3NY0A

Crystal structure of uree from helicobacter pylori (ni2+ bound form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
147
Chain Sequence
IIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 37
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3ny0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3ny0A02
1XAOA 1GMWD 1GMUA 3LA0A 1GMVA 4L3KA 1C3GA 3I38A 1GMWA 3LZ8A 3TJ9A 3NY0A 2Q2GA 3TJ8A 2HFVA 3AGYA 2B26A 3NXZA 1EARA 1EB0A 3TJAA 3AGXA 2QLDA 1NLTA 3AGZA 3L9ZA 4J80A
chains in the Genus database with same CATH superfamily
2M5YA 3RRKA 2CQ0A 2NR0A 2AX1A 4ECVA 4DV1F 3ZTOA 4B3MF 3DLKA 2CZ4A 2PI4A 2UP1A 2XYGB 3FCHA 3QT7A 2CKWA 4EBDA 3ENAA 3N5BA 3ILIA 2CPXA 4JYAJ 3I4HX 5D0EA 3R7SB 1Z2ZA 2XLKA 3O2IA 5AXKA 2JRRA 2OPRB 1RYSA 2MQPA 3LP1B 1VRUB 3W5YA 3MTJA 2XZTB 2BANA 4JOUA 2XS5A 1N56A 4ANDA 1C1CB 2KFNA 2ZVIA 1VIOA 6FD1A 5L1JA 4DMZA 2HHHF 4BCAA 2W9AA 4Z7CA 2UUCJ 2CJKA 1VBKA 2V6AA 2A0FB 3VGSA 2XGQA 4H4OB 3K2YA 4MAKA 5IV3A 3CIZA 3Q0AA 4UY85 1JWWA 4RW7A 7FD1A 4DR2F 4ZVFA 3PJWA 4J9PA 1XIQA 1KD1T 3OL9A 2V2ZA 4OYZA 2BMBA 2IRXA 2UXDJ 2JDJA 4TY8B 4EI2A 2DRAA 3TX8A 2XYPB 2LLZA 3A13A 4WFBQ 3BYPA 2LXUA 2VPWB 2WBRA 1UVLA 4OYMA 4FXWA 4QZVB 1YZ7A 2BJEA 4PQUA 3P8BB 2HIYA 2W7OA 1RB0A 5DJBA 5D6GA 2J6UA 3T6JA 1Y11A 4JI7F 2QFIA 4PUOA 1LK5A 3EJMA 1PAEX 1BQNB 3EGWB 4W98A 2A1BA 4NYOA 3IM8A 5D3GA 1IN0A 3MECB 4MYTA 2DTJA 4RNNA 4PWDA 4DOZA 1VHFA 4LF8F 4DX7A 1F5CA 2ZJRQ 1E6VA 4ANCA 3GG0A 4MIAA 3I6PA 3K8WA 3O5TB 1SJFA 5DG8A 5DO2A 3D3BJ 3RW7A 4LFBJ 2CQPA 3BPSP 1YQHA 5BR8F 4AL6A 5T7LB 4O3SA 1HR0J 2HVDA 3PEJA 5KFXA 1TK5A 5G0RB 5HP1A 4F3QA 1NHVA 4RPFA 4MIBA 3HLUA 1HIYA 3M30A 4B3OA 4PG4A 4UQGA 3HT3A 2KXNB 3EUNA 3EVOA 3W61A 2XSFA 4U6PA 8AT1B 4TN2A 4CNZA 4JV5F 1V3RA 2W8KA 4A46A 5D4PA 2G2OA 1IKXB 1X4CA 1LEOA 3IG1B 1WHVA 4DUYF 1CJKA 1QTMA 2W1BA 1UEVA 4B9VA 2MZSA 3OUYB 3EPGA 4KR0B 2V8GA 4C8KA 5J1EA 1AW0A 4UOGA 4ED3A 1IBCB 1X4AA 3AFGA 4ETXA 2L08A 2EFVA 4DR6J 3KKFA 2BKNA 2RQ4A 3P5BP 4IG0A 1YSJA 5L1KA 3OFGA 4ILRA 1S1UB 2HAFA 4RO0A 3TNVA 2CRLA 3R5GA 4XO0A 2FJDB 4ZVEA 2PI5A 1NNDA 2MJUA 3TEGA 1XN9A 4DR4F 3BKTA 3TZWA 2QLXA 1OYDA 3KUHA 5GMEA 4OJGA 2ZE2B 1X5OA 5M2UA 1HNWF 1Q8IA 3G8QA 2J6SA 1R7IA 1CJVA 3NAHA 2ZNYA 4EYIB 1DRZA 1MW7A 1RTHA 1N32F 2W7PA 4Y2CA 3EZUA 4CP5A 2FTRA 1ICEB 2IA6A 3H5YA 4TQSA 3P3DA 2KL8A 1S1VB 3W9JA 4DV6J 1S0MA 3D6FB 1RTIA 3VWSA 2V4QA 4HR2A 2BR0A 1IVZA 3DNCA 4C8NA 3M8RA 2IM2A 5KT5A 4WP8A 2OJ3A 3HJFA 3JAMY 3W9IA 1FE0A 2RHSB 2PEBA 4H4KC 1WWHA 4XK8C 2VC0A 2N82B 2CDQA 2BQ3A 4LQ3A 4M5DA 1NB2A 2Z2MA 2Z57B 3OSPA 3ULHA 2IRYA 4F26A 2JC1A 4YFUA 1X5TA 5CCMA 5L9NA 4K4WA 4IH7A 2PN6A 4UZCA 2B6AA 3MEEB 1I6JA 3MM5A 2CWXA 1JNZB 2U2FA 3LO3A 1TL1A 3TRGA 3QSYB 5K14B 1FNXH 2OPSB 3LWMA 1KS2A 3MI7X 2BJ7A 1VK8A 4TXSA 1AUSL 1JKHB 3J7YU 4F4KA 2H1YA 1U45A 2CPHA 3GU0A 4K4UA 4B3TJ 1JMTA 2XMAA 3I5CA 4ZS6A 4FNHA 3RBEA 