3TJAA

Crystal structure of helicobacter pylori uree in the apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystallographic and X-ray absorption spectroscopic characterization of Helicobacter pylori UreE bound to Ni2+ and Zn2+ reveals a role for the disordered C-terminal arm in metal trafficking.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 35
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3tjaA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3tjaA02
3AGYA 4J80A 3LA0A 3NXZA 2QLDA 1NLTA 2B26A 1EARA 1EB0A 3AGXA 4L3KA 3L9ZA 1XAOA 2Q2GA 3NY0A 3I38A 1GMWD 1GMUA 3LZ8A 3TJ8A 3TJ9A 3AGZA 2HFVA 1GMWA 1GMVA 3TJAA 1C3GA
chains in the Genus database with same CATH superfamily
3QJPA 3PRBA 4JV0A 3BO4A 1VHIA 2DHSA 2UVWA 1RAHB 3KYLA 1HHQA 1X8DA 5HVFA 3EVMA 2C3YA 3HVTA 4OI0A 3TQ1A 4RW6B 4RNHA 1RCXB 2Y1RI 2P9EA 4F4YA 1NBEB 1OWXA 2BANB 3BYPA 3CJKA 5FJ4A 3MEEB 5KFKA 1RU1A 5HQLA 1YGYA 3TA1A 1SJFA 3EVOA 2AJQA 3CCWA 5HAOA 2BDPA 3AB2B 3GILA 3KMQA 3C16B 4XPCA 3NWRA 3ZTRA 3KHRA 4Y2KA 2V2KA 4ETZA 2WONA 3SFGA 3CJ5A 4ANEA 3DOMB 4ZLPA 2HHSA 1O5JA 2NSCA 3DDNA 1AFJA 5AXMA 2AX0A 1HNIB 2ZBIA 4WIQA 1LXJA 1BLUA 1S4FA 2NXNA 1WEYA 4HI1A 1R8HA 2R7WA 2RT3A 3JTPA 1VISA 3M9OB 5J2NB 3ZZRA 4KR0B 1JJHA 2RRNA 2BVZA 4ANCA 3UFCX 1SKUB 3RTVA 3N5BA 3KK2B 2X1GA 1VYAA 3I5AA 5HP1B 1P9YA 3UD5A 2DT9A 4WK3A 3SSQA 2UUAJ 1U1QA 3W9JA 1HW9A 4LBIA 1X5OA 1TKZA 5B0FA 2ZH9A 1K1QA 4L3KA 3ONQA 4B02A 2PMWA 1K8AT 1KHVA 2ZOGA 8RUCA 4C11B 3LP2A 2KFZA 3GIIA 5HLFA 2RS8A 3ILJA 4NLRA 4CI0B 4L72B 2W2PP 1N6QA 4X84A 1T05B 2GJ2A 1FDAA 2VB6A 3ZC4A 3MEDB 1WTBA 4J9PA 2QN6B 2FJAB 2C3MA 2OUGA 1IWAA 3R2CJ 2BV3A 3M2VA 1UP1A 2GMLA 2OH2A 4MJKA 4L3NA 4MMOA 3EZ5A 1M0SA 1RKJA 2DBBA 2ZD1B 2GIQA 1ZZNA 5DZ6A 4NCGA 1V6HA 3EGZA 5M2PA 3UDLA 2JX2A 3BGRB 3D68A 4LFCF 2Z2MA 1JLEA 3IGNA 1SH2A 5FIIA 3CGIA 1R0AA 4XIUA 1QY7A 5ADZA 3QIDA 1DTTB 5AE2A 2GIRA 4IYQA 2JFKA 2HRUA 4DX7A 5CCLA 4URQU 4AQYF 4ZVPB 2VHGA 1U1NA 2X1BA 2R8JA 1O6XA 3WQPA 2MB0B 4IQXA 1QD1A 1WF0A 3AB4B 1S48A 2PFDA 4YFUA 1YJRA 3GYGA 4Q8EA 2LQ8A 3MUMP 3K5PA 3ZZUA 3BDEA 4OI3A 2BE2B 4PZVA 1IM4A 1MU2A 1FJGF 2FC8A 4TNOA 3WX8A 3W2WB 3QLHB 3MI7X 1IKWA 4M5LA 4DLGA 3RB0A 3E51A 1TKXA 1X9WA 4A8XA 3VGSA 4J37A 2XZWA 1RT7B 3C46A 1C0UA 4EZ9A 4P9SA 2IC3A 1DZ5A 3N6LA 3DRRB 5AE1A 3BYRA 3G8TA 4QYZJ 3ZNUA 2Q79A 1REVB 3HFVA 2Y1JA 2HZVA 2K8GA 3BSCA 4RNOA 3ILLA 4DQSA 4B3RJ 3W61A 2ZOMA 2NS1B 1FDBA 3EGWB 3TJAA 1VBZA 3LP0B 4YHHF 3O8WA 5DGAA 2EC0A 5ETTA 1CVJA 3DLKB 3K7RA 3M2RA 1ZS6A 1VQ7S 1TUVA 1LWFB 3I56S 3I32A 1SJ4P 3WIVA 4Y2AA 4R8UA 1GTHA 3JQJA 4YHHJ 4DR2J 2HIQA 3OR2A 3M8YA 2V2QA 1AZSA 2CNKB 1DQAA 4FF3A 1CJUA 4W90B 3M8QB 3GFZA 4X64F 2W9BA 3UE2A 1XMQF 1SB6A 1YG0A 2BR0A 1BWEA 1RXOB 1KVKA 1RHRB 2BKOA 3EDRB 2PE8A 4C9DA 2Q3PA 4U7CA 2VBZA 1R8CA 1S9GA 1S9FA 1NJXA 4X64J 1S6QB 2NXEA 3W2VB 1XMQJ 2H1YA 4KH0B 3OXFA 1QLNA 2D69A 3I4HX 3OL6A 3N0VA 2CIMA 4A8QA 2DNQA 3UN5A 4WK1A 4LF9J 3OR1A 2FD2A 4OX8A 1VJWA 3LGNA 4MT1A 5CD4H 4WBFA 5ETLA 2HK3A 3PJWA 1VBXA 3OVAA 3DOKB 1RCOB 5IWAF 2QSWA 1PC4A 4NA2A 1JLFB 3KJFB 2YBVA 5J2QB 4B9LA 3KLGB 5BR8F 1RHMB 1XQIA 1PKUA 4K4ZA 4KGMA 1KFSA 3SQGA 4I64A 3PNIA 2DNMA 3FNNA 3K0JA 4ID5B 5IWAJ 5CQGA 1EAYC 1VIXA 3K5MA 2O66A 5BR8J 2D9OA 3HJFA 5C7PA 4RU9A 4IOCQ 1S0MA 3OHAA 4GKJF 1Y4ZB 1KQSR 3QMQA 2BACA 4DPTA 4ZVHA 2B9WA 7FDRA 3NNAA 4OYZA 1QAXA 3DGPA 2XYGB 4ZN3A 2XGPA 2KHCA 4WP9A 5F8GA 3C6UB 4ZLNA 1HBNB 3QGPA 3OHBA 2W9CB 3NCPA 2G0CA 1F3FA 1HBUB 3EWGA 1ZAXA 1SJ1A 2AEFA 2KZMA 3OPKA 2BYCA 3PJ9A 3LO3A 1YHQS 4BHQA 3IMQJ 1RHKB 4JI6F 2N7CA 4EEYA 3AAWB 5HROA 1JKHB 2YY3A 4Q43A 4OHYA 1RZMA 4ECWA 1SC4B 5LMUJ 4V1Ak 2RB7A 1FXDA 2B4VA 3G8QA 4ED7A 3PCOB 2RRAA 2W9AA 5CHCB 2CQDA 3KLVA 5EWEA 1IKYA 3R97A 1U1PA 1TELA 3FVYA 2CXEA 2XO6A 3PZPA 2LA4A 1OJ4A 1U4BA 4BBYA 1YIJS 5KFSA 1Q79A 3ICLA 2XZTB 4RW8B 4FZVA 4GO5X 1F2GA 2YKNB 2FTRA 4RWXA 3LWMA 4X4QA 3RU0A 1FE0A 4F4ZA 3X1LB 2V4RA 1YRUA 1R8BA 1V3SA 3QIPB 2YX4A 1F5BA 4HTIA 5B09A 1RBOB 1UJ4A 2H5IB 2RD5C 1FKOA 2ZBRA 5ETRA 3NXZA 3J7AN 1VOMA 3PEJA 2OEMA 3UVJA 2FVSA 3TAMB 1PG5B 1W2BR 1GXUA 1ZBTA 2CQ3A 3ZO7A 2HVDA 1CG2A 4WWSA 3H40A 4C8LA 3LP1A 2H48B 3CNQP 2M4MA 4DBQA 3KOAA 1HKAA 2HPUA 4DG1A 2HZAA 1IR1A 3ZZPA 4PYAA 4J9SA 4F02A 4LQ9A 4UOFA 3I87A 1NKBA 5FDLB 1R0BG 4P7VA 1WC4A 4TYAA 3D6TB 4CT9A 1FEEA 4CO0A 3RW6A 5HN0A 5E3AA 3GFHA 4CO3A 4IH6A 1NSPA 2Y1IA 1YJ7A 2CNNB 5H9EJ 4DCPB 4DSKA 5ETSA 5G0RB 1V3ZA 3M8SA 3SEOA 2AHOB 1UVLA 1NB7A 4G1QA 4G6VB 2KO1A 1IBLF 2OPPA 1NSQA 3KLHB 2P8IA 1NSKL 3HHLC 4WTYA 4DV3F 1UVIA 1XBWA 1NDKA 4I6WA 3V4IA 1SQEA 4RW9A 4ENOA 1B4SA 3Q8SB 1WKLA 3NMAA 3L95X 3M8PA 2D1CA 1AUSL 4O44A 3IRWP 3FK4A 4LF2A 1WF1A 1U1KA 3KK1A 2LEAA 2HHWA 4K2XA 2UZAA 4X4RA 1XAOA 2MZ1A 3G82B 4R5PA 5KT3A 5F8HA 2BRLA 1VR6A 4P2XA 1UVKA 4DPYA 4PXEA 4UOCA 3GIJA 3SCJE 4UW2A 3IR6B 2M52A 2IDEA 3Q8QB 3SSRA 3UI3A 2BJ1A 3G9CA 2WVEA 2OIHA 4DV5F 2O3DA 3DRPA 2UVVA 3HK2A 1W2IA 4IR1A 4UTGA 2YNFA 1TL3A 1N88A 2WBMA 4IG3B 2BM0A 1U1MA 2QC3A 4K2JA 1Y5IB 4YDDB 3HHLD 4ZIVA 2QV6A 3CC7S 2A6MA 3JQMA 5C24B 2DR8A 2HVHA 3VVTA 5A6PA 1CULB 2Z58B 2RDIA 5J2PA 1RT1B 4CRJA 1BGXT 1B7YB 3ZZYA 4CZCA 2M8HA 3MWBA 2HHVA 1RBAA 4F4KA 5A8WB 1N54B 5D4OA 1IBMJ 4WIIA 3R6LB 3T6JA 2JC1A 1UWAA 2E29A 4H4OA 2ZVIA 3HHLB 3CCLS 4ZDNA 3WC2A 1T94A 4MK9A 2KI2A 4DR4J 1X4CA 2UUCF 1KLMA 5RUBA 1RTZA 3ET6A 4CIOA 1KRPA 2EG2A 2ZFHA 2NPFA 2CQPA 3CCRS 2B56A 3L7PA 4NLTA 4LF1A 4F4WA 1XC9A 5KAKA 1JMTA 4ELUA 3RB3A 4U67Q 2Q6BA 1L3VA 4O3PA 1Y3JA 4AFFA 3IFEA 2UXDF 1R6VA 4GVBA 3CWJA 4HH1A 3CD6S 2F9JA 1EIYB 1FTRA 3J80Y 4PPZA 1BY9A 2YXLA 4F2RA 2Z30B 1M90T 2QL5B 2X3DA 4NLOA 2R7XA 4I2PB 1HWUA 4TY8A 1U8WA 4OI2A 4ED0A 1RJJA 4NWBA 4KGKA 3H5XA 3SBMA 3OLBA 1A9NB 1NK7A 1S0OA 3FEXB 2ZNYA 4Q2MA 2UV8G 5DG8A 1W25A 4F04B 2EEYA 2PEHA 3MM7B 2HHTA 3GG1A 4U8VA 3L3CA 2GA7A 2YKOA 1P6TA 5EN1A 3PW7A 3FKBA 1T9UA 2AX1A 2QMXA 3FC9A 3N6MA 3RR8A 3Q8YA 1NJWA 3Q2TC 3M32B 2VPWB 4ES1A 2AF6A 1N34F 2DHXA 2ATLA 4DL7A 2NXUA 2FJVA 2Y8YA 4Q0BB 2V67A 3DCAA 2VUGA 4OZLA 1VQKS 1WEXA 1UZDA 1N34J 3TVKA 1YBAA 2J0SD 3HVAA 3C2PA 3B8HA 4RW4B 4EFAC 1RAFB 2EK1A 3VGVA 1L3UA 5IFMA 2ADBA 5HI7A 1XJWB 1QE1B 2AIRB 5F8LA 4YEAA 4CM2A 4ILMA 1PAEX 2B6AB 3CCQS 5HANA 4IFYA 1TKTB 2XNRA 5KT5A 1RSCA 4D3HA 2RF2B 3P96A 4EO8A 2LCWA 2RNEA 3Q8UA 2OJ3A 2F8HA 4TU8A 5BJRA 2B51A 2KT5A 4MYTA 1VDHA 2ASJA 1ZAWA 2JRSA 4Z2XA 1D09B 2MGZB 4KKOB 4WCEQ 2BX6A 2WB4A 2W24A 4CLTA 4A8OA 2R7UA 1XIQA 4B9MA 2CJXB 1FXLA 2MEWA 1WTFA 2CWXA 1WG4A 3VAJA 1RLDA 4P74A 1OIAA 1T03B 5L9XA 3J7YU 1YJTA 4DN9A 1RHQB 1V9OA 2DO0A 4UT4A 2DJWA 4ED4A 1XEZA 4KV8A 4PWDA 2YWFA 1F1BB 4X65F 2QRRA 1LWXA 4I4BA 1Y10A 3NBPA 1PYOB 4LF8F 2JVRA 2EXUA 1SIZA 2L08A 4Q44A 4ECSA 1HFEL 1PJ7A 3ISNC 4X65J 2WHOA 2DIUA 5T41A 2DHAA 3ETOA 2HHQA 1WKJA 1FDNA 1JLGB 4WFZA 2NZ4A 5HBMA 5KFUA 3GWCA 5IS2A 4X4OA 2KFNA 2LVWA 3B82A 5KG1A 5F0WA 2LXFA 4DCOB 4ELVA 4DUYJ 4WFAQ 2B43A 1ZA2B 3VZIA 4IFVB 1EP4B 1Y0HA 3QFWA 4DPWA 5FD1A 1MWZA 4C0HA 1DURA 4V19J 2L9WA 1TR0A 2VG7B 1UEVA 4KFBA 2HGLA 2B9EA 3K89A 1K47A 1D8YA 4WYLA 4DEZA 3BBCA 3KMSA 3C6TA 3FJ2A 2MLXA 2RRBA 3HHEA 3MPDA 1VQ8S 4A8YA 4QZVB 2PSZA 2VPZB 2AYBA 4PKDB 3L4BC 3MR2A 3THTA 1FNXH 2CDQA 2YPZA 2ZM6F 4UOHA 4QPXA 2AZ3A 5K8NA 4CLLA 3OBIA 5D0HA 2MKHA 4P6QA 1KQFB 3HO1A 1Z1ZA 2J9EA 1ZZFA 2ZM6J 2PC6A 1Q0NA 2IVFB 4EI2A 4NLGA 2V63A 3BO3A 5KFYA 3JS9A 3JSMA 5K8PA 5A2QU 1B0TA 3GLJA 1APSA 3UO0A 1IR2A 1NB2A 4RW6A 2LFVA 4DR7F 2F3JA 1RTDB 3QGIA 4FBUA 1DFDA 4HACB 1F9HA 1FDDA 2H9ZA 2HFOA 7FD1A 4QU6A 2JC0A 1EKSA 3D7SB 3MEEA 3P6YC 1S76D 1KBRA 1X4AA 5A6WA 1OS5A 1X0FA 4OZ5A 2A10A 2DY9A 1CPZA 2X51A 2VFTA 2M5YA 3THVA 4OZNA 5KT2A 2E44A 2OD6A 3D66A 2XY6A 2MKCA 1NH7A 1GX5A 4GC6A 2DD8S 4IKAA 4OMFG 3OFFA 1O51A 5AJ3J 5HVGA 4DR1J 4Y0FA 3DOMA 2MSTA 2R2SA 2EG1A 3W9HA 1HQEA 1C4CA 1I1GA 5IT4A 2MZRA 1Q81T 1TKDA 1HNIA 2IA0A 3M8ZA 5C5JA 3MFIA 2FYXA 2FZKB 4M63A 1IKVB 2BJ9A 1RWMB 1D9AA 2UXCJ 2DK2A 1IN0A 3D2WA 2JVOA 2K7JA 2B7CB 2C2KB 1UAWA 4ZVRB 3F44A 5HP1A 2AJ4A 4F4AA 3AOCA 4HH0A 3E3XA 3NNHA 3V81B 5KG5A 2VFRA 2ZH4A 1KOHA 3GE9A 4CDIA 5DZ7A 4DV4F 3W1YC 3HHDA 4PAAA 3PW0A 2GAGC 4RNFA 4YN3B 4PRFA 1RTIB 2YWHA 1HI8A 2VODA 4C11A 2B8PA 3U02A 2JVMA 2XHWA 1BQNA 2XS5A 1S6PB 4YY3F 3OLAA 4ECRA 4DV4J 1BHNA 1WHXA 2YPYA 3MD3A 4Q2LA 1T05A 2VZ9A 3IG1A 3PEHA 2MZTA 5DO2A 1H7WA 3MEDA 3G71S 3MD1A 4JI8F 4OV6A 1Y5NB 4ZCMA 1YSJA 3R5AA 1U1RA 2PI4A 3OL8A 5EGYA 1TMMA 2YNGA 4WP8A 4YY3J 5HVHA 1U2RA 2LXUA 2CPEA 2V8GA 3W5XA 5KFRA 4GO7X 2ERRA 3H2VE 1Y3KA 2FLPA 4LR7A 3DRYA 3KUGA 3G6XA 2XHCA 3NGDA 3HJVA 3CJSA 3K5OA 1HWIA 2OPRA 3BGRA 5B0GA 3AJ1A 1FX2A 2RQMA 3MAQA 3S01A 1WC0A 3PRVA 3NKYA 3VV2B 4G1PA 1DTTA 1NKEA 4PQUB 3HDSA 3IR7B 2KDOA 3B54A 1N5TA 2XSFA 3SSSA 5B0CA 5GADU 4CTAB 4RNNA 1S0VA 5LXRA 1E6VB 1FERA 2CJYB 4ELTA 3G8SA 1HA1A 3DN9A 2BE2A 4FYYB 1VBKA 2RUSA 4QU7A 1RTHB 2MQPA 3QLHA 2M0GB 1FFSB 3G96A 1QVGR 3N6NA 2BMBA 1YWXA 2MKKA 4I6AA 2ODXA 2HMIB 1T02A 1F60B 1S1VB 2AGQA 3OD2A 5AE3A 1LWEB 1RDRA 1WG1A 3J7YI 1RT7A 2J0WA 2KB2A 4U95A 5KFEA 4OV1A 5HL7Q 3FRZA 3AKOB 3UD4P 1RGVA 4NI2B 1CEZA 1REVA 1M1HA 4QWDA 2WOMB 2DRAA 2HNDB 2MSSA 1VS3A 3W8GA 4MK8A 4DWIA 4BLGA 4E98A 3LP0A 2VFUA 5C2GA 1YLXA 1R8AA 1LXNA 2CJAA 3H2UB 2L9DA 1SVDA 1IKXB 1HWKA 4UUWA 3DLKA 5F41A 4LRCA 2HHHF 3PFOA 1YZ7A 4NE9C 2EFVA 3HKZD 1S4EA 3R5GA 3KLFA 4QW9A 2DEIA 2XEXA 1F2HA 3AXKA 1YRXA 3SYZA 5AXKA 1P27B 3ISZA 3PX6A 1S99A 1V5VA 4NEZA 4FS2A 2HHHJ 5IV3A 2MQQA 3M8QA 5L46A 1LK5A 2JLFA 2M8DB 2VONA 4C48A 4DV0J 2FHMA 3GCWP 2RJZA 4JBCA 2QL7B 1IQTA 1S6QA 3W2VA 1RTJB 3S1TA 4WFBQ 3UQSA 2CPZA 1SCJB 2ZKUA 4FVCA 2MDAA 3PY8A 1FTCA 4HKQA 3OTOF 2HHXA 4RUAA 3NLCA 2C3OA 1FD2A 2I8EA 1RT5B 2MHEA 3AGZA 3CMES 3SXLA 5M2RA 2IVYA 2WB1D 1Q86T 2VDHA 3DOKA 3PYGA 2DH8A 4FPIA 2RILA 4K50A 5J2QA 3GP9A 3KLGA 1SQFA 3BR8A 2PI5A 1AFIA 4EMDA 2AP6A 4USHA 3ENQA 1SH3A 4J80A 2R7SA 1CJVB 6AT1B 2GJIA 2JDJA 2GZOA 4FYWB 4USMA 3MEKA 4LF4F 5LJ5Y 4QWAA 1GAOA 4CLFA 4AUKA 1JLAB 3MTKA 3N79A 2XTJP 4JI7F 2PD1A 1ZPVA 2W2QP 4P7TA 3DLBA 5L38A 3PKMA 2ZUAA 4LF4J 5F8IA 2QX0A 5GMKa 1IBKJ 1H74A 4NLUA 4CYUB 3JQKA 3K58A 3D0GE 3C6UA 1VRUA 1HBNA 3I0SB 4TLRA 1YJ9S 2OMOA 2W9CA 3RW7A 2B4UA 2ZH5A 2C2EA 3KJQB 2B4PA 3BSNA 