3TJAA

Crystal structure of helicobacter pylori uree in the apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 35
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tjaA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tjaA02
2HFVA 1GMWA 1C3GA 3LA0A 1EARA 3AGYA 1NLTA 1GMUA 3AGZA 3LZ8A 3NY0A 2Q2GA 1GMVA 1GMWD 4L3KA 3TJ9A 2B26A 3L9ZA 4J80A 3TJAA 3TJ8A 3AGXA 3NXZA 1EB0A 3I38A 1XAOA 2QLDA
chains in the Genus database with same CATH superfamily
2JVMA 2XY6A 1T9XA 2DY9A 4P10A 2P6SA 3GSDA 1MN9A 2KXFA 4ZMMA 2AJ1A 2FUG9 1T11A 4DR2F 2LEPA 2AYBA 3W5XA 1TFWA 5CXTA 1Q0NA 3QIPA 1X0FA 3B4DA 2APOA 2DKOB 5K20B 5BJRA 5IT0A 5AXMA 3MEGB 1X4AA 2D74B 3PW2A 3ILLA 4KHPJ 2MGZB 1B99A 5KT5A 5HLFB 3JQKA 3CD5A 1OY9A 2XI2A 2OELA 2DR9A 2V0NA 4TU7A 4BC7A 5J1PA 1EETB 1KHWA 2Y3YA 3QIDA 2A2CA 3SCJE 1LW0B 2MKSA 1G4CA 2BM1A 2VFRA 3T19A 1JLFB 4KQZA 1F3VA 2AEJA 1FK9B 3GR0A 2MZTA 3OJSA 2DRDA 1U47A 1IKVB 3EVWA 4PXBA 2HGMA 1U8SA 2VODA 2FHKA 1S1XB 4RNNA 4FYXB 1D9FA 4ILMA 1RDRA 1YJVA 3HVAA 3ZC4A 2DTJA 5C7PA 4J9SA 1MMLA 1UPPA 4ID5B 1NBEB 2VKRA 4I7FB 2YXLA 2W9BA 3D2WA 1YJ9S 3W2WA 1KS2A 1RAEB 1VHFA 4C6AA 2DGUA 3AD7C 4AXJA 2E7VA 2X1FA 4QYZK 4NEZA 4M94A 1AUDA 1S1TA 3MECB 1NK6A 2RQMA 3MFHA 3AQOA 3NOGA 2RF2B 3H5SA 1RTHB 3AXKA 4CLLA 2YKMA 3KG0A 3M8WA 1UPMB 3J81Y 4DV1J 5DG8A 3IR7B 5CZVA 4DFPA 1OY6A 1U49A 2X3GA 1EP4B 3CIMA 2YTCA 1R0AA 1QDUB 1TL7B 4KV8B 2KXNB 2MQOA 1Q4RA 4JI1J 2I5JB 4X65F 2QYCA 3DKDA 4WFXA 1O5JA 1UFLA 3VVTA 2KO1A 2WONA 2E5LJ 3CTRA 2ZH6A 3CO9A 4MKBA 3V5RA 4QW8A 3VGVA 4I2QA 1N6QA 3KK2B 2IY5B 4WBFA 4P52A 5B0FA 4DSIA 4FKYA 3DMJA 2W2QP 3CXCR 1PYTA 1ZM3A 3IG1B 4ZP7A 1F1BB 2YKAA 2QJ3A 3HVTA 4DL3A 1K44A 2Z2ZA 3VAHA 1SJFA 4X4OA 1ULRA 1HI1A 3N5FA 5B0EA 4FS2A 2G0CA 3KUGA 5I4MA 4KAIA 3ILJA 4AL6A 2BANB 2KJVA 2QL9B 4C0BA 1SC6A 3CDBA 1ACMB 3EM1A 4QIVA 3ENAA 3S1TA 1U1KA 2GAGC 2XLKA 1GEHA 4KRWA 3K5NA 5K8OA 3HSJA 3WBZA 5F8NA 1NSQA 3SI8A 3POTA 1OY8A 4KFBB 4JI8F 1N36J 3IO1A 3FEZA 3M2UB 1NK9A 1PC5A 1IWAA 4MTPA 1Q79A 2DVIA 3DM2B 1RSCA 5GAGI 4W92B 1CULB 2YNIB 3MR3A 5KFUA 4DQQA 3DLHA 1WSVA 2KZZA 1HWIA 2B7CB 2DR6A 1SC3B 2DNQA 1N48A 4NLQA 2MLXA 1HKAA 4K4ZA 3I5BA 1WSRA 4FVCA 1FWKA 5EX3A 4TVAB 5IQ6A 1S59A 3PEJA 3C6UA 2V68A 1VBYA 1JJCB 4WPAA 2IM1A 4JV2A 1TV6B 3CVKA 4Y6IA 2WB1D 2BOPA 4KH1B 1K47A 5H1SV 1B0VA 3B6BA 1MROB 2ZVSA 3GU0A 3MR2A 4MFBA 4P2MA 3PY8A 4DQSA 3LP2A 3A8JA 2JC1A 4NRUA 2K3KA 1MSWD 1SKSA 3QJLA 2V8GA 4ECZA 1K1SA 2QV6A 3D1HA 3C15B 2GVDA 4DMZA 4HL9A 3W64A 4F26A 3DRPB 5M2RA 4O44A 4NXNF 2B7BB 4KTQA 5GADI 2MYFA 5E3PA 4WP9A 1PYOB 1C4CA 3OVSA 2UXCF 4DV4J 4NLYA 3QZ8A 1NCLA 1C4AA 1R3NA 4DR4J 3DOMA 3PX6A 3K8VA 4QR2A 4B3OB 4HKQA 3J7AN 1H6KX 3VQSA 1RA7A 1U09A 2BJ8A 2CQ1A 3NLCA 3HVWA 4CTAB 2J8AA 3V6DB 2IIHA 3MR6A 4J9VA 1X5SA 4K2JA 4ZJLA 2YNHA 3R5GA 4F3QA 5ETVA 1NM2A 1NPKA 3UD3P 2XTJP 3KLHB 2KH9A 1SJQA 2AX0A 4A8MP 4HDHA 1IBKF 2OTJS 2OFGX 3Q8UA 4ETXA 2XYHB 3I5AA 3U1NA 2ZD1A 2FY1A 2YKPA 2GHPA 4DV2F 1WOPA 3A8KA 1S9EB 4DV1F 3D67A 2HNYB 4N76A 1KTQA 4KGVB 1UEKA 3UDLA 1VC5A 4GVBB 2GIRA 3DYAB 4LBIA 3LGHA 2E29A 2MJUA 4HEA9 3HHLD 4YMEA 2C3YA 4RUCA 2R7SA 2VJUA 3KLGB 5A8RB 4JI1F 2DGXA 1AYEA 4WZQA 1HWLA 5KFRA 5L8RC 2RRAA 2WVEA 4ES1A 1V3SA 4Y2KA 1GXUA 1KDNA 3I5CA 1TUGB 3I0RB 4F36A 1UVNA 3HVRA 2JDJA 3DOLA 2E5LF 3NCPA 3UWTA 3H7HB 3BJYA 1VQMS 4YQWA 5GAGU 3D7SB 2V69A 3KLFB 2DNLA 3V4MA 1VBXA 2Y1JA 3MMCB 1M5VC 3JYTA 2DPJA 5FD1A 3BB5A 5IZHA 1N0VC 4QPTA 3CJSA 2ACYA 3M32A 4EWTA 1U48A 2LYVA 5JMNA 4OHZA 2DCUB 1YJWS 3R8YA 3G71S 4UOFA 4DR3J 5D8HB 1JXVA 2DPIA 5C25B 2RU9A 3PFEA 4RW4B 1YKWA 4F8RA 1T9UA 1DTQA 3JSMB 4KO0A 2XGQA 2RHSB 3M8QA 5C42A 1RT3B 2EFVA 3O3LA 5HQLA 4RU2A 1KFDA 1RBLA 2DD8S 2LA4A 3TANA 3LAKA 3M05A 2XY7A 3H5UA 3SSQA 3O44A 4PQAA 5A0YA 3TYTA 4EYIB 2VUGA 2BQ3A 4ZVGA 1N52B 1DTTA 2JH3A 4NCGB 2M5YA 1GFWB 3OR1A 3R97A 1EAYC 2HNDA 3R27A 4TYAA 3EE3A 5IC4B 4QR0A 2KI2A 4J7CA 3IGNA 4K2XA 2PI4A 4KY3A 3T6JA 3QMQA 5GMKa 5GADU 2FVQA 5T41A 3HT3A 5CYMB 4WFNQ 4LF7F 1L3TA 1Q86T 1S9FA 4DG1B 1YRTA 2EK1A 1M0SA 3CDUA 5FLXY 3U02A 1QVGR 4C97A 1X5TA 4JV5F 1JLGB 1IKYB 4ZPAA 4OI0A 1E6VB 1TVRA 5HJYA 3A3NB 1XNQJ 1LOUA 2D3OR 1U25A 4IO1A 1S99A 3MEGA 4NI2A 5FDLB 2MGZA 5HLFA 4TQRA 1FI4A 2BOAA 2XLJA 5G0RB 2BA9A 2YWKA 3LWMA 1EETA 2IA6A 1ZZNA 1LW0A 4LFCJ 4P6QA 2Z2MA 3W9JA 1C0UB 1CQMA 1JLFA 2DGSA 1GXLA 4B9VA 4YY3F 1FK9A 3Q8QB 1N56A 2CZ4A 2UUAJ 5DQHA 4TXSA 3IA0A 1VQ6S 1PKUA 1G1XA 2U1AA 2DB1A 4LR8A 4J5OA 1IM4A 1L3SA 2MPUA 2BABA 3T1HJ 1T8EA 2MHNA 3OXGA 4OYPA 1CS4A 2RUGA 2LFVA 2XZDB 4NA3A 4J9RA 4F7VA 1RT6B 3D1QA 2KL8A 4ID5A 2FYXA 3S6EA 2HHSA 3P5BP 4DV7F 3VALA 2YKQA 5LL6d 3ZTSA 4QWBA 3HF5A 3JXOA 2AGQA 1VI7A 4C98A 3AQPA 5G4DA 3ENWA 2BW2A 4QBUA 4JI2J 4CH7A 5CQGA 1WDTA 2BE2A 2ZE2B 3MECA 1GXTA 1UW9A 2RF2A 2KTQA 2X1BA 5CCMA 5F8GA 3NWRA 2O01C 4K5SA 4Y2IA 2R7UA 1NLKL 4B3SJ 1V9OA 1TUWA 2J9DA 4I64A 1TL7A 3H5XA 2AU0A 4KV8A 2LU2A 5B08A 4DR7J 4LSNB 3MD1A 1M1GA 2RRBA 2K06A 5F8MA 5AE2A 2ATCB 2QGFB 4A4JA 3G6VA 4JI7J 4NXMJ 2E9ZA 2CYYA 1G2EA 5KT4A 3ZTRA 4DX6A 1NJWA 2UXDJ 2QA1A 4Y2CA 5DZ7A 1WEXA 1I94J 3KK2A 3EZUA 5IC6B 3CCQS 1XEZA 1JJ2R 3IG1A 1S72S 4UOGA 2WZ1A 3UVJB 3OXFA 2XYPB 1CJVB 5SZTA 3FKBA 2QT7A 2C2OB 2VG6A 5F0UA 4D3GA 2Y1LB 1F3FA 4DR3F 4CLUA 2CJKA 2KVIA 3FJ2A 4U9RA 1WHVA 4U95A 4XDDA 4P2FA 3O5TB 2BANA 1HWJA 2HFOA 3KK3B 4OHVA 2BMBA 2LLZA 2XNQA 3IAS9 4Y2AA 2PT0A 4MKAA 2BRLA 2FLNA 3FBCA 1GX6A 2R7VA 1SJ3P 2HKEA 1IUJA 3CF5Q 2AJQA 1T05B 1KONA 4JOUA 2J6SA 3FGVA 2K1RA 2NXJA 3KHRA 2J9CA 4PEOA 3VTIA 1M1HA 4KFBA 1KC8T 3EGZA 1S1UB 2K7KA 5JVGQ 4MK8A 4AFFA 1HYSB 1I5OB 2RDDA 1UVLA 3IWNC 1NO8A 4WFBQ 3DM2A 1CULA 2N7YA 2YNIA 4NA1A 1FVSA 3CC2S 1Q1KA 4HTIA 2AEFA 3BSCA 2B9EA 1ITPA 4KR0B 3BN4A 1HBNB 3L95X 2NQPA 2Y0BB 1Y10A 4Y2MA 1BHNA 1CG2A 2V67A 3LGNA 2CPDA 3TVKA 4CT8A 2VIHA 4DL2A 3C19A 3HFZB 4Z2XA 1H98A 2ERRA 2BKPA 3ILIA 2AV5A 4MYTA 1FRLA 3MUTP 1RHKB 3G96A 1YBUA 1SUQB 4QWAA 4V19X 1SH2A 1Q5YA 1VRUB 2IMWP 3X3UA 3QFHA 2DGVA 3OSNA 3EUNA 4A46A 2XWXA 4X2BA 1XAOA 5U47A 3P4UB 4Y00A 3SYZA 1YTYA 3J81U 4LUBA 3WZ0A 4EZ6A 2FGCA 3C15A 4USTA 4O3QA 2B9YA 1VQYA 4FF2A 5KFTA 2J6UA 2W2PP 1F2GA 3DRPA 5E7OB 2YVSA 2XSFA 4MIAA 2VPWB 1D9AA 4ZHRB 3NMAA 4B3OA 2BJ7A 3CW2C 4I1TA 1V5VA 4LT6A 2GMLA 4USMA 2E5HA 5DGAA 1PAEX 1SL0A 4OZ2A 3V6DA 2ZITA 2B5JB 1TTHB 1U1OA 4CM2A 1WC4A 2JSXA 5IQQA 3ZZOA 5EX0A 2CQCA 2XZWA 4JBCA 3BN7A 4DSEA 2HHHJ 2Z58B 2FZGB 3JTPA 4EI2A 2J8SA 4TU9A 3KLHA 2W9AA 2HZCA 6FDRA 2ZJPQ 3DN9A 2F9JA 1NKCA 1QAYA 3OSPA 3TJ9A 1O51A 3P49B 1SH3A 3M8ZA 3ZZRA 1NKEA 1H3DA 1RACB 4RWWA 1Z2ZA 1KSPA 3AJ2A 3M7VA 2PD1A 2HZAA 2HNYA 3Q22A 1K73T 4RLEA 2AJ2A 2XMJA 2EBEA 1WNEA 2B56A 2VQFF 4GVBA 5J1NA 4E98A 3DYAA 1WDDA 5D4PA 2F5GA 2OH2A 2IYIA 5LSRA 1RCOB 1Y9OA 4DF4A 1LK5A 3CCES 2E1MC 3GYNA 1X4CA 2BX6A 1DURA 4NLWA 7FDRA 2DHAA 3G8TA 4NLSA 3I0RA 4KPCA 4W4MA 4NXMF 3Q23A 5KG2A 1VQ5S 3NKYA 4FVMA 1I94F 3E51A 1NDCA 5ETRA 1QUVA 4J90A 2IA0A 1XMQJ 2IDEA 4G1QB 5E3QA 4C4WA 1F2HA 1NSKL 3PV8A 4W90B 3MMCA 1R8CA 2R7RA 4DR5F 5HQMA 3QRRA 1REGX 1FRKA 3PRBA 3UD5A 3PEHA 4USHA 1AFIA 2HSEB 4OJHA 2E5IA 3NS6A 2C2KB 2IAJB 3LGMA 1KBRA 2JZ5A 5C25A 2HAFA 4RW4A 4AQYF 4FBTA 4GC6A 3CD6S 3T1YJ 3TARA 3JSMA 5KFNA 4KBIA 3GV8B 2LU1A 1RT3A 3SEOA 3G87A 3K0JA 3OTCA 1RT5B 2ZZNA 1W7WA 2MKKA 1C1CA 1Y3KA 4LBPA 2MZJA 4GO5X 2H5EA 3PO5A 4OI1A 3TEHB 2AYGA 3L4BC 3IAM9 4NCGA 3OTDA 4RU9A 2GO9A 2ZBQA 2G2OA 4OZNA 4FF3A 4IUFA 4WK1A 3L9ZA 1JNZB 1S4EA 3IWXA 3FMWA 3H42A 4B9SA 4ZOSA 2MSSA 4C11A 3MM5B 2AJFE 3M9NB 4LIRA 2HQGA 5CYMA 2DK2A 3T5LA 2YNFB 3IM8A 2FJWA 1VQLS 4UQGA 2VG7B 1BWVA 4Y65A 3QGGA 2ZKUA 5IS2A 4KPYA 3JQJA 5KFPA 2QTWA 1JLGA 4IFVA 1IKYA 4TNOA 1DFDA 1E6VA 1IJEB 4WXWA 2RB7A 4NASA 1H7XA 1KFSA 3M2RB 3NNCA 5FDLA 3I56S 1GK8A 4PAAA 1NH7A 1GX5A 4LF9J 3TVYA 5E3CA 2M2BA 5I3PA 5G0RA 4EBEA 3CJ8A 4F0KA 3K58A 3OTOF 2CPZA 2CVEA 1U6FA 1ZZFA 3SSRA 3OXLA 2F8MA 1WKLA 5SUHA 3R9LA 2W2NP 3J7A1 2G9OA 1VRQC 1UFWA 4LSZB 1TFYA 2CPEA 3LP1B 2RU3A 3MR5A 2J9EA 3PIOQ 3OVBA 1YJRA 3TA0A 2N82B 1NDKA 3C3LA 3NEKA 3NS5A 1OQ6A 1WJ9A 1TP7A 3CC4S 4DV0F 5HAOA 4MK9A 3OL6A 4MK7A 5DQGA 1VC6A 3RR8A 1NLTA 2W24A 4OV6A 2F65A 4WTOB 4PABA 3RRKA 3PFOA 1SL2A 4RWXA 1HHTP 4K4YA 3MOZA 1W2IA 2F3JA 5ETPA 1H2VZ 1VLYA 4QIEA 2YWFA 3K89A 4Q8EA 2G4BA 3EXCX 4DL6A 5ETLA 1N5QA 2AWZA 2M0GB 2VPYB 4NLOA 4HACB 4IG0B 4F0HA 1R43A 3A13A 4EEYA 5KT6A 1FXRA 1GMUA 4EBCA 4BWMA 1R89A 2L08A 3T9ZA 4TLQA 3DHXA 3THVA 2H5IB 2I9SA 1GNKA 2OD6A 4O3OA 4U7UD 2ADCA 3IM9A 3RRGA 3EDQB 2N3LA 4L75A 5KG1A 3DRSB 1SJ1A 1T94A 2D7SA 3US5A 5BXIA 1YK9A 2JLGA 2JFKA 4Y28C 4KGZB 4LSNA 4RBVA 2LXIA 4X4NA 5EDWA 4PQUA 3OTBA 3SFUA 2ASDA 3I9V9 3K5MA 4PR6A 5LJ5Y 2V4RA 2CDQA 1HI0P 1T0TV 2KZMA 3WX8A 2BE7D 4H4MB 4X66F 2JC0A 4LVNP 5IV3A 4MIWA 2I38A 2R7XA 4X64J 2FLPA 1QSSA 2FB0A 4YR3A 1DLOA 2CPHA 3MMBA 4C8LA 2VG5B 5FLXU 3JTOA 3RB3A 1RAJA 4QR1A 3QT6A 3M9MB 4EZ9A 4DPYA 3SQOP 1CJVA 3BSNA 1BD6A 3UCZP 5L9XA 3IRXB 2VBYA 2DIVA 3GYXB 3S8SA 2C3MA 2P9CA 1VLOA 3T1YF 1RABB 3QRQA 3MGJA 3M2VB 3K7RA 3NP5A 2ZOGA 3D66A 2CWKA 4Q8FA 3Q2SC 3CJRA 5DLGA 2IC3B 2CQDA 2DO0A 3PZPA 3OLAA 3TP2A 1XK8A 2FHMA 3BV8A 2RHQB 4USUA 1T05A 4UUWA 5B7WA 4U6PA 4EO6A 2JEFA 3VZIA 2FVSA 1TZ0A 1JIHA 2COLA 4ELVA 1FCAA 1BE4A 2WRMA 1N5SA 4M8LA 1K0VA 3UN3A 1X9MA 5E33A 1HYSA 2W7PA 2MQPA 3M6WA 2HHPA 3GB0A 2PFFB 4BLGA 4UQTA 3O8WA 2K8GA 1VFJA 5HMZA 1DY3A 2OPQB 2DR7A 3PR5B 4DDFA 4UW2A 4YDXA 4RW9B 2VPZB 3SCKE 2IMOA 4X4PA 1WEYA 2HBQB 5F8IA 2ZHAA 4URQU 5KFYA 4ICLB 1P1TA 1TUVA 4URSA 5ETKA 4J9QA 1WG5A 1PJ7A 5L38A 3UN2A 3MEKA 2DR5A 1RT2B 2DNNA 1YITS 1VRUA 2W4DA 5D0EA 2R8JA 1JLAB 2CQBA 4AYBD 4DV6J 1YHQS 4DWIA 1NNDA 4DZ6A 1JLQB 4EK2A 4Y3CA 2KRRA 4DJBA 5HROB 2WSCC 2EFQA 3H90A 2VOPA 5K8NA 4FF1A 1FE4A 4JV1A 2XLIA 4E2FB 2CPXA 2CRLA 1T3OA 2YKOA 1Q8KA 1UVKA 2C2EA 1S7HA 5KFEA 4F67A 5D6GA 3UDEA 4YR2A 4M63A 1VQPS 2HRTA 2GAHC 3R6LB 1M1KT 1TKTB 1NMEB 2HQFA 2XMMA 3I4PA 4PWDA 1LFPA 2XC9A 2HG4A 3SBMA 3R6GB 1FDDA 3JSRA 3FK4A 1N33J 3MI7X 3EPGA 3MTKA 1D8ZA 3FEYB 5H9FJ 5KG5A 1HNXJ 4CO5A 3N79A 2VBXA 2RNEA 1FO1A 3W60A 2VJVA 4GKJJ 2VQEJ 1YBTA 3HHLC 4DV3J 3RYLA 1HD1A 3PW0A 5MAOA 1F5BA 4ZVTB 1KQGB 2H51B 2AGPA 4NCBA 2O3DA 1EQ0A 2I0XA 2B51A 