3DM2B 3B6BA 4O0IA 2QV6A 2KZMA 1UVJA 1UJ6A 5IZHA 1Y5NB 3J80Y 1L3SA 4QWBA 4ZVUB 2ZDOA 1WC3A 2ZM6F 5IC6B 5KFEA 3T5HA 2IM1A 2QLWA 1B0PA 1GFWB 4C9DA 1I5OB 1UWBA 4TU8A 1RT1B 4A8XA 1BGXT 1H74A 3G96A 1GXLA 1LXJA 4DWIA 4I0WA 3BREA 1M0SA 2DNQA 1IQZA 4NA2A 2VBXA 1X9WA 1RWVB 4ES3A 3KJNB 4I2QB 1IKVA 2CPYA 5JMNA 2BA9A 2BRKA 3AD8C 1VQ8S 1H7XA 1U47A 2JEGA 3MR3A 1TKTA 4L76A 1LXNA 1VRQC 2B9YA 2F4FA 1AZSA 2OPQB 2H9ZA 3DXBA 5DLGA 4YY3F 4LF6F 1G1XA 4ICLA 1SIWB 4C3MA 1VLOA 4PG7A 4DQPA 3KNAA 3HO1A 2IM0A 2VPZB 3RUBL 2XC9A 3DHWC 1KSPA 1HI1A 2AMCB 1CJTB 3BDEA 3D0HE 3HHLB 1HI8A 3DOKA 1F6TA 4ZITA 3CCSS 1SV5A 1AB8A 3ETMA 2YPZA 1Z4UA 2DNMA 3SSRA 3V5RA 3F44A 4Q2LA 1RCOB 2DXDA 2HNYA 4B3RJ 3W8PA 1GTHA 2QLFB 2LEBA 5IS2A 4ED7A 4MK7A 2NQPA 2L9WA 4ID5B 5HATA 2ACYA 1FKOB 1SKWA 4PXCA 1C0TB 2W2QP 2CPFA 4QU6A 2KRBA 2IC3A 3M2VB 5C7PA 3M6XA 4CT9A 4ECYA 5HVGA 4CQ1A 2HGMA 1U09A 2W2MP 4OX6A 4ECXA 2FJEB 2IYGA 2JEJA 1TL7A 5IT4A 2NREA 5HK4A 1MROB 3RAQA 3LGNA 3PRVA 3ZTPA 2P2CB 2VBYA 3BO2A 1FFGB 2ZH9A 3NP5A 1S99A 2LMIA 2F4VJ 3NNCA 3C3LA 3DKDA 3TR5A 2AD9A 3S7RA 3IM9A 3DRYA 1R6VA 4LSLA 3D6HB 3WC0A 3R9LA 4FPIA 3CJRA 1UL3A 1CQMA 3R8YA 3I9ZA 3CDEA 1XQIA 2Z56B 2R7QA 1FRIA 1JLEB 4KQZA 4JV1A 3QGIA 1H2TZ 4EYHB 2AYEA 1VBZA 1VCTA 1X8DA 3FJ2A 1U1NA 1VQ5S 2WOMB 5DQIA 5L46A 3JTPA 2CQDA 2Y0BB 1J5OA 2EBGA 3QRPA 2P9CA 2YBVA 2V67A 3GJSB 1K0TA 2XHCA 4IFVA 1OO0B 3PFEA 1YRUA 4F67A 2I9SA 3C6EC 4WJBA 3R7BB 3SV4A 3MTKA 3MD3A 1WF1A 4ZKAA 2Y9HA 5C42B 3PV8A 1RTJA 2D7SA 2DVIA 5J1NA 3KK2A 9RUBA 4OV6A 2HS0A 1X9SA 5A6WA 1W2IA 1B0TA 4K5RA 1HPZB 2GMJA 2AYMA 3OV7A 1HBNA 2YXLA 2R2TA 3G82B 2KN4A 1PBUA 2ASYA 4XDCA 4GC7A 1XBWA 1U02A 3G9CA 1FEEA 1ELOA 4X65F 2Z2ZA 3V4IA 3C6UA 1S97A 3I0SB 3MMBB 4P2FA 4I6WA 3TVKA 4OYIA 1WG1A 1Q82T 2HRTA 2R7WA 5J2PA 4V19X 2F9DA 2OD4A 1C3GA 5A6PA 4DFPA 3X1LB 4Z37A 3JAMU 4R0EA 4ANEA 3H2UB 2DR9A 1RT6A 3THPA 4R0JA 3S8SA 4J5OA 2KG0A 3AD7C 3MM6B 3US5A 2M7SA 1YX2A 4JI0J 2UXBF 2MXYA 1G7CB 3AKOB 1KVJA 2NXNA 4WE1A 1LWFB 4MYUA 1FHTA 2GHPA 2EFQA 1RYRA 2GVZB 1SH0A 3N9UC 2DR8A 2K06A 3CCUS 3PJ9A 1JJ2R 1E6YA 3HZGA 2F9JA 3KFWX 3UVJB 1GX6A 2HQDA 4QPTA 1TL5A 4I2PA 3VAMA 3TI0A 2KI2A 4Y34A 1CULA 1TL3B 3DYAA 1FK9A 1WELA 1N36F 1R0BG 1RABB 4F2RA 1TUWA 4CH7A 4OX8A 4FVCA 2HGNA 2OIHA 2OO4A 1WEZA 2CQHA 4QYZK 1FJ7A 2DNPA 2J7KA 2J9EA 1RA7A 5FDLB 4PG5A 4J9MA 2JL9A 1TVRB 4ED0A 2AW0A 5IV4A 1Q8BA 1S12A 2XULA 3RW6A 3J80U 4RBUA 2AX0A 2XI3A 2ZC3A 1P6TA 5BJRA 2GHVC 3OD2A 5E0OA 4DV4J 3HD2A 2H51B 4LBPA 4M5LA 3W65A 4Q5VA 2LVWA 3UW1A 3BBBA 4DPXA 5CD4A 3KWMA 3M6UA 1HWLA 1I51B 2DKOB 1FD2A 3H2LA 4A8WA 1ZBTA 2MLYA 3NGKA 4OZNA 1T9WA 1P27B 1HHQA 2QX0A 2YKQA 3POTA 5D0GA 3NGSA 1WI8A 3RB6A 3QFHA 3R1LA 4FYWB 3HHEA 3W60A 2I2YA 2UZAA 4DLGA 1NJZA 1FJCA 3M8YA 4KO0A 2DNKA 3DC2A 4KPCA 3VGUA 3CDBA 1JX4A 5DM6Q 3OXFA 2MEWA 1MMDA 3QO9B 2Q66A 1SKSA 4C4WA 3ENWA 3Q83A 4OJ1A 4CLUA 1N5YA 2HURA 