;  1O0P A;  4TU7 A;  5HLF B;  1HR0 J;  4DPW A;  1RAH B;  5HAO A;  3V6D A;  3ISN D;  4KYZ A;  2EXU A;  4WE1 A;  1KLM A;  5L1J A;  7FDR A;  2V4J A;  3GIR A;  4I4B A;  3VR1 A;  2HMI B;  3GQC A;  2X51 A;  1K73 T;  4DUZ J;  4DV1 F;  1H3D A;  3DRX A;  4JV5 F;  2LCW A;  3CD5 A;  1D09 B;  2ZM6 F;  3H25 A;  3V6H A;  4URG A;  3AB2 B;  1I6J A;  2HWT A;  2XMA A;  3KUG A;  4OJH A;  4X4V A;  4XIU A;  1V3S A;  2XS2 A;  3M30 A;  3M8P B;  2CJY B;  1S7I A;  3CIM A;  4RO0 A;  3SSR A;  1WHY A;  2YWW A;  1E6V A;  2BX6 A;  3OR1 A;  3B82 A;  2J7W A;  3CCL S;  1NCL A;  4UZC A;  1NLK L;  5J1P A;  3ZTR A;  5KG2 A;  6FDR A;  4A4J A;  3J7Y I;  5A8W B;  1BD6 A;  1S0V A;  3GCW P;  3BR8 A;  2ABY A;  1FER A;  1IKV A;  3PO5 A;  4WKR A;  2B8Q A;  4ZVS B;  2AEM A;  3LGH A;  5KFN A;  4PXB A;  5K20 B;  4F36 A;  3GII A;  2MKY A;  1GNK A;  3QO9 B;  3POT B;  1XMQ F;  4FKY A;  2UUB F;  4AUK A;  3PHE A;  3V81 B;  4GVL A;  1VQ7 S;  3LW5 C;  2B5J B;  3CT9 A;  4DV7 F;  4MFB A;  2R2T A;  3ETO A;  1T03 B;  2U2F A;  2MHN A;  2NXN A;  4ED0 A;  1VRT B;  3C16 B;  3E01 B;  1SKW A;  1WUU A;  1YBT A;  2AEJ A;  1NLT A;  4FNH A;  3NEK A;  1GMU A;  3MR3 A;  2OEJ A;  2FVC A;  3KJN B;  2ZH7 A;  3KLE A;  1YZ6 A;  3P96 A;  4LF1 A;  5M2P A;  3ZNJ 1;  3FCW A;  5EN1 A;  2BQR A;  2R7X A;  2OKQ A;  1CJU A;  4C8Y A;  3R8Y A;  5D6G A;  5A8K B;  3PW2 A;  1MSW D;  1FES A;  4M5D A;  3KLV A;  2VPY B;  5KFX A;  3EXY A;  1NK0 A;  2AJ1 A;  3EGV A;  1U8S A;  4NRU A;  1ELO A;  4U95 A;  4DPX A;  5J2P B;  2V8H A;  2XMU A;  2LU1 A;  1FEE A;  4HI1 A;  1ZM9 A;  4ZPB A;  4GKK J;  5KFT A;  1YTY A;  2N4C A;  3I5A A;  3NCR A;  2W9B B;  2EK1 A;  2D3O 1;  1W26 A;  4ZK7 M;  2FYX A;  2M8D B;  4DXL A;  2NPF A;  1FWK A;  5B0G A;  4CTA A;  3A3P B;  3MEG B;  4DN9 A;  1JJ4 A;  2HLT A;  1VBZ A;  2KFY A;  2EBE A;  5KFK A;  1DY3 A;  4DSK A;  3BKU A;  2AJ2 A;  1JMT A;  1U2F A;  1WOS A;  4H54 A;  3I32 A;  1XK8 A;  1KFD A;  2B6A B;  1YHQ S;  2CJX B;  1XTZ A;  1JLE A;  1PSD A;  1QY7 A;  1IBK F;  1JLF A;  4WFZ A;  2W8L A;  4DL6 A;  1X4C A;  2XSJ B;  4NI2 B;  4IR9 A;  4ZP6 A;  4HVZ A;  1GFW B;  1X5S A;  4CYU B;  2VBX A;  5AE3 A;  3OXG A;  2I6W