3AOCA 2YY3A 1R31A 3JAMU 3DRRB 2KM8B 1VHIA 1Q8BA 2Q66A 4C0OC 4DR6J 1O6XA 4ATNA 2HRYA 3M9OB 2VBZA 2GMJA 3A8IA 3AH6A 1K9MT 1Q7YT 3HI9A 1RBAA 1DZ5A 4OZLA 4CDIA 1HQUB 3THTA 2RDJA 1KVKA 1UA0A 1EB0A 1FRMA 4ZJQA 1JJ4A 4TN2A 3BH6B 4ZVOB 3PO4A 1FERA 3T1AA 2D3ZA 3VHQA 4ELUA 1YDLA 3PHEA 3CJKB 3TZWA 4JI3F 3G86A 1PILA 2BJDA 2D1CA 2FJVA 1BY9A 1WOOA 2M8HA 2BDPA 1RHQB 2V94A 3QIPB 5KFVA 3B78A 3I32A 1RK8A 3FNNA 4H4KC 2OLWA 4KIAA 5HO4A 3M30A 5GMEA 2MKIA 2R7WA 3OLBA 3RAQA 2RT3A 2XMKA 1RTDB 1TELA 1SIZA 2DO4A 1SVDA 1WORA 4OZJA 4OMFG 4LRAA 3PW5A 4PYDA 4OQJA 2RS8A 1L3UA 4C48A 3PVXA 3RRHA 1RT5A 1B0TA 3GR1A 4B9UA 2GHWA 1RWVB 1EHWA 5ADZA 5E41A 2XMAA 3QGHA 3SDEB 1KLNA 2JRRA 1H73A 3GIKA 2XWYA 3B82A 3PJWA 4Q45A 2ASLA 1CPZA 2A6OA 4J9NA 1P8GA 2QZ8A 3ICLA 3C16B 1RWNB 4HT5A 2FHOB 5KFQA 2CVIA 2XCPA 1HNWF 5A8KA 3MM5A 1VC0A 2EG1A 3P3DA 4N47A 3NWGA 3ZTOA 1JKHB 1W25A 4TY9A 2W9BB 2YNFA 2CAJA 2VG7A 1Y3JA 3ZFVA 1HR0J 4AT1B 4ZDNA 3HX9A 4BC9A 1VCTA 4CLTA 3CD7A 4LF2A 4JI0J 3R5DA 3LP0A 4ZLPA 3TAQA 4F4AA 2NSCA 1SC1B 5E3RA 1XIQA 2C2NA 1WOSA 3GPAA 5AJ3J 4L74A 4B08A 3M2RA 1RLCL 3C5XC 4ID8A 2YKMB 2BQRA 5IWAJ 3AGYA 4YS2A 1KVIA 1RAGB 3GJRB 2G1HA 3AXMA 3KG1A 4NWBA 3KLEA 1WKKA 3ET6A 1MLAA 1T95A 5E2QA 1HNVB 3BBBA 2ZC4A 5JJBA 3NAHA 4MT1A 2JWNA 2JX2A 4HDGA 4CQ1A 2NS1B 4JI6J 2OAUA 3DRYA 4PRFA 1VYAA 3PW4A 4RKUC 2DRAA 3GONA 1FRJA 1WF2A 3GYGA 3LP1A 3KTQA 2Q1LA 3KDOA 4W98A 4C8OA 1S6OA 1N34J 3W61A 4HHUA 2W4CA 4U8YA 3L7PA 4DUZF 3RW7A 3DU5A 3QLHB 1S1WA 1HW8A 1O8BA 4FPRA 4QU6A 3KHHA 2C3OA 5K5MA 2FJBB 3BQ1A 1D0EA 5H9EJ 4NLTA 4WIIA 3CIZA 3KLIA 1R0CB 2PMHA 2RUSA 2HEKA 4ZIWA 3TOQA 2UXBJ 2Q3PA 4O3RA 2L3MA 1QSYA 2XB2D 1H38A 4DSFA 3ZNUA 2QMXA 4GKJF 7AT1B 1WELA 3AB2B 1KNZA 1RHUB 4OV1A 2PEHA 1U02A 3WDOA 2XULA 4DPXA 4HACA 4C8MA 1SV5A 3T3FA 4DCOB 3BDEA 3R7SB 2B4UA 2W1BA 1VBZA 4PG8A 2J7KA 2FLLA 3ISZA 4DR6F 2P5VA 4WU3A 3POTB 1HMVB 1UETA 1UZHA 2GNKA 2Z8QA 2HLUA 3DRSA 3H5YA 3KOAA 1ZS6A 1UCNA 4N77A 4N56A 1NRKA 5KTQA 5D0GA 4WYLA 1CJUA 4OZ5A 3NNHA 3D3CJ 4LF1A 5GAEI 2HFVA 1RT1B 2J7WA 2CNOB 2OGUA 2MZSA 3FRZA 2ZBIA 4R25A 3OPKA 4LF4F 2CUYA 4ZLNA 4N8OA 3MMJA 2FPHX 2OFHX 1KN6A 2XYGB 3HFVA 4DR2J 1Q95G 4C3MA 1RHMB 1Q78A 4H4MA 2DHHA 1N32F 1S9GB 4EBDA 3ENQA 8RUCA 2VG5A 2C3UA 2CQIA 2LQ8A 4QOTA 3CMAS 4PKDB 5HVGA 3IRXA 2FLOA 4UZBA 4KE5A 2BYCA 3KWMA 2CXEA 4JI5F 1R8PA 3PJXA 1X5OA 1JLCA 3D6TB 1RTIB 1T9YA 2CIMA 1SQFA 3M2VA 1VIXA 2M4MA 4I2PB 2F4FA 4BBYA 1P9YA 3I4HX 3BBFA 3DLBA 2NLWA 3H2LA 3CSKA 4ITSA 1QM9A 4ETZA 1QLNA 4IDKB 2I6WA 3OJUA 1U2FA 3KJFB 3OBIA 3UDCA 1AZSB 1FE0A 2WVCA 4GO7X 2HLTA 1YZ7A 3MFIA 1LXJA 1HNIB 3MTJA 3DOMB 1S49A 4C8ZA 4RZRA 2AYMA 3NBPB 4LREA 4YB1P 5LOQA 4ECQA 4CO2A 1XERA 3DXSX 1GTEA 4OYOA 1Y7PA 4QWCA 3CD0A 2OPQA 3VAJA 3KK1B 3BO3A 2DITA 2CNLB 2BJ9A 3KNGA 2IHR1 1X4HA 4RW9A 5KFHA 2RH3A 1HR0F 1BGXT 5AXKA 5HI7A 3ISND 4ICLA 3RBEA 1VQOS 3P8BB 4CWBA 2B3TB 4DI6A 1P6TA 3D0GE 2PFDA 4USWA 1PSDA 5AJ3F 1SCJB 3R5BA 2GJ2A 4Z7CA 2C2ZB 2XI3A 1JLAA 1FJGJ 3QAEA 1U6ZA 3ADAC 3KMSA 4PG5A 1JLQA 1XNRJ 2F1FA 4XPEA 5A2QY 4F2SA 3MR7A 1GTHA 3WQPA 1ZOTA 4ED8A 5HROA 1KVJA 1M5KC 4EU0A 3GP9A 3PTWA 1RE1B 2GW8A 2YX7A 1LK7A 2NXUA 4N41A 6AT1B 1N4LA 2Z57B 2M3DA 4AUKA 4ZVFA 4X65J 2WW8A 4FN5A 1LFWA 1N34F 2OMOA 4OYBA 4KH0B 3TUJC 2NREA 3R7BB 1G7CB 5DM7Q 2XMUA 1TKTA 1IBMJ 5AT1B 3CDAA 2KN4A 1HA1A 4FNHA 1UJ5A 4DL5A 3C2PA 4IR1A 1EKSA 1PCAA 2WTFA 1A6LA 5GAEU 3HJFA 3P45B 1RWOB 1HBUB 4J37A 4QQBA 5LT5A 2NSBA 1ZAWA 3UD4P 2FD2A 5B0GA 4KHMA 1S0OA 4UUXA 3N0VA 2G2YA 3SQGB 3RGIA 1RU1A 4KO0B 1QAIA 4TQSA 1NSAA 5C42B 5AE3A 2YBVA 1UL3A 1RUSA 3R1HA 2DH7A 4DUYF 2C22A 4J9OA 1R8AA 2E9RX 3BR9A 3MCOA 1MN7A 4LRDA 4QZVB 1NHUA 3PYDA 3DRRA 2V2QA 1YJ7A 1FFWB 4JI8J 2VASA 2XG8A 3ZZTA 4M5MA 3QJPA 3M8YA 5DQIA 4M95A 5DRKA 1HQUA 3FBFA 2H9ZA 1L3VA 4ZKAA 4P7VA 4Q7AA 2O66A 3RJMB 4O3NA 5D15A 2WVDA 4LF5F 3H98A 4ES3A 2ZEJA 3CJKA 1KD1T 1KOHA 3K2YA 1Z4UA 1GH8A 2CQ4A 5DM6Q 3M6XA 1IN0A 3FSIA 4OHYA 1X4BA 3I55S 4M1KA 5K9FA 1TVRB 4L3KA 5EWGA 4GVLA 3RB0A 4NI2B 2JHEA 4OYZA 2XMTA 4P75A 1RTDA 2LQJA 4K4SA 3GG1A 1XQIA 1NB2A 4NMLA 5AE1A 2VL1A 2XY5A 2HHXA 4DLGA 2EG2A 2RQCA 4L6V3 3PW7A 2BEFA 2H1YA 2RDIA 3BPDA 4R5PB 1ZPVA 5I3QA 2ADBA 3SDEA 3RR7A 4CCHA 3AD8C 3DLLQ 4NXNJ 2Z56B 4ERDA 1NZAA 2K3IA 2NPFA 1FDBA 1FNMA 4A48A 2UXCJ 5KAKA 3M6VA 1FA0A 3MAAA 2X1GA 4FBUA 4NYPA 4ZVSB 3C16A 1U1NA 1XC9A 2R42A 1VJWA 2ILZA 1CS4B 3VAMA 4ZVRB 1X60A 2CQ2A 3CJ3A 3KHGA 3KJNB 3I6PA 4RW7B 5B0AA 2E1PA 1JKHA 1Y5NB 4DL7A 3V6KA 2B9WA 1T7PA 2YNGA 2XCAA 4J9KA 2D9OA 2CZ9A 2UUBF 1IBKJ 3U1MA 3CC7S 2BE2B 4OZ1A 2MKYA 2Q6BA 4OHWA 3R2DJ 1R7IA 3QWPA 1YLXA 2N4CA 4G1IA 4DV2J 1YWXA 1OQ3A 3BGUA 4PZVA 4NEYA 1JMTA 1FJGF 2G13A 1U2RA 4ER8A 1XNRF 1YX2A 1X4EA 2UU9J 4P74A 2M52A 3PX0A 1HNVA 2DXEA 3Q8PB 2P8IA 2LA6A 4Z37A 2FZKB 5KFKA 4G6VB 5K8MA 4P71A 3H0PA 4UOCA 4LFAJ 2WOMB 1NJYA 1CLFA 3B54A 3I31A 1URRA 4LF8J 5F0WA 3PXGa 1VMBA 4OX6A 4M5HA 3HP6A 2QLWA 2YX1A 4TU8A 1XBWA 3FZ2A 1TK8A 3QLHA 2DHXA 1IBMF 4G3IA 5CD4A 3BGRB 3LALA 1C1BB 1PBAA 1F9EB 2XMVA 3K5LA 2QEXS 4B9LA 2WVFA 3RB6A 4ZITA 3JSBA 1TMMA 1LWFB 2Q79A 1OMSA 4HR2A 3G8SA 1LXNA 2HHWA 2PA3A 3PACA 1HI8A 3NGDA 2UVWA 4WK3A 2VG6B 2EXUA 2I1RA 2PGCA 4O23A 5DGBA 4U8VA 4EFAC 2Y1IA 3ZNJ1 5KFMA 2E1CA 3T6BA 2M7SA 3CJ5A 3MZIA 1V5IB 5D0RA 1RYRA 1FD2A 3TAMB 3M4XA 1SJRA 2PSZA 3RBZA 1PGZA 3FEXB 2K1RB 1TKXB 3CEDA 2HS3A 4DUTA 1HMVA 2WK4A 2R7QA 3MMAB 2F9DA 4DPWA 2IRXA 4RX6A 4CT9A 1IM6A 5DDOC 1FD8A 2VH7A 1RWXB 2OD4A 4OI2A 4DS4A 5B0BA 1E6YB 3DLGA 1WG1A 1J2VA 2RAQA 1F60B 5IT9Y 2RQ4A 3LQVA 1ZM2A 4JB8B 1JJHA 3MPDA 5CHCB 1CBKA 3HSGA 1RT1A 4JUZA 3VV2B 3TX0A 3CMES 2HFZA 1KQSR 4LF7J 1YSJA 2W4PA 1GT8A 5KOWA 1WF1A 2C2DA 4ANCA 1RT4B 2D3O1 3ZTQA 4JV5J 1S9GA 1NSPA 2HS0A 5KFDA 1U6BA 3QPIA 4G1PA 5J2MA 4K50A 2CQGA 3I87A 1TL3B 2B43A 3DXBA 2HVDA 5KG6A 2FDNA 5LXRA 5L1IA 4RNOA 1RWMB 4F25A 1FF2A 5DZ6A 2DT9A 2KFNA 1HWKA 5F8LA 3J7YI 4WE1B 1P9QC 4IOAQ 1CJKB 1RTIA 1B64A 1I51B 3FCHA 4ILRA 4I2PA 4DCPB 2QMWA 2VA2A 3BF4A 1OPIA 3QT7A 3H8YA 4IDKA 1FDNA 2KFZA 1NEEA 4YY3J 3LW5C 3W5ZA 4GRSA 4WKRA 1DAXA 3D6FB 2HGNA 4C8NA 1AZSA 1NB7A 3N6NA 3EX7B 4X84A 2CNNB 4IKAA 1XWLA 3CCUS 1HNIA 1SH0A 2DNGA 4OZ0A 3W9IA 4X4UA 1IQTA 2LEBA 2X3DA 2AYEA 3TZYA 2R3VA 3NBPA 3FQLA 4JI4J 4M5DB 4O3PA 3LPYA 3OVAA 2XBPA 1RI7A 1S6QB 4DV7J 2Q43A 4ECVA 3KK1A 4O3SA 3UR3C 1S12A 2E7XA 4LRFA 4H4OB 5EHHA 5GMDA 3TA2A 3SV4A 2EEYA 4ILLA 3RTVA 4FZVA 4F3MA 4DSJA 4A8KA 3TWZA 5GVQA 2KM8C 4ZCKA 3BSOA 3MEEB 5T7LA 3UNYA 1SKUB 3VAGA 5F9LA 1YBAA 1RBOB 3HMJG 2VBWA 4EGLA 4DXLA 4GKKF 5EGYA 4L73A 5ETOA 3QRPA 2MLZA 2LKZA 3F41A 2FHJA 2DNOA 4FNIA 2R2RA 2F7VA 2F8EX 3HHEA 2UU9F 2HBRB 2CQPA 4USVA 3ZZ0A 4UY8T 1FESA 1CSJA 2CJAA 4U7CA 4QYZJ 4FXDA 4IQXA 2HQ3A 3ETOA 2G0JA 4LFAF 1R8BA 4IG3B 2H4WB 4JYAF 4LF8F 1FKOB 1JWWA 2A6MA 3MM9B 2HFNA 4I6WA 1GQEA 5EN1A 3OL9A 5LMUF 2BJ3A 4V1Ak 1VQ9S 2EFNA 3IBWA 1VDHA 4I0WA 4DLEA 2HPUA 2CPJA 1S0VA 2JLFA 2HQIA 2ACMA 1HBUA 2E9TA 4OYAA 2KVQE 1TKDA 3CUNA 4I6YA 1TL1B 2E1AA 2OP5A 4WTYA 4XAKA 3U1LA 4ZN3A 2OUGA 2EBGA 2P9GA 1XMOF 3SQGA 5D0HA 3C14B 2AT1B 1Q8LA 1TQLA 3AJDA 2LMIA 1P1LA 4B3TF 5DG7A 1UA1A 2YWEA 1WI8A 1APSA 1U26A 4URGA 1PBUA 3OL7A 3M8PB 1C1CB 3CCSS 4ECXA 1NJZA 1EX8A 1B0PA 4I56A 3EVOA 2DNZA 3T5HA 3J7YU 3ELHA 4RBUA 4NLVA 3DCAA 4Y34A 3PKYA 1NH8A 3MPYA 3DNCA 4XTTA 1J5OB 2MDAA 4IRDA 1S77D 2XSJB 3KDNA 3SXLA 1HARA 3ILOA 1C0TA 5LM7E 3R5CA 2HNZB 5FIIA 3PIPQ 2PI5A 4C11B 4ES2A 1PC4A 4IH6A 5KFXA 2HRUA 1RHJB 1YJUA 4NL5A 3E2EA 3VAIA 4QIGA 5DETA 1FRXA 2VU5A 4OJGA 2CADA 4NLRA 4DS5A 2FJEB 4ZP9A 1VQNS 3BPSP 1CQNA 3BSAA 4IFVB 2DH9A 2DGWA 5CCLA 1FXDA 2VZ9A 2MQNA 4NLXA 2BRKA 1UWBB 2KJWA 3HHNB 1U1PA 4I69A 3DU6A 3OR2B 1MNEA 2KHCA 1RWWB 1F9FA 3TR5A 5KT7A 5C2CA 5K14B 2NPIA 2J6TA 2IRYA 3OFGA 1VR6A 1D3WA 2YPYA 3UW1A 5LSOA 4R5PA 1NHKL 2JJ4D 2O5DA 1SKWA 3V4IB 1WEZA 1FX2A 2J0SD 2M88A 4WXOA 2RSQA 1ZH5A 3ULHA 2AHOB 1KRPA 5HSPA 4FXVA 2GQQA 4OX9J 2I2YA 2GJFA 3CNQP 3OFEA 2ROGA 3H59A 3CO0P 2CJBA 3QO9B 4A8YA 4KHRA 4DX8H 4DL4A 1LWEB 4ZCLA 4JI4F 1S6PA 1WC5A 2OSRA 2A2DA 4RR5A 2AZ1A 2GIFA 4RW7A 1JXEA 4I4BA 3CULA 1UP1A 4LIWA 5M2PA 2GGPA 1H0HB 2A18A 4IFYA 1R8HA 4KC5A 4DQRA 3F73A 4DOZA 1DQ8A 2IM3A 2M70A 1SI9A 2ZH2A 4J80A 4A47A 4QYRA 3HDSA 4ENOA 1NK0A 4NCAA 2DNRA 5B0DA 2OTLS 2GIQA 4CH0S 1RHRB 3W5YA 2XS5A 1H7WA 1MU2B 4ZCIA 1WI6A 5HVFA 4MAKA 4NZ7A 2YWHA 1VIOA 2VQFJ 2J9DE 3SMZA 3CCTA 4F50A 4EO8A 5KFZA 4KGXB 3D9BA 2VDIA 3Q8SB 1NZ8A 2V8PA 2BR0A 3GCWP 1MWZA 4XO0A 3MCSA 3OTEA 2WOMA 4ZPVR 3W9HA 2HW3A 2OO4A 2HIYA 4LQ3A 3FCVA 2B8QA 3NGSA 4PQUB 2F4VJ 3B4MA 3BR8A 1U8WA 3ITHB 1VBKA 1RWKB 2QLXA 1IBCB 3PCOB 3BGRA 1C1BA 3CWJA 1SB6A 3DLJA 2IVFB 3W3SA 3ENVA 1TAUA 4KKOB 2V9WA 1UMJA 1DLOB 3MMBB 4DR5J 1HD0A 1LWFA 3VGUA 1ZM9A 4Q44A 5L46A 1CEZA 3PNIA 1HNZF 2KFYA 2QYGA 3V81A 4FYVB 1K0TA 4AQYJ 2Z0GA 4M5JA 2IPOB 2RKIB 3OUYA 3MEDB 5FJ4A 1QE1A 3AB4B 3GIJA 1Q53A 4GC7A 1Q16B 2AF6A 1X7VA 3MDFA 5F9NA 3TAMA 1FEEA 1RZMA 4CM0A 2MZRA 5BYSA 4X4RA 4IQMA 1TKXA 1QD1A 3KUEA 1Y11A 3C46A 3MMAA 5J1EB 2LP4A 4I68A 3Q8RB 1WC6A 3EYZA 2HGLA 4V19J 2AJ0A 2BV3A 1E6YA 2IVMA 1PIEA 2ROEA 2Z4PA 3QGPA 2V4JB 3A4TA 4F2RA 2H54B 2R2TA 4GMKA 4F4WA 4YB7A 3HCXA 6FD1A 1RXOB 1I3OB 1NK4A 2YQ1A 4KGKA 1RT4A 1OYDA 1XR7A 1OPZA 5ETSA 3ONQA 5LSLA 3M6UA 2CNKB 2DEIA 2R4FA 4CLZA 7FD1A 4OYWA 2KT3A 3SIPB 4CLFA 2ATLA 2WBMA 1NPRA 1TL3A 1AROP 2HYIB 5KFSA 2HZVA 3EZ5A 2PE8A 4CIOA 4DPOA 4DU8A 5IM0B 2ZJRQ 4ZN1A 3PJ9A 3DOKB 1NAQA 1URNA 5A8WA 2NXEA 3GTYX 3JQMA 2ZDOA 2DXFA 1RAAB 4TY8A 4WE1A 1CJKA 1F5AA 4ZPCA 4XIUA 4DN9A 1WD6A 3AA8A 3IMQJ 3OTOJ 1YIJS 2DNMA 2F8HA 1ZAVA 4YOEA 4IYQA 4FPIA 4DSKA 3AAWB 2ASYA 1FRIA 3GJTB 2ZWOA 4HLBA 2PMZD 2FVCA 1RLDA 3TQEA 2WSEC 1NK8A 4L76A 1JLEA 3GV5B 1FXLA 2NXCA 3KHLA 1KHVA 3OFFA 2F40A 2ZBPA 4AD6A 4ZPWR 2DBBA 4K4TA 4OX9F 3ISNC 1N5TA 4OZ3A 1RB0A 3GV7B 1LWXA 4PWDB 4O4GB 4DV0J 1NK5A 2G0IA 2CQ3A 2Y1RI 4M5DA 3HSZA 2N3OA 4ED6A 5EUHA 3VGTA 2Y0SD 1S6QA 1SQGA 4DU7A 1UKUA 4YB6A 3AKOB 4H4OA 1FX4A 4YR0A 3AOBA 4CLWA 5DDPC 1F5CA 4M5KA 2CPIA 4NE9C 2ALYB 1ZBTA 2KHDA 2XHCA 4OJ3A 2CQ0A 4KJIA 2EFPA 2XZTB 3CB4A 3ETMA 5KG4A 1X4GA 3MEEA 4ZP8A 3ZZZA 4IOBA 1FTCA 2BUNA 3MCMA 3B8HA 2J0QD 2UVRA 3BGLA 