1FVSA 3BN7A 2J6TA 1FWPA 2FUG9 4K5SA 2O3DA 4HI1A 3QGGA 3SFUA 2MY8A 1RGVA 4JI3F 4EWTA 2VG6A 1GXUA 5H9EJ 4CYUB 4WFYA 2JVMA 2D9PA 3TAMB 5BYSA 1F60B 1LW2B 2CQBA 4DSEA 2ADBA 3PXGa 4FF1A 3LP2B 2HWTA 2HMIA 4X62J 2Y1RI 2HK3A 3I5BA 3FEYB 3FKBA 2QLJB 2AEJA 3V6JA 2CADA 4NLRA 2V8HA 4FF3A 2E44A 5A8WA 2MZTA 1QSSA 3M6WA 2W2OP 4ZPCA 3M32A 3A3NB 3GV5B 3JSRA 2OEKA 4R8UA 2RRNA 4OYAA 2M2BA 2RU3A 4CO1A 1HNVB 1IBMF 4OYXA 4LFCF 1XNQF 2XMJA 1HWKA 2VQEF 2R4FA 4OJHA 2JHEA 4KHPJ 3QPIA 3BQ1A 1D09B 3OHAA 2XYHB 3MM8A 3DLEB 2BW7A 1TKXA 3IBWA 3BSAA 1JIHA 3MFHA 1N5TA 2KU7A 2HFVA 2J0QD 2CJXB 1NHUA 2QSFA 3IBCB 3SBMA 2MZRA 5KT7A 1ZA2B 2NYIA 1Q5YA 4X4QA 2IA0A 4A48A 2AQ4A 2L9NA 2KVQE 1AUDA 1MMLA 3SDEB 1KQGB 3PY8A 2AHOB 1JJ4A 5IFMA 3AOCA 1HBOB 3CJ2A 5KFTA 1BC6A 2MPUA 3PACA 2FC8A 4CRJA 2BKOA 3ZFVA 3R2CJ 3W64A 2JLGA 2CPJA 2HZAA 2W9BB 1EETA 1PYOB 2UUCF 5D4LA 5L9XA 2RSQA 3DHXA 5E5NA 4Q7AA 2A10A 2FLNA 1U0SA 3GIJA 4CH1A 4O44A 5DDOC 1M5PC 4IQMA 1RXOB 2QL9B 4ZA1A 2XMUA 1N33F 2PO4A 3CDWA 1YIJS 1UEKA 4HTJA 1P1LA 4DS5A 1SC3B 5IT0A 1NKBA 4ALZA 3G4SS 1WC4A 5K5MA 1APSA 4EO6A 3ZTQA 2L3MA 5HMZA 3KG0A 4DS4A 5BYRA 2XY7A 3DMJB 3RJMB 1TFYA 4X66J 1LK7A 2E1CA 5F41A 1BXNA 1NPKA 2JEIA 1T3NA 1UP1A 2DBBA 4F4WA 3NL0A 1VYAA 5DS7A 2K7JA 2APOA 1GTEA 3HD1A 1HMVB 2F8EX 2ADCA 2ROGA 4P2XA 1I94J 3CCQS 2YQ0A 1FJGJ 3UN3A 2IYIA 1JLQB 3O8WA 3JTOA 3MGJA 3G87A 2GJ2A 2POKA 4G1IA 3JS9A 1T94A 4CLFA 2CQGA 3QIPB 1X0FA 1DHMA 3R5DA 5C24A 3Q23A 3ISNC 3J7ZT 2EFGA 3CCVS 1S77D 5GMKa 2JEFA 2D9OA 5THWA 4KT0C 1G2EA 3D67A 3UFCX 3CB4A 5HROB 2FHMA 3E3XA 2O66A 4DN0A 1YJ9S 4PKDB 1BUXA 3PKYA 2D74B 1G3OA 3VHQA 4ZIVA 2ZJPQ 1N0UA 3KK1B 3THVA 2PSZA 4J7CA 1HR0F 4RW6A 4HKQA 4DV1J 1HQEB 2V8VA 3I82A 3JXOA 2HFSA 3UPFA 4URGA 5HAOA 4B3MJ 4BWMA 1LQ9A 2K2PA 3CJ4A 1DTTA 3CULA 2B5JB 4ZVSB 3MZIA 5LSRA 2MJNA 5ETOA 2MYFA 3AY0A 1YWXA 4Y2KA 2BJ8A 4KV8B 1JXVA 1QVFR 2GO9A 1WORA 1YG0A 3D4JA 3W63A 3PM9A 5CCLA 2HHHJ 3HP6A 1LWEB 2PDAA 3KK3B 2KTQA 2MQLA 3K17A 1J5EF 2BE7D 2OTJS 2RNEA 4DF8A 2UU9J 3K5NA 2RDDA 1FRJA 5CYJA 1T9VA 3M2RA 3TQEA 4DR6F 4DR2J 2CPZA 4DU7A 1L3TA 1I1GA 1URNA 3FSIA 4RNHA 1CLFA 2MGZB 3Q2TC 3W5ZA 2KXHA 3OFFA 3BQ0A 2HBQB 1QAXA 4LF9F 2CQ3A 2VJUA 2FHOB 4TQRA 4YB6A 2R8HA 2YNIA 1NJYA 2XG8A 1HNIB 1S5ZA 3TUIC 2QZ8A 1GK8A 1MU2A 1YBTA 1N5VA 2YX4A 1X4EA 3KHGA 2HFUA 5K20B 3MM9A 2WVBA 3H5XA 4P71A 2PFDA 3FBEA 4L75A 4KFBA 2C22A 3FFIA 2FHJD 5IM0A 2XLIA 3HVTA 3MFIA 4IRDA 5F8LA 3BBFA 1UVKA 2C3OA 3V6DB 3BS9A 2A2DA 4DV6F 4QIEA 5A8RB 2FLLA 1FTCA 4A8YA 1FRXA 5A0YA 1NJXA 2QA4G 1RBOB 4A4JA 2W25A 4G1QB 2K1RB 1S72S 2J9CA 1PKUA 1YLXA 1R0AA 1CJUA 1TTHB 2NXJA 4IRCA 3HHLD 5KFKA 4DSKA 1B7YB 2WVFA 2P6SA 2OI2A 2ATCB 2C2MB 2VU5A 2Q1LA 1BQMA 3U02A 3O1LA 3FCWA 1KOOA 1WKKA 1XWLA 2VDHA 4DV5F 1PC4A 3HM9A 3TA1A 1HWIA 2NYHA 2PMWA 1TFWA 3QZ7A 4TNOA 3MEDB 3C15B 1PBAA 3DGVA 2A18A 3DRRA 2ZH4A 3AXKA 2D69A 3MPYA 2OGUA 