3CO0P 3LPEA 3OVBA 1EKRA 4H4MA 4DSEA 2FJWA 1Q8IA 4LREA 1FI4A 3T9ZA 4KYZA 1RABB 1PBUA 1N36J 2UXBJ 3JSRA 4ETXA 1RT3A 1S9EA 1WELA 4Y2MA 3TUIC 1RAJA 2BJ8A 3AD7C 1UA1A 5KFAA 2GAHC 1HPZB 3FBCA 3IBFB 2G0IA 3KUEA 5KG4A 2VICA 4KE5A 3CCUS 2Y0BB 4LRAA 1Y00A 3PG9A 2V2VA 1U25A 2JH3A 2XCAA 2FHOB 3D0HE 4IO1A 1CJKB 2XG8A 4P75A 1V3RA 1R7IA 4JI4F 3EZOA 2YWWA 3F56A 4X4SA 4DJBA 4KC5A 4ANDA 2AD9A 3L7UA 4OLPA 2WCXA 2YKNA 1RBLA 2XWYA 2DRDA 2RIJA 4H4KC 2XLIA 2BW2A 4EBCA 4ED5A 2ALYB 2QLXA 2QLDA 1U02A 5F8NA 4A48A 4DV1J 4W92B 3HI9A 5DLFA 3E01B 4K4UA 1VBYA 3TJ8A 1AB8A 1UKUA 2QO3A 2A2CA 1VQ5S 1SKSA 2GJFA 1ZPWX 2EI5A 3MCSA 2EBEA 2APOA 3G2XA 2FJBB 4KHMA 4DPXA 2HWIA 2IJFA 3KXDA 3M30B 2U1AA 1TAUA 4F3MA 3VHQA 1TTHB 4XAKA 4F4XA 3LAKA 1X4EA 3DMJB 4QIWD 4OFZA 4EUVA 2WSEC 3H0PA 4LFAF 1LFWA 2ZZTA 4R25A 4N8NA 3DFEA 4DPOA 3RAQA 3D54A 3VAGA 4ECVA 5D4LA 2BJDA 2I6WA 2YQ1A 2L41A 3LANA 3MF5A 1NJYA 1OSCA 5BXIA 1RWXB 3THPA 4CM0A 4USIA 4Y2IA 3H5UA 4F2SA 5CZXA 2J7UA 1X9SA 2V6AA 2IYIA 3GSDA 5G0RA 5GVQA 3GJRB 4FVMA 1NUEA 1LW0B 2EFQA 3KLHA 3QGHA 5GADI 4IH5A 4ZPCA 3CE8A 3FCWA 4YB5A 2G2YA 4OYPA 3OTCA 3IR5B 4M5IA 1UWBB 3SQOP 4ZJOA 2A6OA 5HMZA 5LT5A 4FF1A 5KG7A 1XR6A 4PG8A 2OPQB 1P1TA 2XY7A 2O1PA 2J9DE 2UV8A 3SCKE 4O4GB 5LSRA 4KTQA 2QYCA 1JXLA 5DM7Q 1EHWA 4NLWA 3JSYA 2RDDA 1Q53A 1XN9A 5H9FJ 3FEYB 3UDEA 4HR2A 4P73A 4M5HA 3TEHB 1A7GE 4ZP9A 2KZZA 1QTNB 2G13A 1AYEA 3QO9A 4DSFA 2IYGA 3KDNA 4ZVGA 2MZSA 2KFYA 3TVYA 1PILA 4IG3A 3AFGA 1J5OA 3UR3C 3C8YA 2IRYA 4KHRA 5DS7A 3EYZA 5C24A 1AA1B 1MW7A 4ZVEA 5D78A 2CVEA 2EKNA 2HS3A 3J81j 2ZZNA 2JEGA 4YQWA 4DUZF 2QMWA 4TU9A 2AEJA 4OYXA 4ECXA 4K0KF 1XWLA 4I56A 1RA6A 1XNQJ 4B3MJ 3P3DA 2E5LJ 3N01A 1MROB 3HHLA 2U2FA 3MXHP 4DUZJ 3NS5A 1ZM4A 3R7SB 4O4RA 3NL0A 4NXMF 3BF4A 4DV6J 4DUTA 4UOGA 3TWZA 2HQFA 5KFCA 4XDCA 1Q5VA 1T7PA 3E8OA 3BQ0A 2P9CA 1H73A 2DPIA 1EZZB 3W5ZA 2XCPA 2DVIA 1AT1B 2K7KA 5E5NA 5KFJA 1M5KC 4WKRA 1H98A 4NXMJ 3CJ2A 3DLEB 5EX0A 5DQIA 1UMJA 1RLCL 4CLSA 1J27A 1J2VA 2XYHB 1S5ZA 2IA6A 3HSZA 2KRRA 2LDIA 3T1YF 3QATA 3MPVA 1FWLA 1X31C 1U6BA 3UR0A 3FFIB 3M8RA 1RB0A 2YNIB 3OQ2A 2BJ7A 3C14B 4PEOA 3JYTA 3EMTA 2VQFJ 3T1YJ 1T0TV 1KTVA 4I2PA 2KG1A 5F9LA 2J0XA 2CG4A 2WK4A 4FBTA 1U48A 2YWEA 2HG4A 2DGSA 5D4PA 4ID8A 1SIWB 4P2MA 1UVNA 4NASA 3MCNA 3PV8A 4QIGA 2HHPA 1M5PC 2ZE2B 3MM7A 2OI2A 3LGHA 3J80U 2AGPA 3OTBA 3UN3A 4OIXA 4U7UD 3IWNC 3UNYA 1UW4A 1EARA 2QTWA 4QR0A 4X66J 2D3UA 2I9SA 2AW0A 2KXFA 2J6UA 1T3OA 1IR0A 3M32A 3R5DA 5KG3A 4JI5J 4LR8A 4RBUA 3KK3A 2HGNA 3RRGA 2XMJA 5BYSA 2CQIA 5L9NA 1MWYA 1LK7A 4Q0BA 4ED1A 1FK9B 1EB0A 1I5OB 3AOBA 1U6FA 3BM7A 3AD8C 2GVZA 3SV3A 1HNVB 2MY8A 2O01C 1B99A 3MPWA 1XMOJ 3D9BA 2ATCB 4B08A 4QIVA 3DYAA 4DU7A 1HHTP 4DSJA 4F36A 1KC8T 1WC6A 2QFJA 5L8RC 4FXVA 4YR2A 1QE1A 2GVDB 1U0HB 1URRA 1LOUA 1D9FA 2B6AA 2KVQE 3IC1A 5E2QA 2RF2A 1KP6A 1R27B 2VV5A 1G1XA 3OL9A 4ZPWR 5J1EA 3H4DA 1BXNA 3RG6A 3M6VA 4KSEB 1RYSA 2UU9J 5E3RA 2MGZA 4KKOA 2JZ8A 2KHDA 1FT8A 3KLIA 2GX8A 5C42A 4NLSA 1URNA 1QUVA 2CPXA 2OSRA 4F26A 3HHNB 1T03A 4ZPBA 5KG0A 1WWHA 2FHJA 1B0VA 2L3MA 2HEKA 1WC3A 4WE1A 2HFSA 2YKMB 2DH9A 3CCSS 4J9KA 2PMZD 2V94A 4ZCIA 3UN2A 5GAEU 1RWNB 3DI6B 1KQKA 2IM3A 3LUYA 4I2QB 3VCDA 5KFBA 4MFBB 1OY9A 3OTDA 1A0OB 2XMAA 2HFVA 3ILIA 4OHZA 2WONB 3A4TA 5GAGU 1KS2A 2HWTA 1WF2A 1TK0A 4W98A 3PTWA 5KTQA 2DHHA 1JLGA 3PO5A 1EQ0A 4FXWA 1MMLA 1LW2B 3CULA 1UPMB 3KJVB 2F5GA 3T5JA 4LSNB 3HT0A 4RR5A 1FKAF 4WTOB 4IFVA 1EP4A 2YKAA 2E7XA 4USTA 3ZTOA 4K4WA 4MIBA 4DL0C 3JTNA 2E1PA 2QA2A 4U6PA 2VG7A 2QSFA 2MQLA 1PJ6A 1REGX 4EYIB 4IR9A 2M88A 2V8HA 1HIYA 4F3QA 3IP0A 4ZOSA 2IMOA 3KUHA 4K8RA 1HLWA 2CQ1A 4K7QA 4ZPTR 1K0TA 2J76E 3CTRA 4ZCLA 3PRDA 3FEZA 5D0RA 5T7LB 3R5BA 4C98A 3P8BB 2V8PA 3CDEA 2FUG9 1OQ3A 3GR0A 3MR3A 1Q95G 2OGUA 3TZYA 1Z4UA 3T5KA 4AL7A 3D1OA 2ZC3A 4DR5F 3BZQA 4DDFA 2QGFB 4ZITA 3QQCD 5KOWA 4A8WA 1NZAA 3GIKA 5KG6A 2RHQB 3MM9A 1HR0F 4LF5F 2ZUGA 5F9NA 3IAS9 4ES2A 1PCAA 2LQ5A 5E3PA 1S12A 3W5YA 4EK2A 4DR5J 4X4PA 5K14A 4EBDA 4Y65A 1R0AB 4NXNJ 5IM0A 4HACA 2G0JA 3IRXB 1SC1B 2XSJB 3W65A 1VK8A 2Y0SD 1CJTB 2ZBCA 4QQBA 5DG9A 2G2OA 4ZLJA 2WAQD 1K9MT 3NAIA 3I55S 5LSLA 1N32F 3KG4A 4LBPA 1KVIA 5HJYA 1MNEA 1W7WA 4NZ0A 4I7FB 2N3LA 3CJ0A 1YI2S 3D1HA 2QJ3A 3NNCA 3CDWA 1FEHA 1B64A 5MLCV 3I96A 5IC6B 2K1RB 4NRTA 3BGOP 3BBFA 3D3BJ 1IKWB 2C3PA 4K59A 3LF0A 3EGVA 5LMNF 1GQEA 2DB1A 1EJ7L 1FXRA 2EWHA 1SPBP 1TKXB 2Q1LA 3DU5A 4CQ1A 5A8KB 3MM8B 4M5JA 2IM2A 2C2OB 1VQ9S 4M1KA 2IC3B 1DRZA 2CJKA 3CIMA 3F0NA 5KFIA 3D28A 5E0OA 1X4FA 1XERA 2O67A 1SV5B 4OHVA 3OUYA 1S10A 4ER8A 4M5NA 5CYMB 1BQMA 3ZTPA 3V81A 2DGQA 3ITHB 4G3IA 2EBGA 2OLWA 2V0NA 9ATCB 4OYOA 2HWHA 3GIMA 3KTQA 3HD1A 3QGGA 2BQ3A 3QJLA 1CQNA 2DNYA 1RHUB 1X7VA 2F4VF 3TYTA 2K3IA 3HSGA 2W7PA 1MG7A 3ZZZA 1CJUB 1OPIA 2W7AA 2PA8D 3AXMA 3U1LA 2EFPA 2XYPB 1ACMB 4A4JA 5I42B 1NHKL 1Q4RA 5KFHA 2D41A 5KT4A 3L7OA 1Q8LA 4J9VA 3MM6B 2DR5A 5B0BA 1S9GB 2BUNA 3H4BA 1NK4A 4FKYA 1X4GA 1UFWA 3KHLA 3SZ2A 2YH0A 1YTYA 3CCMS 3T9NA 1X4DA 1FESA 3M05A 4B9NA 3QAUA 4PXDA 3P5BP 3OR1B 1JX4A 1VIOA 4PQUA 2LXIA 2KJVA 4J90A 2GMHA 4USUA 3A8IA 2VU5A 6FDRA 2HNZB 1QAIA 2PT0A 2CPYA 4CTAA 2C2MB 3IBWA 3MMCB 4X4NA 3PR5B 2KG0A 1E6VA 3NS7B 2LQ9A 2ZKTA 2XMTA 1BWVA 3H7HB 1M5HA 3SQGB 3HM9A 4JI3F 3ZTSA 3DDIA 3W66A 4WZMA 1M1GA 5F0UA 1R89A 1RTHA 4CLZA 1YK9A 1T95A 3AD9C 4OX9F 3N4WA 2HBYB 2F8MA 1N0UA 1S1VA 4JI3J 2B7BB 3HKWA 3M2UB 4LFCJ 1B0PA 1U8SA 3MCMA 5K5MA 4C7QA 2MQOA 1KDNA 2XMVA 1A6LA 4NI2A 1C0TA 5D8HB 2DY1A 4AQYJ 4PG4A 4PG7A 1FVSA 5GAEI 2HNDA 3DC2A 2AJ2A 1SC3B 3QWPA 3TR5A 2ZITA 1CS4B 3EPGA 3BGUA 1GEHA 5D0EA 4RNMA 4ZLLA 4OLOA 1GX6A 4C8KA 4ZHRB 2WVCA 4HLBA 5F8JA 2K3KA 2ALZA 1IKXA 1N5YB 1HNXF 5GAGI 2POKA 1FJGJ 4ALZA 4QIEA 2CQ2A 5DJBA 2HW3A 4Y34A 1FNMA 1YRTA 2EFOA 2B0GA 4TXSA 4MKBA 2E1CA 3FZ2A 1MWQA 3N28A 2LMIA 4JP8A 1WHVA 5L1LA 1VFJA 3I5BA 1SH0A 2KH9A 2ASYA 3O6QA 4M94A 1ZOTA 5MAOA 4NLDA 2ABYA 3ENWA 3J81Y 1ZA1B 4DL6A 1TQLA 2B8QA 2V2ZA 1WC5A 5DM6Q 1SJRA 2KVIA 3HLUA 3R1HA 1KSPA 4I67A 1JK9B 5KFLA 1N33F 4K5RA 1YKWA 1SQGA 1NZ8A 3M6WA 3CC2S 1FRJA 3MM5B 3MMAA 3PR4A 2VPYB 4K4VA 1C1CA 4H54A 2YH1A 2R2TA 4USVA 4MKVA 1GMVA 2NLWA 1RT5A 3VAFA 4G1IA 3TRGA 1N33J 1DLOB 3W62A 1CSJA 3BB5A 2V4JA 4B3OA 2VQEF 4DL5A 4DCJB 3DRSB 3HX9A 3A8KA 4LVNP 1RISA 3OFGA 2E1MC 4K5SA 4XK8C 1WSRA 3VAKA 1TZ0A 3DM2B 1CJVA 3T6BA 2JRRA 1ELOA 2GW8A 3CMAS 3H25A 1FX4A 2NZCA 4QW8A 4LSZB 4N76A 2DGWA 1JLAA 1N4LA 1H7XA 3MEGA 3POTA 4I6YA 4DFPA 4QPTA 2ZH1A 1U1LA 2B4OA 4L75A 4CLWA 1EETB 4IO9Q 3MOJB 2KTQA 2E9ZA 2RSQA 1V5IB 2NSBA 2MQ8A 1KQGB 3DOLA 3FCHA 4LUBA 2FJEB 1F5CA 3C15B 3ADAC 3I0SA 4ZPVR 2CPHA 1FWPA 2BZ2A 5B08A 2OPSB 2DTJA 3QNWB 2VA2A 4L74A 4ZK7M 3EX7B 3JB9k 1LWCB 4RW7A 3CT9A 3M8PB 4OYIA 5CABA 3S8SA 3K59A 3IBCB 4O44B 4TU7A 2ROEA 1RA7A 3V5RA 1Y11A 4R5PB 4DHVA 3D6MB 3QRRA 2SXLA 1HPZA 3I38A 4GKJJ 5GMEA 3A3OB 2ZDOA 2DNOA 4OYWA 3ZTQA 4ZVQB 2IMWP 4E2FB 4LSLB 3V6KA 3OJSA 2R8HA 1NK5A 3QZ8A 2DR6A 2CWKA 1WUUA 4PG6A 1CJKA 2GGPA 1PGZA 2YKQA 2IIHA 1NCLA 4F67A 2Z2ZA 4YB6A 3DKDA 4O23A 1IVZA 1NEEA 1GMWA 2IM1A 4ZP6A 3PHEA 2DKOB 2IVMA 2JHEA 3U1NA 4ZVFA 4OL8A 2R8GA 4DF4A 2R7OA 3Q8RB 4JI0F 3AQPA 3AOAA 3G6VA 4KHPF 2Z4PA 4J7CA 3R5CA 3W7BA 3NGTA 4JI6J 1BMQB 5J2PB 1XR7A 3RGIA 5D0GA 3S7RA 4JI0J 1Q8BA 2NREA 4DL4A 5CYQB 1M5SA 3M30A 2CVIA 4YP3A 4H4OB 2A2DA 2R7TA 3RJMB 2CA9A 3DMJA 4JI1F 2QG9B 1KLMB 3Q22A 1G6BA 3D3CJ 2RQKA 3I9ZA 2Y8WA 1IBCB 1RI7A 5B0EA 4PWUA 1FFWB 2R3VA 1IJEB 1I3OB 4N56A 3DDKA 4JI1J 3O1LA 1YBUA 5HATA 2H54B 4O3OA 2KM8C 3CD0A 2M2BA 1WORA 2V8DA 3KFWX 4D3GA 3P45B 3G86A 4M5MA 2J5AA 2Z0GA 3T19A 4CT8A 1K44A 5IV4A 1VQSA 2XMMA 2HQDA 2W1BA 1NPKA 3CJ3A 5JUMA 2HBQB 2HIYA 2IFXA 4MKAA 5LJ3Y 1UWBA 5K8OA 3B78A 4DQRA 4OZ1A 4LF7F 3BS9A 5L1JA 4KB7A 2E5GA 2FC9A 4BCAA 4USWA 4U7UK 5KT7A 4MK7A 3FBBA 4DOZA 4LF7J 3UD3P 5HJXA 4QYZK 4C8MA 2CAJA 3LGMA 2Q6CA 2ZHBA 1DARA 2VPXB 2DEJA 2A1BA 4RBTA 3RBZA 1WOSA 1UVJA 3AODA 2MJNA 1IBLJ 1JJCB 3AY0A 1SI9A 4PQAA 4OZJA 4LRBA 4DV3J 4NLVA 3HCXA 4QWCA 5KFWA 1OY8A 2GV1A 1S72S 4OJGA 4ECZA 3F73A 2NQPA 2FY1A 2HFUA 2ZHOA 2L9NA 3V2UC 4I68A 3ZNJ1 2JNJA 2L48A 2KM8B 3I31A 4DZ6A 1IJFB 1OMSA 2QFIA 3OW2R 1SJ3P 3IM9A 1MSWD 3PW4A 2FDNA 2NUUG 4A8SA 2JLEA 4ILRA 4IFYB 4ZPDA 1MROA 1N48A 2Q2GA 1OYDA 3BH7B 3KNAA 2VBWA 4F0KA 4DV5J 2RUGA 2PA3A 2FZCB 1GT8A 1DY3A 5I4MA 2MKIA 1NSAA 4KJIA 3C19A 1SXLA 4URGA 5BYRA 3DXSX 1GH8A 2VD3A 3GB0A 4AYBD 3L09A 2E5JA 4ZPAA 2W2MP 2KT2A 3H42A 2RH3A 1OO0B 3DLEA 3AJ2A 1G3OA 2HZCA 3BEGB 1K73T 3K57A 1Z2LA 4AXIA 2R9LA 3DNCA 3CC4S 5H1SV 3GJSB 5D4NA 4KV8B 3CD5A 1AUDA 2YNIA 1T9XA 3EJMA 3NBPB 4KGZB 2UVRA 2Q43A 1B3TA 3C14A 4KRWA 1RAEB 3GTYX 1ZH5A 2AT1B 1MMNA 3M4XA 2HFNA 2UUCJ 1RWOB 4OJ3A 4NA3A 4KY3A 2AV5A 3BN7A 2QMUB 2W8KA 3KG0A 2CQHA 3UDVA 3T5HA 2OO4A 1UFLA 3HZEA 4ZP8A 3OJUA 3RBDA 2AWZA 3FMWA 3B4MA 2NYHA 4RUBA 4O0IA 4J9RA 4LFBF 5HBMB 3K8VA 2JOQA 2HQIA 3I9V9 2ZE2A 1WOOA 3NRBA 1S1TB 2RAQA 2XZDB 2NYIA 2I38A 4RX6A 3NCQA 3CB4A 1SBRA 1NK6A 2UXDJ 3QWUA 4O3SA 1TFYA 1Q5YA 4ZCKA 2HLTA 2HNYB 4UF4A 5DDOC 1U09A 4KGVB 2FVQA 3NGSA 3LQVA 2DR7A 4RUHA 1VQLS 3NY0A 4KFBB 5HQ8A 1FK9A 1T9WA 3HF5A 4AD6A 3GG0A 2RE1A 3W63A 4DR6F 2CJQA 3O5TB 2VL1A 1ZETA 3UW1A 1HNVA 2H4WB 4IDKB 1UJ5A 2BJ3A 4B9VA 1HMVB 3A8EA 3W8PA 1QUPA 3BGFA 4FP9A 3OSNA 2J8AA 2WBRA 4DR6J 2GVDA 4YOEA 3DLGB 1O0PA 1WI8A 1UTAA 2FLOA 1GNKA 2XULA 2CZ4A 2IAJA 2OFGX 2VOOA 3CSKA 1XK8A 3RZAA 2HRYA 4JV2A 2EC2A 3JSMB 1VQPS 1P1LA 1FE4A 4OI4A 4RPFA 3D6HB 1QSSA 1FO1A 1XTZA 4NLYA 3PIPQ 3IAM9 4M5DA 3TNVA 4IOBA 4FF2A 2LU2A 4QWBA 5D3GA 3Q8PB 4YB7A 3R7NB 2BW7A 2YKMA 3TAPA 3CEDA 4I1TA 4C6AA 1N5SA 5FLXY 4MH8A 4KAIA 3EPIA 3LW5C 2FGOA 3DI6A 2QZ8A 3R27A 2M70A 1ROFA 4I2QA 5J2MA 3MECA 4MFBA 3U7JA 1NAQA 2DXFA 2EK6A 3MR5A 2FJXA 1NU4A 2HAIA 1VI7A 2V8VA 3FZBA 3GQCA 5CYJA 1KOOA 2D9PA 1Y9OA 2YNHA 2JWNA 1HQEB 5H9EK 3K17A 1JLBA 1VRTB 2CFXA 4C3MA 4CH0S 4J9QA 2GMJA 1PIEA 3R7BB 1UZHA 1LW2A 1B7FA 2ZH7A 3V4MA 2WRMA 1H0HB 3KJVA 4QOTA 2UUAF 3GYNA 4M95A 4LSNA 1S6UA 4ZKAA 2GNKA 5J1NA 4RZRA 1CC7A 4PWWA 3MDFA 3AA9A 4C2MA 2COLA 4LIRA 4LF8J 3P4UB 3EXCX 3T5LA 2H65B 3CMQA 2BA9A 2F65A 4NZ6A 3O3LA 3F41A 5AXNA 2LLZA 9RUBA 2V4QA 3GFXA 5T7LA 4BC9A 2FB0A 4RLEA 1BQNB 3CJTA 2HHUA 