2ZZTA 4Q2LA 5HMXA 4IH7A 3W65A 2A0FB 1X31C 3KXDA 2QG9B 2AX1A 3HFKA 3EICA 1RU2A 3HKZD 1RAFB 5KFFA 4Q0BA 2L9WA 4B3MJ 1AB8A 5HBMB 1U7LA 4LSLB 2OPPB 2OKQA 4WFYA 3RG6A 1S48A 4IG3A 2VFSA 1X8DA 3MPWA 3QWUA 1G6BA 1FKOA 4PG6A 3EPIA 3MM9A 2F4VF 2UV8G 3HK2A 3L09A 1T03A 2QLBB 4XDCA 4PPZA 5IT9U 1JB0C 4ECTA 3QFWA 2CJQA 2VFVA 1FEHA 4DV5F 4X66J 1AT1B 1RKIA 1AUSL 1NKBA 4ED1A 4ALZA 4FYWB 3M30B 1TL4A 1JXLA 2POKA 3GE9A 2UUCJ 2SXLA 3H2VE 1TL1A 2B0GA 4F02A 2H65B 3MURP 3CCWA 2V2KA 1OYEA 4P73A 2YWWA 4RUAA 2BACA 3LA0A 1JX4A 2U2FA 3C6TB 2UVUA 3C14A 3BEGB 3LWLA 4QW9A 4PXEA 4BCAA 5KOXA 4ANEA 2FTRA 4Q2MA 3I38A 1HLWA 3KNAA 2BBEA 3M8PA 3TUPA 4CO0A 9RUBA 2ROPA 1U0HA 3FRYA 1MWQA 5LJ3Y 2YQ3A 3QJJA 3LO3A 2R2UA 2VV5A 2KT5A 1N54B 2V2ZA 1J5OA 1FFSB 2MQ8A 2E5JA 1H74A 2XSJA 2ZWPA 3MWBA 5DG9A 4Y0FA 3NY0A 2Q2GA 4DFMA 2HNZA 2DR8A 2L9NA 2GVZA 3OQ2A 2GCFA 5A8KB 3QYYA 2EPIA 3HO1A 4WP3A 5D3GB 3FUYA 4RW6B 3BKTA 4OYIA 1L3KA 2YH0A 5C5JA 1WC3A 4ELTA 2YH1A 2YKNB 3UO0A 1S7IA 2DHSA 4ZPDA 1YQHA 2MTLA 1RAIB 3M8SA 1TKZB 2G1DA 4DQIA 3CCVS 2O67A 3LP0B 4B9NA 5KFAA 1GMVA 1UWBA 2AW0A 5KFCA 1DBDA 1BQMB 2V8DA 3D54A 2CJ9A 3OR2A 5KFWA 2ZBRA 4ED2A 3IR5B 4WU2A 2OIHA 4KHPF 4DR1J 2I8EA 4KGMA 5K14A 1ZTTA 3VCDA 4PXDA 2V8VA 3KLEB 5DS7A 3ET6B 4C9DA 2FC8A 3N5BA 3GWCA 1N5YA 1ELOA 3BQ2A 3N6LA 2HBZB 4BWJA 4WCEQ 1I1GA 2WHOA 3DC2A 3V4IA 1DARA 3EVMA 2H48B 2AMCB 2NUHA 4OHXA 5IXUA 1UJ6A 1MG7A 2IBKA 2VFUA 2UUWA 4B9TA 1QAJA 1FTRA 2HWHA 4TLRA 3OD2A 3CJTA 1EKRA 3VWSA 3HSDA 1S1WB 3QO9A 5C24B 1QJHA 4WZMA 4HH1A 5C2GA 1QTMA 1LWEA 3A3OB 4IH5A 3GIMA 5ETQA 3OFHA 3TRGA 3LANA 2MQQA 3VVUA 3U7JA 3KLIB 2W9CA 4RBTA 5I3UB 2OI2A 1VGYA 3TJAA 1WHXA 1X9WA 4K4UA 2V50A 4K7QA 4ED7A 1PG5B 3BH7B 1HQEA 4ZCMA 1LWCB 3R5AA 1PO6A 1S1VB 4ZVQB 1JLBA 3UN5A 2ALZA 2VD3A 3PYEA 2XS2A 1SV5B 1EARA 1FNOA 4WFZA 1MU2A 2VOOA 2ZH8A 3MM6A 2B8PA 4XPCA 5J2QA 1IWGA 5J2PB 1WC0A 3EGWB 4B9MA 2DNKA 2MXYA 2Z2LA 3AA9A 2LQ9A 1C3GA 4A8XA 2R7TA 4B3MF 4QJVA 3O1LA 2X7IA 2HHUA 5HMYA 1HBOB 2OEJA 3UE2A 1IKXA 2XO7A 2CQHA 1CJUB 2N4DA 3EDRB 4X4TA 1FJ7A 3HHKA 1V3RA 2FQQB 1C2PA 3I9ZA 1RTJA 3ITHA 1UTAA 1G3OA 4JI3J 2V34A 3DGPB 3PRVA 2VPXB 4KKOA 3RU0A 2MB0B 2EKNA 1UVMA 5HVHA 1IKWB 1U45A 2KDOA 4AL7A 2UUCF 2P2CB 4HHJA 4A8WA 2QLDA 4BS2A 1A0OB 1Q82T 3VZHA 4ECRA 1JLCB 2IVYA 2ZDPA 3CCMS 3BM7A 5IFMA 1U24A 2FGOA 2RKIA 1HW9A 3MEDA 3P6YC 3GIIA 3AOAA 4P7TA 2N7CA 3AY0A 1H2TZ 2BM0A 1BQXA 2JEGA 4ZVEA 1NDPA 4DFKA 3HHLB 3CCZA 5HJXA 3UDVA 4CO3A 2RS2A 3GJSB 1N36F 4DF8A 3C6EC 5J1EA 4USKA 1M5PC 5A76A 1Y00A 1AA1B 4PPDA 2AKWB 2E66A 5L9NA 1IR1A 1HNWJ 2FVRA 2V4JA 3O2IA 4ECSA 2BQUA 2IBOA 2VONA 3FFIB 4JV0A 3U27A 1QSLA 1U4BA 2YWGA 1UVJA 1VK8A 1ROFA 1NUEA 1IR2A 3A8EA 4CLSA 5A6PA 3TVZA 1T9TA 4P72A 3VR1A 3SV3A 4OI4A 2RIJA 2XEXA 3FBBA 3CJ0A 2R2SA 2MSTA 2MZ1A 5IM0A 1NPPA 3DFEA 2GMHA 1S0NA 4PWWA 4CI0B 3DOKA 2EI5A 1DQAA 4QPXA 4DR1F 1WHYA 2ABYA 1DRZA 1RP5A 1EZZB 3HLUA 5J2NB 3ZO7A 4AE5A 2BJEA 2GJIA 4QWEA 2BW7A 5CH7B 2BZ2A 1F0XA 2W8LA 2GX8A 5HQ8A 1LW2B 1HIYA 2E7WA 4M5IA 1P27B 1QVFR 3CDWA 3TNVA 2HHQA 1FKPB 5HP1B 2XMWA 2B26A 2DHGA 3FQKA 4K4VA 1R6YA 4X62J 1IKVA 3QT8A 5CYQB 2HMIB 1ICEB 5IOLA 4C8KA 4DV4F 1BUXA 4DUZJ 1HBMB 1S1XA 2PA8D 3W66A 4O4GA 4DR4F 2IYGA 4K59A 2RILA 3IN5A 5ITHA 1NHVA 4PG7A 2NCKL 2GQ2A 2DXDA 4CZCA 2QLJB 3I96A 3H25A 3E8OA 4CO4A 4I7FA 3TAPA 3IP0A 3K5PA 4C7QA 1Q7LB 3TA1A 2V4QA 1A9NB 2MJNA 5E5NA 1SJ4P 3CCRS 4LMZA 3I82A 2V8HA 2WAQD 3AHPA 4A8OA 2B4OA 4LQ9A 1YJTA 2H4YB 1RTHA 2ZH1A 1ZA2B 3KFWX 3PDNA 2GHVC 4LRBA 2NXNA 4USIA 3A12A 3S7RA 2VHGA 2RVJA 1EP4A 1KOOA 1D09B 1JK9B 2FY8A 2HVHA 3IRWP 1RCXB 3KYLA 3E01B 2QA4G 3EGNA 2IDLA 5HBMA 4LSLA 1W2BR 1Q81T 3R5JB 4DCJB 2I5JA 2OPPA 3MUVP 3J80Y 4EYHB 2JEIA 4MKYA 2DGTA 3TW0A 1J5EJ 4LF4J 3QZ7A 5DLFA 4ECWA 5F3ZA 1B7FA 5RUBA 4R0EA 3A1YG 4F4KA 2CG4A 1N88A 1N32J 2V9KA 4NYZA 3TUZC 5E0OA 4F4YA 2CA9A 4KSEB 4ZPBA 1VRTB 2ZC3A 3LF0A 1CC7A 2GZOA 2FVPA 2RQKA 4R0JA 5D4OA 2NYIA 1CVJA 1FVQA 2HURA 3AT1B 2HQDA 3RAMA 2XS7A 1OWXA 1F9HA 2VC0A 4FYDA 4JI5J 2VF3A 1LQ9A 3C6TA 3F0NA 2QIFA 3JAMY 4OI3A 1QAXA 4KB7A 2R8GA 1SC4B 3TZZA 2DNYA 2ZHOA 5AXLA 3MAQA 4HTJA 2C28A 5GAHI 2EK6A 1REVB 1MWYA 5DDQC 1HL6A 2DRBA 2ZUGA 3QATA 3G9CA 2VFTA 3GZ7A 2DJWA 4OYMA 1S4FA 4QCLA 1U1MA 3MUMP 4PYAA 1DQ9A 2JL9A 4CO1A 2BKOA 3M2UA 3MAAB 2YQ0A 4DPTA 1RQ0A 3FCWA 4JP8A 2MLYA 1CC8A 4DX5A 2J0WA 1TU0B 2B6AB 2BVZA 4C2MA 1A7GE 2C42A 2J5AA 3BGOP 5D3GA 1BWEA 4RW6A 3TI0A 4WP8A 2A3JA 1SPBP 3C66A 3FSYA 5JXSA 2YKNA 2YNGB 2MQLA 2JNJA 4FP9A 1FJCA 3TQ1A 3L3CA 4FDFA 4L3NA 2AD9A 1TKZA 5KFGA 3GMGA 1N0UA 2DNHA 1K8AT 3WIVA 1LKZA 1XNQF 5KT3A 1BQMA 1TV6A 3G2XA 1VOMA 4IRCA 3G8QA 3JSYA 1ZETA 1OSDA 1MROA 1WUUA 2DGQA 2KT2A 1IXKA 1WG4A 3IFEA 4ZJOA 3VAFA 1S76D 1R0BG 2M9KA 4ED3A 3OL8A 4F0MA 2EW9A 4UTGA 2QL5B 3DDKA 4LFCF 2J0XA 4WIQA 5ETNA 3TUIC 2KXHA 2QA4S 1R6VA 2JVRA 3GJQB 2UUAF 2DISA 4X62F 4F4ZA 2LECA 4RNFA 1TR0A 5IV4A 1V6HA 1U1QA 5K8PA 8ATCB 3T1HF 5C24A 2HVEA 5HK4A 2C3PA 3DDNA 3GCXP 1IVZA 1S57A 3CCLS 1Z2LA 4P2SA 4CTAA 3THPA 4ZS6A 2NZCA 3LZ8A 4LFBJ 4DPUA 4NX9A 1GMWD 5I3UA 3X1LB 1NXIA 5JVHQ 1WF0A 4YP3A 4WKYA 4JI2F 4OYXA 3JTNA 1XR5A 2D3UA 1HQ2A 3VGSA 2GS8A 4CLYA 1AXQA 3WC2A 1LWCA 2D69A 1MW7A 5BYQA 1S1VA 3D3BJ 4ZLLA 2MQMA 3JB9k 4S0MA 1S9EA 5HANA 4MJKA 4DUYJ 2GA7A 4CYUB 1O0PA 2V6AA 1N5VA 1RISA 4K5RA 5J2PA 5HN0A 4B3SF 3R2CJ 2H5JB 3HZGA 5GAHU 1OIAA 3L7UA 3K59A 3KLGA 5A8RA 3DLGB 1HBOA 1HFEL 5KG3A 1ZA1B 4UY85 3HJVA 4DR7F 3PRDA 4FYYB 2PO4A 3MD3A 8AT1B 4JI7F 2E1RA 3K5OA 1J5EF 4LF5J 2H3EB 2EWHA 4HI1A 4BDPA 2RRNA 2ZH7A 3HPOA 1BQNB 1PAUB 3W2VB 4PG4A 2UXDF 2WBRA 3DGPA 5D77A 4OX7A 5L1JA 3KLFA 2D41A 5J2MB 3GLJA 1FJEB 2DY1A 1JNRB 2PDAA 1TL5A 1IKWA 1IR0A 3HZEA 3ZZPA 4Q43A 2UZAA 5B0CA 2Q6CA 5JUMA 2CJYB 2QMUB 2KG0A 4LR7A 2UVVA 4HH0A 3SCIE 5L1KA 3W8PA 2K7JA 3D4JA 2Y8YA 4MKVA 5CAAA 3RAXA 1GAOA 1TMJA 3DDIA 5E3AA 2HVZA 2OJ3A 4EMDA 1LNQA 5D4LA 3F44A 4DL0C 3FSXA 3Q8VA 4DEZA 2FHJD 4J9MA 3TZXA 4HT7A 2DEJA 1RADB 3GILA 3TX8A 2ZNYA 3G6YA 2JVOA 4P9SA 3Q86A 3AODA 4R8UB 2KKHA 1V3ZA 3E3XA 3HHLA 3EMTA 3AGXA 2FJXA 1RWPB 2W8KA 2Z30B 2ZBCA 1SQEA 3ZZUA 3UCUP 1U1RA 1VISA 3I0SB 4MIBA 4USJC 3NNAA 1VQSA 4RL1A 1KTVA 1UEUA 3PHTA 2JFDA 2QA2A 4B3RJ 2CG8A 1RAOA 3FFIA 4CNZA 3QNWB 1KLMB 3SCLE 3HM9A 4DG1A 1NJXA 3LH2S 1ZYQA 2GO8A 2AZ3A 4M5GA 3OHAA 2UUBJ 2V5HG 2KYZA 4RJVA 2OPRB 2LDYA 4LRCA 4ZK7M 2DIUA 4ZA1A 4RNMA 1T3NA 3TJ8A 3BO2A 4QIFA 5T7LB 4LJMA 3D1OA 2XM3A 1ZAXA 3QSYB 3P96A 3KMQA 2CWXA 3IS9B 1M5OC 4CP5A 3D0HE 5J2NA 5KG0A 1LEOA 2C2MB 5CA5A 4PUOB 4H4KA 1YRXA 4WWSA 4FKXA 4PWUA 5CYJA 1LW2A 5T14A 1S97A 3BKUA 3VF0B 1MMNA 1R27B 1C0UA 3CJ2A 1FKPA 1FFGB 3FBEA 5HP1A 1QTNB 2KRBA 4NOHA 5H9FK 4QIWD 3R7NB 1XR6A 5CYQA 1Q5VA 2HMIA 1RJJA 4EUVA 2HFUA 4NLDA 2EKYA 1LV5A 3LTOA 5CZXA 3N6MA 1NDLA 1H72C 1HBMA 2OPSB 4DHVA 3D5MA 4DN0A 3J7Z5 3L7OA 1RKJA 2HK2A 2PN6A 3W8GA 4E0DA 5KFBA 4OJ1A 1RT6A 4LFBF 2ZZMA 1L5UA 1N8RT 4U96A 3EJMA 2RD5C 1VJQA 2GQCA 3FC9A 2HHHF 2R8HA 2KB2A 2J76E 4ECUA 4H54A 2KG1A 1VQ8S 3IBCB 5KFOA 1DJ0A 2ZE2A 2W25A 1IQZA 5BR8J 5DDRC 2LXFA 4RUBA 3CE8A 4DX7A 5BYRA 1HPZB 2CPYA 4K4WA 2V63A 2NZ4A 3FMBA 4K4XA 3BO4A 4E8UA 1C0TB 3E01A 1UW4A 4J9LA 3GG0A 3D6HB 4QWDA 4G65A 5A6WA 4WYWA 3R3TA 1WC1A 4PXCA 3MF5A 1CJTB 3MM8B 3PKMA 3CPWR 2CKWA 3N9UC 2VDHA 4HHHA 4BHQA 3MCNA 2ASJA 1RA6A 3S01A 1SIWB 3G82B 3IC1A 3QQCD 2ILYA 1XMQF 2EC0A 1U0SA 1S0MA 2HBYB 2OEMA 4YFUA 1VRTA 1F6TA 4ANDA 3UVJA 1AFJA 1RT7B 2IJFA 3HXMA 5KT2A 1S6UA 4ZPTR 3M8RA 3BGFA 2ZOMA 1EQMA 3J81j 1RGVA 1D9DA 2HS4A 2VC1A 3T41A 2ODXA 3GFXA 4RW8B 4A8QA 3KK3A 1REVA 3N28A 2XNRA 2RJZA 2FJAB 1U1LA 4YHHJ 3BYPA 5EWFA 4OL8A 2HQCA 5LXYA 3VQTA 2BJ1A 2A10A 3AJ1A 1S1UA 3Q8YA 4CH1A 3GIRA 3Q83A 2BE9B 2LEAA 5L1LA 3N4WA 2B6AA 1S6PB 3RW6A 3QAUA 3KJVB 5KFLA 4B3RF 1XJWB 1Y5IB 3K57A 4F04B 1SL1A 3TO8A 3EWGA 1HBNA 1KP6A 2C2RA 4UOHA 1VQ4S 3SSSA 5M2UA 2GGPB 2Y9HA 2ZKTA 4ZP6A 4IFYB 1EIYB 3DI6B 2D9PA 5AXNA 1WWHA 4TYBA 1OO0B 4C3LA 2FZCB 3CJ4A 1QUPA 1SUQA 3BDPA 4K8RA 2X1AA 3ZXWA 3NAIA 1BLUA 2CDRB 4GKKJ 1FDAA 3G6XA 4LF9F 3MPUB 3H4BA 1X4FA 2VKZG 4MMOA 3FVYA 2CFXA 1UVIA 1KEKA 5H9EK 2MEWA 1WHWA 3OHBA 2QC3A 2EVZA 3CMQA 3H40A 4IRKA 2HK3A 3WX4A 2AQ4A 2MMYA 2O1PA 3D6MB 2E44A 3PM9A 3CDEA 3F56A 1K1QA 2ZUAA 4JYAJ 2ZOFA 2MY8A 3QSIA 3H4DA 2QSWA 3V6JA 4ZHRA 5LMUJ 2W2MP 1NU4A 4OIXA 3J80U 2C1EB 1X4DA 3G6ES 4WJBA 5KG7A 3NS7B 1MMDA 1IBLJ 3D68A 4NLPA 2M8DB 2B5JA 4NRTA 2JRSA 4J91A 1HHSA 2K2PA 3IXQA 4ZLJA 3LOUA 4OX8A 4OI6A 1FWPA 4DFJA 3V81B 4FS1A 1M90T 3NRBA 3WIUA 1X5PA 2AIRB 1XMOJ 5I42B 1YG0A 2DH8A 1Y0HA 1YGYA 3MM7B 1B3TA 5BR8F 1D8YA 3H2UB 3OUYB 1QE1B 1TAQA 4RPFA 4YEAA 3W62A 2MHEA 3JS9A 4B3TJ 2YX4A 2DYAA 4CLPA 2VB6A 4AXIA 3DLEB 4RNHA 1KWMA 1EJ7L 4CYUA 5F8HA 3SZ2A 4RUHA 4P2XA 2A1BA 3CCJS 4K0KJ 2PEBA 3M1VB 3UQSA 3KKFA 2WW4A 1S10A 3UCGA 2QSFA 3V6HA 5KFIA 3HD2A 1DHMA 4LR9A 3DLKB 3NGTA 2CZVC 3IGVA 1NJIT 2MY7A 1T9WA 2L41A 2UUTA 2NYHA 4UT4A 2MZQA 1JQGA 1UZDA 2MKCA 1BQNA 1YZ6A 3NMRA 3W2VA 3ZTPA 3OV7A 2CPFA 1PJ5A 3Q24A 3NCQA 2ZJQQ 2IJRA 1WTFA 4G1QA 4RO0A 2R9LA 1GMWA 2YPZA 2AGOA 4X64F 2HIQA 2DCLA 1H2UX 2WCXA 4KT0C 4M5NA 1X9SA 2X51A 4ZVUB 2QL7B 1KKHA 5A8WB 3W7BA 2IAJA 3RBDA 2ZNZA 3NGRA 5HL7Q 3HHDA 1U2CA 4TY8B 3FDSA 3WC0A 2LDIA 3BQ0A 1FT8A 4O4RA 4HI2A 4ED5A 3O6QA 2W7OA 4D3HA 1OSCA 2FIUA 4NPOA 4Z7YA 2P9EA 1UAWA 3EZOA 4R8UA 4YHHF 3P5TL 3A3PB 2ZVIA 1JLEB 1D1UA 3MHYA 1BMQB 2PMWA 5LMNJ 2ZH3A 1YJNS 2R8IA 3I0SA 3Q89A 3WHIA 3NG8A 4DQPA 1NK7A 3V2UC 5D78A 2HWIA 3RBXA 2W01A 1KLMA 3KG4A 2G2ZA 3W2WB 1UJ4A 4O0NA 4YN3B 1M5SA 1RTZA 2GC8A 2QX0A 1BC6A 3G4SS 2R7OA 3KLVA 3QBCA 2QN6B 1S1TB 2V2VA 2OPRA 1VS3A 2JLEA 2Z2YB 2KYXA 2IJNA 3DHWC 3K8WA 1UEVA 1SKRA 3T5KA 3PYFA 2XGPA 5IT4A 4N7TA 3IS9A 4X4SA 3CGIA 4NMXA 2HAIA 3MAHA 4DV6F 4OLPA 4DBQA 1X0PA 4PUOA 5F3TA 4KYZA 4N8NA 1KR4A 2JOQA 4QU7A 1R0AB 2CJXB 4Q0BB 5THWA 3UPFA 2IRUA 2HVIA 4J9UE 3GFYA 3C8YA 2W2OP 2LXUA 2QLFB 3HKWA 2FJDB 1XN9A 1I6JA 4HVZA 1IJFB 1BXNA 3IBFB 3EGVA 1UFKA 1FNXH 1T03B 2WONB 1S79A 1SBRA 2OPSA 1HWUA 4LF6J 3QGIA 2XQCA 2AJ4A 4I2QB 1N6QB 2OSQA 1OS5A 3TEGA 1XMBA 1IBLF 1Z1ZA 2ZFHA 3R1LA 3DMJB 3T5JA 4B17A 2XO6A 5B09A 4LBHA 3HVTB 1N33F 3MOJB 1HNZJ 2RE1A 4UZCA 2OMLA 1HNXF 4YDDB 