2BANB 4JB8B 3AT1B 2CNLB 4TY9A 3DRSB 2XY5A 2D1CA 2HQFA 3PW7A 4JV5J 2N7YA 3JSYA 1L5UA 4F02A 4B3TF 3B4MA 1YZ6A 1QUVA 5ETPA 3VAIA 2I38A 4WFNQ 2F65A 2KFYA 4DUYJ 3OJSA 3RZAA 3TANA 2G0CA 4RW7B 1S7HA 5JXSA 3PYEA 4WF9Q 1D9DA 4EU0A 5A76A 2OP5A 1RWPB 1VC5A 3ET6B 5SUHA 4UZBA 2HSEB 1J27A 5KFLA 2E7XA 4M5NA 1FI4A 3N28A 3N6NA 1YDLA 5FJ4A 1RA6A 2QN6B 1YKWA 5IWAF 1O0PA 4LR9A 2HG4A 5GADI 4LF7F 2VIHA 3N6LA 1VFJA 2QRRA 1WOPA 1HNWJ 2J76E 3K0JA 5LSOA 2E1MC 1UFWA 4F0MA 5KFVA 1HYSA 3ITHA 3E2EA 1N32J 3KG4A 1D3WA 2FHKA 1GH8A 5E7OB 3VV2B 1O8BA 4YB1P 4ECZA 4P10A 1N6QB 3P96A 3ZTRA 3M8SA 5D3GB 4EK2A 2RRAA 2BJDA 1IBKF 4CDIA 3MR5A 3HHNB 1EZZB 3NCRA 5DM7Q 3GFXA 5KOXA 4KPYA 2ZZTA 1S1XA 2F8HA 2HHQA 3TA0A 3OR1B 3RR8A 1YITS 4F0KA 3CEDA 4NLTA 2GA7A 4L73A 1XR7A 3WQPA 1RAJA 4KY3A 2KB2A 4AE5A 1ULRA 1FDDA 5KFIA 1DARA 5HP1B 1Q0NA 3FK4A 4F4YA 4L3NA 3LANA 2DGWA 3UD3P 3KHRA 4UQTA 2EK1A 4B3OB 1C1BB 3D6TB 1NLKL 1CPZA 4OQJA 2MSSA 2V2QA 2CAJA 2Z2LA 3BSNA 3OVBA 2FQQB 2DO0A 4CZCA 4FZVA 3QWUA 2MKCA 1N4LA 2YX7A 1WD6A 2BRLA 2PT0A 1NAQA 3IRXB 3A3OB 1CJKB 2FJWA 1S6QA 4G3IA 4NLPA 2NPIA 1WHXA 4LVNP 4NZ0A 5J2NB 1U49A 5J1EB 2CFXA 1GMWA 1WKLA 2HS4A 6FDRA 1B7FA 3I32A 2PC6A 3MPVA 1SL1A 2N3LA 1S0NA 3Q2SC 4IG0B 3HX9A 1PJ6A 1EX8A 1YJTA 4CLTA 2CJYB 3D54A 3H4BA 4NLVA 3OL8A 3LWLA 3IS9A 2JJ4D 3QT6A 3BH7B 2BEFA 4IQXA 1RT7B 2AJ1A 2R8KA 1RTHB 2DH9A 3DDKA 1FDAA 2ZOGA 3ZZOA 2VD3A 2AJ2A 1QJHA 5B09A 2VKZG 5F8IA 1RDRA 3ZZRA 4AT1B 2CZ9A 3G6YA 2DGOA 2DGQA 1RT3B 1WSVA 1WTBA 2QE5A 5A8KA 1GNKA 1TV6A 2YVSA 2B8QA 2OELA 3N0VA 1OPZA 3FVYA 1NJIT 2LU2A 3K5MA 2EVZA 4ECSA 2XEXA 1FKPA 2R3VA 4D3GA 4DG1B 1H3DA 3HMJG 5ETNA 5HLFA 3Q22A 1Y5IB 2C2EA 4ATNA 4OI1A 3RB4A 4KH1B 3MAHA 1JNRB 2YKNA 5BYQA 5DZ7A 1A6LA 4ZCMA 4DCPB 2J5AA 1VJWA 3MM5B 4A47A 1V5IB 5F8HA 4JV2A 2E7VA 4CO0A 4UW2A 2C2RA 3OFHA 1WG5A 3T1AA 3LF0A 4P74A 1LNQA 3FMWA 1K1QA 1MN7A 4QOTA 1WC1A 3NRBA 4J9RA 1RT4B 4BS2A 2VFSA 3ZTSA 1VQ6S 4DV0J 1R8PA 2M70A 1HL6A 4WPAA 4MTPA 4H4KA 1K47A 4UF4A 2DB1A 4KBIA 4CT8A 2R2SA 3KJFB 3BKUA 5KG0A 4I68A 2X7IA 3OVAA 1WACA 5CYMA 2KH9A 2XQCA 2YKPA 1SBRA 2VG5B 3OTCA 2QA4S 1GEHA 1UWBB 2L9DA 3CJ0A 1RBLA 2EXUA 1QAIA 5LMUF 1TK8A 3WZ0A 2E1PA 2R7OA 3TOQA 4DFKA 2OPRA 2GO8A 4DX6A 1YJ7A 1VRUA 1YBAA 1BQXA 2VOPA 1A0OB 5B0BA 4NRTA 3DDNA 3CMQA 1WJ9A 4OYBA 2MKJA 1C1CA 5HI7A 4OJ3A 2H4YB 3MHYA 2HVEA 5HANA 4EZ6A 5KFWA 1LW0A 2VZ9A 5KFGA 4H4OA 1AZSB 1SJ1A 1NKEA 4ICLB 3VAKA 4FYVB 3WHIA 1I3OB 1K73T 1IM4A 4RU2A 1DLOB 4AYBD 3RAMA 3A1YG 4LR7A 1RKJA 2JFDA 4DL3A 2KKHA 3CNQP 4U8YA 5GAGI 2CQCA 3CE8A 3DGPA 3OQ2A 1FE4A 4DHVA 2YNHB 2Y1LB 4RUAA 3R5CA 2DHGA 3I96A 1SV5B 3GV8B 3CJ8A 3MOJB 4MK9A 3D1HA 1F3VA 2VODA 3BYRA 3RRHA 2YQ3A 5EWGA 3M6VA 3H20A 1KQFB 4DPUA 4BHQA 4LF5J 2R8IA 3OBIA 4QWCA 4ECTA 3NGTA 3CTRA 4N76A 1AXQA 3W7BA 4DV4F 2QL5B 1NXIA 1NH7A 4U7UD 1Y00A 3BGFA 2DO4A 3CCTA 3DRPA 3KUGA 2V0NA 2C1EB 2L41A 4OI2A 