4HEA9 4RL1A 4KIAA 3IG1B 5KOXA 1WHWA 3M6XA 4PXCA 4U9RA 2DO4A 1RP5A 3PM9A 3ZFVA 4O3NA 5EHHA 2YNGB 1LV5A 2KU7A 1G4CA 3L9ZA 2JZ5A 2VC1A 3Q23A 4DS4A 3Q24A 4WFXA 3I5CA 3VQTA 4IH7A 1IXKA 1WDDA 2GQQA 3EXYA 4ZP7A 2GQCA 3LTOA 5CH7B 3ISND 5HSPA 1YJNS 2OPRB 3M1VB 1NXIA 4OYBA 2FPHX 2BXJA 3NGRA 3A13A 3SI8A 3UDCA 2DNZA 3IRXA 2DPJA 3D4JA 1FRXA 2XSJA 2PIIA 4NA1A 2B5JB 1NLKL 1CJTA 4NZ7A 1NDPA 1S7HA 3T1HF 3I0RB 2UP1A 4NCBA 4HL9A 3N9UC 3IO1A 4ED2A 4HDGA 5KFGA 1NHUA 4I7FA 2OTJS 3T1HJ 4HHUA 4YMEA 2K1RA 3B6BA 2PFFB 3SDEB 2BANA 1S1XB 2LYVA 4DFJA 4IQMA 2F8EX 2CADA 1FJ7A 3NS6A 5A8KA 3OTEA 4HVZA 3MM8A 4CLKA 4K4SA 4B3RF 3PDNA 3M8WA 5E33A 4DR7J 3ZZTA 3GPAA 2J6TA 3C16A 1KFDA 3LA0A 1X60A 2MJUA 1L3TA 4DV2F 2D3ZA 3CJ8A 3UWTA 3CCES 5DG7A 5KFOA 5IXUA 4OZ3A 3Q83A 2QLJB 1SV5A 3JAMY 1RKIA 2VJVA 3TW0A 5CYMA 2LEPA 4ZVOB 4C3LA 3NP5A 1C3GA 3CCJS 1NK8A 4OJ1A 5HMWA 3ITHA 4DR2F 4DV2J 1YZ6A 3CUNA 4DL2A 3ENAA 3MMJA 1CBKA 1F0XA 4A8FA 2H4YB 4DFKA 3DHXA 4DN0A 5KFVA 4F50A 5DLGA 2GHWA 5AXLA 5J2NA 1FFGB 4Z37A 2DRBA 3KLFB 7AT1B 4O3RA 5GAHU 1N52B 4E0DA 3KK2A 2LKZA 2ZVSA 3TVZA 2W7OA 3R2DJ 4DX6A 3VGTA 4LT6A 2CNOB 2DH7A 2E9TA 2HLUA 5I42A 1ZAVA 1DTQB 2C2NA 3CCZA 3NCRA 4CP5A 5A76A 1YQHA 1JNRB 5ETOA 3MM6A 3PACA 4NX9A 4LF9F 1WC1A 2IJRA 1UL3A 4NEYA 4J9NA 4EU0A 2IY5B 1TMJA 5HMXA 1S1UB 2F9DA 2NCKL 3GJTB 4R0JA 3GIRA 3RYLA 1VRQC 1H6KX 1ULRA 5IQQA 4WU3A 4C4WA 2H5JB 1JIHA 4K4TA 1PC5A 1HQUB 5EWGA 2UVUA 2CJBA 1U7LA 2XC9A 2XLJA 2HNZA 2OELA 2R8KA 1ZTTA 3MMCA 4TKTA 4ED8A 1C2PA 5F8MA 4JI8J 1C1BB 2HVEA 1NO8A 2BABA 2KKHA 2ZD1A 3MR7A 3O44A 3CCTA 4GVLA 3OV7A 2KRBA 1F5AA 5HO4A 5T14A 4JV5F 1RAGB 3LALA 3MAHA 3VR1A 4HYKA 1VC0A 4PUOB 3MHYA 1LNQA 1TUWA 5L1IA 4L76A 1WOPA 3UPFA 2Z56B 2K06A 3UCUP 3M2UA 3ETMA 5ETPA 1ZM9A 4JV5J 2CZ9A 3C66A 3QT8A 2VG6B 4WPAA 2OAUA 2FVCA 1VHFA 4ECUA 2MLYA 3US5A 1U2CA 2OFHX 1QJHA 1U47A 4L73A 2J9DA 1VRUB 2ZH2A 5IT9Y 3W2WA 2CUYA 1SC6A 1CS4A 3HP6A 3H98A 4LR9A 3BPSP 5LMUF 4H4MB 1HBMB 1S6OA 3QRQA 1S1WB 3GJQB 3R3TA 4ZHRA 2ZZMA 2BQUA 1N5YA 1RUSA 5KFXA 8AT1B 4ZIWA 2GIFA 5F3ZA 2MTLA 4B9SA 1RT3B 1S9EB 3QSYB 1S7IA 1KWMA 3DRRA 2FJDB 2R7VA 2FLNA 2VKZG 2VIHA 1D1UA 3CD7A 2XLKA 2FZGB 1HBOB 3WIUA 3PYDA 4DMZA 1MN7A 3TI0A 4ZMMA 4C8OA 4NPOA 2UUWA 3G4SS 3BGLA 2ZJPQ 5D15A 4JB8B 1PJ5A 1DQ9A 2IBOA 3HSJA 2M9KA 2DYAA 1IM6A 1LWFA 2VFVA 2GS8A 3GONA 1DQ8A 2W2OP 2QIFA 4NRUA 1RT4B 3MM5A 1RT2B 2VOPA 4WU2A 2YX1A 4N47A 2AEMA 4WZQA 1F9FA 2WVDA 1R43A 1DLOA 3MUTP 3J81U 1RK8A 2GHVC 2I5JB 2DGTA 1C4AA 1WNEA 2V5HG 4DL3A 1FJEB 2V50A 4DS5A 3DRSA 2R42A 5CAAA 5LSOA 1T11A 3SMZA 2XB2D 5KFDA 4IRDA 3V6DB 1NK9A 4KPYA 1QM9A 3DM2A 2XY5A 2F7VA 2E1RA 3FCVA 2LP4A 5KFMA 3BQ1A 1P9QC 4JOUA 5LXYA 5E3CA 1R31A 2RKIB 1RU2A 3BQ2A 2HVZA 1JLFA 2LDYA 3OTOJ 1EETA 2DNHA 3AGXA 4ECTA 2DGUA 2VH7A 3SIPB 4UQGA 1MN9A 2V68A 2CZVC 3MCOA 4YB1P 3QT7A 2XMWA 1T9YA 4ID5A 4HDHA 1YJWS 3C15A 1SKWA 1PSDA 1OQ6A 2XMUA 2OPSA 5DQGA 4J5OA 1LWCA 1RYRA 2NPIA 4M8LA 1I51B 1FVQA 2VBXA 2Z57B 2A3JA 3H20A 2ASLA 1WKKA 4KO0B 4PXBA 2CPDA 2G4BA 3U27A 4TQRA 4G65A 1O8BA 3V6HA 3D1QA 5D6GA 1RWUA 4CLYA 1VQOS 3R9LA 4CWBA 1RWKB 4JI7J 3VZHA 2QLFB 2QYGA 4GRSA 3BH6B 5JXSA 2ZHAA 1JWWA 4LSLA 3PYFA 1X5TA 1VGYA 1HBUA 4P72A 4YS2A 4WP3A 1WD6A 3BO2A 1F6TA 1S49A 2W4CA 4OZ2A 2VG5B 3QO9B 1H38A 4B9TA 3PXGa 1UVMA 4B3TF 1J5OB 3FQLA 1JKHA 2CQ0A 1Z2ZA 2IPOB 4RO0A 2HS0A 3DXBA 2C3UA 3MFHA 3EM1A 1IBMF 3GSIA 1NJZA 2IM0A 1HI1A 2ZDPA 3GMGA 4B3TJ 1YJVA 4DR4F 3CPWR 5I3QA 1BQXA 4NCAA 5GAHI 2GQ2A 2EVZA 2VDIA 5CYQA 4RU2A 2ZC4A 3ZZ0A 2RQCA 1FKPB 2YX7A 4RW8A 2MHNA 1HYSB 3MMBB 3QIPA 4B9UA 4WJBA 2JEJA 3BBBA 2DITA 1Q8KA 4JI4J 1R6YA 4DQPA 5KT6A 2OEJA 5CA5A 2ZBQA 2EW9A 4ED3A 3PFEA 3TZWA 5CZVA 4BC7A 5EWFA 2BRKA 3TAMA 3VGUA 4X62F 2GHPA 2C2DA 5L39A 1VJQA 3S6EA 3RRKA 3RR7A 1I94F 1Y5LB 2CPFA 4I0WA 2N3OA 1JLQB 4NYOA 1TVRB 1FRIA 4X62J 1JJ4A 4F25A 1YX2A 4FNIA 2BBEA 3AGYA 1JQGA 1AXQA 1XMBA 3TZZA 4OHXA 2YKPA 5FDLA 1I94J 1VQNS 3EUNA 2Z2LA 3TANA 2H5EA 1VMBA 2IJNA 3JYTB 2MXYA 2W25A 4LFAJ 1Q82T 4NL5A 5C25B 1FHTA 1S59A 5DRKA 4LRDA 1G7CB 2YQ0A 3U1MA 1D8ZA 4HHHA 4ECQA 1KD1T 5ETQA 2AYMA 2MKSA 2MLZA 4RUCA 4FNHA 2XWXA 5HMYA 2YVSA 2PN6A 3HPOA 3HVWA 1Q1KA 2MMYA 5A0YB 2XGQA 4X4VA 3KJNB 3N5FA 2FGCA 3TX8A 3DLJA 3VALA 3QRPA 1FRLA 5JVHQ 2C28A 4M5GA 3C5XC 3M6UA 2KN4A 2F63A 1F9EB 2G2ZA 3X3UA 4FN5A 2HS4A 3KK3B 4ICLB 3J7A1 3CDBA 1TL1B 4LQ3A 2R2UA 3M7VA 3G82A 1VCTA 4WFYA 2GVZB 1JXVA 4F8RA 3MOZA 5DDQC 1PYTA 4TQSA 3EGNA 4OHWA 1HD1A 1D9DA 3DRXA 3DYAB 2XI3A 4GMKA 4C8YA 2DXDA 2CQBA 4XTTA 4IG0B 1HARA 3J7Z5 3QJJA 2R7QA 3TARA 1RWPB 4C3KA 2X1AA 4RWWA 2FHJD 3O2IA 5J1EB 3Q0AA 1WG5A 1BE4A 2WSFC 1TV6B 1N8RT 1H3DA 1VLYA 2J0QD 1PO6A 4NYPA 3WC0A 2K2PA 1ZYQA 1TFWA 2LU1A 1CULA 1RWWB 1RT1A 2XNQA 3KLIB 2IRXA 2IBKA 5C42B 2YTCA 3EVWA 2VC0A 2HURA 5A8WA 2ZOFA 3CJRA 4TVAB 2V9WA 4QCLA 3DHWC 4MAKA 4DSIA 3Q86A 2Y9HA 1RE1B 1UETA 4WE1B 1L3SA 2HQCA 2GO8A 2AYGA 4A46A 4Y6IA 3GV7B 4K0KJ 2BE9B 2F4FA 2C1EB 2ZNZA 4M5KA 3MAAB 2CNLB 4EBEA 3R1LA 3TOQA 4PR6A 4OJHA 2BOAA 4AT1B 5DETA 3CO9A 1S77D 1TL7B 3FQKA 4QR1A 4DUYF 3HXMA 1JLCB 4PPDA 3AT1B 5I3UB 2VFSA 2KYZA 2AJ1A 1RHJB 5CD4A 2IDLA 4MYUA 5I3PA 2NXJA 2DHGA 3BPDA 1S1TA 2BM1A 1QAJA 2VKRA 4OX6A 1N0VC 2QA4G 4NYZA 5K20B 1TK5A 2KYXA 4C8NA 2VBYA 4CH1A 2HNYA 3PVXA 1X4BA 3KLEB 1K1SA 4FS1A 3QFHA 2MY7A 5SZTA 2Z8QA 1GK8A 2CPIA 5IT0A 2B9YA 3CJQA 4HTJA 4TY9A 4A47A 3TA0A 1FRKA 1Q78A 1HL6A 3IS9B 4LMZA 4IUFA 1X4HA 4IDKA 4MIWA 1H2VZ 2GC8A 2G9OA 2AJ0A 3IGVA 4ZVUB 2OEKA 1HMVA 2MQNA 2P6SA 3G6YA 2DGXA 1ZTWA 2OD4A 2DNKA 4A8MP 1KLNA 3DLGA 4J9MA 2IHR1 3GZ7A 4ZA1A 3WZ0A 3MUVP 4UZBA 2QLWA 2N4DA 1E6YB 5B7WA 1RT6B 1VC5A 4AXJA 2BJEA 1HW8A 4Q5VA 3J7ZT 3PHTA 2I0XA 1XR5A 2XS2A 1SUQB 2HQ3A 3FGVA 1UPPA 4RW4A 2VA3A 3MM9B 1M5OC 3W3SA 2A18A 3NOGA 2NUHA 1NH8A 3HZGA 4C8ZA 5K14B 3WDOA 1TKTA 5IC4B 4B3SF 1DAXA 5IM0B 4OYAA 2RQ4A 2CQCA 3MURP 5A8RB 2HYIB 3PYEA 1Y7PA 2KXNB 3OXLA 3TUPA 2ACMA 5KG2A 3GV5B 5AJ3F 3TJ9A 4DR1F 2FY8A 1L5UA 4B3SJ 2FVPA 3PW5A 1JXEA 4EWTA 4DFMA 4P52A 3A8JA 1OPZA 1GXTA 2E5HA 4DX8H 2R2RA 4JI2F 3V6JA 4S0MA 3HFZB 2JFDA 1H72C 3HVTB 2HBRB 2CJ9A 4HT5A 2FLLA 2UXCF 3K2YA 3NG8A 1VRTA 2GO9A 3CJKB 3SCIE 3C6EC 3OFHA 1JB0C 4KT0C 4JI2J 2GFFA 5FLXU 2W4PA 1SL1A 2XM3A 2KJWA 3VAMA 2ASDA 1NPPA 4EYHB 2AMCB 4OX7A 4NMLA 3MGJA 4LVOP 4U8YA 3OT9A 4X2BA 2OP5A 1B70B 1X5PA 3FUYA 1QTMA 3DU6A 2P2CB 5LOQA 1GMUA 3H59A 3NOCA 4ECYA 2Z2YB 4CNYA 3OUYB 3M9NB 2VF3A 1BQMB 5BYQA 1UA0A 5CXTA 2XO7A 4ZJQA 1TL4A 3TAQA 5ETKA 4TYBA 5KFTA 1H2UX 3CVKA 4CCHA 4WXOA 4FYDA 4GKKF 2AYEA 1YDLA 2M3DA 2CYYA 5H9FK 2LECA 1RAAB 2E66A 5DDPC 4QWEA 3T41A 5ETNA 3A3PB 1CQMA 4P10A 4GKKJ 2OSQA 1D3WA 3HULA 4O3QA 3BKUA 5ETVA 1TKZB 2PEBA 5L1KA 3RRHA 2C2RA 4RBVA 2AGOA 2EFNA 3VAHA 4DQQA 3K5NA 3MPYA 4LIWA 1S57A 3I6PA 3LP2B 4DX5A 3NEKA 5HLFB 1ITPA 1EX8A 2LQBA 3AJDA 2RVJA 1U24A 3M1VA 3IWLA 4Y00A 1N6QB 5D77A 3HHKA 1GXLA 2J7KA 2DNRA 3QZ7A 3R5JB 2G1HA 5EUHA 2P5VA 5K9FA 2KT3A 2B5JA 2E1AA 4KGXB 3FSXA 4Z7CA 1HNZF 2D7SA 3FBFA 1UW9A 2HBZB 4WXWA 4ZVSB 3G6ES 2QL9B 3M2VB 3I0RA 3JTOA 2CKWA 3FSYA 2OHDA 4KQZA 1G2EA 2W8LA 4NCGB 3MR6A 1HNZJ 1X0PA 1RACB 3ZXWA 2DISA 3BJYA 1JLEB 4YR0A 4RJVA 3LAMA 3RAXA 4USKA 1RTDA 3SDEA 1S1XA 2JJ4D 1Q16B 5JMNA 1HR0J 4DQIA 4LF5J 4CLPA 1ICEB 3BREA 1QSLA 1VQYA 3MPUB 4ERDA 2E9RX 1SKRA 4PABA 4ZJLA 1C0TB 3A1YG 1MU2B 3HT3A 2CPJA 3DLLQ 2FQQB 3QPIA 1N32J 4Y3CA 5GMDA 2E7WA 2ADCA 4I69A 2HSEB 1LFPA 3FDSA 4QIFA 3AH6A 2P6TA 3AA8A 3TP2A 3PX4A 4CO2A 4U96A 4Z7YA 1IKVA 1C0UB 3PIOQ 1D0EA 3P49B 2V9KA 5LMNJ 1IWGA 1AROP 5ITHA 1WJ9A 1ZM2A 4DV0F 3C3LA 3HSDA 3R6GB 4OI6A 4XPEA 4IOAQ 5HK4A 2HVIA 4XO0A 4LRFA 1NMEB 3JAMU 1TUGB 4LBHA 4P2FA 2ZBPA 3IWXA 1GFWB 1DTQA 1SJQA 3KG1A 5EDWA 1NKCA 3HMJG 1NDCA 2D74B 3GU0A 1JJ2R 3M2RB 1RTIA 1WACA 1KR4A 1LKZA 4FXDA 3HFKA 3SV4A 2XBPA 3LH2S 4R8UB 1S1UA 2EPIA 1T3NA 1S6PA 3OR2B 3HD2A 1Q7LB 4MTPA 2CQ4A 3MMAB 3GFYA 1AZSB 1C1CB 1F3VA 4EGLA 3MTJA 2IRUA 4DR3F 2W9BB 2R4FA 2J8SA 1N5VA 1HQUA 4B17A 3CDUA 2J7WA 2F4VJ 3NMRA 3WBZA 2V4JB 4B3OB 2DNLA 4CO4A 4OI1A 4ITSA 1C1BA 3K8WA 4ED6A 4DR3J 1UFKA 2CDRB 2QA1A 1FCAA 2JEIA 4XDDA 2J9CA 3H8YA 4PUOA 4EO6A 1WI6A 5KFNA 1IBKF 2N82B 3MEGB 3POTB 3W9IA 5AT1B 1VQ4S 3KHGA 2AJFE 4AL5A 4HT7A 2VG6A 2AZ1A 4ZVTB 2ACYA 4NLQA 4O0NA 4L6V3 2NR0A 3DOLB 1T8EA 1PYSB 4N7TA 4Y2CA 4PCQA 2RS2A 1N36F 2UXBF 4QBUA 2X3GA 1NM2A 3VVUA 2M7SA 2HMIA 3LOUA 3TQEA 4RW7B 3VAIA 1HBMA 1S1WA 5J1PA 2W01A 1LWEA 4DU8A 2DXEA 1M1KT 4J9LA 1IUJA 4P71A 4OX9J 1GMWD 2QE5A 3RB4A 1HWJA 1TAQA 4DZDA 3DGPB 3QAEA 2BQRA 2WOMA 1NDLA 4AL6A 1DJ0A 2WZ1A 5IT9U 3IA0A 1HBOA 3G87A 3AQOA 3E2EA 1UEKA 2WW8A 3ELHA 4OZ0A 3HVRA 1HD0A 2HFZA 1NRKA 2V34A 3BKFA 2GGPB 2W2NP 1U26A 4Y28C 4DV1F 2JL9A 4KPCA 4N5SA 4DI6A 2JLGA 3PKYA 4DLEA 5HROB 2NXCA 1CLFA 2ILZA 4BWMA 2YWGA 2YQ3A 1VK3A 2PMHA 4BDPA 5E7OB 1RT4A 1HNXJ 3RUBL 2ZWOA 1RT2A 3QT5A 2OTLS 1YJUA 3JXOA 1IKYB 5IZHA 1N56A 1R8PA 4KH1B 3CDAA 2ROGA 4DV7F 1NNDA 2I5JA 2BKNA 3KWMA 4W4MA 2QLBB 3KNGA 3H5YA 2D3OR 3I82A 4USJC 1RTJA 1NK0A 5DGBA 4F0HA 4AE5A 4UQTA 1HWLA 3V6DA 4DV7J 1J5EF 4UZCA 4BWJA 2DGOA 4NMXA 4K4XA 1FKOB 1X9MA 3ULHA 5KFFA 1DBDA 1NPRA 4CNZA 3UVJB 4ES3A 2F1FA 1H2TZ 2VASA 4C0OC 3H90A 4NLPA 2RKIA 4FKXA 3CIZA 1J5EJ 2RDJA 4Q45A 2HRTA 3LP1B 4YUDA 1U6ZA 3ZZOA 2DNNA 3QYYA 2X1FA 2LA6A 4DG1B 2YWKA 2C2ZB 4OYMA 1T9VA 1NLTA 2B26A 2BKPA 4IRCA 2ZWPA 3PX0A 2BE7D 2XI2A 1AW0A 2VQEJ 1SL2A 2DCLA 2AU0A 2BEFA 2W4DA 3CJ4A 4Q7AA 3ILOA 4FYVB 2PDAA 2B9XA 2H51B 2QEXS 3AHPA 3OL7A 2HQGA 2X7IA 4KO0A 1BD6A 2ZEJA 3SCLE 3D6FB 1W26A 2DNPA 3RBEA 1QSYA 3QBCA 5KFPA 4G1QB 4CYUA 4HI2A 2I1RA 1BUXA 3OXGA 2OPPB 2E5IA 2UUTA 3PJXA 2WSCC 1KEKA 1KNZA 2RMLA 3QSIA 5B0AA 2FIUA 4PYDA 3V4IB 2XQCA 3B4DA 4J9UE 3NGKA 4DPUA 2C22A 3WHIA 4RW9B 4EZ6A 3TA2A 4JYAF 2JSXA 4RKUC 4URSA 3TO8A 3D67A 2VG5A 3TEGA 2WVFA 2BOPA 5F3TA 1WEZA 3KK1B 1YVFA 3EICA 4P2SA 4JV1A 1ZM3A 1P8GA 4JYAJ 2HAFA 2ZJRQ 3IM8A 3TX0A 3BV8A 1XNQF 4B3MF 2AQ4A 2CQGA 1UJ6A 2XS7A 2E5LF 1KKHA 5LM7E 2XMKA 2HK2A 5IOLA 3W64A 3DRPB 1T9TA 5IQ6A 3K5LA 4DV6F 3M9MB 4CO5A 1RAOA 2I2YA 1WHYA 1R0CB 1FKPA 3GR1A 2YNFB 1TL3B 2MKJA 1FNOA 1FD8A 1HYSA 3H5SA 3TUJC 2MYFA 3MMBA 1HNWF 1YITS 1I6JA 1L3KA 3R8YA 3E01A 2DGVA 2B3TB 1S97A 2A0FB 2MQMA 1KHWA 2ROPA 