1VQKS 1XTZA 3IWLA 2B4PA 2VQEF 2ZM6J 1RAHB 4DV3F 1PYSB 4C0HA 2F63A 2UV8A 2MKHA 3HT0A 3RUBL 2IM0A 1B4SA 1FKAF 1WACA 4IG0A 2OHDA 4FXWA 3FZBA 5ETTA 2HWTA 2L9DA 1U0HB 4NZ0A 4IO9Q 1YI2S 3GFHA 1M5HA 1B7YB 1HPZA 5KFJA 1TK0A 1VQ7S 3D28A 2ZHBA 3K17A 4K0KF 3RZAA 2B9XA 2WB4A 1Q8IA 5F8JA 3OW2R 1VK3A 1KQFB 2GVZB 1AW0A 2QE5A 4TKTA 2LVWA 3KJQB 4X4QA 2PIIA 1S5ZA 2LQ5A 1CJTA 3MM8A 3W1YC 3N01A 3PG9A 3HULA 4OLOA 4MYUA 1FHTA 2HHVA 3G82A 2EC2A 5MLCV 3C6UB 3Q0AA 3SFGA 1J27A 5CABA 2JEJA 4AL5A 4IR9A 1Y5LB 2LCWA 1Y4ZB 2B4VA 4I6AA 1RT7A 2FC9A 1OJ4A 5D4NA 3GSIA 2AEMA 1W26A 4MFBB 4C3KA 3IR6B 4YB5A 1FRHA 3LP2B 2HHTA 3H20A 2IC3A 4NLGA 2IM2A 1N5YB 4X4VA 2AP6A 4RW8A 4WFAQ 4M5LA 4CNYA 2GVDB 2L48A 4F3OA 4NLUA 3CT9A 4O44B 3BREA 5A2QU 3T9NA 3J7ZT 1UWAA 4YUDA 2JZ8A 4A8FA 3NOCA 5LMNF 2WVBA 2WSFC 3NGKA 1SXLA 3KUHA 4IOCQ 4DSLA 2BKNA 1WTBA 1FWLA 5DJBA 2P6TA 3BZQA 3HD1A 3BYRA 3KJVA 3NL0A 3RB4A 1ZTWA 2DGOA 2IFXA 3AGZA 2W9CB 3LAMA 2YNHB 3UNGC 2VA3A 1YRUA 3CJQA 5DO2A 4FF4A 3UFCX 2EFOA 3GFZA 3AFGA 2DNPA 2ZH9A 3DI6A 4JI0F 2ZH5A 1HQEB 2LQBA 1JLBB 3NXZA 2ZD1B 3OT9A 2OEKA 2QRRA 1RT2A 2QO3A 1YVFA 4UF4A 4U7UK 5IWAF 4ECYA 4CRJA 3MM6B 4L72B 3LUYA 5J2QB 1KQKA 2GV1A 4CLKA 1T02A 3AD9C 2R8KA 2E5GA 2W7AA 4PCQA 4JI6F 2MKJA 4XK8C 4N5SA 3DRXA 1IKXB 5EWEA 4F4XA 4HYKA 3PR4A 4ED0A 2HFSA 2PC6A 4NYOA 4ZIVA 4NA2A 4I67A 2EFGA 2ZH4A 1TK5A 1RTJB 3DOLB 4J9PA 4A8SA 1WKJA 1HHQA 2Y8WA 4LF6F 3MXHP 3BS9A 4DV5J 4C8YA 2QFIA 5HATA 3PX4A 5HMWA 4NZ6A 4B02A 1ZM4A 3JYTB 5CD4H 3BBCA 1QY7A 5ETMA 3NCRA 3M32B 3NGUA 4ED4A 2UXBF 4WF9Q 4MH8A 2KU7A 1T9VA 5I42A 2RMLA 3VAKA 2VICA 3BKFA 3MM7A 2ZM6F 1DTQB 3UR0A 3Q2TC 3M8QB 5L39A 3EXYA 3D0IE 3PYGA 3ZZYA 4Q5VA 4O0IA 3DLEA 3MPVA 5F41A 2UP1A 4ZVHA 4LVOP 3UI3A 2NR0A 4OFZA 2NUUG 5A0YB 2QFJA 1PJ6A 2J7UA 1DTTB 1RWUA 3QT5A 3M1VA 3OR1B 2HNDB 9ATCB 3W63A 4ZVPB 4DZDA 1RYSA 2XHWA 1B70B 3DGVA 1ZPWX 2GFFA 3DLKA 4U67Q 2BXJA 3GQCA 3LPEA
chains in the Genus database with same CATH topology
2HFVA 1GMWA 1C3GA 3LA0A 1EARA 3AGYA 1NLTA 1GMUA 3AGZA 3LZ8A 3NY0A 2Q2GA 1GMVA 1GMWD 4L3KA 3TJ9A 2B26A 3L9ZA 4J80A 3TJAA 3TJ8A 3AGXA 3NXZA 1EB0A 3I38A 1XAOA 2QLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFV A;  1GMW A;  1C3G A;  3LA0 A;  1EAR A;  3AGY A;  1NLT A;  1GMU A;  3AGZ A;  3LZ8 A;  3NY0 A;  2Q2G A;  1GMV A;  1GMW D;  4L3K A;  3TJ9 A;  2B26 A;  3L9Z A;  4J80 A;  3TJA A;  3TJ8 A;  3AGX A;  3NXZ A;  1EB0 A;  3I38 A;  1XAO A;  2QLD A; 
#chains in the Genus database with same CATH topology
 2JVM A;  2XY6 A;  1T9X A;  2DY9 A;  4P10 A;  2P6S A;  3GSD A;  1MN9 A;  2KXF A;  4ZMM A;  2AJ1 A;  2FUG 9;  1T11 A;  4DR2 F;  2LEP A;  2AYB A;  3W5X A;  1TFW A;  5CXT A;  1Q0N A;  3QIP A;  1X0F A;  3B4D A;  2APO A;  2DKO B;  5K20 B;  5BJR A;  5IT0 A;  5AXM A;  3MEG B;  1X4A A;  2D74 B;  3PW2 A;  3ILL A;  4KHP J;  2MGZ B;  1B99 A;  5KT5 A;  5HLF B;  3JQK A;  3CD5 A;  1OY9 A;  2XI2 A;  2OEL A;  2DR9 A;  2V0N A;  4TU7 A;  4BC7 A;  5J1P A;  1EET B;  1KHW A;  2Y3Y A;  3QID A;  2A2C A;  3SCJ E;  1LW0 B;  2MKS A;  1G4C A;  2BM1 A;  2VFR A;  3T19 A;  1JLF B;  4KQZ A;  1F3V A;  2AEJ A;  1FK9 B;  3GR0 A;  2MZT A;  3OJS A;  2DRD A;  1U47 A;  1IKV B;  3EVW A;  4PXB A;  2HGM A;  1U8S A;  2VOD A;  2FHK A;  1S1X B;  4RNN A;  4FYX B;  1D9F A;  4ILM A;  1RDR A;  1YJV A;  3HVA A;  3ZC4 A;  2DTJ A;  5C7P A;  4J9S A;  1MML A;  1UPP A;  4ID5 B;  1NBE B;  2VKR A;  4I7F B;  2YXL A;  2W9B A;  3D2W A;  1YJ9 S;  3W2W A;  1KS2 A;  1RAE B;  1VHF A;  4C6A A;  2DGU A;  3AD7 C;  4AXJ A;  2E7V A;  2X1F A;  4QYZ K;  4NEZ A;  4M94 A;  1AUD A;  1S1T A;  3MEC B;  1NK6 A;  2RQM A;  3MFH A;  3AQO A;  3NOG A;  2RF2 B;  3H5S A;  1RTH B;  3AXK A;  4CLL A;  2YKM A;  3KG0 A;  3M8W A;  1UPM B;  3J81 Y;  4DV1 J;  5DG8 A;  3IR7 B;  5CZV A;  4DFP A;  1OY6 A;  1U49 A;  2X3G A;  1EP4 B;  3CIM A;  2YTC A;  1R0A A;  1QDU B;  1TL7 B;  4KV8 B;  2KXN B;  2MQO A;  1Q4R A;  4JI1 J;  2I5J B;  4X65 F;  2QYC A;  3DKD A;  4WFX A;  1O5J A;  1UFL A;  3VVT A;  2KO1 A;  2WON A;  2E5L J;  3CTR A;  2ZH6 A;  3CO9 A;  4MKB A;  3V5R A;  4QW8 A;  3VGV A;  4I2Q A;  1N6Q A;  3KK2 B;  2IY5 B;  4WBF A;  4P52 A;  5B0F A;  4DSI A;  4FKY A;  3DMJ A;  2W2Q P;  3CXC R;  1PYT A;  1ZM3 A;  3IG1 B;  4ZP7 A;  1F1B B;  2YKA A;  2QJ3 A;  3HVT A;  4DL3 A;  1K44 A;  2Z2Z A;  3VAH A;  1SJF A;  4X4O A;  1ULR A;  1HI1 A;  3N5F A;  5B0E A;  4FS2 A;  2G0C A;  3KUG A;  5I4M A;  4KAI A;  3ILJ A;  4AL6 A;  2BAN B;  2KJV A;  2QL9 B;  4C0B A;  1SC6 A;  3CDB A;  1ACM B;  3EM1 A;  4QIV A;  3ENA A;  3S1T A;  1U1K A;  2GAG C;  2XLK A;  1GEH A;  4KRW A;  3K5N A;  5K8O A;  3HSJ A;  3WBZ A;  5F8N A;  1NSQ A;  3SI8 A;  3POT A;  1OY8 A;  4KFB B;  4JI8 F;  1N36 J;  3IO1 A;  3FEZ A;  3M2U B;  1NK9 A;  1PC5 A;  1IWA A;  4MTP A;  1Q79 A;  2DVI A;  3DM2 B;  1RSC A;  5GAG I;  4W92 B;  1CUL B;  2YNI B;  3MR3 A;  5KFU A;  4DQQ A;  3DLH A;  1WSV A;  2KZZ A;  1HWI A;  2B7C B;  2DR6 A;  1SC3 B;  2DNQ A;  1N48 A;  4NLQ A;  2MLX A;  1HKA A;  4K4Z A;  3I5B A;  1WSR A;  4FVC A;  1FWK A;  5EX3 A;  4TVA B;  5IQ6 A;  1S59 A;  3PEJ A;  3C6U A;  2V68 A;  1VBY A;  1JJC B;  4WPA A;  2IM1 A;  4JV2 A;  1TV6 B;  3CVK A;  4Y6I A;  2WB1 D;  2BOP A;  4KH1 B;  1K47 A;  5H1S V;  1B0V A;  3B6B A;  1MRO B;  2ZVS A;  3GU0 A;  3MR2 A;  4MFB A;  4P2M A;  3PY8 A;  4DQS A;  3LP2 A;  3A8J A;  2JC1 A;  4NRU A;  2K3K A;  1MSW D;  1SKS A;  3QJL A;  2V8G A;  4ECZ A;  1K1S A;  2QV6 A;  3D1H A;  3C15 B;  2GVD A;  4DMZ A;  4HL9 A;  3W64 A;  4F26 A;  3DRP B;  5M2R A;  4O44 A;  4NXN F;  2B7B B;  4KTQ A;  5GAD I;  2MYF A;  5E3P A;  4WP9 A;  1PYO B;  1C4C A;  3OVS A;  2UXC F;  4DV4 J;  4NLY A;  3QZ8 A;  1NCL A;  1C4A A;  1R3N A;  4DR4 J;  3DOM A;  3PX6 A;  3K8V A;  4QR2 A;  4B3O B;  4HKQ A;  3J7A N;  1H6K X;  3VQS A;  1RA7 A;  1U09 A;  2BJ8 A;  2CQ1 A;  3NLC A;  3HVW A;  4CTA B;  2J8A A;  3V6D B;  2IIH A;  3MR6 A;  4J9V A;  1X5S A;  4K2J A;  4ZJL A;  2YNH A;  3R5G A;  4F3Q A;  5ETV A;  1NM2 A;  1NPK A;  3UD3 P;  2XTJ P;  3KLH B;  2KH9 A;  1SJQ A;  2AX0 A;  4A8M P;  4HDH A;  1IBK F;  2OTJ S;  2OFG X;  3Q8U A;  4ETX A;  2XYH B;  3I5A A;  3U1N A;  2ZD1 A;  2FY1 A;  2YKP A;  2GHP A;  4DV2 F;  1WOP A;  3A8K A;  1S9E B;  4DV1 F;  3D67 A;  2HNY B;  4N76 A;  1KTQ A;  4KGV B;  1UEK A;  3UDL A;  1VC5 A;  4GVB B;  2GIR A;  3DYA B;  4LBI A;  3LGH A;  2E29 A;  2MJU A;  4HEA 9;  3HHL D;  4YME A;  2C3Y A;  4RUC A;  2R7S A;  2VJU A;  3KLG B;  5A8R B;  4JI1 F;  2DGX A;  1AYE A;  4WZQ A;  1HWL A;  5KFR A;  5L8R C;  2RRA A;  2WVE A;  4ES1 A;  1V3S A;  4Y2K A;  1GXU A;  1KDN A;  3I5C A;  1TUG B;  3I0R B;  4F36 A;  1UVN A;  3HVR A;  2JDJ A;  3DOL A;  2E5L F;  3NCP A;  3UWT A;  3H7H B;  3BJY A;  1VQM S;  4YQW A;  5GAG U;  3D7S B;  2V69 A;  3KLF B;  2DNL A;  3V4M A;  1VBX A;  2Y1J A;  3MMC B;  1M5V C;  3JYT A;  2DPJ A;  5FD1 A;  3BB5 A;  5IZH A;  1N0V C;  4QPT A;  3CJS A;  2ACY A;  3M32 A;  4EWT A;  1U48 A;  2LYV A;  5JMN A;  4OHZ A;  2DCU B;  1YJW S;  3R8Y A;  3G71 S;  4UOF A;  4DR3 J;  5D8H B;  1JXV A;  2DPI A;  5C25 B;  2RU9 A;  3PFE A;  4RW4 B;  1YKW A;  4F8R A;  1T9U A;  1DTQ A;  3JSM B;  4KO0 A;  2XGQ A;  2RHS B;  3M8Q A;  5C42 A;  1RT3 B;  2EFV A;  3O3L A;  5HQL A;  4RU2 A;  1KFD A;  1RBL A;  2DD8 S;  2LA4 A;  3TAN A;  3LAK A;  3M05 A;  2XY7 A;  3H5U A;  3SSQ A;  3O44 A;  4PQA A;  5A0Y A;  3TYT A;  4EYI B;  2VUG A;  2BQ3 A;  4ZVG A;  1N52 B;  1DTT A;  2JH3 A;  4NCG B;  2M5Y A;  1GFW B;  3OR1 A;  3R97 A;  1EAY C;  2HND A;  3R27 A;  4TYA A;  3EE3 A;  5IC4 B;  4QR0 A;  2KI2 A;  4J7C A;  3IGN A;  4K2X A;  2PI4 A;  4KY3 A;  3T6J A;  3QMQ A;  5GMK a;  5GAD U;  2FVQ A;  5T41 A;  3HT3 A;  5CYM B;  4WFN Q;  4LF7 F;  1L3T A;  1Q86 T;  1S9F A;  4DG1 B;  1YRT A;  2EK1 A;  1M0S A;  3CDU A;  5FLX Y;  3U02 A;  1QVG R;  4C97 A;  1X5T A;  4JV5 F;  1JLG B;  1IKY B;  4ZPA A;  4OI0 A;  1E6V B;  1TVR A;  5HJY A;  3A3N B;  1XNQ J;  1LOU A;  2D3O R;  1U25 A;  4IO1 A;  1S99 A;  3MEG A;  4NI2 A;  5FDL B;  2MGZ A;  5HLF A;  4TQR A;  1FI4 A;  2BOA A;  2XLJ A;  5G0R B;  2BA9 A;  2YWK A;  3LWM A;  1EET A;  2IA6 A;  1ZZN A;  1LW0 A;  4LFC J;  4P6Q A;  2Z2M A;  3W9J A;  1C0U B;  1CQM A;  1JLF A;  2DGS A;  1GXL A;  4B9V A;  4YY3 F;  1FK9 A;  3Q8Q B;  1N56 A;  2CZ4 A;  2UUA J;  5DQH A;  4TXS A;  3IA0 A;  1VQ6 S;  1PKU A;  1G1X A;  2U1A A;  2DB1 A;  4LR8 A;  4J5O A;  1IM4 A;  1L3S A;  2MPU A;  2BAB A;  3T1H J;  1T8E A;  2MHN A;  3OXG A;  4OYP A;  1CS4 A;  2RUG A;  2LFV A;  2XZD B;  4NA3 A;  4J9R A;  4F7V A;  1RT6 B;  3D1Q A;  2KL8 A;  4ID5 A;  2FYX A;  3S6E A;  2HHS A;  3P5B P;  4DV7 F;  3VAL A;  2YKQ A;  5LL6 d;  3ZTS A;  4QWB A;  3HF5 A;  3JXO A;  2AGQ A;  1VI7 A;  4C98 A;  3AQP A;  5G4D A;  3ENW A;  2BW2 A;  4QBU A;  4JI2 J;  4CH7 A;  5CQG A;  1WDT A;  2BE2 A;  2ZE2 B;  3MEC A;  1GXT A;  1UW9 A;  2RF2 A;  2KTQ A;  2X1B A;  5CCM A;  5F8G A;  3NWR A;  2O01 C;  4K5S A;  4Y2I A;  2R7U A;  1NLK L;  4B3S J;  1V9O A;  1TUW A;  2J9D A;  4I64 A;  1TL7 A;  3H5X A;  2AU0 A;  4KV8 A;  2LU2 A;  5B08 A;  4DR7 J;  4LSN B;  3MD1 A;  1M1G A;  2RRB A;  2K06 A;  5F8M A;  5AE2 A;  2ATC B;  2QGF B;  4A4J A;  3G6V A;  4JI7 J;  4NXM J;  2E9Z A;  2CYY A;  1G2E A;  5KT4 A;  3ZTR A;  4DX6 A;  1NJW A;  2UXD J;  2QA1 A;  4Y2C A;  5DZ7 A;  1WEX A;  1I94 J;  3KK2 A;  3EZU A;  5IC6 B;  3CCQ S;  1XEZ A;  1JJ2 R;  3IG1 A;  1S72 S;  4UOG A;  2WZ1 A;  3UVJ B;  3OXF A;  2XYP B;  1CJV B;  5SZT A;  3FKB A;  2QT7 A;  2C2O B;  2VG6 A;  5F0U A;  4D3G A;  2Y1L B;  1F3F A;  4DR3 F;  4CLU A;  2CJK A;  2KVI A;  3FJ2 A;  4U9R A;  1WHV A;  4U95 A;  4XDD A;  4P2F A;  3O5T B;  2BAN A;  1HWJ A;  2HFO A;  3KK3 B;  4OHV A;  2BMB A;  2LLZ A;  2XNQ A;  3IAS 9;  4Y2A A;  2PT0 A;  4MKA A;  2BRL A;  2FLN A;  3FBC A;  1GX6 A;  2R7V A;  1SJ3 P;  2HKE A;  1IUJ A;  3CF5 Q;  2AJQ A;  1T05 B;  1KON A;  4JOU A;  2J6S A;  3FGV A;  2K1R A;  2NXJ A;  3KHR A;  2J9C A;  4PEO A;  3VTI A;  1M1H A;  4KFB A;  1KC8 T;  3EGZ A;  1S1U B;  2K7K A;  5JVG Q;  