1U6ZA 2WW8A 3BM7A 3T6BA 2WK4A 1T95A 2GGPA 4Y00A 3I0RB 4OZ2A 2NSCA 2GCFA 3LUYA 2YWEA 3R2DJ 1HNZJ 3JQKA 1SQGA 4HHUA 2XLJA 4TYAA 4XIUA 2E5IA 4IRKA 4F04B 1BY9A 2RMLA 4OHXA 2YNFA 4UTGA 2N4CA 1RWUA 4K4YA 4I7FA 4KJIA 2CNKB 3D66A 3MPUB 3U1NA 1HI0P 4WFAQ 4DQQA 1K8AT 3FUYA 1X31C 4BDPA 4ZJLA 1DY3A 3CJSA 3KLFB 3PX4A 3CC7S 1X5SA 2F63A 1MWZA 4ES1A 2A3JA 1QY7A 5IXUA 3AGYA 3UO0A 2HWIA 4X2BA 5EN1A 3IN5A 4ZLJA 2UXBJ 1Y5LB 2W4PA 4TKTA 3H8YA 4B9UA 1U2RA 4WFZA 3V81B 2IVMA 4NI2B 1H2VZ 1IKXA 1NKCA 1WEYA 2C2ZB 3JYTB 2G0JA 3NGRA 3IG1A 2HIQA 4Z7YA 1T03A 2ZHAA 3EM1A 2JOQA 3NMRA 3PW5A 4A8KA 2DGTA 2JWNA 2JRSA 5I3PA 2LCWA 2HRYA 2WB1D 2WZ1A 1J5OB 3AJDA 4NLUA 2W4CA 5E3RA 4PZVA 4IFVB 3HKWA 4DR3F 3L3CA 4LSNA 3PKMA 1DAXA 1KNZA 4NLYA 4MKVA 1IWGA 1S1UA 5KT6A 1JJHA 3I31A 1TKZA 4QWDA 2HHPA 1RTDA 2BVZA 3MWBA 4NOHA 2WHOA 3QRRA 3MD1A 2XO6A 2OFHX 1OY8A 3C8YA 4B02A 1U25A 4DUTA 3MF5A 4C3KA 3ZXWA 1RAOA 4F4ZA 2P8IA 2WSEC 2RAQA 3R3TA 1N8RT 4KHMA 1FXLA 3HFVA 1DQ8A 4XTTA 1ZTWA 4I6AA 2FVQA 4RW9A 2YWWA 2ZH8A 2Z8QA 3WDOA 2WVDA 3QT5A 1DZ5A 1TR0A 4DFMA 3IXQA 3V4IB 2FDNA 3C6UB 4MT1A 4WKRA 5LJ3Y 4J9KA 3T5LA 2CQ1A 5F8GA 3RBXA 3BGOP 5HQ8A 3M1VB 3T1YF 3NEKA 4KGKA 4OZJA 4L74A 2YWHA 5DQHA 4JBCA 3ZO7A 4NYZA 2O1PA 4L3KA 3CPWR 4Y65A 1RT6B 2H3EB 1Q5VA 4RWWA 5LJ5Y 3MMJA 2ZBCA 4CO4A 3NS7B 1C2PA 1YJRA 2NS1B 2LQJA 3A4TA 4IR1A 1M5HA 4AFFA 4P7TA 2OMLA 1S4FA 1MSWD 4KRWA 4HHJA 2FLOA 5K14A 2OPSA 2CPIA 2E66A 1RBAA 3S6EA 2OPPA 1NK5A 4B3SJ 4IOCQ 4EBEA 2YPYA 1S1TB 4N77A 2NXUA 2C2NA 3SMZA 3EGNA 3OTDA 4FYYB 4I2PB 3IWXA 4IUFA 4KKOB 2E9RX 3ENQA 3DM2A 2ATLA 5CYQB 4JI3J 2NUUG 2DH8A 2OD6A 3KJVB 3P45B 3QATA 1NZ8A 4X4OA 3U1LA 5JUMA 1OQ6A 2GNKA 1D8YA 2ALYB 1H2UX 5KFOA 1SKUB 3R97A 1I94F 3UNYA 4E2FB 2H5IB 4PABA 2IAJB 1XJWB 1NK7A 3SCLE 2JVOA 2XMKA 4NEYA 2JVRA 4LQ9A 3C6TB 1DFDA 2DRDA 4F36A 1JLBB 2ZEJA 1ACMB 2VQEJ 4I2QA 4DFJA 2J0WA 1QSLA 3HHKA 5E3PA 3U1MA 1A7GE 3NKYA 4K0KJ 3D68A 1T05A 2M4MA 4WYLA 2X3DA 3NCPA 3DFEA 4DN9A 4ER8A 3O3LA 5IQ6A 3BH6B 2PMZD 3W1YC 1N34J 3GZ7A 4DV2F 3H25A 4ITSA 3I38A 4HH1A 2ZUGA 5F3TA 1RACB 2CNNB 4OV1A 2UUAF 4OL8A 2IPOB 2PEHA 3POTB 2FJVA 2LYVA 2HVIA 3S1TA 4AD6A 2HBZB 3AAWB 1YBUA 3T1HF 1YGYA 1G6BA 5M2RA 2YNGB 1EB0A 4KO0B 2J9DA 3UDVA 2E5GA 1VQKS 3V6KA 3GTYX 1S9GB 4WTYA 2IBKA 4OFZA 1FFSB 5GADU 3OXLA 4K4TA 4EMDA 2N7CA 2XGPA 1BLUA 2C2OB 3CDAA 1LKZA 5B0EA 2EFOA 2FVCA 1BE4A 4KSEB 3L7OA 1ITPA 4M5MA 1N5YB 1PJ7A 1VC6A 3MEGB 3QYYA 2QSWA 1N33J 1ZAWA 2UU9F 2QYGA 3CD0A 2DY9A 3GCWP 1EARA 1S0OA 4NXNF 4I56A 3C19A 1MROA 3GV7B 1F1BB 3D3CJ 2X3GA 1W25A 2V2VA 4O4GA 2HMIB 2DD8S 1ZAXA 1CBKA 1S57A 4PG8A 5D15A 3A8IA 4ZVTB 2VHGA 1WEXA 3U7JA 4I69A 5A8WB 4NLDA 3UWTA 4YR2A 2W9CA 2QA1A 1S0VA 3BV8A 2LU1A 1TKDA 4R8UB 1IUJA 1TAUA 1F5BA 2N4DA 1M5OC 1RWWB 2DGVA 3BB5A 3CMAS 3UN2A 2A6MA 3MR6A 1RU2A 4ID8A 1JXEA 1Q1KA 2J9DE 3RRGA 1OY9A 4DL4A 3NOCA 1TKXB 3QAEA 1VQOS 4ECQA 2EPIA 