2D3O1 2CRLA 1VC6A 1HNWJ 1S79A 4KHPJ 5THWA 3RB6A 3Q8VA 1JLQA 2G1DA 4PG5A 4KBIA 1FJCA 2GCFA 4ILLA 1TVRA 5JJBA 2VQFF 3CXCR 2MZJA 1BC6A 1U1OA 1KVJA 3ET6B 1SL0A 1FF2A 1TL5A 3BSOA 1UCNA 1X5SA 4FYXB 2DIVA 3JSBA 4IRKA 2OKQA 3DGVA 4CLUA 2KXHA 5EX3A 5M2UA 2Y3YA 5C25A 4X4UA 1EQMA 3SFUA 4WF9Q 1VQ6S 3EE3A 3W60A 4V19X 2C42A 2LEBA 4DF8A 4N41A 4X66F 5DDRC 4GVBB 1JNZB 3VQSA 3UNGC 1FWKA 3VF0B 3OSPA 1OSDA 1LW0A 5DQHA 2HKEA 5E41A 4JI5F 3Q89A 4FPRA 5A0YA 2R7RA 1FA0A 1S0NA 1MLAA 3KDOA 1HHSA 5JVGQ 4QYRA 4NLXA 4TY8B 1XMOF 3CW2C 4E8UA 4H4KA 4DSLA 2OPQA 4ICLA 1NHVA 2MKYA 1TL1A 2Q66A 2O5DA 6FD1A 3UCZP 1YBTA 3FRYA 2ZH8A 2WVBA 4O4GA 3LWLA 2H3EB 1WDTA 2UUBF 3BKTA 3H2LA 1WSVA 1UEUA 2OMLA 4N77A 4R0EA 2RU9A 1VQMS 4JUZA 2HGMA 3T3FA 2CG8A 2QT7A 4IG0A 3LPYA 1HI0P 4FF4A 3P5TL 2UU9F 3D5MA 4J9OA 1OYEA 4N8OA 1OY6A 2UUBJ 1U0SA 2EFGA 3NAHA 3ENVA 2E7VA 2VJUA 1R3NA 2IAJB 5C2CA 1TV6A 1GTEA 2N7YA 3RBXA 4UUXA 2DR9A 4UY85 2RHSB 3UCGA 2EKYA 1XNRF 2R8IA 4ZS6A 1RAIB 5KFZA 3PO4A 5U47A 2ZH3A 3A3NB 4M5DB 1LQ9A 3IN5A 4Q8FA 1RADB 4WYWA 4GC7A 5D3GB 1XNRJ 3DLHA 4QJVA 5B0DA 3WX4A 3KHHA 1U2FA 1MMDA 3FMBA 3EZUA 4F3OA 3TZXA 4MIAA 1QDUB 3CF5Q 8ATCB 3IXQA 1M5VC 4YDXA 4X4TA 3MZIA 5J2MB 3MECB 3MAAA 1U45A 1VLOA 1DHMA 1QVFR 2AKWB 3NWGA 4F0MA 3CCVS 4K4YA 1IQZA 1TK8A 1TL7A 4WFNQ 4F7VA 1CC8A 1PAUB 3RAMA 2YNHB 1JLCA 5I3UA 4A8KA 4CO1A 1JLBB 5ETMA 4PWDB 4CH7A 1RWVB 3T1AA 2DNGA 4LF6F 1KN6A 3FFIA 3D0IE 2P9GA 3NGUA 2RU3A 1TP7A 4YR3A 3I4PA 4C0BA 2KL8A 4NOHA 4BS2A 2LQJA 5LL6d 3KLEA 4WKYA 5K8MA 5KFQA 4LF6J 3EDQB 1K0VA 3VTIA 2V69A 1LEOA 2QA4S 2ZH6A 3BSAA 1HQ2A 5G4DA 1KTQA 2PGCA 3BDPA 5HQMA 4HHJA 3FBEA 1Q7YT 3IS9A 1N5QA 2JEFA 1FRMA 3TUZC 1PBAA 2DCUB 4QR2A 2ILYA 3VWSA 2FVRA 4LFBJ 4OQJA 4DXLA 4FDFA 3A12A 2WW4A 3GYXB 3FSIA 2MZQA 5E3QA 4J91A 1E6YA 1FRHA 4ZN1A 2FHKA 3GCXP 4TLQA 1RT6A 5CCMA 4C97A 5SUHA 3PW2A 3KKFA 1TU0B 2F40A 3Q2SC 4MKYA 4TN2A 1RQ0A 4NXNF 3C6TB 2PO4A 4LJMA 4ATNA 1SUQA 3OVSA 1NJIT 1KONA 5A2QY 3BN4A 3LZ8A 3QT6A 1U0HA 2WTFA 1QAYA 2N4CA 1U49A 3OFEA 2Y1LB 2MPUA 4UY8T 3BR9A 2J6SA 5A8RA 3GV8B 2ZJQQ
chains in the Genus database with same CATH topology
3AGYA 4J80A 3LA0A 3NXZA 2QLDA 1NLTA 2B26A 1EARA 1EB0A 3AGXA 4L3KA 3L9ZA 1XAOA 2Q2GA 3NY0A 3I38A 1GMWD 1GMUA 3LZ8A 3TJ8A 3TJ9A 3AGZA 2HFVA 1GMWA 1GMVA 3TJAA 1C3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGY A;  4J80 A;  3LA0 A;  3NXZ A;  2QLD A;  1NLT A;  2B26 A;  1EAR A;  1EB0 A;  3AGX A;  4L3K A;  3L9Z A;  1XAO A;  2Q2G A;  3NY0 A;  3I38 A;  1GMW D;  1GMU A;  3LZ8 A;  3TJ8 A;  3TJ9 A;  3AGZ A;  2HFV A;  1GMW A;  1GMV A;  3TJA A;  1C3G A; 
#chains in the Genus database with same CATH topology
 3QJP A;  3PRB A;  4JV0 A;  3BO4 A;  1VHI A;  2DHS A;  2UVW A;  1RAH B;  3KYL A;  1HHQ A;  1X8D A;  5HVF A;  3EVM A;  2C3Y A;  3HVT A;  4OI0 A;  3TQ1 A;  4RW6 B;  4RNH A;  1RCX B;  2Y1R I;  2P9E A;  4F4Y A;  1NBE B;  1OWX A;  2BAN B;  3BYP A;  3CJK A;  5FJ4 A;  3MEE B;  5KFK A;  1RU1 A;  5HQL A;  1YGY A;  3TA1 A;  1SJF A;  3EVO A;  2AJQ A;  3CCW A;  5HAO A;  2BDP A;  3AB2 B;  3GIL A;  3KMQ A;  3C16 B;  4XPC A;  3NWR A;  3ZTR A;  3KHR A;  4Y2K A;  2V2K A;  4ETZ A;  2WON A;  3SFG A;  3CJ5 A;  4ANE A;  3DOM B;  4ZLP A;  2HHS A;  1O5J A;  2NSC A;  3DDN A;  1AFJ A;  5AXM A;  2AX0 A;  1HNI B;  2ZBI A;  4WIQ A;  1LXJ A;  1BLU A;  1S4F A;  2NXN A;  1WEY A;  4HI1 A;  1R8H A;  2R7W A;  2RT3 A;  3JTP A;  1VIS A;  3M9O B;  5J2N B;  3ZZR A;  4KR0 B;  1JJH A;  2RRN A;  2BVZ A;  4ANC A;  3UFC X;  1SKU B;  3RTV A;  3N5B A;  3KK2 B;  2X1G A;  1VYA A;  3I5A A;  5HP1 B;  1P9Y A;  3UD5 A;  2DT9 A;  4WK3 A;  3SSQ A;  2UUA J;  1U1Q A;  3W9J A;  1HW9 A;  4LBI A;  1X5O A;  1TKZ A;  5B0F A;  2ZH9 A;  1K1Q A;  4L3K A;  3ONQ A;  4B02 A;  2PMW A;  1K8A T;  1KHV A;  2ZOG A;  8RUC A;  4C11 B;  3LP2 A;  2KFZ A;  3GII A;  5HLF A;  2RS8 A;  3ILJ A;  4NLR A;  4CI0 B;  4L72 B;  2W2P P;  1N6Q A;  4X84 A;  1T05 B;  2GJ2 A;  1FDA A;  2VB6 A;  3ZC4 A;  3MED B;  1WTB A;  4J9P A;  2QN6 B;  2FJA B;  2C3M A;  2OUG A;  1IWA A;  3R2C J;  2BV3 A;  3M2V A;  1UP1 A;  2GML A;  2OH2 A;  4MJK A;  4L3N A;  4MMO A;  3EZ5 A;  1M0S A;  1RKJ A;  2DBB A;  2ZD1 B;  2GIQ A;  1ZZN A;  5DZ6 A;  4NCG A;  1V6H A;  3EGZ A;  5M2P A;  3UDL A;  2JX2 A;  3BGR B;  3D68 A;  4LFC F;  2Z2M A;  1JLE A;  3IGN A;  1SH2 A;  5FII A;  3CGI A;  1R0A A;  4XIU A;  1QY7 A;  5ADZ A;  3QID A;  1DTT B;  5AE2 A;  2GIR A;  4IYQ A;  2JFK A;  2HRU A;  4DX7 A;  5CCL A;  4URQ U;  4AQY F;  4ZVP B;  2VHG A;  1U1N A;  2X1B A;  2R8J A;  1O6X A;  3WQP A;  2MB0 B;  4IQX A;  1QD1 A;  1WF0 A;  3AB4 B;  1S48 A;  2PFD A;  4YFU A;  1YJR A;  3GYG A;  4Q8E A;  2LQ8 A;  3MUM P;  3K5P A;  3ZZU A;  3BDE A;  4OI3 A;  2BE2 B;  4PZV A;  1IM4 A;  1MU2 A;  1FJG F;  2FC8 A;  4TNO A;  3WX8 A;  3W2W B;  3QLH B;  3MI7 X;  1IKW A;  4M5L A;  4DLG A;  3RB0 A;  3E51 A;  1TKX A;  1X9W A;  4A8X A;  3VGS A;  4J37 A;  2XZW A;  1RT7 B;  3C46 A;  1C0U A;  4EZ9 A;  4P9S A;  2IC3 A;  1DZ5 A;  3N6L A;  3DRR B;  5AE1 A;  3BYR A;  3G8T A;  4QYZ J;  3ZNU A;  2Q79 A;  1REV B;  3HFV A;  2Y1J A;  2HZV A;  2K8G A;  3BSC A;  4RNO A;  3ILL A;  4DQS A;  4B3R J;  3W61 A;  2ZOM A;  2NS1 B;  1FDB A;  3EGW B;  3TJA A;  1VBZ A;  3LP0 B;  4YHH F;  3O8W A;  5DGA A;  2EC0 A;  5ETT A;  1CVJ A;  3DLK B;  3K7R A;  3M2R A;  1ZS6 A;  1VQ7 S;  1TUV A;  1LWF B;  3I56 S;  3I32 A;  1SJ4 P;  3WIV A;  4Y2A A;  4R8U A;  1GTH A;  3JQJ A;  4YHH J;  4DR2 J;  2HIQ A;  3OR2 A;  3M8Y A;  2V2Q A;  1AZS A;  2CNK B;  1DQA A;  4FF3 A;  1CJU A;  4W90 B;  3M8Q B;  3GFZ A;  4X64 F;  2W9B A;  3UE2 A;  1XMQ F;  1SB6 A;  1YG0 A;  2BR0 A;  1BWE A;  1RXO B;  1KVK A;  1RHR B;  2BKO A;  3EDR B;  2PE8 A;  4C9D A;  2Q3P A;  4U7C A;  2VBZ A;  1R8C A;  1S9G A;  1S9F A;  1NJX A;  4X64 J;  1S6Q B;  2NXE A;  3W2V B;  1XMQ J;  2H1Y A;  4KH0 B;  3OXF A;  1QLN A;  2D69 A;  3I4H X;  3OL6 A;  3N0V A;  2CIM A;  4A8Q A;  2DNQ A;  3UN5 A;  4WK1 A;  4LF9 J;  3OR1 A;  2FD2 A;  4OX8 A;  1VJW A;  3LGN A;  4MT1 A;  5CD4 H;  4WBF A;  5ETL A;  2HK3 A;  3PJW A;  1VBX A;  3OVA A;  3DOK B;  1RCO B;  5IWA F;  2QSW A;  1PC4 A;  4NA2 A;  1JLF B;  3KJF B;  2YBV A;  5J2Q B;  4B9L A;  3KLG B;  5BR8 F;  1RHM B;  1XQI A;  1PKU A;  4K4Z A;  4KGM A;  1KFS A;  3SQG A;  4I64 A;  3PNI A;  2DNM A;  3FNN A;  3K0J A;  4ID5 B;  5IWA J;  5CQG A;  1EAY C;  1VIX A;  3K5M A;  2O66 A;  5BR8 J;  2D9O A;  3HJF A;  5C7P A;  4RU9 A;  4IOC Q;  1S0M A;  3OHA A;  4GKJ F;  1Y4Z B;  1KQS R;  3QMQ A;  2BAC A;  4DPT A;  4ZVH A;  2B9W A;  7FDR A;  3NNA A;  4OYZ A;  1QAX A;  3DGP A;  2XYG B;  4ZN3 A;  2XGP A;  2KHC A;  4WP9 A;  5F8G A;  3C6U B;  4ZLN A;  1HBN B;  3QGP A;  3OHB A;  2W9C B;  3NCP A;  2G0C A;  1F3F A;  1HBU B;  3EWG A;  1ZAX A;  1SJ1 A;  2AEF A;  2KZM A;  3OPK A;  2BYC A;  3PJ9 A;  3LO3 A;  1YHQ S;  4BHQ A;  3IMQ J;  1RHK B;  4JI6 F;  2N7C A;  4EEY A;  3AAW B;  5HRO A;  1JKH B;  2YY3 A;  4Q43 A;  4OHY A;  1RZM A;  4ECW A;  1SC4 B;  5LMU J;  4V1A k;  2RB7 A;  1FXD A;  2B4V A;  3G8Q A;  4ED7 A;  3PCO B;  2RRA A;  2W9A A;  5CHC B;  2CQD A;  3KLV A;  5EWE A;  1IKY A;  3R97 A;  1U1P A;  1TEL A;  3FVY A;  2CXE A;  2XO6 A;  3PZP A;  2LA4 A;  1OJ4 A;  1U4B A;  4BBY A;  1YIJ S;  5KFS A;  1Q79 A;  3ICL A;  2XZT B;  4RW8 B;  4FZV A;  4GO5 X;  1F2G A;  2YKN B;  2FTR A;  4RWX A;  3LWM A;  4X4Q A;  3RU0 A;  1FE0 A;  4F4Z A;  3X1L B;  2V4R A;  1YRU A;  1R8B A;  1V3S A;  3QIP B;  2YX4 A;  1F5B A;  4HTI A;  5B09 A;  1RBO B;  1UJ4 A;  2H5I B;  2RD5 C;  1FKO A;  2ZBR A;  5ETR A;  3NXZ A;  3J7A N;  1VOM A;  3PEJ A;  2OEM A;  3UVJ A;  2FVS A;  3TAM B;  1PG5 B;  1W2B R;  1GXU A;  1ZBT A;  2CQ3 A;  3ZO7 A;  2HVD A;  1CG2 A;  4WWS A;  3H40 A;  4C8L A;  3LP1 A;  2H48 B;  3CNQ P;  2M4M A;  4DBQ A;  3KOA A;  1HKA A;  2HPU A;  4DG1 A;  2HZA A;  1IR1 A;  3ZZP A;  4PYA A;  4J9S A;  4F02 A;  4LQ9 A;  4UOF A;  3I87 A;  1NKB A;  5FDL B;  1R0B G;  4P7V A;  1WC4 A;  4TYA A;  3D6T B;  4CT9 A;  1FEE A;  4CO0 A;  3RW6 A;  5HN0 A;  5E3A A;  3GFH A;  4CO3 A;  4IH6 A;  1NSP A;  2Y1I A;  1YJ7 A;  2CNN B;  5H9E J;  4DCP B;  4DSK A;  5ETS A;  5G0R B;  1V3Z A;  3M8S A;  3SEO A;  2AHO B;  1UVL A;  1NB7 A;  4G1Q A;  4G6V B;  2KO1 A;  1IBL F;  2OPP A;  1NSQ A;  3KLH B;  2P8I A;  1NSK L;  3HHL C;  4WTY A;  4DV3 F;  1UVI A;  1XBW A;  1NDK A;  4I6W A;  3V4I A;  1SQE A;  4RW9 A;  4ENO A;  1B4S A;  3Q8S B;  1WKL A;  3NMA A;  3L95 X;  3M8P A;  2D1C A;  1AUS L;  4O44 A;  3IRW P;  3FK4 A;  4LF2 A;  1WF1 A;  1U1K A;  3KK1 A;  2LEA A;  2HHW A;  4K2X A;  2UZA A;  4X4R A;  1XAO A;  2MZ1 A;  3G82 B;  4R5P A;  5KT3 A;  5F8H A;  2BRL A;  1VR6 A;  4P2X A;  1UVK A;  4DPY A;  4PXE A;  4UOC A;  3GIJ A;  3SCJ E;  4UW2 A;  3IR6 B;  2M52 A;  2IDE A;  3Q8Q B;  3SSR A;  3UI3 A;  2BJ1 A;  3G9C A;  2WVE A;  2OIH A;  4DV5 F;  2O3D A;  3DRP A;  2UVV A;  3HK2 A;  1W2I A;  4IR1 A;  4UTG A;  2YNF A;  1TL3 A;  1N88 A;  2WBM A;  4IG3 B;  2BM0 A;  1U1M A;  2QC3 A;  4K2J A;  1Y5I B;  4YDD B;  3HHL D;  4ZIV A;  2QV6 A;  3CC7 S;  2A6M A;  3JQM A;  5C24 B;  2DR8 A;  2HVH A;  3VVT A;  5A6P A;  1CUL B;  2Z58 B;  2RDI A;  5J2P A;  1RT1 B;  4CRJ A;  1BGX T;  1B7Y B;  3ZZY A;  4CZC A;  2M8H A;  3MWB A;  2HHV A;  1RBA A;  4F4K A;  5A8W B;  1N54 B;  5D4O A;  1IBM J;  4WII A;  3R6L B;  3T6J A;  2JC1 A;  1UWA A;  2E29 A;  4H4O A;  2ZVI A;  3HHL B;  3CCL S;  4ZDN A;  3WC2 A;  1T94 A;  4MK9 A;  2KI2 A;  4DR4 J;  1X4C A;  2UUC F;  1KLM A;  5RUB A;  1RTZ A;  3ET6 A;  4CIO A;  1KRP A;  2EG2 A;  2ZFH A;  2NPF A;  2CQP A;  3CCR S;  2B56 A;  3L7P A;  4NLT A;  4LF1 A;  4F4W A;  1XC9 A;  5KAK A;  1JMT A;  4ELU A;  3RB3 A;  4U67 Q;  2Q6B A;  1L3V A;  4O3P A;  1Y3J A;  4AFF A;  3IFE A;  2UXD F;  1R6V A;  4GVB A;  3CWJ A;  4HH1 A;  3CD6 S;  2F9J A;  1EIY B;  1FTR A;  3J80 Y;  4PPZ A;  1BY9 A;  2YXL A;  4F2R A;  2Z30 B;  1M90 T;  2QL5 B;  2X3D A;  4NLO A;  2R7X A;  4I2P B;  1HWU A;  4TY8 A;  1U8W A;  4OI2 A;  4ED0 A;  1RJJ A;  4NWB A;  4KGK A;  3H5X A;  3SBM A;  3OLB A;  1A9N B;  1NK7 A;  1S0O