4MK8 A;  4AFF A;  1HYS B;  1I5O B;  2RDD A;  1UVL A;  3IWN C;  1NO8 A;  4WFB Q;  3DM2 A;  1CUL A;  2N7Y A;  2YNI A;  4NA1 A;  1FVS A;  3CC2 S;  1Q1K A;  4HTI A;  2AEF A;  3BSC A;  2B9E A;  1ITP A;  4KR0 B;  3BN4 A;  1HBN B;  3L95 X;  2NQP A;  2Y0B B;  1Y10 A;  4Y2M A;  1BHN A;  1CG2 A;  2V67 A;  3LGN A;  2CPD A;  3TVK A;  4CT8 A;  2VIH A;  4DL2 A;  3C19 A;  3HFZ B;  4Z2X A;  1H98 A;  2ERR A;  2BKP A;  3ILI A;  2AV5 A;  4MYT A;  1FRL A;  3MUT P;  1RHK B;  3G96 A;  1YBU A;  1SUQ B;  4QWA A;  4V19 X;  1SH2 A;  1Q5Y A;  1VRU B;  2IMW P;  3X3U A;  3QFH A;  2DGV A;  3OSN A;  3EUN A;  4A46 A;  2XWX A;  4X2B A;  1XAO A;  5U47 A;  3P4U B;  4Y00 A;  3SYZ A;  1YTY A;  3J81 U;  4LUB A;  3WZ0 A;  4EZ6 A;  2FGC A;  3C15 A;  4UST A;  4O3Q A;  2B9Y A;  1VQY A;  4FF2 A;  5KFT A;  2J6U A;  2W2P P;  1F2G A;  3DRP A;  5E7O B;  2YVS A;  2XSF A;  4MIA A;  2VPW B;  1D9A A;  4ZHR B;  3NMA A;  4B3O A;  2BJ7 A;  3CW2 C;  4I1T A;  1V5V A;  4LT6 A;  2GML A;  4USM A;  2E5H A;  5DGA A;  1PAE X;  1SL0 A;  4OZ2 A;  3V6D A;  2ZIT A;  2B5J B;  1TTH B;  1U1O A;  4CM2 A;  1WC4 A;  2JSX A;  5IQQ A;  3ZZO A;  5EX0 A;  2CQC A;  2XZW A;  4JBC A;  3BN7 A;  4DSE A;  2HHH J;  2Z58 B;  2FZG B;  3JTP A;  4EI2 A;  2J8S A;  4TU9 A;  3KLH A;  2W9A A;  2HZC A;  6FDR A;  2ZJP Q;  3DN9 A;  2F9J A;  1NKC A;  1QAY A;  3OSP A;  3TJ9 A;  1O51 A;  3P49 B;  1SH3 A;  3M8Z A;  3ZZR A;  1NKE A;  1H3D A;  1RAC B;  4RWW A;  1Z2Z A;  1KSP A;  3AJ2 A;  3M7V A;  2PD1 A;  2HZA A;  2HNY A;  3Q22 A;  1K73 T;  4RLE A;  2AJ2 A;  2XMJ A;  2EBE A;  1WNE A;  2B56 A;  2VQF F;  4GVB A;  5J1N A;  4E98 A;  3DYA A;  1WDD A;  5D4P A;  2F5G A;  2OH2 A;  2IYI A;  5LSR A;  1RCO B;  1Y9O A;  4DF4 A;  1LK5 A;  3CCE S;  2E1M C;  3GYN A;  1X4C A;  2BX6 A;  1DUR A;  4NLW A;  7FDR A;  2DHA A;  3G8T A;  4NLS A;  3I0R A;  4KPC A;  4W4M A;  4NXM F;  3Q23 A;  5KG2 A;  1VQ5 S;  3NKY A;  4FVM A;  1I94 F;  3E51 A;  1NDC A;  5ETR A;  1QUV A;  4J90 A;  2IA0 A;  1XMQ J;  2IDE A;  4G1Q B;  5E3Q A;  4C4W A;  1F2H A;  1NSK L;  3PV8 A;  4W90 B;  3MMC A;  1R8C A;  2R7R A;  4DR5 F;  5HQM A;  3QRR A;  1REG X;  1FRK A;  3PRB A;  3UD5 A;  3PEH A;  4USH A;  1AFI A;  2HSE B;  4OJH A;  2E5I A;  3NS6 A;  2C2K B;  2IAJ B;  3LGM A;  1KBR A;  2JZ5 A;  5C25 A;  2HAF A;  4RW4 A;  4AQY F;  4FBT A;  4GC6 A;  3CD6 S;  3T1Y J;  3TAR A;  3JSM A;  5KFN A;  4KBI A;  3GV8 B;  2LU1 A;  1RT3 A;  3SEO A;  3G87 A;  3K0J A;  3OTC A;  1RT5 B;  2ZZN A;  1W7W A;  2MKK A;  1C1C A;  1Y3K A;  4LBP A;  2MZJ A;  4GO5 X;  2H5E A;  3PO5 A;  4OI1 A;  3TEH B;  2AYG A;  3L4B C;  3IAM 9;  4NCG A;  3OTD A;  4RU9 A;  2GO9 A;  2ZBQ A;  2G2O A;  4OZN A;  4FF3 A;  4IUF A;  4WK1 A;  3L9Z A;  1JNZ B;  1S4E A;  3IWX A;  3FMW A;  3H42 A;  4B9S A;  4ZOS A;  2MSS A;  4C11 A;  3MM5 B;  2AJF E;  3M9N B;  4LIR A;  2HQG A;  5CYM A;  2DK2 A;  3T5L A;  2YNF B;  3IM8 A;  2FJW A;  1VQL S;  4UQG A;  2VG7 B;  1BWV A;  4Y65 A;  3QGG A;  2ZKU A;  5IS2 A;  4KPY A;  3JQJ A;  5KFP A;  2QTW A;  1JLG A;  4IFV A;  1IKY A;  4TNO A;  1DFD A;  1E6V A;  1IJE B;  4WXW A;  2RB7 A;  4NAS A;  1H7X A;  1KFS A;  3M2R B;  3NNC A;  5FDL A;  3I56 S;  1GK8 A;  4PAA A;  1NH7 A;  1GX5 A;  4LF9 J;  3TVY A;  5E3C A;  2M2B A;  5I3P A;  5G0R A;  4EBE A;  3CJ8 A;  4F0K A;  3K58 A;  3OTO F;  2CPZ A;  2CVE A;  1U6F A;  1ZZF A;  3SSR A;  3OXL A;  2F8M A;  1WKL A;  5SUH A;  3R9L A;  2W2N P;  3J7A 1;  2G9O A;  1VRQ C;  1UFW A;  4LSZ B;  1TFY A;  2CPE A;  3LP1 B;  2RU3 A;  3MR5 A;  2J9E A;  3PIO Q;  3OVB A;  1YJR A;  3TA0 A;  2N82 B;  1NDK A;  3C3L A;  3NEK A;  3NS5 A;  1OQ6 A;  1WJ9 A;  1TP7 A;  3CC4 S;  4DV0 F;  5HAO A;  4MK9 A;  3OL6 A;  4MK7 A;  5DQG A;  1VC6 A;  3RR8 A;  1NLT A;  2W24 A;  4OV6 A;  2F65 A;  4WTO B;  4PAB A;  3RRK A;  3PFO A;  1SL2 A;  4RWX A;  1HHT P;  4K4Y A;  3MOZ A;  1W2I A;  2F3J A;  5ETP A;  1H2V Z;  1VLY A;  4QIE A;  2YWF A;  3K89 A;  4Q8E A;  2G4B A;  3EXC X;  4DL6 A;  5ETL A;  1N5Q A;  2AWZ A;  2M0G B;  2VPY B;  4NLO A;  4HAC B;  4IG0 B;  4F0H A;  1R43 A;  3A13 A;  4EEY A;  5KT6 A;  1FXR A;  1GMU A;  4EBC A;  4BWM A;  1R89 A;  2L08 A;  3T9Z A;  4TLQ A;  3DHX A;  3THV A;  2H5I B;  2I9S A;  1GNK A;  2OD6 A;  4O3O A;  4U7U D;  2ADC A;  3IM9 A;  3RRG A;  3EDQ B;  2N3L A;  4L75 A;  5KG1 A;  3DRS B;  1SJ1 A;  1T94 A;  2D7S A;  3US5 A;  5BXI A;  1YK9 A;  2JLG A;  2JFK A;  4Y28 C;  4KGZ B;  4LSN A;  4RBV A;  2LXI A;  4X4N A;  5EDW A;  4PQU A;  3OTB A;  3SFU A;  2ASD A;  3I9V 9;  3K5M A;  4PR6 A;  5LJ5 Y;  2V4R A;  2CDQ A;  1HI0 P;  1T0T V;  2KZM A;  3WX8 A;  2BE7 D;  4H4M B;  4X66 F;  2JC0 A;  4LVN P;  5IV3 A;  4MIW A;  2I38 A;  2R7X A;  4X64 J;  2FLP A;  1QSS A;  2FB0 A;  4YR3 A;  1DLO A;  2CPH A;  3MMB A;  4C8L A;  2VG5 B;  5FLX U;  3JTO A;  3RB3 A;  1RAJ A;  4QR1 A;  3QT6 A;  3M9M B;  4EZ9 A;  4DPY A;  3SQO P;  1CJV A;  3BSN A;  1BD6 A;  3UCZ P;  5L9X A;  3IRX B;  2VBY A;  2DIV A;  3GYX B;  3S8S A;  2C3M A;  2P9C A;  1VLO A;  3T1Y F;  1RAB B;  3QRQ A;  3MGJ A;  3M2V B;  3K7R A;  3NP5 A;  2ZOG A;  3D66 A;  2CWK A;  4Q8F A;  3Q2S C;  3CJR A;  5DLG A;  2IC3 B;  2CQD A;  2DO0 A;  3PZP A;  3OLA A;  3TP2 A;  1XK8 A;  2FHM A;  3BV8 A;  2RHQ B;  4USU A;  1T05 A;  4UUW A;  5B7W A;  4U6P A;  4EO6 A;  2JEF A;  3VZI A;  2FVS A;  1TZ0 A;  1JIH A;  2COL A;  4ELV A;  1FCA A;  1BE4 A;  2WRM A;  1N5S A;  4M8L A;  1K0V A;  3UN3 A;  1X9M A;  5E33 A;  1HYS A;  2W7P A;  2MQP A;  3M6W A;  2HHP A;  3GB0 A;  2PFF B;  4BLG A;  4UQT A;  3O8W A;  2K8G A;  1VFJ A;  5HMZ A;  1DY3 A;  2OPQ B;  2DR7 A;  3PR5 B;  4DDF A;  4UW2 A;  4YDX A;  4RW9 B;  2VPZ B;  3SCK E;  2IMO A;  4X4P A;  1WEY A;  2HBQ B;  5F8I A;  2ZHA A;  4URQ U;  5KFY A;  4ICL B;  1P1T A;  1TUV A;  4URS A;  5ETK A;  4J9Q A;  1WG5 A;  1PJ7 A;  5L38 A;  3UN2 A;  3MEK A;  2DR5 A;  1RT2 B;  2DNN A;  1YIT S;  1VRU A;  2W4D A;  5D0E A;  2R8J A;  1JLA B;  2CQB A;  4AYB D;  4DV6 J;  1YHQ S;  4DWI A;  1NND A;  4DZ6 A;  1JLQ B;  4EK2 A;  4Y3C A;  2KRR A;  4DJB A;  5HRO B;  2WSC C;  2EFQ A;  3H90 A;  2VOP A;  5K8N A;  4FF1 A;  1FE4 A;  4JV1 A;  2XLI A;  4E2F B;  2CPX A;  2CRL A;  1T3O A;  2YKO A;  1Q8K A;  1UVK A;  2C2E A;  1S7H A;  5KFE A;  4F67 A;  5D6G A;  3UDE A;  4YR2 A;  4M63 A;  1VQP S;  2HRT A;  2GAH C;  3R6L B;  1M1K T;  1TKT B;  1NME B;  2HQF A;  2XMM A;  3I4P A;  4PWD A;  1LFP A;  2XC9 A;  2HG4 A;  3SBM A;  3R6G B;  1FDD A;  3JSR A;  3FK4 A;  1N33 J;  3MI7 X;  3EPG A;  3MTK A;  1D8Z A;  3FEY B;  5H9F J;  5KG5 A;  1HNX J;  4CO5 A;  3N79 A;  2VBX A;  2RNE A;  1FO1 A;  3W60 A;  2VJV A;  4GKJ J;  2VQE J;  1YBT A;  3HHL C;  4DV3 J;  3RYL A;  1HD1 A;  3PW0 A;  5MAO A;  1F5B A;  4ZVT B;  1KQG B;  2H51 B;  2AGP A;  4NCB A;  2O3D A;  1EQ0 A;  2I0X A;  2B51 A;  3AOC A;  2YY3 A;  1R31 A;  3JAM U;  3DRR B;  2KM8 B;  1VHI A;  1Q8B A;  2Q66 A;  4C0O C;  4DR6 J;  1O6X A;  4ATN A;  2HRY A;  3M9O B;  2VBZ A;  2GMJ A;  3A8I A;  3AH6 A;  1K9M T;  1Q7Y T;  3HI9 A;  1RBA A;  1DZ5 A;  4OZL A;  4CDI A;  1HQU B;  3THT A;  2RDJ A;  1KVK A;  1UA0 A;  1EB0 A;  1FRM A;  4ZJQ A;  1JJ4 A;  4TN2 A;  3BH6 B;  4ZVO B;  3PO4 A;  1FER A;  3T1A A;  2D3Z A;  3VHQ A;  4ELU A;  1YDL A;  3PHE A;  3CJK B;  3TZW A;  4JI3 F;  3G86 A;  1PIL A;  2BJD A;  2D1C A;  2FJV A;  1BY9 A;  1WOO A;  2M8H A;  2BDP A;  1RHQ B;  2V94 A;  3QIP B;  5KFV A;  3B78 A;  3I32 A;  1RK8 A;  3FNN A;  4H4K C;  2OLW A;  4KIA A;  5HO4 A;  3M30 A;  5GME A;  2MKI A;  2R7W A;  3OLB A;  3RAQ A;  2RT3 A;  2XMK A;  1RTD B;  1TEL A;  1SIZ A;  2DO4 A;  1SVD A;  1WOR A;  4OZJ A;  4OMF G;  4LRA A;  3PW5 A;  4PYD A;  4OQJ A;  2RS8 A;  1L3U A;  4C48 A;  3PVX A;  3RRH A;  1RT5 A;  1B0T A;  3GR1 A;  4B9U A;  2GHW A;  1RWV B;  1EHW A;  5ADZ A;  5E41 A;  2XMA A;  3QGH A;  3SDE B;  1KLN A;  2JRR A;  1H73 A;  3GIK A;  2XWY A;  3B82 A;  3PJW A;  4Q45 A;  2ASL A;  1CPZ A;  2A6O A;  4J9N A;  1P8G A;  2QZ8 A;  3ICL A;  3C16 B;  1RWN B;  4HT5 A;  2FHO B;  5KFQ A;  2CVI A;  2XCP A;  1HNW F;  5A8K A;  3MM5 A;  1VC0 A;  2EG1 A;  3P3D A;  4N47 A;  3NWG A;  3ZTO A;  1JKH B;  1W25 A;  4TY9 A;  2W9B B;  2YNF A;  2CAJ A;  2VG7 A;  1Y3J A;  3ZFV A;  1HR0 J;  4AT1 B;  4ZDN A;  3HX9 A;  4BC9 A;  1VCT A;  4CLT A;  3CD7 A;  4LF2 A;  4JI0 J;  3R5D A;  3LP0 A;  4ZLP A;  3TAQ A;  4F4A A;  2NSC A;  1SC1 B;  5E3R A;  1XIQ A;  2C2N A;  1WOS A;  3GPA A;  5AJ3 J;  4L74 A;  4B08 A;  3M2R A;  1RLC L;  3C5X C;  4ID8 A;  2YKM B;  2BQR A;  5IWA J;  3AGY A;  4YS2 A;  1KVI A;  1RAG B;  3GJR B;  2G1H A;  3AXM A;  3KG1 A;  4NWB A;  3KLE A;  1WKK A;  3ET6 A;  1MLA A;  1T95 A;  5E2Q A;  1HNV B;  3BBB A;  2ZC4 A;  5JJB A;  3NAH A;  4MT1 A;  2JWN A;  2JX2 A;  4HDG A;  4CQ1 A;  2NS1 B;  4JI6 J;  2OAU A;  3DRY A;  4PRF A;  1VYA A;  3PW4 A;  4RKU C;  2DRA A;  3GON A;  1FRJ A;  1WF2 A;  3GYG A;  3LP1 A;  3KTQ A;  2Q1L A;  3KDO A;  4W98 A;  4C8O A;  1S6O A;  1N34 J;  3W61 A;  4HHU A;  2W4C A;  4U8Y A;  3L7P A;  4DUZ F;  3RW7 A;  3DU5 A;  3QLH B;  1S1W A;  1HW8 A;  1O8B A;  4FPR A;  4QU6 A;  3KHH A;  2C3O A;  5K5M A;  2FJB B;  3BQ1 A;  1D0E A;  5H9E J;  4NLT A;  4WII A;  3CIZ A;  3KLI A;  1R0C B;  2PMH A;  2RUS A;  2HEK A;  4ZIW A;  3TOQ A;  2UXB J;  2Q3P A;  4O3R A;  2L3M A;  1QSY A;  2XB2 D;  1H38 A;  4DSF A;  3ZNU A;  2QMX A;  4GKJ F;  7AT1 B;  1WEL A;  3AB2 B;  1KNZ A;  1RHU B;  4OV1 A;  2PEH A;  1U02 A;  3WDO A;  2XUL A;  4DPX A;  4HAC A;  4C8M A;  1SV5 A;  3T3F A;  4DCO B;  3BDE A;  3R7S B;  2B4U A;  2W1B A;  1VBZ A;  4PG8 A;  2J7K A;  2FLL A;  3ISZ A;  4DR6 F;  2P5V A;  4WU3 A;  3POT B;  1HMV B;  1UET A;  1UZH A;  2GNK A;  2Z8Q A;  2HLU A;  3DRS A;  3H5Y A;  3KOA A;  1ZS6 A;  1UCN A;  4N77 A;  4N56 A;  1NRK A;  5KTQ A;  5D0G A;  4WYL A;  1CJU A;  4OZ5 A;  3NNH A;  3D3C J;  4LF1 A;  5GAE I;  2HFV A;  1RT1 B;  2J7W A;  2CNO B;  2OGU A;  2MZS A;  3FRZ A;  2ZBI A;  4R25 A;  3OPK A;  4LF4 F;  2CUY A;  4ZLN A;  4N8O A;  3MMJ A;  2FPH X;  2OFH X;  1KN6 A;  2XYG B;  3HFV A;  