1JLEA 3P49B 4B9NA 4K4ZA 3QJJA 4NMLA 1UJ4A 1O6XA 3W2VB 2GHWA 3M2UB 4F4AA 1HW8A 3DLGB 2V2KA 1NUEA 3PYDA 3MOZA 2P9EA 3L95X 1H73A 2FD2A 1ZA1B 2DH7A 4ZPBA 4B17A 4GO7X 4KGXB 3KXDA 1FKAF 1T7PA 3CW2C 1YHQS 2DNYA 2XY6A 3IWLA 2HVZA 3RR7A 2DGSA 1FWLA 1R8BA 3KOAA 1FNMA 4DV3J 2VOOA 2GW8A 5C42A 5EHHA 3B78A 1AA1B 2OMOA 3MUTP 3GCXP 4H4MB 4Z2XA 1KRPA 1EETB 1FXDA 2V63A 2HAIA 3GIKA 4ZHRA 3JSBA 3AHPA 4DX8H 5C25B 4DV7F 1P8GA 3GFYA 1IR2A 1SIZA 1F9FA 1J5EJ 1ZM9A 4M8LA 1X0PA 3HF5A 3GQCA 1WKJA 3OFEA 3EICA 2I5JA 1VJQA 4F50A 1WSRA 3I0SA 1X60A 3MMBA 2ZHOA 3LGHA 1JK9B 2DR5A 2UUTA 4LIRA 4ED6A 2IJNA 2XTJP 2EEYA 4LF9J 1K0VA 3EX7B 2DXFA 2AZ3A 4UOFA 4GKJF 2M52A 3PX0A 4OZ5A 1B99A 4XPCA 3HSJA 2LDIA 1U4BA 4K7QA 3MM6A 1U6BA 2XWXA 3BN4A 2CVIA 1TP7A 2D3O1 1K1SA 2XMTA 2RT3A 3UDCA 3Q24A 2RS2A 2YX1A 5C24B 1LWFA 2IY5B 1UEUA 5ETVA 2G0IA 3HVRA 3PR4A 2RKIB 4MH8A 5CZXA 5KG1A 2B7CB 4QBUA 3WX8A 3PW2A 3E01A 4ED2A 3X3UA 5FD1A 4ZLPA 2QEXS 1KLMB 4DPWA 3Q86A 2Q3PA 2V8DA 4RL1A 4FDFA 5KG2A 3FEXB 2RVJA 4LVOP 2OEJA 3UD5A 3NBPB 1T02A 3NGDA 5JJBA 3C66A 1NPRA 1U1RA 1OJ4A 3PYFA 4NXMF 3FMBA 3MAQA 4ETZA 2GMHA 4DUZJ 4CLWA 1N52B 4M63A 5FLXU 4RW8B 3MUVP 4IYQA 4DV5J 4ED5A 5E3CA 1BHNA 1FJEB 2LA4A 3OL7A 2J0SD 1VS3A 4HT7A 2BBEA 3KLGB 1S9EB 2C2KB 2VC1A 1GQEA 1T11A 1TAQA 1ZS6A 1IM6A 2GS8A 4QJVA 3HXMA 3MM7B 1N5QA 1B4SA 2DJWA 2R9LA 5DDRC 2CDRB 2IIHA 2NPFA 2D3ZA 5ETTA 1JLFB 5AXLA 3CJKA 2YKMB 3K58A 1IKWA 4CM2A 2UV8G 3N79A 2H65B 5KFFA 4JI6F 1YK9A 5B0FA 3CC2S 4C3LA 3R27A 4Q8FA 4LR8A 2ASLA 1J2VA 3QZ8A 4YDDB 3RB3A 2R7SA 3D0IE 5HBMB 5KFNA 2NZ4A 1K9MT 2EC2A 2JH3A 4RBVA 4F25A 3M8QB 3B82A 4NEZA 1BMQB 2B8PA 2HQ3A 5GAGU 8RUCA 5E3QA 5H9EK 1NBEB 5IWAJ 2YNIB 5DLFA 3DOMB 4LF7J 4KHRA 1OY6A 4HI2A 4UT4A 1WC6A 2VDIA 3MXHP 1TUGB 1U8WA 1GXTA 4OI6A 3CCWA 4KFBB 4LRFA 1Q7LB 1F9EB 1RHMB 2MLZA 4MFBB 2YH1A 3BGLA 1V3SA 3HVTB 3MCSA 5L1IA 4JUZA 1IXKA 2FJXA 1HBUB 2HNZB 1XMOJ 5A0YB 2R7VA 5KFQA 2RH3A 4WP3A 1RHRB 3WIVA 4PWWA 1D8ZA 1IBKJ 2ZD1B 3DXSX 3KUEA 4USKA 4U7CA 3W2WB 5K8MA 1QTNB 4DPTA 3NS5A 2XNQA 1FT8A 2DYAA 3EPIA 1LW2A 3TW0A 3D2WA 2MZ1A 2XS2A 1FNOA 2Q2GA 2ZOMA 4LF1A 3W5XA 3WBZA 5DG9A 3GFZA 2F1FA 2MKKA 4R25A 1P1TA 4HYKA 4DL7A 1V5VA 2C42A 3K57A 2E7WA 2RF2B 4NWBA 1M5VC 4RU9A 2UV8A 5K9FA 4ELVA 2HVHA 3MCNA 2DHAA 2HZCA 2MQQA 4ZLLA 2HNDB 1X4FA 5H9FJ 1R27B 4N5SA 3ONQA 2H5JB 3BBCA 2JLFA 1XEZA 2XHWA 4N47A 4FF2A 3AXMA 3TAPA 4ZLNA 1XMQF 4NCGB 2DIUA 2VG7B 4DV0F 2XI2A 2E1RA 1X7VA 3D1OA 1SJRA 3PVXA 2CQIA 1F0XA 1M1GA 1WI6A 1P9YA 4QYRA 1RK8A 3MMCA 4NX9A 5I42B 4ZVOB 3HPOA 4C2MA 4S0MA 2CZVC 3NY0A 4QR2A 3M7VA 1AFIA 4C11A 3KG1A 4NE9C 1CC7A 4P6QA 5E33A 1VGYA 4I6YA 2ILZA 3ILJA 3PZPA 4J90A 4ZPAA 1HBOA 5IT9Y 4ELUA 1U1KA 4IO9Q 2Q6BA 3TVYA 5KG6A 1CC8A 2NXCA 1RAEB 1RAFB 1EP4B 3ITHB 4DSJA 4JI2F 2MSTA 1SJ4P 5CABA 1EKSA 5L1LA 2W9BA 4ZVQB 4DPOA 4L72B 5DGBA 4J9VA 3EXCX 3CD5A 4CCHA 5IQQA 1MLAA 3L7UA 