A;  3FEX B;  2ZNY A;  4Q2M A;  2UV8 G;  5DG8 A;  1W25 A;  4F04 B;  2EEY A;  2PEH A;  3MM7 B;  2HHT A;  3GG1 A;  4U8V A;  3L3C A;  2GA7 A;  2YKO A;  1P6T A;  5EN1 A;  3PW7 A;  3FKB A;  1T9U A;  2AX1 A;  2QMX A;  3FC9 A;  3N6M A;  3RR8 A;  3Q8Y A;  1NJW A;  3Q2T C;  3M32 B;  2VPW B;  4ES1 A;  2AF6 A;  1N34 F;  2DHX A;  2ATL A;  4DL7 A;  2NXU A;  2FJV A;  2Y8Y A;  4Q0B B;  2V67 A;  3DCA A;  2VUG A;  4OZL A;  1VQK S;  1WEX A;  1UZD A;  1N34 J;  3TVK A;  1YBA A;  2J0S D;  3HVA A;  3C2P A;  3B8H A;  4RW4 B;  4EFA C;  1RAF B;  2EK1 A;  3VGV A;  1L3U A;  5IFM A;  2ADB A;  5HI7 A;  1XJW B;  1QE1 B;  2AIR B;  5F8L A;  4YEA A;  4CM2 A;  4ILM A;  1PAE X;  2B6A B;  3CCQ S;  5HAN A;  4IFY A;  1TKT B;  2XNR A;  5KT5 A;  1RSC A;  4D3H A;  2RF2 B;  3P96 A;  4EO8 A;  2LCW A;  2RNE A;  3Q8U A;  2OJ3 A;  2F8H A;  4TU8 A;  5BJR A;  2B51 A;  2KT5 A;  4MYT A;  1VDH A;  2ASJ A;  1ZAW A;  2JRS A;  4Z2X A;  1D09 B;  2MGZ B;  4KKO B;  4WCE Q;  2BX6 A;  2WB4 A;  2W24 A;  4CLT A;  4A8O A;  2R7U A;  1XIQ A;  4B9M A;  2CJX B;  1FXL A;  2MEW A;  1WTF A;  2CWX A;  1WG4 A;  3VAJ A;  1RLD A;  4P74 A;  1OIA A;  1T03 B;  5L9X A;  3J7Y U;  1YJT A;  4DN9 A;  1RHQ B;  1V9O A;  2DO0 A;  4UT4 A;  2DJW A;  4ED4 A;  1XEZ A;  4KV8 A;  4PWD A;  2YWF A;  1F1B B;  4X65 F;  2QRR A;  1LWX A;  4I4B A;  1Y10 A;  3NBP A;  1PYO B;  4LF8 F;  2JVR A;  2EXU A;  1SIZ A;  2L08 A;  4Q44 A;  4ECS A;  1HFE L;  1PJ7 A;  3ISN C;  4X65 J;  2WHO A;  2DIU A;  5T41 A;  2DHA A;  3ETO A;  2HHQ A;  1WKJ A;  1FDN A;  1JLG B;  4WFZ A;  2NZ4 A;  5HBM A;  5KFU A;  3GWC A;  5IS2 A;  4X4O A;  2KFN A;  2LVW A;  3B82 A;  5KG1 A;  5F0W A;  2LXF A;  4DCO B;  4ELV A;  4DUY J;  4WFA Q;  2B43 A;  1ZA2 B;  3VZI A;  4IFV B;  1EP4 B;  1Y0H A;  3QFW A;  4DPW A;  5FD1 A;  1MWZ A;  4C0H A;  1DUR A;  4V19 J;  2L9W A;  1TR0 A;  2VG7 B;  1UEV A;  4KFB A;  2HGL A;  2B9E A;  3K89 A;  1K47 A;  1D8Y A;  4WYL A;  4DEZ A;  3BBC A;  3KMS A;  3C6T A;  3FJ2 A;  2MLX A;  2RRB A;  3HHE A;  3MPD A;  1VQ8 S;  4A8Y A;  4QZV B;  2PSZ A;  2VPZ B;  2AYB A;  4PKD B;  3L4B C;  3MR2 A;  3THT A;  1FNX H;  2CDQ A;  2YPZ A;  2ZM6 F;  4UOH A;  4QPX A;  2AZ3 A;  5K8N A;  4CLL A;  3OBI A;  5D0H A;  2MKH A;  4P6Q A;  1KQF B;  3HO1 A;  1Z1Z A;  2J9E A;  1ZZF A;  2ZM6 J;  2PC6 A;  1Q0N A;  2IVF B;  4EI2 A;  4NLG A;  2V63 A;  3BO3 A;  5KFY A;  3JS9 A;  3JSM A;  5K8P A;  5A2Q U;  1B0T A;  3GLJ A;  1APS A;  3UO0 A;  1IR2 A;  1NB2 A;  4RW6 A;  2LFV A;  4DR7 F;  2F3J A;  1RTD B;  3QGI A;  4FBU A;  1DFD A;  4HAC B;  1F9H A;  1FDD A;  2H9Z A;  2HFO A;  7FD1 A;  4QU6 A;  2JC0 A;  1EKS A;  3D7S B;  3MEE A;  3P6Y C;  1S76 D;  1KBR A;  1X4A A;  5A6W A;  1OS5 A;  1X0F A;  4OZ5 A;  2A10 A;  2DY9 A;  1CPZ A;  2X51 A;  2VFT A;  2M5Y A;  3THV A;  4OZN A;  5KT2 A;  2E44 A;  2OD6 A;  3D66 A;  2XY6 A;  2MKC A;  1NH7 A;  1GX5 A;  4GC6 A;  2DD8 S;  4IKA A;  4OMF G;  3OFF A;  1O51 A;  5AJ3 J;  5HVG A;  4DR1 J;  4Y0F A;  3DOM A;  2MST A;  2R2S A;  2EG1 A;  3W9H A;  1HQE A;  1C4C A;  1I1G A;  5IT4 A;  2MZR A;  1Q81 T;  1TKD A;  1HNI A;  2IA0 A;  3M8Z A;  5C5J A;  3MFI A;  2FYX A;  2FZK B;  4M63 A;  1IKV B;  2BJ9 A;  1RWM B;  1D9A A;  2UXC J;  2DK2 A;  1IN0 A;  3D2W A;  2JVO A;  2K7J A;  2B7C B;  2C2K B;  1UAW A;  4ZVR B;  3F44 A;  5HP1 A;  2AJ4 A;  4F4A A;  3AOC A;  4HH0 A;  3E3X A;  3NNH A;  3V81 B;  5KG5 A;  2VFR A;  2ZH4 A;  1KOH A;  3GE9 A;  4CDI A;  5DZ7 A;  4DV4 F;  3W1Y C;  3HHD A;  4PAA A;  3PW0 A;  2GAG C;  4RNF A;  4YN3 B;  4PRF A;  1RTI B;  2YWH A;  1HI8 A;  2VOD A;  4C11 A;  2B8P A;  3U02 A;  2JVM A;  2XHW A;  1BQN A;  2XS5 A;  1S6P B;  4YY3 F;  3OLA A;  4ECR A;  4DV4 J;  1BHN A;  1WHX A;  2YPY A;  3MD3 A;  4Q2L A;  1T05 A;  2VZ9 A;  3IG1 A;  3PEH A;  2MZT A;  5DO2 A;  1H7W A;  3MED A;  3G71 S;  3MD1 A;  4JI8 F;  4OV6 A;  1Y5N B;  4ZCM A;  1YSJ A;  3R5A A;  1U1R A;  2PI4 A;  3OL8 A;  5EGY A;  1TMM A;  2YNG A;  4WP8 A;  4YY3 J;  5HVH A;  1U2R A;  2LXU A;  2CPE A;  2V8G A;  3W5X A;  5KFR A;  4GO7 X;  2ERR A;  3H2V E;  1Y3K A;  2FLP A;  4LR7 A;  3DRY A;  3KUG A;  3G6X A;  2XHC A;  3NGD A;  3HJV A;  3CJS A;  3K5O A;  1HWI A;  2OPR A;  3BGR A;  5B0G A;  3AJ1 A;  1FX2 A;  2RQM A;  3MAQ A;  3S01 A;  1WC0 A;  3PRV A;  3NKY A;  3VV2 B;  4G1P A;  1DTT A;  1NKE A;  4PQU B;  3HDS A;  3IR7 B;  2KDO A;  3B54 A;  1N5T A;  2XSF A;  3SSS A;  5B0C A;  5GAD U;  4CTA B;  4RNN A;  1S0V A;  5LXR A;  1E6V B;  1FER A;  2CJY B;  4ELT A;  3G8S A;  1HA1 A;  3DN9 A;  2BE2 A;  4FYY B;  1VBK A;  2RUS A;  4QU7 A;  1RTH B;  2MQP A;  3QLH A;  2M0G B;  1FFS B;  3G96 A;  1QVG R;  3N6N A;  2BMB A;  1YWX A;  2MKK A;  4I6A A;  2ODX A;  2HMI B;  1T02 A;  1F60 B;  1S1V B;  2AGQ A;  3OD2 A;  5AE3 A;  1LWE B;  1RDR A;  1WG1 A;  3J7Y I;  1RT7 A;  2J0W A;  2KB2 A;  4U95 A;  5KFE A;  4OV1 A;  5HL7 Q;  3FRZ A;  3AKO B;  3UD4 P;  1RGV A;  4NI2 B;  1CEZ A;  1REV A;  1M1H A;  4QWD A;  2WOM B;  2DRA A;  2HND B;  2MSS A;  1VS3 A;  3W8G A;  4MK8 A;  4DWI A;  4BLG A;  4E98 A;  3LP0 A;  2VFU A;  5C2G A;  1YLX A;  1R8A A;  1LXN A;  2CJA A;  3H2U B;  2L9D A;  1SVD A;  1IKX B;  1HWK A;  4UUW A;  3DLK A;  5F41 A;  4LRC A;  2HHH F;  3PFO A;  1YZ7 A;  4NE9 C;  2EFV A;  3HKZ D;  1S4E A;  3R5G A;  3KLF A;  4QW9 A;  2DEI A;  2XEX A;  1F2H A;  3AXK A;  1YRX A;  3SYZ A;  5AXK A;  1P27 B;  3ISZ A;  3PX6 A;  1S99 A;  1V5V A;  4NEZ A;  4FS2 A;  2HHH J;  5IV3 A;  2MQQ A;  3M8Q A;  5L46 A;  1LK5 A;  2JLF A;  2M8D B;  2VON A;  4C48 A;  4DV0 J;  2FHM A;  3GCW P;  2RJZ A;  4JBC A;  2QL7 B;  1IQT A;  1S6Q A;  3W2V A;  1RTJ B;  3S1T A;  4WFB Q;  3UQS A;  2CPZ A;  1SCJ B;  2ZKU A;  4FVC A;  2MDA A;  3PY8 A;  1FTC A;  4HKQ A;  3OTO F;  2HHX A;  4RUA A;  3NLC A;  2C3O A;  1FD2 A;  2I8E A;  1RT5 B;  2MHE A;  3AGZ A;  3CME S;  3SXL A;  5M2R A;  2IVY A;  2WB1 D;  1Q86 T;  2VDH A;  3DOK A;  3PYG A;  2DH8 A;  4FPI A;  2RIL A;  4K50 A;  5J2Q A;  3GP9 A;  3KLG A;  1SQF A;  3BR8 A;  2PI5 A;  1AFI A;  4EMD A;  2AP6 A;  4USH A;  3ENQ A;  1SH3 A;  4J80 A;  2R7S A;  1CJV B;  6AT1 B;  2GJI A;  2JDJ A;  2GZO A;  4FYW B;  4USM A;  3MEK A;  4LF4 F;  5LJ5 Y;  4QWA A;  1GAO A;  4CLF A;  4AUK A;  1JLA B;  3MTK A;  3N79 A;  2XTJ P;  4JI7 F;  2PD1 A;  1ZPV A;  2W2Q P;  4P7T A;  3DLB A;  5L38 A;  3PKM A;  2ZUA A;  4LF4 J;  5F8I A;  2QX0 A;  5GMK a;  1IBK J;  1H74 A;  4NLU A;  4CYU B;  3JQK A;  3K58 A;  3D0G E;  3C6U A;  1VRU A;  1HBN A;  3I0S B;  4TLR A;  1YJ9 S;  2OMO A;  2W9C A;  3RW7 A;  2B4U A;  2ZH5 A;  2C2E A;  3KJQ B;  2B4P A;  3BSN A;  3CO0 P;  3LPE A;  3OVB A;  1EKR A;  4H4M A;  4DSE A;  2FJW A;  1Q8I A;  4LRE A;  1FI4 A;  3T9Z A;  4KYZ A;  1RAB B;  1PBU A;  1N36 J;  2UXB J;  3JSR A;  4ETX A;  1RT3 A;  1S9E A;  1WEL A;  4Y2M A;  3TUI C;  1RAJ A;  2BJ8 A;  3AD7 C;  1UA1 A;  5KFA A;  2GAH C;  1HPZ B;  3FBC A;  3IBF B;  2G0I A;  3KUE A;  5KG4 A;  2VIC A;  4KE5 A;  3CCU S;  2Y0B B;  4LRA A;  1Y00 A;  3PG9 A;  2V2V A;  1U25 A;  2JH3 A;  2XCA A;  2FHO B;  3D0H E;  4IO1 A;  1CJK B;  2XG8 A;  4P75 A;  1V3R A;  1R7I A;  4JI4 F;  3EZO A;  2YWW A;  3F56 A;  4X4S A;  4DJB A;  4KC5 A;  4AND A;  2AD9 A;  3L7U A;  4OLP A;  2WCX A;  2YKN A;  1RBL A;  2XWY A;  2DRD A;  2RIJ A;  4H4K C;  2XLI A;  2BW2 A;  4EBC A;  4ED5 A;  2ALY B;  2QLX A;  2QLD A;  1U02 A;  5F8N A;  4A48 A;  4DV1 J;  4W92 B;  3HI9 A;  5DLF A;  3E01 B;  4K4U A;  1VBY A;  3TJ8 A;  1AB8 A;  1UKU A;  2QO3 A;  2A2C A;  1VQ5 S;  1SKS A;  2GJF A;  1ZPW X;  2EI5 A;  3MCS A;  2EBE A;  2APO A;  3G2X A;  2FJB B;  4KHM A;  4DPX A;  2HWI A;  2IJF A;  3KXD A;  3M30 B;  2U1A A;  1TAU A;  4F3M A;  3VHQ A;  1TTH B;  4XAK A;  4F4X A;  3LAK A;  1X4E A;  3DMJ B;  4QIW D;  4OFZ A;  4EUV A;  2WSE C;  3H0P A;  4LFA F;  1LFW A;  2ZZT A;  4R25 A;  4N8N A;  3DFE A;  4DPO A;  3RAQ A;  3D54 A;  3VAG A;  4ECV A;  5D4L A;  2BJD A;  2I6W A;  2YQ1 A;  2L41 A;  3LAN A;  3MF5 A;  1NJY A;  1OSC A;  5BXI A;  1RWX B;  3THP A;  4CM0 A;  4USI A;  4Y2I A;  3H5U A;  4F2S A;  5CZX A;  2J7U A;  1X9S A;  2V6A A;  2IYI A;  3GSD A;  5G0R A;  5GVQ A;  3GJR B;  4FVM A;  1NUE A;  1LW0 B;  2EFQ A;  3KLH A;  3QGH A;  5GAD I;  4IH5 A;  4ZPC A;  3CE8 A;  3FCW A;  4YB5 A;  2G2Y A;  4OYP A;  3OTC A;  3IR5 B;  4M5I A;  1UWB B;  3SQO P;  4ZJO A;  2A6O A;  5HMZ A;  5LT5 A;  4FF1 A;  5KG7 A;  1XR6 A;  4PG8 A;  2OPQ B;  1P1T A;  2XY7 A;  2O1P A;  2J9D E;  2UV8 A;  3SCK E;  4O4G B;  5LSR A;  4KTQ A;  2QYC A;  1JXL A;  5DM7 Q;  1EHW A;  4NLW A;  3JSY A;  2RDD A;  1Q53 A;  1XN9 A;  5H9F J;  3FEY B;  3UDE A;  4HR2 A;  4P73 A;  4M5H A;  3TEH B;  1A7G E;  4ZP9 A;  2KZZ A;  1QTN B;  2G13 A;  1AYE A;  3QO9 A;  4DSF A;  2IYG A;  3KDN A;  4ZVG A;  2MZS A;  2KFY A;  3TVY A;  1PIL A;  4IG3 A;  3AFG A;  1J5O A;  3UR3 C;  3C8Y A;  2IRY A;  4KHR A;  5DS7 A;  3EYZ A;  5C24 A;  1AA1 B;  1MW7 A;  4ZVE A;  5D78 A;  2CVE A;  2EKN A;  2HS3 A;  3J81 j;  2ZZN A;  2JEG A;  4YQW A;  4DUZ F;  2QMW A;  4TU9 A;  2AEJ A;  4OYX A;  4ECX A;  4K0K F;  1XWL A;  4I56 A;  1RA6 A;  1XNQ J;  4B3M J;  3P3D A;  2E5L J;  3N01 A;  1MRO B;  3HHL A;  2U2F A;  3MXH P;  4DUZ J;  3NS5 A;  1ZM4 A;  3R7S B;  4O4R A;  3NL0 A;  4NXM F;  3BF4 A;  4DV6 J;  4DUT A;  4UOG A;  3TWZ A;  2HQF A;  5KFC A;  4XDC A;  1Q5V A;  1T7P A;  3E8O A;  3BQ0 A;  2P9C A;  1H73 A;  2DPI A;  1EZZ B;  3W5Z A;  2XCP A;  2DVI A;  1AT1 B;  2K7K A;  5E5N A;  5KFJ A;  1M5K C;  4WKR A;  1H98 A;  4NXM J;  3CJ2 A;  3DLE B;  5EX0 A;  5DQI A;  1UMJ A;  1RLC L;  4CLS A;  1J27 A;  1J2V A;  2XYH B;  1S5Z A;  2IA6 A;  3HSZ A;  2KRR A;  2LDI A;  3T1Y F;  3QAT A;  3MPV A;  1FWL A;  1X31 C;  1U6B A;  3UR0 A;  3FFI B;  3M8R A;  1RB0 A;  2YNI B;  3OQ2 A;  2BJ7 A;  3C14 B;  4PEO A;  3JYT A;  3EMT A;  2VQF J;  3T1Y J;  1T0T V;  1KTV A;  4I2P A;  2KG1 A;  5F9L A;  2J0X A;  2CG4 A;  2WK4 A;  4FBT A;  1U48 A;  2YWE A;  2HG4 A;  2DGS A;  5D4P A;  4ID8 A;  1SIW B;  4P2M A;  1UVN A;  4NAS A;  3MCN A;  3PV8 A;  4QIG A;  2HHP A;  1M5P C;  2ZE2 B;  3MM7 A;  2OI2 A;  