4DR2 J;  1Q95 G;  4C3M A;  1RHM B;  1Q78 A;  4H4M A;  2DHH A;  1N32 F;  1S9G B;  4EBD A;  3ENQ A;  8RUC A;  2VG5 A;  2C3U A;  2CQI A;  2LQ8 A;  4QOT A;  3CMA S;  4PKD B;  5HVG A;  3IRX A;  2FLO A;  4UZB A;  4KE5 A;  2BYC A;  3KWM A;  2CXE A;  4JI5 F;  1R8P A;  3PJX A;  1X5O A;  1JLC A;  3D6T B;  1RTI B;  1T9Y A;  2CIM A;  1SQF A;  3M2V A;  1VIX A;  2M4M A;  4I2P B;  2F4F A;  4BBY A;  1P9Y A;  3I4H X;  3BBF A;  3DLB A;  2NLW A;  3H2L A;  3CSK A;  4ITS A;  1QM9 A;  4ETZ A;  1QLN A;  4IDK B;  2I6W A;  3OJU A;  1U2F A;  3KJF B;  3OBI A;  3UDC A;  1AZS B;  1FE0 A;  2WVC A;  4GO7 X;  2HLT A;  1YZ7 A;  3MFI A;  1LXJ A;  1HNI B;  3MTJ A;  3DOM B;  1S49 A;  4C8Z A;  4RZR A;  2AYM A;  3NBP B;  4LRE A;  4YB1 P;  5LOQ A;  4ECQ A;  4CO2 A;  1XER A;  3DXS X;  1GTE A;  4OYO A;  1Y7P A;  4QWC A;  3CD0 A;  2OPQ A;  3VAJ A;  3KK1 B;  3BO3 A;  2DIT A;  2CNL B;  2BJ9 A;  3KNG A;  2IHR 1;  1X4H A;  4RW9 A;  5KFH A;  2RH3 A;  1HR0 F;  1BGX T;  5AXK A;  5HI7 A;  3ISN D;  4ICL A;  3RBE A;  1VQO S;  3P8B B;  4CWB A;  2B3T B;  4DI6 A;  1P6T A;  3D0G E;  2PFD A;  4USW A;  1PSD A;  5AJ3 F;  1SCJ B;  3R5B A;  2GJ2 A;  4Z7C A;  2C2Z B;  2XI3 A;  1JLA A;  1FJG J;  3QAE A;  1U6Z A;  3ADA C;  3KMS A;  4PG5 A;  1JLQ A;  1XNR J;  2F1F A;  4XPE A;  5A2Q Y;  4F2S A;  3MR7 A;  1GTH A;  3WQP A;  1ZOT A;  4ED8 A;  5HRO A;  1KVJ A;  1M5K C;  4EU0 A;  3GP9 A;  3PTW A;  1RE1 B;  2GW8 A;  2YX7 A;  1LK7 A;  2NXU A;  4N41 A;  6AT1 B;  1N4L A;  2Z57 B;  2M3D A;  4AUK A;  4ZVF A;  4X65 J;  2WW8 A;  4FN5 A;  1LFW A;  1N34 F;  2OMO A;  4OYB A;  4KH0 B;  3TUJ C;  2NRE A;  3R7B B;  1G7C B;  5DM7 Q;  2XMU A;  1TKT A;  1IBM J;  5AT1 B;  3CDA A;  2KN4 A;  1HA1 A;  4FNH A;  1UJ5 A;  4DL5 A;  3C2P A;  4IR1 A;  1EKS A;  1PCA A;  2WTF A;  1A6L A;  5GAE U;  3HJF A;  3P45 B;  1RWO B;  1HBU B;  4J37 A;  4QQB A;  5LT5 A;  2NSB A;  1ZAW A;  3UD4 P;  2FD2 A;  5B0G A;  4KHM A;  1S0O A;  4UUX A;  3N0V A;  2G2Y A;  3SQG B;  3RGI A;  1RU1 A;  4KO0 B;  1QAI A;  4TQS A;  1NSA A;  5C42 B;  5AE3 A;  2YBV A;  1UL3 A;  1RUS A;  3R1H A;  2DH7 A;  4DUY F;  2C22 A;  4J9O A;  1R8A A;  2E9R X;  3BR9 A;  3MCO A;  1MN7 A;  4LRD A;  4QZV B;  1NHU A;  3PYD A;  3DRR A;  2V2Q A;  1YJ7 A;  1FFW B;  4JI8 J;  2VAS A;  2XG8 A;  3ZZT A;  4M5M A;  3QJP A;  3M8Y A;  5DQI A;  4M95 A;  5DRK A;  1HQU A;  3FBF A;  2H9Z A;  1L3V A;  4ZKA A;  4P7V A;  4Q7A A;  2O66 A;  3RJM B;  4O3N A;  5D15 A;  2WVD A;  4LF5 F;  3H98 A;  4ES3 A;  2ZEJ A;  3CJK A;  1KD1 T;  1KOH A;  3K2Y A;  1Z4U A;  1GH8 A;  2CQ4 A;  5DM6 Q;  3M6X A;  1IN0 A;  3FSI A;  4OHY A;  1X4B A;  3I55 S;  4M1K A;  5K9F A;  1TVR B;  4L3K A;  5EWG A;  4GVL A;  3RB0 A;  4NI2 B;  2JHE A;  4OYZ A;  2XMT A;  4P75 A;  1RTD A;  2LQJ A;  4K4S A;  3GG1 A;  1XQI A;  1NB2 A;  4NML A;  5AE1 A;  2VL1 A;  2XY5 A;  2HHX A;  4DLG A;  2EG2 A;  2RQC A;  4L6V 3;  3PW7 A;  2BEF A;  2H1Y A;  2RDI A;  3BPD A;  4R5P B;  1ZPV A;  5I3Q A;  2ADB A;  3SDE A;  3RR7 A;  4CCH A;  3AD8 C;  3DLL Q;  4NXN J;  2Z56 B;  4ERD A;  1NZA A;  2K3I A;  2NPF A;  1FDB A;  1FNM A;  4A48 A;  2UXC J;  5KAK A;  3M6V A;  1FA0 A;  3MAA A;  2X1G A;  4FBU A;  4NYP A;  4ZVS B;  3C16 A;  1U1N A;  1XC9 A;  2R42 A;  1VJW A;  2ILZ A;  1CS4 B;  3VAM A;  4ZVR B;  1X60 A;  2CQ2 A;  3CJ3 A;  3KHG A;  3KJN B;  3I6P A;  4RW7 B;  5B0A A;  2E1P A;  1JKH A;  1Y5N B;  4DL7 A;  3V6K A;  2B9W A;  1T7P A;  2YNG A;  2XCA A;  4J9K A;  2D9O A;  2CZ9 A;  2UUB F;  1IBK J;  3U1M A;  3CC7 S;  2BE2 B;  4OZ1 A;  2MKY A;  2Q6B A;  4OHW A;  3R2D J;  1R7I A;  3QWP A;  1YLX A;  2N4C A;  4G1I A;  4DV2 J;  1YWX A;  1OQ3 A;  3BGU A;  4PZV A;  4NEY A;  1JMT A;  1FJG F;  2G13 A;  1U2R A;  4ER8 A;  1XNR F;  1YX2 A;  1X4E A;  2UU9 J;  4P74 A;  2M52 A;  3PX0 A;  1HNV A;  2DXE A;  3Q8P B;  2P8I A;  2LA6 A;  4Z37 A;  2FZK B;  5KFK A;  4G6V B;  5K8M A;  4P71 A;  3H0P A;  4UOC A;  4LFA J;  2WOM B;  1NJY A;  1CLF A;  3B54 A;  3I31 A;  1URR A;  4LF8 J;  5F0W A;  3PXG a;  1VMB A;  4OX6 A;  4M5H A;  3HP6 A;  2QLW A;  2YX1 A;  4TU8 A;  1XBW A;  3FZ2 A;  1TK8 A;  3QLH A;  2DHX A;  1IBM F;  4G3I A;  5CD4 A;  3BGR B;  3LAL A;  1C1B B;  1PBA A;  1F9E B;  2XMV A;  3K5L A;  2QEX S;  4B9L A;  2WVF A;  3RB6 A;  4ZIT A;  3JSB A;  1TMM A;  1LWF B;  2Q79 A;  1OMS A;  4HR2 A;  3G8S A;  1LXN A;  2HHW A;  2PA3 A;  3PAC A;  1HI8 A;  3NGD A;  2UVW A;  4WK3 A;  2VG6 B;  2EXU A;  2I1R A;  2PGC A;  4O23 A;  5DGB A;  4U8V A;  4EFA C;  2Y1I A;  3ZNJ 1;  5KFM A;  2E1C A;  3T6B A;  2M7S A;  3CJ5 A;  3MZI A;  1V5I B;  5D0R A;  1RYR A;  1FD2 A;  3TAM B;  3M4X A;  1SJR A;  2PSZ A;  3RBZ A;  1PGZ A;  3FEX B;  2K1R B;  1TKX B;  3CED A;  2HS3 A;  4DUT A;  1HMV A;  2WK4 A;  2R7Q A;  3MMA B;  2F9D A;  4DPW A;  2IRX A;  4RX6 A;  4CT9 A;  1IM6 A;  5DDO C;  1FD8 A;  2VH7 A;  1RWX B;  2OD4 A;  4OI2 A;  4DS4 A;  5B0B A;  1E6Y B;  3DLG A;  1WG1 A;  1J2V A;  2RAQ A;  1F60 B;  5IT9 Y;  2RQ4 A;  3LQV A;  1ZM2 A;  4JB8 B;  1JJH A;  3MPD A;  5CHC B;  1CBK A;  3HSG A;  1RT1 A;  4JUZ A;  3VV2 B;  3TX0 A;  3CME S;  2HFZ A;  1KQS R;  4LF7 J;  1YSJ A;  2W4P A;  1GT8 A;  5KOW A;  1WF1 A;  2C2D A;  4ANC A;  1RT4 B;  2D3O 1;  3ZTQ A;  4JV5 J;  1S9G A;  1NSP A;  2HS0 A;  5KFD A;  1U6B A;  3QPI A;  4G1P A;  5J2M A;  4K50 A;  2CQG A;  3I87 A;  1TL3 B;  2B43 A;  3DXB A;  2HVD A;  5KG6 A;  2FDN A;  5LXR A;  5L1I A;  4RNO A;  1RWM B;  4F25 A;  1FF2 A;  5DZ6 A;  2DT9 A;  2KFN A;  1HWK A;  5F8L A;  3J7Y I;  4WE1 B;  1P9Q C;  4IOA Q;  1CJK B;  1RTI A;  1B64 A;  1I51 B;  3FCH A;  4ILR A;  4I2P A;  4DCP B;  2QMW A;  2VA2 A;  3BF4 A;  1OPI A;  3QT7 A;  3H8Y A;  4IDK A;  1FDN A;  2KFZ A;  1NEE A;  4YY3 J;  3LW5 C;  3W5Z A;  4GRS A;  4WKR A;  1DAX A;  3D6F B;  2HGN A;  4C8N A;  1AZS A;  1NB7 A;  3N6N A;  3EX7 B;  4X84 A;  2CNN B;  4IKA A;  1XWL A;  3CCU S;  1HNI A;  1SH0 A;  2DNG A;  4OZ0 A;  3W9I A;  4X4U A;  1IQT A;  2LEB A;  2X3D A;  2AYE A;  3TZY A;  2R3V A;  3NBP A;  3FQL A;  4JI4 J;  4M5D B;  4O3P A;  3LPY A;  3OVA A;  2XBP A;  1RI7 A;  1S6Q B;  4DV7 J;  2Q43 A;  4ECV A;  3KK1 A;  4O3S A;  3UR3 C;  1S12 A;  2E7X A;  4LRF A;  4H4O B;  5EHH A;  5GMD A;  3TA2 A;  3SV4 A;  2EEY A;  4ILL A;  3RTV A;  4FZV A;  4F3M A;  4DSJ A;  4A8K A;  3TWZ A;  5GVQ A;  2KM8 C;  4ZCK A;  3BSO A;  3MEE B;  5T7L A;  3UNY A;  1SKU B;  3VAG A;  5F9L A;  1YBA A;  1RBO B;  3HMJ G;  2VBW A;  4EGL A;  4DXL A;  4GKK F;  5EGY A;  4L73 A;  5ETO A;  3QRP A;  2MLZ A;  2LKZ A;  3F41 A;  2FHJ A;  2DNO A;  4FNI A;  2R2R A;  2F7V A;  2F8E X;  3HHE A;  2UU9 F;  2HBR B;  2CQP A;  4USV A;  3ZZ0 A;  4UY8 T;  1FES A;  1CSJ A;  2CJA A;  4U7C A;  4QYZ J;  4FXD A;  4IQX A;  2HQ3 A;  3ETO A;  2G0J A;  4LFA F;  1R8B A;  4IG3 B;  2H4W B;  4JYA F;  4LF8 F;  1FKO B;  1JWW A;  2A6M A;  3MM9 B;  2HFN A;  4I6W A;  1GQE A;  5EN1 A;  3OL9 A;  5LMU F;  2BJ3 A;  4V1A k;  1VQ9 S;  2EFN A;  3IBW A;  1VDH A;  4I0W A;  4DLE A;  2HPU A;  2CPJ A;  1S0V A;  2JLF A;  2HQI A;  2ACM A;  1HBU A;  2E9T A;  4OYA A;  2KVQ E;  1TKD A;  3CUN A;  4I6Y A;  1TL1 B;  2E1A A;  2OP5 A;  4WTY A;  4XAK A;  3U1L A;  4ZN3 A;  2OUG A;  2EBG A;  2P9G A;  1XMO F;  3SQG A;  5D0H A;  3C14 B;  2AT1 B;  1Q8L A;  1TQL A;  3AJD A;  2LMI A;  1P1L A;  4B3T F;  5DG7 A;  1UA1 A;  2YWE A;  1WI8 A;  1APS A;  1U26 A;  4URG A;  1PBU A;  3OL7 A;  3M8P B;  1C1C B;  3CCS S;  4ECX A;  1NJZ A;  1EX8 A;  1B0P A;  4I56 A;  3EVO A;  2DNZ A;  3T5H A;  3J7Y U;  3ELH A;  4RBU A;  4NLV A;  3DCA A;  4Y34 A;  3PKY A;  1NH8 A;  3MPY A;  3DNC A;  4XTT A;  1J5O B;  2MDA A;  4IRD A;  1S77 D;  2XSJ B;  3KDN A;  3SXL A;  1HAR A;  3ILO A;  1C0T A;  5LM7 E;  3R5C A;  2HNZ B;  5FII A;  3PIP Q;  2PI5 A;  4C11 B;  4ES2 A;  1PC4 A;  4IH6 A;  5KFX A;  2HRU A;  1RHJ B;  1YJU A;  4NL5 A;  3E2E A;  3VAI A;  4QIG A;  5DET A;  1FRX A;  2VU5 A;  4OJG A;  2CAD A;  4NLR A;  4DS5 A;  2FJE B;  4ZP9 A;  1VQN S;  3BPS P;  1CQN A;  3BSA A;  4IFV B;  2DH9 A;  2DGW A;  5CCL A;  1FXD A;  2VZ9 A;  2MQN A;  4NLX A;  2BRK A;  1UWB B;  2KJW A;  3HHN B;  1U1P A;  4I69 A;  3DU6 A;  3OR2 B;  1MNE A;  2KHC A;  1RWW B;  1F9F A;  3TR5 A;  5KT7 A;  5C2C A;  5K14 B;  2NPI A;  2J6T A;  2IRY A;  3OFG A;  1VR6 A;  1D3W A;  2YPY A;  3UW1 A;  5LSO A;  4R5P A;  1NHK L;  2JJ4 D;  2O5D A;  1SKW A;  3V4I B;  1WEZ A;  1FX2 A;  2J0S D;  2M88 A;  4WXO A;  2RSQ A;  1ZH5 A;  3ULH A;  2AHO B;  1KRP A;  5HSP A;  4FXV A;  2GQQ A;  4OX9 J;  2I2Y A;  2GJF A;  3CNQ P;  3OFE A;  2ROG A;  3H59 A;  3CO0 P;  2CJB A;  3QO9 B;  4A8Y A;  4KHR A;  4DX8 H;  4DL4 A;  1LWE B;  4ZCL A;  4JI4 F;  1S6P A;  1WC5 A;  2OSR A;  2A2D A;  4RR5 A;  2AZ1 A;  2GIF A;  4RW7 A;  1JXE A;  4I4B A;  3CUL A;  1UP1 A;  4LIW A;  5M2P A;  2GGP A;  1H0H B;  2A18 A;  4IFY A;  1R8H A;  4KC5 A;  4DQR A;  3F73 A;  4DOZ A;  1DQ8 A;  2IM3 A;  2M70 A;  1SI9 A;  2ZH2 A;  4J80 A;  4A47 A;  4QYR A;  3HDS A;  4ENO A;  1NK0 A;  4NCA A;  2DNR A;  5B0D A;  2OTL S;  2GIQ A;  4CH0 S;  1RHR B;  3W5Y A;  2XS5 A;  1H7W A;  1MU2 B;  4ZCI A;  1WI6 A;  5HVF A;  4MAK A;  4NZ7 A;  2YWH A;  1VIO A;  2VQF J;  2J9D E;  3SMZ A;  3CCT A;  4F50 A;  4EO8 A;  5KFZ A;  4KGX B;  3D9B A;  2VDI A;  3Q8S B;  1NZ8 A;  2V8P A;  2BR0 A;  3GCW P;  1MWZ A;  4XO0 A;  3MCS A;  3OTE A;  2WOM A;  4ZPV R;  3W9H A;  2HW3 A;  2OO4 A;  2HIY A;  4LQ3 A;  3FCV A;  2B8Q A;  3NGS A;  4PQU B;  2F4V J;  3B4M A;  3BR8 A;  1U8W A;  3ITH B;  1VBK A;  1RWK B;  2QLX A;  1IBC B;  3PCO B;  3BGR A;  1C1B A;  3CWJ A;  1SB6 A;  3DLJ A;  2IVF B;  3W3S A;  3ENV A;  1TAU A;  4KKO B;  2V9W A;  1UMJ A;  1DLO B;  3MMB B;  4DR5 J;  1HD0 A;  1LWF A;  3VGU A;  1ZM9 A;  4Q44 A;  5L46 A;  1CEZ A;  3PNI A;  1HNZ F;  2KFY A;  2QYG A;  3V81 A;  4FYV B;  1K0T A;  4AQY J;  2Z0G A;  4M5J A;  2IPO B;  2RKI B;  3OUY A;  3MED B;  5FJ4 A;  1QE1 A;  3AB4 B;  3GIJ A;  1Q53 A;  4GC7 A;  1Q16 B;  2AF6 A;  1X7V A;  3MDF A;  5F9N A;  3TAM A;  1FEE A;  1RZM A;  4CM0 A;  2MZR A;  5BYS A;  4X4R A;  4IQM