1B0VA 3GIRA 4U67Q 1SH2A 2WBMA 3ZNJ1 3DCAA 1L3VA 2CQ2A 2DNZA 3LPEA 4USMA 3CWJA 1OYEA 2XBPA 5E41A 5K8NA 1S1XB 5J2MB 1WG4A 4OI4A 3KNGA 4ES2A 4R5PB 3LGMA 2RE1A 2H48B 4FKXA 2CYYA 3K5OA 1TQLA 1YRTA 5B7WA 5J2QB 3FQLA 4DQRA 2VBWA 4CLKA 1TL4A 2ZH2A 1RAGB 2LECA 3ZZPA 3BGRB 4G65A 1HNXJ 4LF5F 1HW9A 1HHSA 1IKYB 3LP0A 4RZRA 2AYGA 1MWYA 1JLQA 2D3OR 2EK6A 3BO4A 1UPMB 2QMXA 4ZCKA 5ETQA 1F9HA 3OTEA 1KKHA 2VKRA 3QIPA 2HHVA 1WNEA 2WTFA 3D5MA 2BM0A 3JSMB 4OMFG 1M1HA 3MUMP 1H98A 3R5AA 2V9WA 3DI6B 4RJVA 4XDDA 1SJQA 4CI0B 1HNZF 2BE2A 3HULA 4NRUA 3I5AA 2A2CA 3NGUA 2VB6A 4CIOA 1D9AA 3C46A 4WU2A 4RBTA 2HFNA 3LAMA 4NLXA 4ZPWR 1UKUA 1N48A 3KK1A 2FZCB 1RTZA 1HQEA 4K59A 3QWPA 4NASA 1SUQA 2MTLA 2GQCA 1URRA 2B5JA 3IS9B 5KOWA 4YQWA 4B9LA 1V3ZA 3M05A 4GVBB 4OI0A 5CH7B 4HVZA 1QE1B 2HHSA 3CIMA 1CSJA 2DPJA 3PHEA 3UNGC 5LMUJ 1O51A 3GFHA 4UOCA 2Y1JA 2YWGA 1T9TA 1KQSR 3J7AN 3SFGA 3NOGA 3PYGA 5KAKA 3BJYA 1KDNA 5DRKA 3I9V9 1YJUA 1LWEA 3KK3A 2PIIA 2HFZA 3UCGA 3N6MA 3OW2R 4WK3A 5A8KB 4YR3A 3MPWA 3PR5B 2C28A 4BC7A 1TV6B 4ZP8A 2UUWA 3OVSA 3PX6A 2MGZA 4M5IA 3W8GA 2V4JA 4IR9A 3HHLC 1FKPB 3AJ2A 2W24A 4X4NA 1F5AA 2XNRA 3IR5B 2R7XA 2PFFB 2IBOA 2KRRA 2EW9A 2J0XA 2AP6A 3OHBA 4J9QA 1NH8A 1RT2A 2NCKL 2VFRA 3UE2A 3PHTA 1UFLA 3EE3A 1K44A 1HD1A 1H6KX 1U7LA 3L7PA 5AE1A 4RW4A 1X4HA 2EFPA 3V6DA 4CO5A 5DGAA 2LQ5A 4V19J 1UVIA 5A8RA 5KG7A 3UDEA 1D9FA 1ROFA 2IVYA 2ZH6A 2GQ2A 2ZUAA 2K1RA 1OPIA 1VQMS 3C2PA 3ILOA 4ZP6A 3C14A 2XSJA 4LF4J 3THTA 3PW4A 2C3PA 2DCUB 5LOQA 2OH2A 5CYMB 3O6QA 2MQMA 1KQKA 4GKKJ 1PCAA 1GX5A 3A8JA 4Y28C 4NL5A 3R5JB 3H59A 9ATCB 3MEDA 1ZTTA 3C15A 3BR9A 5F8JA 1U1MA 5D8HB 2PGCA 3IP0A 2EG1A 3DRSA 4DL2A 2EC0A 2RQCA 3MCMA 4B3SF 5B0GA 4WBFA 1LW0B 1FX4A 4IKAA 5L39A 2MHNA 1Q8LA 3TUJC 2KHCA 1F2GA 2YKOA 2J8SA 2UVWA 1IBLF 1IJEB 4DSFA 1S6PB 2I6WA 3AH6A 3ET6A 2G2YA 1EQMA 1KVIA 4LJMA 3DGPB 1RSCA 3BZQA 4DR3J 3HJVA 4N8OA 5SZTA 1RAIB 2QGFB 2GVDA 3RU0A 2OFGX 2CQ4A 2VV5A 3QNWB 2J8AA 1RHUB 1DURA 2KJWA 2JZ8A 1VQYA 3M8PA 2FZGB 1FRHA 1REVA 3G6XA 4J9UE 3RAXA 2WONB 1DJ0A 5ADZA 2DHSA 1N5SA 5C5JA 4MKYA 4NLWA 4K0KF 2AIRB 2IJRA 3DRPB 2H54B 3M9NB 3DOLB 4TVAB 4ZVGA 5IT9U 2GGPB 5CZVA 1N6QA 2CG8A 5FIIA 3BQ2A 3LQVA 2B9XA 2K8GA 1TU0B 2Y8WA 1LFPA 4IFYA 1TMMA 1N34F 3JB9k 1LV5A 2V9KA 3D6MB 4E98A 1FX2A 4ZMMA 5ITHA 3ENVA 2E29A 3OR1A 1U2FA 2YNFB 3NG8A 2P5VA 1LOUA 3CF5Q 1HBMA 4I7FB 4QWAA 2DRBA 3T1YJ 2DR6A 1S79A 3CCRS 2RUSA 3PG9A 1PC5A 4NYPA 2MHEA 1FCAA 1ZAVA 1Q7YT 2CXEA 4LRDA 3H90A 1U1LA 2VASA 5HMWA 1JXLA 3SQGA 2ABYA 2K3IA 4NLOA 2Z58B 2UVRA 2R7UA 2DHHA 1C1BA 4PEOA 1NU4A 3EWGA 5T14A 2ZWPA 3GLJA 4DPYA 3OT9A 2IFXA 4K50A 4X4VA 4Q0BB 1ZPVA 5CQGA 2VQFJ 3QLHA 2QFJA 1LWCB 2HBRB 4ENOA 5M2PA 2GAGC 1B64A 3UCZP 2B9EA 1T03B 3IRXA 5IC4B 3AODA 4OX9F 1ZPWX 4FYXB 1VOMA 4NCAA 2HK2A 1FERA 5J2NA 3NMAA 2KM8B 3QRQA 1P9QC 3T19A 2CUYA 3VZIA 2M3DA 2E1AA 3FZ2A 2IM3A 2VFUA 3CJ5A 4ZN3A 