3LGH A;  3J80 U;  2AGP A;  3OTB A;  3UN3 A;  4OIX A;  4U7U D;  3IWN C;  3UNY A;  1UW4 A;  1EAR A;  2QTW A;  4QR0 A;  4X66 J;  2D3U A;  2I9S A;  2AW0 A;  2KXF A;  2J6U A;  1T3O A;  1IR0 A;  3M32 A;  3R5D A;  5KG3 A;  4JI5 J;  4LR8 A;  4RBU A;  3KK3 A;  2HGN A;  3RRG A;  2XMJ A;  5BYS A;  2CQI A;  5L9N A;  1MWY A;  1LK7 A;  4Q0B A;  4ED1 A;  1FK9 B;  1EB0 A;  1I5O B;  3AOB A;  1U6F A;  3BM7 A;  3AD8 C;  2GVZ A;  3SV3 A;  1HNV B;  2MY8 A;  2O01 C;  1B99 A;  3MPW A;  1XMO J;  3D9B A;  2ATC B;  4B08 A;  4QIV A;  3DYA A;  4DU7 A;  1HHT P;  4DSJ A;  4F36 A;  1KC8 T;  1WC6 A;  2QFJ A;  5L8R C;  4FXV A;  4YR2 A;  1QE1 A;  2GVD B;  1U0H B;  1URR A;  1LOU A;  1D9F A;  2B6A A;  2KVQ E;  3IC1 A;  5E2Q A;  2RF2 A;  1KP6 A;  1R27 B;  2VV5 A;  1G1X A;  3OL9 A;  4ZPW R;  5J1E A;  3H4D A;  1BXN A;  3RG6 A;  3M6V A;  4KSE B;  1RYS A;  2UU9 J;  5E3R A;  2MGZ A;  4KKO A;  2JZ8 A;  2KHD A;  1FT8 A;  3KLI A;  2GX8 A;  5C42 A;  4NLS A;  1URN A;  1QUV A;  2CPX A;  2OSR A;  4F26 A;  3HHN B;  1T03 A;  4ZPB A;  5KG0 A;  1WWH A;  2FHJ A;  1B0V A;  2L3M A;  2HEK A;  1WC3 A;  4WE1 A;  2HFS A;  2YKM B;  2DH9 A;  3CCS S;  4J9K A;  2PMZ D;  2V94 A;  4ZCI A;  3UN2 A;  5GAE U;  1RWN B;  3DI6 B;  1KQK A;  2IM3 A;  3LUY A;  4I2Q B;  3VCD A;  5KFB A;  4MFB B;  1OY9 A;  3OTD A;  1A0O B;  2XMA A;  2HFV A;  3ILI A;  4OHZ A;  2WON B;  3A4T A;  5GAG U;  1KS2 A;  2HWT A;  1WF2 A;  1TK0 A;  4W98 A;  3PTW A;  5KTQ A;  2DHH A;  1JLG A;  3PO5 A;  1EQ0 A;  4FXW A;  1MML A;  1LW2 B;  3CUL A;  1UPM B;  3KJV B;  2F5G A;  3T5J A;  4LSN B;  3HT0 A;  4RR5 A;  1FKA F;  4WTO B;  4IFV A;  1EP4 A;  2YKA A;  2E7X A;  4UST A;  3ZTO A;  4K4W A;  4MIB A;  4DL0 C;  3JTN A;  2E1P A;  2QA2 A;  4U6P A;  2VG7 A;  2QSF A;  2MQL A;  1PJ6 A;  1REG X;  4EYI B;  4IR9 A;  2M88 A;  2V8H A;  1HIY A;  4F3Q A;  3IP0 A;  4ZOS A;  2IMO A;  3KUH A;  4K8R A;  1HLW A;  2CQ1 A;  4K7Q A;  4ZPT R;  1K0T A;  2J76 E;  3CTR A;  4ZCL A;  3PRD A;  3FEZ A;  5D0R A;  5T7L B;  3R5B A;  4C98 A;  3P8B B;  2V8P A;  3CDE A;  2FUG 9;  1OQ3 A;  3GR0 A;  3MR3 A;  1Q95 G;  2OGU A;  3TZY A;  1Z4U A;  3T5K A;  4AL7 A;  3D1O A;  2ZC3 A;  4DR5 F;  3BZQ A;  4DDF A;  2QGF B;  4ZIT A;  3QQC D;  5KOW A;  4A8W A;  1NZA A;  3GIK A;  5KG6 A;  2RHQ B;  3MM9 A;  1HR0 F;  4LF5 F;  2ZUG A;  5F9N A;  3IAS 9;  4ES2 A;  1PCA A;  2LQ5 A;  5E3P A;  1S12 A;  3W5Y A;  4EK2 A;  4DR5 J;  4X4P A;  5K14 A;  4EBD A;  4Y65 A;  1R0A B;  4NXN J;  5IM0 A;  4HAC A;  2G0J A;  3IRX B;  1SC1 B;  2XSJ B;  3W65 A;  1VK8 A;  2Y0S D;  1CJT B;  2ZBC A;  4QQB A;  5DG9 A;  2G2O A;  4ZLJ A;  2WAQ D;  1K9M T;  3NAI A;  3I55 S;  5LSL A;  1N32 F;  3KG4 A;  4LBP A;  1KVI A;  5HJY A;  1MNE A;  1W7W A;  4NZ0 A;  4I7F B;  2N3L A;  3CJ0 A;  1YI2 S;  3D1H A;  2QJ3 A;  3NNC A;  3CDW A;  1FEH A;  1B64 A;  5MLC V;  3I96 A;  5IC6 B;  2K1R B;  4NRT A;  3BGO P;  3BBF A;  3D3B J;  1IKW B;  2C3P A;  4K59 A;  3LF0 A;  3EGV A;  5LMN F;  1GQE A;  2DB1 A;  1EJ7 L;  1FXR A;  2EWH A;  1SPB P;  1TKX B;  2Q1L A;  3DU5 A;  4CQ1 A;  5A8K B;  3MM8 B;  4M5J A;  2IM2 A;  2C2O B;  1VQ9 S;  4M1K A;  2IC3 B;  1DRZ A;  2CJK A;  3CIM A;  3F0N A;  5KFI A;  3D28 A;  5E0O A;  1X4F A;  1XER A;  2O67 A;  1SV5 B;  4OHV A;  3OUY A;  1S10 A;  4ER8 A;  4M5N A;  5CYM B;  1BQM A;  3ZTP A;  3V81 A;  2DGQ A;  3ITH B;  4G3I A;  2EBG A;  2OLW A;  2V0N A;  9ATC B;  4OYO A;  2HWH A;  3GIM A;  3KTQ A;  3HD1 A;  3QGG A;  2BQ3 A;  3QJL A;  1CQN A;  2DNY A;  1RHU B;  1X7V A;  2F4V F;  3TYT A;  2K3I A;  3HSG A;  2W7P A;  1MG7 A;  3ZZZ A;  1CJU B;  1OPI A;  2W7A A;  2PA8 D;  3AXM A;  3U1L A;  2EFP A;  2XYP B;  1ACM B;  4A4J A;  5I42 B;  1NHK L;  1Q4R A;  5KFH A;  2D41 A;  5KT4 A;  3L7O A;  1Q8L A;  4J9V A;  3MM6 B;  2DR5 A;  5B0B A;  1S9G B;  2BUN A;  3H4B A;  1NK4 A;  4FKY A;  1X4G A;  1UFW A;  3KHL A;  3SZ2 A;  2YH0 A;  1YTY A;  3CCM S;  3T9N A;  1X4D A;  1FES A;  3M05 A;  4B9N A;  3QAU A;  4PXD A;  3P5B P;  3OR1 B;  1JX4 A;  1VIO A;  4PQU A;  2LXI A;  2KJV A;  4J90 A;  2GMH A;  4USU A;  3A8I A;  2VU5 A;  6FDR A;  2HNZ B;  1QAI A;  2PT0 A;  2CPY A;  4CTA A;  2C2M B;  3IBW A;  3MMC B;  4X4N A;  3PR5 B;  2KG0 A;  1E6V A;  3NS7 B;  2LQ9 A;  2ZKT A;  2XMT A;  1BWV A;  3H7H B;  1M5H A;  3SQG B;  3HM9 A;  4JI3 F;  3ZTS A;  3DDI A;  3W66 A;  4WZM A;  1M1G A;  5F0U A;  1R89 A;  1RTH A;  4CLZ A;  1YK9 A;  1T95 A;  3AD9 C;  4OX9 F;  3N4W A;  2HBY B;  2F8M A;  1N0U A;  1S1V A;  4JI3 J;  2B7B B;  3HKW A;  3M2U B;  4LFC J;  1B0P A;  1U8S A;  3MCM A;  5K5M A;  4C7Q A;  2MQO A;  1KDN A;  2XMV A;  1A6L A;  4NI2 A;  1C0T A;  5D8H B;  2DY1 A;  4AQY J;  4PG4 A;  4PG7 A;  1FVS A;  5GAE I;  2HND A;  3DC2 A;  2AJ2 A;  1SC3 B;  3QWP A;  3TR5 A;  2ZIT A;  1CS4 B;  3EPG A;  3BGU A;  1GEH A;  5D0E A;  4RNM A;  4ZLL A;  4OLO A;  1GX6 A;  4C8K A;  4ZHR B;  2WVC A;  4HLB A;  5F8J A;  2K3K A;  2ALZ A;  1IKX A;  1N5Y B;  1HNX F;  5GAG I;  2POK A;  1FJG J;  4ALZ A;  4QIE A;  2CQ2 A;  5DJB A;  2HW3 A;  4Y34 A;  1FNM A;  1YRT A;  2EFO A;  2B0G A;  4TXS A;  4MKB A;  2E1C A;  3FZ2 A;  1MWQ A;  3N28 A;  2LMI A;  4JP8 A;  1WHV A;  5L1L A;  1VFJ A;  3I5B A;  1SH0 A;  2KH9 A;  2ASY A;  3O6Q A;  4M94 A;  1ZOT A;  5MAO A;  4NLD A;  2ABY A;  3ENW A;  3J81 Y;  1ZA1 B;  4DL6 A;  1TQL A;  2B8Q A;  2V2Z A;  1WC5 A;  5DM6 Q;  1SJR A;  2KVI A;  3HLU A;  3R1H A;  1KSP A;  4I67 A;  1JK9 B;  5KFL A;  1N33 F;  4K5R A;  1YKW A;  1SQG A;  1NZ8 A;  3M6W A;  3CC2 S;  1FRJ A;  3MM5 B;  3MMA A;  3PR4 A;  2VPY B;  4K4V A;  1C1C A;  4H54 A;  2YH1 A;  2R2T A;  4USV A;  4MKV A;  1GMV A;  2NLW A;  1RT5 A;  3VAF A;  4G1I A;  3TRG A;  1N33 J;  1DLO B;  3W62 A;  1CSJ A;  3BB5 A;  2V4J A;  4B3O A;  2VQE F;  4DL5 A;  4DCJ B;  3DRS B;  3HX9 A;  3A8K A;  4LVN P;  1RIS A;  3OFG A;  2E1M C;  4K5S A;  4XK8 C;  1WSR A;  3VAK A;  1TZ0 A;  3DM2 B;  1CJV A;  3T6B A;  2JRR A;  1ELO A;  2GW8 A;  3CMA S;  3H25 A;  1FX4 A;  2NZC A;  4QW8 A;  4LSZ B;  4N76 A;  2DGW A;  1JLA A;  1N4L A;  1H7X A;  3MEG A;  3POT A;  4I6Y A;  4DFP A;  4QPT A;  2ZH1 A;  1U1L A;  2B4O A;  4L75 A;  4CLW A;  1EET B;  4IO9 Q;  3MOJ B;  2KTQ A;  2E9Z A;  2RSQ A;  1V5I B;  2NSB A;  2MQ8 A;  1KQG B;  3DOL A;  3FCH A;  4LUB A;  2FJE B;  1F5C A;  3C15 B;  3ADA C;  3I0S A;  4ZPV R;  2CPH A;  1FWP A;  2BZ2 A;  5B08 A;  2OPS B;  2DTJ A;  3QNW B;  2VA2 A;  4L74 A;  4ZK7 M;  3EX7 B;  3JB9 k;  1LWC B;  4RW7 A;  3CT9 A;  3M8P B;  4OYI A;  5CAB A;  3S8S A;  3K59 A;  3IBC B;  4O44 B;  4TU7 A;  2ROE A;  1RA7 A;  3V5R A;  1Y11 A;  4R5P B;  4DHV A;  3D6M B;  3QRR A;  2SXL A;  1HPZ A;  3I38 A;  4GKJ J;  5GME A;  3A3O B;  2ZDO A;  2DNO A;  4OYW A;  3ZTQ A;  4ZVQ B;  2IMW P;  4E2F B;  4LSL B;  3V6K A;  3OJS A;  2R8H A;  1NK5 A;  3QZ8 A;  2DR6 A;  2CWK A;  1WUU A;  4PG6 A;  1CJK A;  2GGP A;  1PGZ A;  2YKQ A;  2IIH A;  1NCL A;  4F67 A;  2Z2Z A;  4YB6 A;  3DKD A;  4O23 A;  1IVZ A;  1NEE A;  1GMW A;  2IM1 A;  4ZP6 A;  3PHE A;  2DKO B;  2IVM A;  2JHE A;  3U1N A;  4ZVF A;  4OL8 A;  2R8G A;  4DF4 A;  2R7O A;  3Q8R B;  4JI0 F;  3AQP A;  3AOA A;  3G6V A;  4KHP F;  2Z4P A;  4J7C A;  3R5C A;  3W7B A;  3NGT A;  4JI6 J;  1BMQ B;  5J2P B;  1XR7 A;  3RGI A;  5D0G A;  3S7R A;  4JI0 J;  1Q8B A;  2NRE A;  4DL4 A;  5CYQ B;  1M5S A;  3M30 A;  2CVI A;  4YP3 A;  4H4O B;  2A2D A;  2R7T A;  3RJM B;  2CA9 A;  3DMJ A;  4JI1 F;  2QG9 B;  1KLM B;  3Q22 A;  1G6B A;  3D3C J;  2RQK A;  3I9Z A;  2Y8W A;  1IBC B;  1RI7 A;  5B0E A;  4PWU A;  1FFW B;  2R3V A;  1IJE B;  1I3O B;  4N56 A;  3DDK A;  4JI1 J;  3O1L A;  1YBU A;  5HAT A;  2H54 B;  4O3O A;  2KM8 C;  3CD0 A;  2M2B A;  1WOR A;  2V8D A;  3KFW X;  4D3G A;  3P45 B;  3G86 A;  4M5M A;  2J5A A;  2Z0G A;  3T19 A;  4CT8 A;  1K44 A;  5IV4 A;  1VQS A;  2XMM A;  2HQD A;  2W1B A;  1NPK A;  3CJ3 A;  5JUM A;  2HBQ B;  2HIY A;  2IFX A;  4MKA A;  5LJ3 Y;  1UWB A;  5K8O A;  3B78 A;  4DQR A;  4OZ1 A;  4LF7 F;  3BS9 A;  5L1J A;  4KB7 A;  2E5G A;  2FC9 A;  4BCA A;  4USW A;  4U7U K;  5KT7 A;  4MK7 A;  3FBB A;  4DOZ A;  4LF7 J;  3UD3 P;  5HJX A;  4QYZ K;  4C8M A;  2CAJ A;  3LGM A;  2Q6C A;  2ZHB A;  1DAR A;  2VPX B;  2DEJ A;  2A1B A;  4RBT A;  3RBZ A;  1WOS A;  1UVJ A;  3AOD A;  2MJN A;  1IBL J;  1JJC B;  3AY0 A;  1SI9 A;  4PQA A;  4OZJ A;  4LRB A;  4DV3 J;  4NLV A;  3HCX A;  4QWC A;  5KFW A;  1OY8 A;  2GV1 A;  1S72 S;  4OJG A;  4ECZ A;  3F73 A;  2NQP A;  2FY1 A;  2HFU A;  2ZHO A;  2L9N A;  3V2U C;  4I68 A;  3ZNJ 1;  2JNJ A;  2L48 A;  2KM8 B;  3I31 A;  4DZ6 A;  1IJF B;  1OMS A;  2QFI A;  3OW2 R;  1SJ3 P;  3IM9 A;  1MSW D;  3PW4 A;  2FDN A;  2NUU G;  4A8S A;  2JLE A;  4ILR A;  4IFY B;  4ZPD A;  1MRO A;  1N48 A;  2Q2G A;  1OYD A;  3BH7 B;  3KNA A;  2VBW A;  4F0K A;  4DV5 J;  2RUG A;  2PA3 A;  2FZC B;  1GT8 A;  1DY3 A;  5I4M A;  2MKI A;  1NSA A;  4KJI A;  3C19 A;  1SXL A;  4URG A;  5BYR A;  3DXS X;  1GH8 A;  2VD3 A;  3GB0 A;  4AYB D;  3L09 A;  2E5J A;  4ZPA A;  2W2M P;  2KT2 A;  3H42 A;  2RH3 A;  1OO0 B;  3DLE A;  3AJ2 A;  1G3O A;  2HZC A;  3BEG B;  1K73 T;  3K57 A;  1Z2L A;  4AXI A;  2R9L A;  3DNC A;  3CC4 S;  5H1S V;  3GJS B;  5D4N A;  4KV8 B;  3CD5 A;  1AUD A;  2YNI A;  1T9X A;  3EJM A;  3NBP B;  4KGZ B;  2UVR A;  2Q43 A;  1B3T A;  3C14 A;  4KRW A;  1RAE B;  3GTY X;  1ZH5 A;  2AT1 B;  1MMN A;  3M4X A;  2HFN A;  2UUC J;  1RWO B;  4OJ3 A;  4NA3 A;  4KY3 A;  2AV5 A;  3BN7 A;  2QMU B;  2W8K A;  3KG0 A;  2CQH A;  3UDV A;  3T5H A;  2OO4 A;  1UFL A;  3HZE A;  4ZP8 A;  3OJU A;  3RBD A;  2AWZ A;  3FMW A;  3B4M A;  2NYH A;  4RUB A;  4O0I A;  4J9R A;  4LFB F;  5HBM B;  3K8V A;  2JOQ A;  2HQI A;  3I9V 9;  2ZE2 A;  1WOO A;  3NRB A;  1S1T B;  2RAQ A;  2XZD B;  2NYI A;  2I38 A;  4RX6 A;  3NCQ A;  3CB4 A;  1SBR A;  1NK6 A;  2UXD J;  3QWU A;  4O3S A;  1TFY A;  1Q5Y A;  4ZCK A;  2HLT A;  2HNY B;  4UF4 A;  5DDO C;  1U09 A;  4KGV B;  2FVQ A;  3NGS A;  3LQV A;  2DR7 A;  4RUH A;  1VQL S;  3NY0 A;  4KFB B;  5HQ8 A;  1FK9 A;  1T9W A;  3HF5 A;  4AD6 A;  3GG0 A;  2RE1 A;  3W63 A;  4DR6 