A;  1TKX A;  1QD1 A;  3KUE A;  1Y11 A;  3C46 A;  3MMA A;  5J1E B;  2LP4 A;  4I68 A;  3Q8R B;  1WC6 A;  3EYZ A;  2HGL A;  4V19 J;  2AJ0 A;  2BV3 A;  1E6Y A;  2IVM A;  1PIE A;  2ROE A;  2Z4P A;  3QGP A;  2V4J B;  3A4T A;  4F2R A;  2H54 B;  2R2T A;  4GMK A;  4F4W A;  4YB7 A;  3HCX A;  6FD1 A;  1RXO B;  1I3O B;  1NK4 A;  2YQ1 A;  4KGK A;  1RT4 A;  1OYD A;  1XR7 A;  1OPZ A;  5ETS A;  3ONQ A;  5LSL A;  3M6U A;  2CNK B;  2DEI A;  2R4F A;  4CLZ A;  7FD1 A;  4OYW A;  2KT3 A;  3SIP B;  4CLF A;  2ATL A;  2WBM A;  1NPR A;  1TL3 A;  1ARO P;  2HYI B;  5KFS A;  2HZV A;  3EZ5 A;  2PE8 A;  4CIO A;  4DPO A;  4DU8 A;  5IM0 B;  2ZJR Q;  4ZN1 A;  3PJ9 A;  3DOK B;  1NAQ A;  1URN A;  5A8W A;  2NXE A;  3GTY X;  3JQM A;  2ZDO A;  2DXF A;  1RAA B;  4TY8 A;  4WE1 A;  1CJK A;  1F5A A;  4ZPC A;  4XIU A;  4DN9 A;  1WD6 A;  3AA8 A;  3IMQ J;  3OTO J;  1YIJ S;  2DNM A;  2F8H A;  1ZAV A;  4YOE A;  4IYQ A;  4FPI A;  4DSK A;  3AAW B;  2ASY A;  1FRI A;  3GJT B;  2ZWO A;  4HLB A;  2PMZ D;  2FVC A;  1RLD A;  3TQE A;  2WSE C;  1NK8 A;  4L76 A;  1JLE A;  3GV5 B;  1FXL A;  2NXC A;  3KHL A;  1KHV A;  3OFF A;  2F40 A;  2ZBP A;  4AD6 A;  4ZPW R;  2DBB A;  4K4T A;  4OX9 F;  3ISN C;  1N5T A;  4OZ3 A;  1RB0 A;  3GV7 B;  1LWX A;  4PWD B;  4O4G B;  4DV0 J;  1NK5 A;  2G0I A;  2CQ3 A;  2Y1R I;  4M5D A;  3HSZ A;  2N3O A;  4ED6 A;  5EUH A;  3VGT A;  2Y0S D;  1S6Q A;  1SQG A;  4DU7 A;  1UKU A;  4YB6 A;  3AKO B;  4H4O A;  1FX4 A;  4YR0 A;  3AOB A;  4CLW A;  5DDP C;  1F5C A;  4M5K A;  2CPI A;  4NE9 C;  2ALY B;  1ZBT A;  2KHD A;  2XHC A;  4OJ3 A;  2CQ0 A;  4KJI A;  2EFP A;  2XZT B;  3CB4 A;  3ETM A;  5KG4 A;  1X4G A;  3MEE A;  4ZP8 A;  3ZZZ A;  4IOB A;  1FTC A;  2BUN A;  3MCM A;  3B8H A;  2J0Q D;  2UVR A;  3BGL A;  2ZZT A;  4Q2L A;  5HMX A;  4IH7 A;  3W65 A;  2A0F B;  1X31 C;  3KXD A;  2QG9 B;  2AX1 A;  3HFK A;  3EIC A;  1RU2 A;  3HKZ D;  1RAF B;  5KFF A;  4Q0B A;  2L9W A;  4B3M J;  1AB8 A;  5HBM B;  1U7L A;  4LSL B;  2OPP B;  2OKQ A;  4WFY A;  3RG6 A;  1S48 A;  4IG3 A;  2VFS A;  1X8D A;  3MPW A;  3QWU A;  1G6B A;  1FKO A;  4PG6 A;  3EPI A;  3MM9 A;  2F4V F;  2UV8 G;  3HK2 A;  3L09 A;  1T03 A;  2QLB B;  4XDC A;  4PPZ A;  5IT9 U;  1JB0 C;  4ECT A;  3QFW A;  2CJQ A;  2VFV A;  1FEH A;  4DV5 F;  4X66 J;  1AT1 B;  1RKI A;  1AUS L;  1NKB A;  4ED1 A;  4ALZ A;  4FYW B;  3M30 B;  1TL4 A;  1JXL A;  2POK A;  3GE9 A;  2UUC J;  2SXL A;  3H2V E;  1TL1 A;  2B0G A;  4F02 A;  2H65 B;  3MUR P;  3CCW A;  2V2K A;  1OYE A;  4P73 A;  2YWW A;  4RUA A;  2BAC A;  3LA0 A;  1JX4 A;  2U2F A;  3C6T B;  2UVU A;  3C14 A;  3BEG B;  3LWL A;  4QW9 A;  4PXE A;  4BCA A;  5KOX A;  4ANE A;  2FTR A;  4Q2M A;  3I38 A;  1HLW A;  3KNA A;  2BBE A;  3M8P A;  3TUP A;  4CO0 A;  9RUB A;  2ROP A;  1U0H A;  3FRY A;  1MWQ A;  5LJ3 Y;  2YQ3 A;  3QJJ A;  3LO3 A;  2R2U A;  2VV5 A;  2KT5 A;  1N54 B;  2V2Z A;  1J5O A;  1FFS B;  2MQ8 A;  2E5J A;  1H74 A;  2XSJ A;  2ZWP A;  3MWB A;  5DG9 A;  4Y0F A;  3NY0 A;  2Q2G A;  4DFM A;  2HNZ A;  2DR8 A;  2L9N A;  2GVZ A;  3OQ2 A;  2GCF A;  5A8K B;  3QYY A;  2EPI A;  3HO1 A;  4WP3 A;  5D3G B;  3FUY A;  4RW6 B;  3BKT A;  4OYI A;  1L3K A;  2YH0 A;  5C5J A;  1WC3 A;  4ELT A;  2YH1 A;  2YKN B;  3UO0 A;  1S7I A;  2DHS A;  4ZPD A;  1YQH A;  2MTL A;  1RAI B;  3M8S A;  1TKZ B;  2G1D A;  4DQI A;  3CCV S;  2O67 A;  3LP0 B;  4B9N A;  5KFA A;  1GMV A;  1UWB A;  2AW0 A;  5KFC A;  1DBD A;  1BQM B;  2V8D A;  3D54 A;  2CJ9 A;  3OR2 A;  5KFW A;  2ZBR A;  4ED2 A;  3IR5 B;  4WU2 A;  2OIH A;  4KHP F;  4DR1 J;  2I8E A;  4KGM A;  5K14 A;  1ZTT A;  3VCD A;  4PXD A;  2V8V A;  3KLE B;  5DS7 A;  3ET6 B;  4C9D A;  2FC8 A;  3N5B A;  3GWC A;  1N5Y A;  1ELO A;  3BQ2 A;  3N6L A;  2HBZ B;  4BWJ A;  4WCE Q;  1I1G A;  2WHO A;  3DC2 A;  3V4I A;  1DAR A;  3EVM A;  2H48 B;  2AMC B;  2NUH A;  4OHX A;  5IXU A;  1UJ6 A;  1MG7 A;  2IBK A;  2VFU A;  2UUW A;  4B9T A;  1QAJ A;  1FTR A;  2HWH A;  4TLR A;  3OD2 A;  3CJT A;  1EKR A;  3VWS A;  3HSD A;  1S1W B;  3QO9 A;  5C24 B;  1QJH A;  4WZM A;  4HH1 A;  5C2G A;  1QTM A;  1LWE A;  3A3O B;  4IH5 A;  3GIM A;  5ETQ A;  3OFH A;  3TRG A;  3LAN A;  2MQQ A;  3VVU A;  3U7J A;  3KLI B;  2W9C A;  4RBT A;  5I3U B;  2OI2 A;  1VGY A;  3TJA A;  1WHX A;  1X9W A;  4K4U A;  2V50 A;  4K7Q A;  4ED7 A;  1PG5 B;  3BH7 B;  1HQE A;  4ZCM A;  1LWC B;  3R5A A;  1PO6 A;  1S1V B;  4ZVQ B;  1JLB A;  3UN5 A;  2ALZ A;  2VD3 A;  3PYE A;  2XS2 A;  1SV5 B;  1EAR A;  1FNO A;  4WFZ A;  1MU2 A;  2VOO A;  2ZH8 A;  3MM6 A;  2B8P A;  4XPC A;  5J2Q A;  1IWG A;  5J2P B;  1WC0 A;  3EGW B;  4B9M A;  2DNK A;  2MXY A;  2Z2L A;  3AA9 A;  2LQ9 A;  1C3G A;  4A8X A;  2R7T A;  4B3M F;  4QJV A;  3O1L A;  2X7I A;  2HHU A;  5HMY A;  1HBO B;  2OEJ A;  3UE2 A;  1IKX A;  2XO7 A;  2CQH A;  1CJU B;  2N4D A;  3EDR B;  4X4T A;  1FJ7 A;  3HHK A;  1V3R A;  2FQQ B;  1C2P A;  3I9Z A;  1RTJ A;  3ITH A;  1UTA A;  1G3O A;  4JI3 J;  2V34 A;  3DGP B;  3PRV A;  2VPX B;  4KKO A;  3RU0 A;  2MB0 B;  2EKN A;  1UVM A;  5HVH A;  1IKW B;  1U45 A;  2KDO A;  4AL7 A;  2UUC F;  2P2C B;  4HHJ A;  4A8W A;  2QLD A;  4BS2 A;  1A0O B;  1Q82 T;  3VZH A;  4ECR A;  1JLC B;  2IVY A;  2ZDP A;  3CCM S;  3BM7 A;  5IFM A;  1U24 A;  2FGO A;  2RKI A;  1HW9 A;  3MED A;  3P6Y C;  3GII A;  3AOA A;  4P7T A;  2N7C A;  3AY0 A;  1H2T Z;  2BM0 A;  1BQX A;  2JEG A;  4ZVE A;  1NDP A;  4DFK A;  3HHL B;  3CCZ A;  5HJX A;  3UDV A;  4CO3 A;  2RS2 A;  3GJS B;  1N36 F;  4DF8 A;  3C6E C;  5J1E A;  4USK A;  1M5P C;  5A76 A;  1Y00 A;  1AA1 B;  4PPD A;  2AKW B;  2E66 A;  5L9N A;  1IR1 A;  1HNW J;  2FVR A;  2V4J A;  3O2I A;  4ECS A;  2BQU A;  2IBO A;  2VON A;  3FFI B;  4JV0 A;  3U27 A;  1QSL A;  1U4B A;  2YWG A;  1UVJ A;  1VK8 A;  1ROF A;  1NUE A;  1IR2 A;  3A8E A;  4CLS A;  5A6P A;  3TVZ A;  1T9T A;  4P72 A;  3VR1 A;  3SV3 A;  4OI4 A;  2RIJ A;  2XEX A;  3FBB A;  3CJ0 A;  2R2S A;  2MST A;  2MZ1 A;  5IM0 A;  1NPP A;  3DFE A;  2GMH A;  1S0N A;  4PWW A;  4CI0 B;  3DOK A;  2EI5 A;  1DQA A;  4QPX A;  4DR1 F;  1WHY A;  2ABY A;  1DRZ A;  1RP5 A;  1EZZ B;  3HLU A;  5J2N B;  3ZO7 A;  4AE5 A;  2BJE A;  2GJI A;  4QWE A;  2BW7 A;  5CH7 B;  2BZ2 A;  1F0X A;  2W8L A;  2GX8 A;  5HQ8 A;  1LW2 B;  1HIY A;  2E7W A;  4M5I A;  1P27 B;  1QVF R;  3CDW A;  3TNV A;  2HHQ A;  1FKP B;  5HP1 B;  2XMW A;  2B26 A;  2DHG A;  3FQK A;  4K4V A;  1R6Y A;  4X62 J;  1IKV A;  3QT8 A;  5CYQ B;  2HMI B;  1ICE B;  5IOL A;  4C8K A;  4DV4 F;  1BUX A;  4DUZ J;  1HBM B;  1S1X A;  2PA8 D;  3W66 A;  4O4G A;  4DR4 F;  2IYG A;  4K59 A;  2RIL A;  3IN5 A;  5ITH A;  1NHV A;  4PG7 A;  2NCK L;  2GQ2 A;  2DXD A;  4CZC A;  2QLJ B;  3I96 A;  3H25 A;  3E8O A;  4CO4 A;  4I7F A;  3TAP A;  3IP0 A;  3K5P A;  4C7Q A;  1Q7L B;  3TA1 A;  2V4Q A;  1A9N B;  2MJN A;  5E5N A;  1SJ4 P;  3CCR S;  4LMZ A;  3I82 A;  2V8H A;  2WAQ D;  3AHP A;  4A8O A;  2B4O A;  4LQ9 A;  1YJT A;  2H4Y B;  1RTH A;  2ZH1 A;  1ZA2 B;  3KFW X;  3PDN A;  2GHV C;  4LRB A;  2NXN A;  4USI A;  3A12 A;  3S7R A;  2VHG A;  2RVJ A;  1EP4 A;  1KOO A;  1D09 B;  1JK9 B;  2FY8 A;  2HVH A;  3IRW P;  1RCX B;  3KYL A;  3E01 B;  2QA4 G;  3EGN A;  2IDL A;  5HBM A;  4LSL A;  1W2B R;  1Q81 T;  3R5J B;  4DCJ B;  2I5J A;  2OPP A;  3MUV P;  3J80 Y;  4EYH B;  2JEI A;  4MKY A;  2DGT A;  3TW0 A;  1J5E J;  4LF4 J;  3QZ7 A;  5DLF A;  4ECW A;  5F3Z A;  1B7F A;  5RUB A;  4R0E A;  3A1Y G;  4F4K A;  2CG4 A;  1N88 A;  1N32 J;  2V9K A;  4NYZ A;  3TUZ C;  5E0O A;  4F4Y A;  2CA9 A;  4KSE B;  4ZPB A;  1VRT B;  2ZC3 A;  3LF0 A;  1CC7 A;  2GZO A;  2FVP A;  2RQK A;  4R0J A;  5D4O A;  2NYI A;  1CVJ A;  1FVQ A;  2HUR A;  3AT1 B;  2HQD A;  3RAM A;  2XS7 A;  1OWX A;  1F9H A;  2VC0 A;  4FYD A;  4JI5 J;  2VF3 A;  1LQ9 A;  3C6T A;  3F0N A;  2QIF A;  3JAM Y;  4OI3 A;  1QAX A;  4KB7 A;  2R8G A;  1SC4 B;  3TZZ A;  2DNY A;  2ZHO A;  5AXL A;  3MAQ A;  4HTJ A;  2C28 A;  5GAH I;  2EK6 A;  1REV B;  1MWY A;  5DDQ C;  1HL6 A;  2DRB A;  2ZUG A;  3QAT A;  3G9C A;  2VFT A;  3GZ7 A;  2DJW A;  4OYM A;  1S4F A;  4QCL A;  1U1M A;  3MUM P;  4PYA A;  1DQ9 A;  2JL9 A;  4CO1 A;  2BKO A;  3M2U A;  3MAA B;  2YQ0 A;  4DPT A;  1RQ0 A;  3FCW A;  4JP8 A;  2MLY A;  1CC8 A;  4DX5 A;  2J0W A;  1TU0 B;  2B6A B;  2BVZ A;  4C2M A;  1A7G E;  2C42 A;  2J5A A;  3BGO P;  5D3G A;  1BWE A;  4RW6 A;  3TI0 A;  4WP8 A;  2A3J A;  1SPB P;  3C66 A;  3FSY A;  5JXS A;  2YKN A;  2YNG B;  2MQL A;  2JNJ A;  4FP9 A;  1FJC A;  3TQ1 A;  3L3C A;  4FDF A;  4L3N A;  2AD9 A;  1TKZ A;  5KFG A;  3GMG A;  1N0U A;  2DNH A;  1K8A T;  3WIV A;  1LKZ A;  1XNQ F;  5KT3 A;  1BQM A;  1TV6 A;  3G2X A;  1VOM A;  4IRC A;  3G8Q A;  3JSY A;  1ZET A;  1OSD A;  1MRO A;  1WUU A;  2DGQ A;  2KT2 A;  1IXK A;  1WG4 A;  3IFE A;  4ZJO A;  3VAF A;  1S76 D;  1R0B G;  2M9K A;  4ED3 A;  3OL8 A;  4F0M A;  2EW9 A;  4UTG A;  2QL5 B;  3DDK A;  4LFC F;  2J0X A;  4WIQ A;  5ETN A;  3TUI C;  2KXH A;  2QA4 S;  1R6V A;  2JVR A;  3GJQ B;  2UUA F;  2DIS A;  4X62 F;  4F4Z A;  2LEC A;  4RNF A;  1TR0 A;  5IV4 A;  1V6H A;  1U1Q A;  5K8P A;  8ATC B;  3T1H F;  5C24 A;  2HVE A;  5HK4 A;  2C3P A;  3DDN A;  3GCX P;  1IVZ A;  1S57 A;  3CCL S;  1Z2L A;  4P2S A;  4CTA A;  3THP A;  4ZS6 A;  2NZC A;  3LZ8 A;  4LFB J;  4DPU A;  4NX9 A;  1GMW D;  5I3U A;  3X1L B;  1NXI A;  5JVH Q;  1WF0 A;  4YP3 A;  4WKY A;  4JI2 F;  4OYX A;  3JTN A;  1XR5 A;  2D3U A;  1HQ2 A;  3VGS A;  2GS8 A;  4CLY A;  1AXQ A;  3WC2 A;  1LWC A;  2D69 A;  1MW7 A;  5BYQ A;  1S1V A;  3D3B J;  4ZLL A;  2MQM A;  3JB9 k;  4S0M A;  1S9E A;  5HAN A;  4MJK A;  4DUY J;  2GA7 A;  4CYU B;  1O0P A;  2V6A A;  1N5V A;  1RIS A;  4K5R A;  5J2P A;  5HN0 A;  4B3S F;  3R2C J;  2H5J B;  3HZG A;  5GAH U;  1OIA A;  3L7U A;  3K59 A;  3KLG A;  5A8R A;  3DLG B;  1HBO A;  1HFE L;  5KG3 A;  1ZA1 B;  4UY8 5;  3HJV A;  4DR7 F;  3PRD A;  4FYY B;  2PO4 A;  3MD3 A;  8AT1 B;  4JI7 F;  2E1R A;  3K5O A;  1J5E F;  4LF5 J;  2H3E B;  2EWH A;  4HI1 A;  4BDP A;  2RRN A;  2ZH7 A;  3HPO A;  1BQN B;  1PAU B;  3W2V