A;  2AKW B;  1TK8 A;  3GJQ B;  4YEA A;  2D69 A;  3TRG A;  3W63 A;  2W4C A;  4FXW A;  2ZZM A;  4I64 A;  1P1L A;  4KH0 B;  5KG5 A;  2WBM A;  1WG5 A;  1C2P A;  1HBU B;  1KON A;  3JSY A;  4QCL A;  3MMA A;  2DD8 S;  1FEH A;  3GIL A;  3C19 A;  4DV5 J;  3ILO A;  5DJB A;  1HD0 A;  1I94 J;  2R8H A;  2XC9 A;  4NXM J;  2MZS A;  4D3H A;  2FGC A;  2M52 A;  2QYC A;  2OTJ S;  3L95 X;  3AD7 C;  2XY5 A;  1Y0H A;  4H4K A;  3DRS B;  1KC8 T;  2G13 A;  2X3G A;  5KT6 A;  3MZI A;  1OJ4 A;  1HQU B;  3HZG A;  1L5U A;  4EBC A;  2B56 A;  1FXD A;  1HWJ A;  3UN5 A;  2MZ1 A;  1TL4 A;  2Q6C A;  4XO0 A;  3D68 A;  5KAK A;  1VGY A;  2ZH9 A;  2W4D A;  2KHD A;  2XO6 A;  1RT6 B;  1UJ5 A;  3UD5 A;  1YJU A;  4QW8 A;  5KFY A;  2BRL A;  4CNZ A;  2IMW P;  3EVM A;  1S9G B;  2DNN A;  3MUT P;  2R2R A;  3KLI B;  4C8N A;  3V2U C;  4MKB A;  4IFV B;  3KJV A;  3ZNU A;  2C28 A;  1JXL A;  1X4B A;  3RYL A;  3OSN A;  3QNW B;  4H4K C;  3THP A;  3QZ7 A;  4DX5 A;  1GK8 A;  2HVZ A;  2HLU A;  2DYA A;  2KXF A;  2UV8 A;  2OIH A;  3M9M B;  4K4T A;  2CQB A;  3N4W A;  2CPZ A;  1S1T A;  2HFS A;  1GTE A;  2QO3 A;  4B3R J;  4DQS A;  3PEH A;  2D3Z A;  1X4A A;  1MRO B;  1R31 A;  1B7F A;  2YNF B;  3AOD A;  3H98 A;  4FXD A;  5I3Q A;  1B0V A;  3G6Y A;  2UXB J;  5FLX U;  3V6D B;  3KMQ A;  1KLM B;  1IKX A;  2FJB B;  2ZNY A;  2HYI B;  1URN A;  2CJB A;  3GFY A;  4Q8E A;  1JXE A;  4ALZ A;  4V19 X;  4RWX A;  4ECY A;  1U2C A;  2XYP B;  3F56 A;  2ZHA A;  2ZD1 B;  2C42 A;  3M30 B;  4UF4 A;  2IVF B;  4M5J A;  2M2B A;  2YX1 A;  5RUB A;  4CO1 A;  1E6V B;  4LF4 J;  2DKO B;  1R43 A;  1VRU A;  5BXI A;  2RUG A;  2RDI A;  1VHF A;  5J2N B;  2HBR B;  2R7V A;  3FEX B;  5CCM A;  4F4K A;  4DR1 F;  1YVF A;  3SCJ E;  1WF0 A;  1N0U A;  1YJ9 S;  3R5A A;  4DV4 J;  3CWJ A;  4NLV A;  2V50 A;  3BKT A; 
#chains in the Genus database with same CATH homology
 3AGZ A;  3TJA A;  1GMW A;  1C3G A;  3I38 A;  3L9Z A;  3AGY A;  3LZ8 A;  1NLT A;  3LA0 A;  2HFV A;  1XAO A;  3TJ8 A;  2B26 A;  1EB0 A;  3NXZ A;  1GMU A;  3TJ9 A;  2Q2G A;  1EAR A;  1GMV A;  4J80 A;  3AGX A;  4L3K A;  3NY0 A;  2QLD A;  1GMW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...