F;  2CJQ A;  3O5T B;  2VL1 A;  1ZET A;  3UW1 A;  1HNV A;  2H4W B;  4IDK B;  1UJ5 A;  2BJ3 A;  4B9V A;  1HMV B;  3A8E A;  3W8P A;  1QUP A;  3BGF A;  4FP9 A;  3OSN A;  2J8A A;  2WBR A;  4DR6 J;  2GVD A;  4YOE A;  3DLG B;  1O0P A;  1WI8 A;  1UTA A;  2FLO A;  1GNK A;  2XUL A;  2CZ4 A;  2IAJ A;  2OFG X;  2VOO A;  3CSK A;  1XK8 A;  3RZA A;  2HRY A;  4JV2 A;  2EC2 A;  3JSM B;  1VQP S;  1P1L A;  1FE4 A;  4OI4 A;  4RPF A;  3D6H B;  1QSS A;  1FO1 A;  1XTZ A;  4NLY A;  3PIP Q;  3IAM 9;  4M5D A;  3TNV A;  4IOB A;  4FF2 A;  2LU2 A;  4QWB A;  5D3G A;  3Q8P B;  4YB7 A;  3R7N B;  2BW7 A;  2YKM A;  3TAP A;  3CED A;  4I1T A;  4C6A A;  1N5S A;  5FLX Y;  4MH8 A;  4KAI A;  3EPI A;  3LW5 C;  2FGO A;  3DI6 A;  2QZ8 A;  3R27 A;  2M70 A;  1ROF A;  4I2Q A;  5J2M A;  3MEC A;  4MFB A;  3U7J A;  1NAQ A;  2DXF A;  2EK6 A;  3MR5 A;  2FJX A;  1NU4 A;  2HAI A;  1VI7 A;  2V8V A;  3FZB A;  3GQC A;  5CYJ A;  1KOO A;  2D9P A;  1Y9O A;  2YNH A;  2JWN A;  1HQE B;  5H9E K;  3K17 A;  1JLB A;  1VRT B;  2CFX A;  4C3M A;  4CH0 S;  4J9Q A;  2GMJ A;  1PIE A;  3R7B B;  1UZH A;  1LW2 A;  1B7F A;  2ZH7 A;  3V4M A;  2WRM A;  1H0H B;  3KJV A;  4QOT A;  2UUA F;  3GYN A;  4M95 A;  4LSN A;  1S6U A;  4ZKA A;  2GNK A;  5J1N A;  4RZR A;  1CC7 A;  4PWW A;  3MDF A;  3AA9 A;  4C2M A;  2COL A;  4LIR A;  4LF8 J;  3P4U B;  3EXC X;  3T5L A;  2H65 B;  3CMQ A;  2BA9 A;  2F65 A;  4NZ6 A;  3O3L A;  3F41 A;  5AXN A;  2LLZ A;  9RUB A;  2V4Q A;  3GFX A;  5T7L A;  4BC9 A;  2FB0 A;  4RLE A;  1BQN B;  3CJT A;  2HHU A;  4HEA 9;  4RL1 A;  4KIA A;  3IG1 B;  5KOX A;  1WHW A;  3M6X A;  4PXC A;  4U9R A;  2DO4 A;  1RP5 A;  3PM9 A;  3ZFV A;  4O3N A;  5EHH A;  2YNG B;  1LV5 A;  2KU7 A;  1G4C A;  3L9Z A;  2JZ5 A;  2VC1 A;  3Q23 A;  4DS4 A;  3Q24 A;  4WFX A;  3I5C A;  3VQT A;  4IH7 A;  1IXK A;  1WDD A;  2GQQ A;  3EXY A;  4ZP7 A;  2GQC A;  3LTO A;  5CH7 B;  3ISN D;  5HSP A;  1YJN S;  2OPR B;  3M1V B;  1NXI A;  4OYB A;  2FPH X;  2BXJ A;  3NGR A;  3A13 A;  3SI8 A;  3UDC A;  2DNZ A;  3IRX A;  2DPJ A;  3D4J A;  1FRX A;  2XSJ A;  2PII A;  4NA1 A;  2B5J B;  1NLK L;  1CJT A;  4NZ7 A;  1NDP A;  1S7H A;  3T1H F;  3I0R B;  2UP1 A;  4NCB A;  4HL9 A;  3N9U C;  3IO1 A;  4ED2 A;  4HDG A;  5KFG A;  1NHU A;  4I7F A;  2OTJ S;  3T1H J;  4HHU A;  4YME A;  2K1R A;  3B6B A;  2PFF B;  3SDE B;  2BAN A;  1S1X B;  2LYV A;  4DFJ A;  4IQM A;  2F8E X;  2CAD A;  1FJ7 A;  3NS6 A;  5A8K A;  3OTE A;  4HVZ A;  3MM8 A;  4CLK A;  4K4S A;  4B3R F;  3PDN A;  3M8W A;  5E33 A;  4DR7 J;  3ZZT A;  3GPA A;  2J6T A;  3C16 A;  1KFD A;  3LA0 A;  1X60 A;  2MJU A;  1L3T A;  4DV2 F;  2D3Z A;  3CJ8 A;  3UWT A;  3CCE S;  5DG7 A;  5KFO A;  5IXU A;  4OZ3 A;  3Q83 A;  2QLJ B;  1SV5 A;  3JAM Y;  1RKI A;  2VJV A;  3TW0 A;  5CYM A;  2LEP A;  4ZVO B;  4C3L A;  3NP5 A;  1C3G A;  3CCJ S;  1NK8 A;  4OJ1 A;  5HMW A;  3ITH A;  4DR2 F;  4DV2 J;  1YZ6 A;  3CUN A;  4DL2 A;  3ENA A;  3MMJ A;  1CBK A;  1F0X A;  4A8F A;  2H4Y B;  4DFK A;  3DHX A;  4DN0 A;  5KFV A;  4F50 A;  5DLG A;  2GHW A;  5AXL A;  5J2N A;  1FFG B;  4Z37 A;  2DRB A;  3KLF B;  7AT1 B;  4O3R A;  5GAH U;  1N52 B;  4E0D A;  3KK2 A;  2LKZ A;  2ZVS A;  3TVZ A;  2W7O A;  3R2D J;  4DX6 A;  3VGT A;  4LT6 A;  2CNO B;  2DH7 A;  2E9T A;  2HLU A;  5I42 A;  1ZAV A;  1DTQ B;  2C2N A;  3CCZ A;  3NCR A;  4CP5 A;  5A76 A;  1YQH A;  1JNR B;  5ETO A;  3MM6 A;  3PAC A;  4NX9 A;  4LF9 F;  1WC1 A;  2IJR A;  1UL3 A;  4NEY A;  4J9N A;  4EU0 A;  2IY5 B;  1TMJ A;  5HMX A;  1S1U B;  2F9D A;  2NCK L;  3GJT B;  4R0J A;  3GIR A;  3RYL A;  1VRQ C;  1H6K X;  1ULR A;  5IQQ A;  4WU3 A;  4C4W A;  2H5J B;  1JIH A;  4K4T A;  1PC5 A;  1HQU B;  5EWG A;  2UVU A;  2CJB A;  1U7L A;  2XC9 A;  2XLJ A;  2HNZ A;  2OEL A;  2R8K A;  1ZTT A;  3MMC A;  4TKT A;  4ED8 A;  1C2P A;  5F8M A;  4JI8 J;  1C1B B;  2HVE A;  1NO8 A;  2BAB A;  2KKH A;  2ZD1 A;  3MR7 A;  3O44 A;  3CCT A;  4GVL A;  3OV7 A;  2KRB A;  1F5A A;  5HO4 A;  5T14 A;  4JV5 F;  1RAG B;  3LAL A;  3MAH A;  3VR1 A;  4HYK A;  1VC0 A;  4PUO B;  3MHY A;  1LNQ A;  1TUW A;  5L1I A;  4L76 A;  1WOP A;  3UPF A;  2Z56 B;  2K06 A;  3UCU P;  3M2U A;  3ETM A;  5ETP A;  1ZM9 A;  4JV5 J;  2CZ9 A;  3C66 A;  3QT8 A;  2VG6 B;  4WPA A;  2OAU A;  2FVC A;  1VHF A;  4ECU A;  2MLY A;  3US5 A;  1U2C A;  2OFH X;  1QJH A;  1U47 A;  4L73 A;  2J9D A;  1VRU B;  2ZH2 A;  5IT9 Y;  3W2W A;  2CUY A;  1SC6 A;  1CS4 A;  3HP6 A;  3H98 A;  4LR9 A;  3BPS P;  5LMU F;  4H4M B;  1HBM B;  1S6O A;  3QRQ A;  1S1W B;  3GJQ B;  3R3T A;  4ZHR A;  2ZZM A;  2BQU A;  1N5Y A;  1RUS A;  5KFX A;  8AT1 B;  4ZIW A;  2GIF A;  5F3Z A;  2MTL A;  4B9S A;  1RT3 B;  1S9E B;  3QSY B;  1S7I A;  1KWM A;  3DRR A;  2FJD B;  2R7V A;  2FLN A;  2VKZ G;  2VIH A;  1D1U A;  3CD7 A;  2XLK A;  2FZG B;  1HBO B;  3WIU A;  3PYD A;  4DMZ A;  1MN7 A;  3TI0 A;  4ZMM A;  4C8O A;  4NPO A;  2UUW A;  3G4S S;  3BGL A;  2ZJP Q;  5D15 A;  4JB8 B;  1PJ5 A;  1DQ9 A;  2IBO A;  3HSJ A;  2M9K A;  2DYA A;  1IM6 A;  1LWF A;  2VFV A;  2GS8 A;  3GON A;  1DQ8 A;  2W2O P;  2QIF A;  4NRU A;  1RT4 B;  3MM5 A;  1RT2 B;  2VOP A;  4WU2 A;  2YX1 A;  4N47 A;  2AEM A;  4WZQ A;  1F9F A;  2WVD A;  1R43 A;  1DLO A;  3MUT P;  3J81 U;  1RK8 A;  2GHV C;  2I5J B;  2DGT A;  1C4A A;  1WNE A;  2V5H G;  4DL3 A;  1FJE B;  2V50 A;  4DS5 A;  3DRS A;  2R42 A;  5CAA A;  5LSO A;  1T11 A;  3SMZ A;  2XB2 D;  5KFD A;  4IRD A;  3V6D B;  1NK9 A;  4KPY A;  1QM9 A;  3DM2 A;  2XY5 A;  2F7V A;  2E1R A;  3FCV A;  2LP4 A;  5KFM A;  3BQ1 A;  1P9Q C;  4JOU A;  5LXY A;  5E3C A;  1R31 A;  2RKI B;  1RU2 A;  3BQ2 A;  2HVZ A;  1JLF A;  2LDY A;  3OTO J;  1EET A;  2DNH A;  3AGX A;  4ECT A;  2DGU A;  2VH7 A;  3SIP B;  4UQG A;  1MN9 A;  2V68 A;  2CZV C;  3MCO A;  4YB1 P;  3QT7 A;  2XMW A;  1T9Y A;  4ID5 A;  4HDH A;  1YJW S;  3C15 A;  1SKW A;  1PSD A;  1OQ6 A;  2XMU A;  2OPS A;  5DQG A;  4J5O A;  1LWC A;  1RYR A;  2NPI A;  4M8L A;  1I51 B;  1FVQ A;  2VBX A;  2Z57 B;  2A3J A;  3H20 A;  2ASL A;  1WKK A;  4KO0 B;  4PXB A;  2CPD A;  2G4B A;  3U27 A;  4TQR A;  4G65 A;  1O8B A;  3V6H A;  3D1Q A;  5D6G A;  1RWU A;  4CLY A;  1VQO S;  3R9L A;  4CWB A;  1RWK B;  4JI7 J;  3VZH A;  2QLF B;  2QYG A;  4GRS A;  3BH6 B;  5JXS A;  2ZHA A;  1JWW A;  4LSL A;  3PYF A;  1X5T A;  1VGY A;  1HBU A;  4P72 A;  4YS2 A;  4WP3 A;  1WD6 A;  3BO2 A;  1F6T A;  1S49 A;  2W4C A;  4OZ2 A;  2VG5 B;  3QO9 B;  1H38 A;  4B9T A;  3PXG a;  1UVM A;  4B3T F;  1J5O B;  3FQL A;  1JKH A;  2CQ0 A;  1Z2Z A;  2IPO B;  4RO0 A;  2HS0 A;  3DXB A;  2C3U A;  3MFH A;  3EM1 A;  1IBM F;  3GSI A;  1NJZ A;  2IM0 A;  1HI1 A;  2ZDP A;  3GMG A;  4B3T J;  1YJV A;  4DR4 F;  3CPW R;  5I3Q A;  1BQX A;  4NCA A;  5GAH I;  2GQ2 A;  2EVZ A;  2VDI A;  5CYQ A;  4RU2 A;  2ZC4 A;  3ZZ0 A;  2RQC A;  1FKP B;  2YX7 A;  4RW8 A;  2MHN A;  1HYS B;  3MMB B;  3QIP A;  4B9U A;  4WJB A;  2JEJ A;  3BBB A;  2DIT A;  1Q8K A;  4JI4 J;  1R6Y A;  4DQP A;  5KT6 A;  2OEJ A;  5CA5 A;  2ZBQ A;  2EW9 A;  4ED3 A;  3PFE A;  3TZW A;  5CZV A;  4BC7 A;  5EWF A;  2BRK A;  3TAM A;  3VGU A;  4X62 F;  2GHP A;  2C2D A;  5L39 A;  1VJQ A;  3S6E A;  3RRK A;  3RR7 A;  1I94 F;  1Y5L B;  2CPF A;  4I0W A;  2N3O A;  1JLQ B;  4NYO A;  1TVR B;  1FRI A;  4X62 J;  1JJ4 A;  4F25 A;  1YX2 A;  4FNI A;  2BBE A;  3AGY A;  1JQG A;  1AXQ A;  1XMB A;  3TZZ A;  4OHX A;  2YKP A;  5FDL A;  1I94 J;  1VQN S;  3EUN A;  2Z2L A;  3TAN A;  2H5E A;  1VMB A;  2IJN A;  3JYT B;  2MXY A;  2W25 A;  4LFA J;  1Q82 T;  4NL5 A;  5C25 B;  1FHT A;  1S59 A;  5DRK A;  4LRD A;  1G7C B;  2YQ0 A;  3U1M A;  1D8Z A;  4HHH A;  4ECQ A;  1KD1 T;  5ETQ A;  2AYM A;  2MKS A;  2MLZ A;  4RUC A;  4FNH A;  2XWX A;  5HMY A;  2YVS A;  2PN6 A;  3HPO A;  3HVW A;  1Q1K A;  2MMY A;  5A0Y B;  2XGQ A;  4X4V A;  3KJN B;  3N5F A;  2FGC A;  3TX8 A;  3DLJ A;  3VAL A;  3QRP A;  1FRL A;  5JVH Q;  2C28 A;  4M5G A;  3C5X C;  3M6U A;  2KN4 A;  2F63 A;  1F9E B;  2G2Z A;  3X3U A;  4FN5 A;  2HS4 A;  3KK3 B;  4ICL B;  3J7A 1;  3CDB A;  1TL1 B;  4LQ3 A;  2R2U A;  3M7V A;  3G82 A;  1VCT A;  4WFY A;  2GVZ B;  1JXV A;  4F8R A;  3MOZ A;  5DDQ C;  1PYT A;  4TQS A;  3EGN A;  4OHW A;  1HD1 A;  1D9D A;  3DRX A;  3DYA B;  2XI3 A;  4GMK A;  4C8Y A;  2DXD A;  2CQB A;  4XTT A;  4IG0 B;  1HAR A;  3J7Z 5;  3QJJ A;  2R7Q A;  3TAR A;  1RWP B;  4C3K A;  2X1A A;  4RWW A;  2FHJ D;  3O2I A;  5J1E B;  3Q0A A;  1WG5 A;  1BE4 A;  2WSF C;  1TV6 B;  1N8R T;  1H3D A;  1VLY A;  2J0Q D;  1PO6 A;  4NYP A;  3WC0 A;  2K2P A;  1ZYQ A;  1TFW A;  2LU1 A;  1CUL A;  1RWW B;  1RT1 A;  2XNQ A;  3KLI B;  2IRX A;  2IBK A;  5C42 B;  2YTC A;  3EVW A;  2VC0 A;  2HUR A;  5A8W A;  2ZOF A;  3CJR A;  4TVA B;  2V9W A;  4QCL A;  3DHW C;  4MAK A;  4DSI A;  3Q86 A;  2Y9H A;  1RE1 B;  1UET A;  4WE1 B;  1L3S A;  2HQC A;  2GO8 A;  2AYG A;  4A46 A;  4Y6I A;  3GV7 B;  4K0K J;  2BE9 B;  2F4F A;  2C1E B;  2ZNZ A;  4M5K A;  3MAA B;  2CNL B;  4EBE A;  3R1L A;  3TOQ A;  4PR6 A;  4OJH A;  2BOA A;  4AT1 B;  5DET A;  3CO9 A;  1S77 D;  1TL7 B;  3FQK A;  4QR1 A;  4DUY F;  3HXM A;  1JLC B;  4PPD A;  3AT1 B;  5I3U B;  2VFS A;  2KYZ A;  2AJ1 A;  1RHJ B;  5CD4 A;  2IDL A;  4MYU A;  5I3P A;  2NXJ A;  2DHG A;  3BPD A;  1S1T A;  2BM1 A;  1QAJ A;  2VKR A;  4OX6 A;  1N0V C;  2QA4 G;  4NYZ A;  5K20 B;  1TK5 A;  2KYX A;  4C8N A;  2VBY A;  4CH1 A;  2HNY A;  3PVX A;  1X4B A;  3KLE B;  1K1S A;  4FS1 A;  3QFH A;  2MY7 A;  5SZT A;  2Z8Q A;  1GK8 A;  2CPI A;  5IT0 A;  2B9Y A;  3CJQ A;  4HTJ A;  4TY9 A;  4A47 A;  3TA0 A;  1FRK A;  1Q78 A;  1HL6 A;  3IS9 B;  4LMZ A;  4IUF A;  1X4H A;  4IDK A;  4MIW A;  1H2V Z;  2GC8 A;  2G9O A;  2AJ0 A;  3IGV A;  4ZVU B;  2OEK A;  1HMV A;  2MQN A;  2P6S A;  3G6Y A;  2DGX A;  1ZTW A;  2OD4 A;  2DNK A;  4A8M P;  1KLN A;  3DLG A;  4J9M A;  2IHR 1;  3GZ7 A;  4ZA1 A;  3WZ0 A;  3MUV P;  4UZB A;  2QLW A;  2N4D A;  1E6Y B;  5B7W A;  1RT6 B;  1VC5 A;  4AXJ A;  2BJE A;  1HW8 A;  4Q5V A;  3J7Z T;  3PHT A;  2I0X A;  1XR5 A;  2XS2 A;  1SUQ B;  2HQ3 A;  3FGV A;  1UPP A;  4RW4 A;  2VA3 A;  3MM9 B;  