B;  4PG4 A;  2UXD F;  2WBR A;  3DGP A;  5D77 A;  4OX7 A;  5L1J A;  3KLF A;  2D41 A;  5J2M B;  3GLJ A;  1FJE B;  2DY1 A;  1JNR B;  2PDA A;  1TL5 A;  1IKW A;  1IR0 A;  3HZE A;  3ZZP A;  4Q43 A;  2UZA A;  5B0C A;  2Q6C A;  5JUM A;  2CJY B;  2QMU B;  2KG0 A;  4LR7 A;  2UVV A;  4HH0 A;  3SCI E;  5L1K A;  3W8P A;  2K7J A;  3D4J A;  2Y8Y A;  4MKV A;  5CAA A;  3RAX A;  1GAO A;  1TMJ A;  3DDI A;  5E3A A;  2HVZ A;  2OJ3 A;  4EMD A;  1LNQ A;  5D4L A;  3F44 A;  4DL0 C;  3FSX A;  3Q8V A;  4DEZ A;  2FHJ D;  4J9M A;  3TZX A;  4HT7 A;  2DEJ A;  1RAD B;  3GIL A;  3TX8 A;  2ZNY A;  3G6Y A;  2JVO A;  4P9S A;  3Q86 A;  3AOD A;  4R8U B;  2KKH A;  1V3Z A;  3E3X A;  3HHL A;  3EMT A;  3AGX A;  2FJX A;  1RWP B;  2W8K A;  2Z30 B;  2ZBC A;  1SQE A;  3ZZU A;  3UCU P;  1U1R A;  1VIS A;  3I0S B;  4MIB A;  4USJ C;  3NNA A;  1VQS A;  4RL1 A;  1KTV A;  1UEU A;  3PHT A;  2JFD A;  2QA2 A;  4B3R J;  2CG8 A;  1RAO A;  3FFI A;  4CNZ A;  3QNW B;  1KLM B;  3SCL E;  3HM9 A;  4DG1 A;  1NJX A;  3LH2 S;  1ZYQ A;  2GO8 A;  2AZ3 A;  4M5G A;  3OHA A;  2UUB J;  2V5H G;  2KYZ A;  4RJV A;  2OPR B;  2LDY A;  4LRC A;  4ZK7 M;  2DIU A;  4ZA1 A;  4RNM A;  1T3N A;  3TJ8 A;  3BO2 A;  4QIF A;  5T7L B;  4LJM A;  3D1O A;  2XM3 A;  1ZAX A;  3QSY B;  3P96 A;  3KMQ A;  2CWX A;  3IS9 B;  1M5O C;  4CP5 A;  3D0H E;  5J2N A;  5KG0 A;  1LEO A;  2C2M B;  5CA5 A;  4PUO B;  4H4K A;  1YRX A;  4WWS A;  4FKX A;  4PWU A;  5CYJ A;  1LW2 A;  5T14 A;  1S97 A;  3BKU A;  3VF0 B;  1MMN A;  1R27 B;  1C0U A;  3CJ2 A;  1FKP A;  1FFG B;  3FBE A;  5HP1 A;  1QTN B;  2KRB A;  4NOH A;  5H9F K;  4QIW D;  3R7N B;  1XR6 A;  5CYQ A;  1Q5V A;  2HMI A;  1RJJ A;  4EUV A;  2HFU A;  4NLD A;  2EKY A;  1LV5 A;  3LTO A;  5CZX A;  3N6M A;  1NDL A;  1H72 C;  1HBM A;  2OPS B;  4DHV A;  3D5M A;  4DN0 A;  3J7Z 5;  3L7O A;  1RKJ A;  2HK2 A;  2PN6 A;  3W8G A;  4E0D A;  5KFB A;  4OJ1 A;  1RT6 A;  4LFB F;  2ZZM A;  1L5U A;  1N8R T;  4U96 A;  3EJM A;  2RD5 C;  1VJQ A;  2GQC A;  3FC9 A;  2HHH F;  2R8H A;  2KB2 A;  2J76 E;  4ECU A;  4H54 A;  2KG1 A;  1VQ8 S;  3IBC B;  5KFO A;  1DJ0 A;  2ZE2 A;  2W25 A;  1IQZ A;  5BR8 J;  5DDR C;  2LXF A;  4RUB A;  3CE8 A;  4DX7 A;  5BYR A;  1HPZ B;  2CPY A;  4K4W A;  2V63 A;  2NZ4 A;  3FMB A;  4K4X A;  3BO4 A;  4E8U A;  1C0T B;  3E01 A;  1UW4 A;  4J9L A;  3GG0 A;  3D6H B;  4QWD A;  4G65 A;  5A6W A;  4WYW A;  3R3T A;  1WC1 A;  4PXC A;  3MF5 A;  1CJT B;  3MM8 B;  3PKM A;  3CPW R;  2CKW A;  3N9U C;  2VDH A;  4HHH A;  4BHQ A;  3MCN A;  2ASJ A;  1RA6 A;  3S01 A;  1SIW B;  3G82 B;  3IC1 A;  3QQC D;  2ILY A;  1XMQ F;  2EC0 A;  1U0S A;  1S0M A;  2HBY B;  2OEM A;  4YFU A;  1VRT A;  1F6T A;  4AND A;  3UVJ A;  1AFJ A;  1RT7 B;  2IJF A;  3HXM A;  5KT2 A;  1S6U A;  4ZPT R;  3M8R A;  3BGF A;  2ZOM A;  1EQM A;  3J81 j;  1RGV A;  1D9D A;  2HS4 A;  2VC1 A;  3T41 A;  2ODX A;  3GFX A;  4RW8 B;  4A8Q A;  3KK3 A;  1REV A;  3N28 A;  2XNR A;  2RJZ A;  2FJA B;  1U1L A;  4YHH J;  3BYP A;  5EWF A;  4OL8 A;  2HQC A;  5LXY A;  3VQT A;  2BJ1 A;  2A10 A;  3AJ1 A;  1S1U A;  3Q8Y A;  4CH1 A;  3GIR A;  3Q83 A;  2BE9 B;  2LEA A;  5L1L A;  3N4W A;  2B6A A;  1S6P B;  3RW6 A;  3QAU A;  3KJV B;  5KFL A;  4B3R F;  1XJW B;  1Y5I B;  3K57 A;  4F04 B;  1SL1 A;  3TO8 A;  3EWG A;  1HBN A;  1KP6 A;  2C2R A;  4UOH A;  1VQ4 S;  3SSS A;  5M2U A;  2GGP B;  2Y9H A;  2ZKT A;  4ZP6 A;  4IFY B;  1EIY B;  3DI6 B;  2D9P A;  5AXN A;  1WWH A;  4TYB A;  1OO0 B;  4C3L A;  2FZC B;  3CJ4 A;  1QUP A;  1SUQ A;  3BDP A;  4K8R A;  2X1A A;  3ZXW A;  3NAI A;  1BLU A;  2CDR B;  4GKK J;  1FDA A;  3G6X A;  4LF9 F;  3MPU B;  3H4B A;  1X4F A;  2VKZ G;  4MMO A;  3FVY A;  2CFX A;  1UVI A;  1KEK A;  5H9E K;  2MEW A;  1WHW A;  3OHB A;  2QC3 A;  2EVZ A;  3CMQ A;  3H40 A;  4IRK A;  2HK3 A;  3WX4 A;  2AQ4 A;  2MMY A;  2O1P A;  3D6M B;  2E44 A;  3PM9 A;  3CDE A;  3F56 A;  1K1Q A;  2ZUA A;  4JYA J;  2ZOF A;  2MY8 A;  3QSI A;  3H4D A;  2QSW A;  3V6J A;  4ZHR A;  5LMU J;  2W2M P;  1NU4 A;  4OIX A;  3J80 U;  2C1E B;  1X4D A;  3G6E S;  4WJB A;  5KG7 A;  3NS7 B;  1MMD A;  1IBL J;  3D68 A;  4NLP A;  2M8D B;  2B5J A;  4NRT A;  2JRS A;  4J91 A;  1HHS A;  2K2P A;  3IXQ A;  4ZLJ A;  3LOU A;  4OX8 A;  4OI6 A;  1FWP A;  4DFJ A;  3V81 B;  4FS1 A;  1M90 T;  3NRB A;  3WIU A;  1X5P A;  2AIR B;  1XMO J;  5I42 B;  1YG0 A;  2DH8 A;  1Y0H A;  1YGY A;  3MM7 B;  1B3T A;  5BR8 F;  1D8Y A;  3H2U B;  3OUY B;  1QE1 B;  1TAQ A;  4RPF A;  4YEA A;  3W62 A;  2MHE A;  3JS9 A;  4B3T J;  2YX4 A;  2DYA A;  4CLP A;  2VB6 A;  4AXI A;  3DLE B;  4RNH A;  1KWM A;  1EJ7 L;  4CYU A;  5F8H A;  3SZ2 A;  4RUH A;  4P2X A;  2A1B A;  3CCJ S;  4K0K J;  2PEB A;  3M1V B;  3UQS A;  3KKF A;  2WW4 A;  1S10 A;  3UCG A;  2QSF A;  3V6H A;  5KFI A;  3HD2 A;  1DHM A;  4LR9 A;  3DLK B;  3NGT A;  2CZV C;  3IGV A;  1NJI T;  2MY7 A;  1T9W A;  2L41 A;  2UUT A;  2NYH A;  4UT4 A;  2MZQ A;  1JQG A;  1UZD A;  2MKC A;  1BQN A;  1YZ6 A;  3NMR A;  3W2V A;  3ZTP A;  3OV7 A;  2CPF A;  1PJ5 A;  3Q24 A;  3NCQ A;  2ZJQ Q;  2IJR A;  1WTF A;  4G1Q A;  4RO0 A;  2R9L A;  1GMW A;  2YPZ A;  2AGO A;  4X64 F;  2HIQ A;  2DCL A;  1H2U X;  2WCX A;  4KT0 C;  4M5N A;  1X9S A;  2X51 A;  4ZVU B;  2QL7 B;  1KKH A;  5A8W B;  3W7B A;  2IAJ A;  3RBD A;  2ZNZ A;  3NGR A;  5HL7 Q;  3HHD A;  1U2C A;  4TY8 B;  3FDS A;  3WC0 A;  2LDI A;  3BQ0 A;  1FT8 A;  4O4R A;  4HI2 A;  4ED5 A;  3O6Q A;  2W7O A;  4D3H A;  1OSC A;  2FIU A;  4NPO A;  4Z7Y A;  2P9E A;  1UAW A;  3EZO A;  4R8U A;  4YHH F;  3P5T L;  3A3P B;  2ZVI A;  1JLE B;  1D1U A;  3MHY A;  1BMQ B;  2PMW A;  5LMN J;  2ZH3 A;  1YJN S;  2R8I A;  3I0S A;  3Q89 A;  3WHI A;  3NG8 A;  4DQP A;  1NK7 A;  3V2U C;  5D78 A;  2HWI A;  3RBX A;  2W01 A;  1KLM A;  3KG4 A;  2G2Z A;  3W2W B;  1UJ4 A;  4O0N A;  4YN3 B;  1M5S A;  1RTZ A;  2GC8 A;  2QX0 A;  1BC6 A;  3G4S S;  2R7O A;  3KLV A;  3QBC A;  2QN6 B;  1S1T B;  2V2V A;  2OPR A;  1VS3 A;  2JLE A;  2Z2Y B;  2KYX A;  2IJN A;  3DHW C;  3K8W A;  1UEV A;  1SKR A;  3T5K A;  3PYF A;  2XGP A;  5IT4 A;  4N7T A;  3IS9 A;  4X4S A;  3CGI A;  4NMX A;  2HAI A;  3MAH A;  4DV6 F;  4OLP A;  4DBQ A;  1X0P A;  4PUO A;  5F3T A;  4KYZ A;  4N8N A;  1KR4 A;  2JOQ A;  4QU7 A;  1R0A B;  2CJX B;  4Q0B B;  5THW A;  3UPF A;  2IRU A;  2HVI A;  4J9U E;  3GFY A;  3C8Y A;  2W2O P;  2LXU A;  2QLF B;  3HKW A;  2FJD B;  1XN9 A;  1I6J A;  4HVZ A;  1IJF B;  1BXN A;  3IBF B;  3EGV A;  1UFK A;  1FNX H;  1T03 B;  2WON B;  1S79 A;  1SBR A;  2OPS A;  1HWU A;  4LF6 J;  3QGI A;  2XQC A;  2AJ4 A;  4I2Q B;  1N6Q B;  2OSQ A;  1OS5 A;  3TEG A;  1XMB A;  1IBL F;  1Z1Z A;  2ZFH A;  3R1L A;  3DMJ B;  3T5J A;  4B17 A;  2XO6 A;  5B09 A;  4LBH A;  3HVT B;  1N33 F;  3MOJ B;  1HNZ J;  2RE1 A;  4UZC A;  2OML A;  1HNX F;  4YDD B;  1VQK S;  1XTZ A;  3IWL A;  2B4P A;  2VQE F;  2ZM6 J;  1RAH B;  4DV3 F;  1PYS B;  4C0H A;  2F63 A;  2UV8 A;  2MKH A;  3HT0 A;  3RUB L;  2IM0 A;  1B4S A;  1FKA F;  1WAC A;  4IG0 A;  2OHD A;  4FXW A;  3FZB A;  5ETT A;  2HWT A;  2L9D A;  1U0H B;  4NZ0 A;  4IO9 Q;  1YI2 S;  3GFH A;  1M5H A;  1B7Y B;  1HPZ A;  5KFJ A;  1TK0 A;  1VQ7 S;  3D28 A;  2ZHB A;  3K17 A;  4K0K F;  3RZA A;  2B9X A;  2WB4 A;  1Q8I A;  5F8J A;  3OW2 R;  1VK3 A;  1KQF B;  2GVZ B;  1AW0 A;  2QE5 A;  4TKT A;  2LVW A;  3KJQ B;  4X4Q A;  2PII A;  1S5Z A;  2LQ5 A;  1CJT A;  3MM8 A;  3W1Y C;  3N01 A;  3PG9 A;  3HUL A;  4OLO A;  4MYU A;  1FHT A;  2HHV A;  3G82 A;  2EC2 A;  5MLC V;  3C6U B;  3Q0A A;  3SFG A;  1J27 A;  5CAB A;  2JEJ A;  4AL5 A;  4IR9 A;  1Y5L B;  2LCW A;  1Y4Z B;  2B4V A;  4I6A A;  1RT7 A;  2FC9 A;  1OJ4 A;  5D4N A;  3GSI A;  2AEM A;  1W26 A;  4MFB B;  4C3K A;  3IR6 B;  4YB5 A;  1FRH A;  3LP2 B;  2HHT A;  3H20 A;  2IC3 A;  4NLG A;  2IM2 A;  1N5Y B;  4X4V A;  2AP6 A;  4RW8 A;  4WFA Q;  4M5L A;  4CNY A;  2GVD B;  2L48 A;  4F3O A;  4NLU A;  3CT9 A;  4O44 B;  3BRE A;  5A2Q U;  3T9N A;  3J7Z T;  1UWA A;  4YUD A;  2JZ8 A;  4A8F A;  3NOC A;  5LMN F;  2WVB A;  2WSF C;  3NGK A;  1SXL A;  3KUH A;  4IOC Q;  4DSL A;  2BKN A;  1WTB A;  1FWL A;  5DJB A;  2P6T A;  3BZQ A;  3HD1 A;  3BYR A;  3KJV A;  3NL0 A;  3RB4 A;  1ZTW A;  2DGO A;  2IFX A;  3AGZ A;  2W9C B;  3LAM A;  2YNH B;  3UNG C;  2VA3 A;  1YRU A;  3CJQ A;  5DO2 A;  4FF4 A;  3UFC X;  2EFO A;  3GFZ A;  3AFG A;  2DNP A;  2ZH9 A;  3DI6 A;  4JI0 F;  2ZH5 A;  1HQE B;  2LQB A;  1JLB B;  3NXZ A;  2ZD1 B;  3OT9 A;  2OEK A;  2QRR A;  1RT2 A;  2QO3 A;  1YVF A;  4UF4 A;  4U7U K;  5IWA F;  4ECY A;  4CRJ A;  3MM6 B;  4L72 B;  3LUY A;  5J2Q B;  1KQK A;  2GV1 A;  4CLK A;  1T02 A;  3AD9 C;  2R8K A;  2E5G A;  2W7A A;  4PCQ A;  4JI6 F;  2MKJ A;  4XK8 C;  4N5S A;  3DRX A;  1IKX B;  5EWE A;  4F4X A;  4HYK A;  3PR4 A;  4ED0 A;  2HFS A;  2PC6 A;  4NYO A;  4ZIV A;  4NA2 A;  4I67 A;  2EFG A;  2ZH4 A;  1TK5 A;  1RTJ B;  3DOL B;  4J9P A;  4A8S A;  1WKJ A;  1HHQ A;  2Y8W A;  4LF6 F;  3MXH P;  3BS9 A;  4DV5 J;  4C8Y A;  2QFI A;  5HAT A;  3PX4 A;  5HMW A;  4NZ6 A;  4B02 A;  1ZM4 A;  3JYT B;  5CD4 H;  3BBC A;  1QY7 A;  5ETM A;  3NCR A;  3M32 B;  3NGU A;  4ED4 A;  2UXB F;  4WF9 Q;  4MH8 A;  2KU7 A;  1T9V A;  5I42 A;  2RML A;  3VAK A;  2VIC A;  3BKF A;  3MM7 A;  2ZM6 F;  1DTQ B;  3UR0 A;  3Q2T C;  3M8Q B;  5L39 A;  3EXY A;  3D0I E;  3PYG A;  3ZZY A;  4Q5V A;  4O0I A;  3DLE A;  3MPV A;  5F41 A;  2UP1 A;  4ZVH A;  4LVO P;  3UI3 A;  2NR0 A;  4OFZ A;  2NUU G;  5A0Y B;  2QFJ A;  1PJ6 A;  2J7U A;  1DTT B;  1RWU A;  3QT5 A;  3M1V A;  3OR1 B;  2HND B;  9ATC B;  3W63 A;  4ZVP B;  4DZD A;  1RYS A;  2XHW A;  1B70 B;  3DGV A;  1ZPW X;  2GFF A;  3DLK A;  4U67 Q;  2BXJ A;  3GQC A;  3LPE A; 
#chains in the Genus database with same CATH homology
 2HFV A;  1GMW A;  1C3G A;  3LA0 A;  1EAR A;  3AGY A;  1NLT A;  1GMU A;  3AGZ A;  3LZ8 A;  3NY0 A;  2Q2G A;  1GMV A;  1GMW D;  4L3K A;  3TJ9 A;  2B26 A;  3L9Z A;  4J80 A;  3TJA A;  3TJ8 A;  3AGX A;  3NXZ A;  1EB0 A;  3I38 A;  1XAO A;  2QLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...