1M5O C;  3W3S A;  2A18 A;  3NOG A;  2NUH A;  1NH8 A;  3HZG A;  4C8Z A;  5K14 B;  3WDO A;  1TKT A;  5IC4 B;  4B3S F;  1DAX A;  5IM0 B;  4OYA A;  2RQ4 A;  2CQC A;  3MUR P;  5A8R B;  2HYI B;  3PYE A;  1Y7P A;  2KXN B;  3OXL A;  3TUP A;  2ACM A;  5KG2 A;  3GV5 B;  5AJ3 F;  3TJ9 A;  4DR1 F;  2FY8 A;  1L5U A;  4B3S J;  2FVP A;  3PW5 A;  1JXE A;  4EWT A;  4DFM A;  4P52 A;  3A8J A;  1OPZ A;  1GXT A;  2E5H A;  4DX8 H;  2R2R A;  4JI2 F;  3V6J A;  4S0M A;  3HFZ B;  2JFD A;  1H72 C;  3HVT B;  2HBR B;  2CJ9 A;  4HT5 A;  2FLL A;  2UXC F;  3K2Y A;  3NG8 A;  1VRT A;  2GO9 A;  3CJK B;  3SCI E;  3C6E C;  3OFH A;  1JB0 C;  4KT0 C;  4JI2 J;  2GFF A;  5FLX U;  2W4P A;  1SL1 A;  2XM3 A;  2KJW A;  3VAM A;  2ASD A;  1NPP A;  4EYH B;  2AMC B;  4OX7 A;  4NML A;  3MGJ A;  4LVO P;  4U8Y A;  3OT9 A;  4X2B A;  2OP5 A;  1B70 B;  1X5P A;  3FUY A;  1QTM A;  3DU6 A;  2P2C B;  5LOQ A;  1GMU A;  3H59 A;  3NOC A;  4ECY A;  2Z2Y B;  4CNY A;  3OUY B;  3M9N B;  2VF3 A;  1BQM B;  5BYQ A;  1UA0 A;  5CXT A;  2XO7 A;  4ZJQ A;  1TL4 A;  3TAQ A;  5ETK A;  4TYB A;  5KFT A;  1H2U X;  3CVK A;  4CCH A;  4WXO A;  4FYD A;  4GKK F;  2AYE A;  1YDL A;  2M3D A;  2CYY A;  5H9F K;  2LEC A;  1RAA B;  2E66 A;  5DDP C;  4QWE A;  3T41 A;  5ETN A;  3A3P B;  1CQM A;  4P10 A;  4GKK J;  2OSQ A;  1D3W A;  3HUL A;  4O3Q A;  3BKU A;  5ETV A;  1TKZ B;  2PEB A;  5L1K A;  3RRH A;  2C2R A;  4RBV A;  2AGO A;  2EFN A;  3VAH A;  4DQQ A;  3K5N A;  3MPY A;  4LIW A;  1S57 A;  3I6P A;  3LP2 B;  4DX5 A;  3NEK A;  5HLF B;  1ITP A;  1EX8 A;  2LQB A;  3AJD A;  2RVJ A;  1U24 A;  3M1V A;  3IWL A;  4Y00 A;  1N6Q B;  5D77 A;  3HHK A;  1GXL A;  2J7K A;  2DNR A;  3QZ7 A;  3R5J B;  2G1H A;  5EUH A;  2P5V A;  5K9F A;  2KT3 A;  2B5J A;  2E1A A;  4KGX B;  3FSX A;  4Z7C A;  1HNZ F;  2D7S A;  3FBF A;  1UW9 A;  2HBZ B;  4WXW A;  4ZVS B;  3G6E S;  2QL9 B;  3M2V B;  3I0R A;  3JTO A;  2CKW A;  3FSY A;  2OHD A;  4KQZ A;  1G2E A;  2W8L A;  4NCG B;  3MR6 A;  1HNZ J;  1X0P A;  1RAC B;  3ZXW A;  2DIS A;  3BJY A;  1JLE B;  4YR0 A;  4RJV A;  3LAM A;  3RAX A;  4USK A;  1RTD A;  3SDE A;  1S1X A;  2JJ4 D;  1Q16 B;  5JMN A;  1HR0 J;  4DQI A;  4LF5 J;  4CLP A;  1ICE B;  3BRE A;  1QSL A;  1VQY A;  3MPU B;  4ERD A;  2E9R X;  1SKR A;  4PAB A;  4ZJL A;  1C0T B;  3A1Y G;  1MU2 B;  3HT3 A;  2CPJ A;  3DLL Q;  2FQQ B;  3QPI A;  1N32 J;  4Y3C A;  5GMD A;  2E7W A;  2ADC A;  4I69 A;  2HSE B;  1LFP A;  3FDS A;  4QIF A;  3AH6 A;  2P6T A;  3AA8 A;  3TP2 A;  3PX4 A;  4CO2 A;  4U96 A;  4Z7Y A;  1IKV A;  1C0U B;  3PIO Q;  1D0E A;  3P49 B;  2V9K A;  5LMN J;  1IWG A;  1ARO P;  5ITH A;  1WJ9 A;  1ZM2 A;  4DV0 F;  3C3L A;  3HSD A;  3R6G B;  4OI6 A;  4XPE A;  4IOA Q;  5HK4 A;  2HVI A;  4XO0 A;  4LRF A;  1NME B;  3JAM U;  1TUG B;  4LBH A;  4P2F A;  2ZBP A;  3IWX A;  1GFW B;  1DTQ A;  1SJQ A;  3KG1 A;  5EDW A;  1NKC A;  3HMJ G;  1NDC A;  2D74 B;  3GU0 A;  1JJ2 R;  3M2R B;  1RTI A;  1WAC A;  1KR4 A;  1LKZ A;  4FXD A;  3HFK A;  3SV4 A;  2XBP A;  3LH2 S;  4R8U B;  1S1U A;  2EPI A;  1T3N A;  1S6P A;  3OR2 B;  3HD2 A;  1Q7L B;  4MTP A;  2CQ4 A;  3MMA B;  3GFY A;  1AZS B;  1C1C B;  1F3V A;  4EGL A;  3MTJ A;  2IRU A;  4DR3 F;  2W9B B;  2R4F A;  2J8S A;  1N5V A;  1HQU A;  4B17 A;  3CDU A;  2J7W A;  2F4V J;  3NMR A;  3WBZ A;  2V4J B;  4B3O B;  2DNL A;  4CO4 A;  4OI1 A;  4ITS A;  1C1B A;  3K8W A;  4ED6 A;  4DR3 J;  1UFK A;  2CDR B;  2QA1 A;  1FCA A;  2JEI A;  4XDD A;  2J9C A;  3H8Y A;  4PUO A;  4EO6 A;  1WI6 A;  5KFN A;  1IBK F;  2N82 B;  3MEG B;  3POT B;  3W9I A;  5AT1 B;  1VQ4 S;  3KHG A;  2AJF E;  4AL5 A;  4HT7 A;  2VG6 A;  2AZ1 A;  4ZVT B;  2ACY A;  4NLQ A;  4O0N A;  4L6V 3;  2NR0 A;  3DOL B;  1T8E A;  1PYS B;  4N7T A;  4Y2C A;  4PCQ A;  2RS2 A;  1N36 F;  2UXB F;  4QBU A;  2X3G A;  1NM2 A;  3VVU A;  2M7S A;  2HMI A;  3LOU A;  3TQE A;  4RW7 B;  3VAI A;  1HBM A;  1S1W A;  5J1P A;  2W01 A;  1LWE A;  4DU8 A;  2DXE A;  1M1K T;  4J9L A;  1IUJ A;  4P71 A;  4OX9 J;  1GMW D;  2QE5 A;  3RB4 A;  1HWJ A;  1TAQ A;  4DZD A;  3DGP B;  3QAE A;  2BQR A;  2WOM A;  1NDL A;  4AL6 A;  1DJ0 A;  2WZ1 A;  5IT9 U;  3IA0 A;  1HBO A;  3G87 A;  3AQO A;  3E2E A;  1UEK A;  2WW8 A;  3ELH A;  4OZ0 A;  3HVR A;  1HD0 A;  2HFZ A;  1NRK A;  2V34 A;  3BKF A;  2GGP B;  2W2N P;  1U26 A;  4Y28 C;  4DV1 F;  2JL9 A;  4KPC A;  4N5S A;  4DI6 A;  2JLG A;  3PKY A;  4DLE A;  5HRO B;  2NXC A;  1CLF A;  2ILZ A;  4BWM A;  2YWG A;  2YQ3 A;  1VK3 A;  2PMH A;  4BDP A;  5E7O B;  1RT4 A;  1HNX J;  3RUB L;  2ZWO A;  1RT2 A;  3QT5 A;  2OTL S;  1YJU A;  3JXO A;  1IKY B;  5IZH A;  1N56 A;  1R8P A;  4KH1 B;  3CDA A;  2ROG A;  4DV7 F;  1NND A;  2I5J A;  2BKN A;  3KWM A;  4W4M A;  2QLB B;  3KNG A;  3H5Y A;  2D3O R;  3I82 A;  4USJ C;  1RTJ A;  1NK0 A;  5DGB A;  4F0H A;  4AE5 A;  4UQT A;  1HWL A;  3V6D A;  4DV7 J;  1J5E F;  4UZC A;  4BWJ A;  2DGO A;  4NMX A;  4K4X A;  1FKO B;  1X9M A;  3ULH A;  5KFF A;  1DBD A;  1NPR A;  4CNZ A;  3UVJ B;  4ES3 A;  2F1F A;  1H2T Z;  2VAS A;  4C0O C;  3H90 A;  4NLP A;  2RKI A;  4FKX A;  3CIZ A;  1J5E J;  2RDJ A;  4Q45 A;  2HRT A;  3LP1 B;  4YUD A;  1U6Z A;  3ZZO A;  2DNN A;  3QYY A;  2X1F A;  2LA6 A;  4DG1 B;  2YWK A;  2C2Z B;  4OYM A;  1T9V A;  1NLT A;  2B26 A;  2BKP A;  4IRC A;  2ZWP A;  3PX0 A;  2BE7 D;  2XI2 A;  1AW0 A;  2VQE J;  1SL2 A;  2DCL A;  2AU0 A;  2BEF A;  2W4D A;  3CJ4 A;  4Q7A A;  3ILO A;  4FYV B;  2PDA A;  2B9X A;  2H51 B;  2QEX S;  3AHP A;  3OL7 A;  2HQG A;  2X7I A;  4KO0 A;  1BD6 A;  2ZEJ A;  3SCL E;  3D6F B;  1W26 A;  2DNP A;  3RBE A;  1QSY A;  3QBC A;  5KFP A;  4G1Q B;  4CYU A;  4HI2 A;  2I1R A;  1BUX A;  3OXG A;  2OPP B;  2E5I A;  2UUT A;  3PJX A;  2WSC C;  1KEK A;  1KNZ A;  2RML A;  3QSI A;  5B0A A;  2FIU A;  4PYD A;  3V4I B;  2XQC A;  3B4D A;  4J9U E;  3NGK A;  4DPU A;  2C22 A;  3WHI A;  4RW9 B;  4EZ6 A;  3TA2 A;  4JYA F;  2JSX A;  4RKU C;  4URS A;  3TO8 A;  3D67 A;  2VG5 A;  3TEG A;  2WVF A;  2BOP A;  5F3T A;  1WEZ A;  3KK1 B;  1YVF A;  3EIC A;  4P2S A;  4JV1 A;  1ZM3 A;  1P8G A;  4JYA J;  2HAF A;  2ZJR Q;  3IM8 A;  3TX0 A;  3BV8 A;  1XNQ F;  4B3M F;  2AQ4 A;  2CQG A;  1UJ6 A;  2XS7 A;  2E5L F;  1KKH A;  5LM7 E;  2XMK A;  2HK2 A;  5IOL A;  3W64 A;  3DRP B;  1T9T A;  5IQ6 A;  3K5L A;  4DV6 F;  3M9M B;  4CO5 A;  1RAO A;  2I2Y A;  1WHY A;  1R0C B;  1FKP A;  3GR1 A;  2YNF B;  1TL3 B;  2MKJ A;  1FNO A;  1FD8 A;  1HYS A;  3H5S A;  3TUJ C;  2MYF A;  3MMB A;  1HNW F;  1YIT S;  1I6J A;  1L3K A;  3R8Y A;  3E01 A;  2DGV A;  2B3T B;  1S97 A;  2A0F B;  2MQM A;  1KHW A;  2ROP A;  2D3O 1;  2CRL A;  1VC6 A;  1HNW J;  1S79 A;  4KHP J;  5THW A;  3RB6 A;  3Q8V A;  1JLQ A;  2G1D A;  4PG5 A;  4KBI A;  1FJC A;  2GCF A;  4ILL A;  1TVR A;  5JJB A;  2VQF F;  3CXC R;  2MZJ A;  1BC6 A;  1U1O A;  1KVJ A;  3ET6 B;  1SL0 A;  1FF2 A;  1TL5 A;  3BSO A;  1UCN A;  1X5S A;  4FYX B;  2DIV A;  3JSB A;  4IRK A;  2OKQ A;  3DGV A;  4CLU A;  2KXH A;  5EX3 A;  5M2U A;  2Y3Y A;  5C25 A;  4X4U A;  1EQM A;  3SFU A;  4WF9 Q;  1VQ6 S;  3EE3 A;  3W60 A;  4V19 X;  2C42 A;  2LEB A;  4DF8 A;  4N41 A;  4X66 F;  5DDR C;  4GVB B;  1JNZ B;  3VQS A;  3UNG C;  1FWK A;  3VF0 B;  3OSP A;  1OSD A;  1LW0 A;  5DQH A;  2HKE A;  5E41 A;  4JI5 F;  3Q89 A;  4FPR A;  5A0Y A;  2R7R A;  1FA0 A;  1S0N A;  1MLA A;  3KDO A;  1HHS A;  5JVG Q;  4QYR A;  4NLX A;  4TY8 B;  1XMO F;  3CW2 C;  4E8U A;  4H4K A;  4DSL A;  2OPQ A;  4ICL A;  1NHV A;  2MKY A;  1TL1 A;  2Q66 A;  2O5D A;  6FD1 A;  3UCZ P;  1YBT A;  3FRY A;  2ZH8 A;  2WVB A;  4O4G A;  3LWL A;  2H3E B;  1WDT A;  2UUB F;  3BKT A;  3H2L A;  1WSV A;  1UEU A;  2OML A;  4N77 A;  4R0E A;  2RU9 A;  1VQM S;  4JUZ A;  2HGM A;  3T3F A;  2CG8 A;  2QT7 A;  4IG0 A;  3LPY A;  1HI0 P;  4FF4 A;  3P5T L;  2UU9 F;  3D5M A;  4J9O A;  1OYE A;  4N8O A;  1OY6 A;  2UUB J;  1U0S A;  2EFG A;  3NAH A;  3ENV A;  2E7V A;  2VJU A;  1R3N A;  2IAJ B;  5C2C A;  1TV6 A;  1GTE A;  2N7Y A;  3RBX A;  4UUX A;  2DR9 A;  4UY8 5;  2RHS B;  3UCG A;  2EKY A;  1XNR F;  2R8I A;  4ZS6 A;  1RAI B;  5KFZ A;  3PO4 A;  5U47 A;  2ZH3 A;  3A3N B;  4M5D B;  1LQ9 A;  3IN5 A;  4Q8F A;  1RAD B;  4WYW A;  4GC7 A;  5D3G B;  1XNR J;  3DLH A;  4QJV A;  5B0D A;  3WX4 A;  3KHH A;  1U2F A;  1MMD A;  3FMB A;  3EZU A;  4F3O A;  3TZX A;  4MIA A;  1QDU B;  3CF5 Q;  8ATC B;  3IXQ A;  1M5V C;  4YDX A;  4X4T A;  3MZI A;  5J2M B;  3MEC B;  3MAA A;  1U45 A;  1VLO A;  1DHM A;  1QVF R;  2AKW B;  3NWG A;  4F0M A;  3CCV S;  4K4Y A;  1IQZ A;  1TK8 A;  1TL7 A;  4WFN Q;  4F7V A;  1CC8 A;  1PAU B;  3RAM A;  2YNH B;  1JLC A;  5I3U A;  4A8K A;  4CO1 A;  1JLB B;  5ETM A;  4PWD B;  4CH7 A;  1RWV B;  3T1A A;  2DNG A;  4LF6 F;  1KN6 A;  3FFI A;  3D0I E;  2P9G A;  3NGU A;  2RU3 A;  1TP7 A;  4YR3 A;  3I4P A;  4C0B A;  2KL8 A;  4NOH A;  4BS2 A;  2LQJ A;  5LL6 d;  3KLE A;  4WKY A;  5K8M A;  5KFQ A;  4LF6 J;  3EDQ B;  1K0V A;  3VTI A;  2V69 A;  1LEO A;  2QA4 S;  2ZH6 A;  3BSA A;  1HQ2 A;  5G4D A;  1KTQ A;  2PGC A;  3BDP A;  5HQM A;  4HHJ A;  3FBE A;  1Q7Y T;  3IS9 A;  1N5Q A;  2JEF A;  1FRM A;  3TUZ C;  1PBA A;  2DCU B;  4QR2 A;  2ILY A;  3VWS A;  2FVR A;  4LFB J;  4OQJ A;  4DXL A;  4FDF A;  3A12 A;  2WW4 A;  3GYX B;  3FSI A;  2MZQ A;  5E3Q A;  4J91 A;  1E6Y A;  1FRH A;  4ZN1 A;  2FHK A;  3GCX P;  4TLQ A;  1RT6 A;  5CCM A;  4C97 A;  5SUH A;  3PW2 A;  3KKF A;  1TU0 B;  2F40 A;  3Q2S C;  4MKY A;  4TN2 A;  1RQ0 A;  4NXN F;  3C6T B;  2PO4 A;  4LJM A;  4ATN A;  1SUQ A;  3OVS A;  1NJI T;  1KON A;  5A2Q Y;  3BN4 A;  3LZ8 A;  3QT6 A;  1U0H A;  2WTF A;  1QAY A;  2N4C A;  1U49 A;  3OFE A;  2Y1L B;  2MPU A;  4UY8 T;  3BR9 A;  2J6S A;  5A8R A;  3GV8 B;  2ZJQ Q; 
#chains in the Genus database with same CATH homology
 3AGY A;  4J80 A;  3LA0 A;  3NXZ A;  2QLD A;  1NLT A;  2B26 A;  1EAR A;  1EB0 A;  3AGX A;  4L3K A;  3L9Z A;  1XAO A;  2Q2G A;  3NY0 A;  3I38 A;  1GMW D;  1GMU A;  3LZ8 A;  3TJ8 A;  3TJ9 A;  3AGZ A;  2HFV A;  1GMW A;  1GMV A;  3TJA A;  1C3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...