4J9OA 4JI8J 4LSNB 4C8LA 3KYLA 1S9FA 1Y0HA 5K8PA 4RUCA 4USIA 1XTZA 1TKZB 1NLTA 1UFKA 1PYSB 4DZDA 1X4BA 1RTDB 3KLHA 5E3AA 5HQLA 3SI8A 6AT1B 1JLGA 2FY8A 2E9TA 5DG7A 1JLAB 4ZCLA 3PNIA 5D0RA 1RT7A 1VBYA 1R0CB 3K59A 3TVZA 5D0HA 1T9YA 1HHTP 4MKBA 4IDKA 2FVPA 1OS5A 1Z1ZA 3CJQA 2I1RA 3EMTA 4DR1F 1H0HB 2BOAA 3CT9A 4F3MA 4URQU 3P4UB 4X4PA 1EJ7L 2QL7B 2CG4A 3C5XC 3T5JA 4GC6A 4OYWA 4RW9B 4EGLA 1REGX 3OLAA 1RWXB 1RT3A 1NEEA 2LP4A 4QW8A 2DK2A 2VL1A 3EDQB 2GIFA 4C0HA 2HHWA 4DV2J 2QLDA 2DNGA 3G71S 1U1PA 3BSCA 1D0EA 4NA3A 1PIEA 5I3UA 2K3KA 1X4DA 2UUAJ 4YHHF 4TLRA 4DV3F 1NMEB 4PWUA 3OJUA 2J7UA 1LWXA 5KFZA 4DG1A 1JLCB 3TQ1A 2OHDA 3VAHA 1QUPA 2AF6A 2F7VA 1VI7A 3Q8UA 3T1HJ 3IMQJ 1HQUB 5F9NA 2MKSA 4J37A 3I4PA 4ZCIA 2AGOA 1T8EA 4GMKA 4WTOB 2AEMA 3GJRB 3K8VA 3M9OB 3EZOA 1RQ0A 4ZPDA 2SXLA 4CLLA 3IFEA 1ZH5A 4USWA 4DSLA 3MMAB 2OPPB 3M8WA 1G4CA 1C0UA 3HHDA 2JNJA 4BLGA 4Q8EA 5CA5A 1RT4A 4YS2A 3M9MB 1U8SA 2EWHA 4LT6A 5D77A 1RE1B 4N56A 1SB6A 4NXNJ 1WF2A 1VHIA 3NAIA 2VONA 1U6FA 1Q4RA 3H40A 1VQPS 1FDNA 2DNHA 1RISA 1KOHA 3W9HA 2VG5A 3LPYA 1SCJB 3HVWA 3KTQA 2LEAA 3W66A 4EEYA 2C3YA 4UUXA 2V5HG 2BOPA 3MDFA 4IOAQ 3RG6A 1VRTB 2RQMA 2I8EA 3JQJA 2CJQA 2HWHA 1DTQA 2Q6CA 1B70B 4DR7F 3D0GE 3M8ZA 4X4TA 1KLNA 1T05B 1NK0A 4IG3B 1PO6A 3SSSA 1L3UA 4NLSA 2RDIA 5AT1B 1UWAA 3P5TL 2UXCJ 4DX5A 1VQSA 4OZ0A 3R6LB 3UR0A 3QFWA 1OWXA 1DLOA 4RUBA 5GAEI 4F7VA 3J81j 3CCZA 3FRZA 3NNAA 1QAJA 1S4EA 3A12A 3DLKB 3KLIA 2BW2A 3VTIA 1NDPA 4A8FA 4IH6A 1R6YA 4DUZF 4AQYJ 2YNHA 3BKFA 2ZFHA 3VCDA 3FSXA 5EX3A 4GO5X 3LW5C 3CJ3A 1S7IA 1U0HA 3KLEA 4K8RA 2M9KA 5HVHA 2CWKA 4JV0A 3VALA 2Q43A 2ODXA 3J81Y 3HK2A 4J9LA 4O0NA 2AJ0A 1Q53A 4ECRA 1XAOA 4W4MA 1FEHA 4U7UK 3PRDA 3KDOA 2V34A 1HWJA 1NZAA 3ZZTA 4K4SA 2KXFA 4P73A 3HFZB 3GJTB 1UTAA 1EKRA 2E5LF 4LBIA 4M5GA 3PJXA 5G4DA 3I0RA 1NK6A 4DV7J 2B43A 3J7A1 4PRFA 4DR5J 5ETRA 3NLCA 4FN5A 2NZCA 4HHHA 3QMQA 3K5PA 3KMSA 1X9MA 1M5SA 1TK0A 2BJ1A 2KM8C 1PSDA 4OX7A 3BEGB 4DU8A 4OI3A 3C16A 2IMWP 3SXLA 5J1PA 1HLWA 4O4GB 3GWCA 4OZ3A 2C3MA 1Y9OA 4J9SA 3TJAA 4K4XA 1QLNA 2B56A 3V2UC 5C2CA 2HZVA 3FC9A 1S1WA 2PD1A 1W26A 2W9CB 4GKJJ 3KLFA 4PQAA 2V50A 4PQUB 2BM1A 4LSZB 2Q79A 1WTFA 2BX6A 3ZZYA 5AJ3J 1EQ0A 1HFEL 1WHWA 4UUWA 3LH2S 4FXVA 1NB7A 3Q8VA 5L38A 1YVFA 2XCPA 4J9NA 4PUOB 1MWQA 3V81A 4FNIA 3DU6A 4NI2A 4P2MA 1XMOF 2LA6A 3JYTA 2W4DA 4K2JA 3GONA 4PWDB 4C98A 1VIXA 1GMVA 1HKAA 3PCOB 3IR6B 4KGMA 2R2UA 4QW9A 1E6VB 1SI9A 3LTOA 4Y0FA 1FD8A 2XZWA 1OIAA 2Z0GA 2VA3A 4LUBA 3AOAA 2DNOA 2ZH7A 5I3QA 3TWZA 3M4XA 1UA0A 1UZHA 5F0WA 1FA0A 2IDEA 2GX8A 3Q89A 2MB0B 8ATCB 1R89A 2DITA 4JI4F 5DZ6A 4NXMJ 2R2RA 3CSKA 3NS6A 3TO8A 2VFVA 5KG4A 3M30B 2XMVA 1VQLS 2R7TA 3R7NB 2RU9A 1IWAA 4MK8A 2FY1A 4RNFA 2KHDA 2JC0A 4ZHRB 1Q16B 4HL9A 2AJ4A 4RWXA 1Q8KA 1FRLA 4FS2A 2EFNA 4PAAA 4DI6A 4G1PA 1XERA 2VA2A 3OR2A 1GMWD 4JI6J 1RWKB 3G8TA 2I5JB 2HLTA 4PXDA 1FDBA 3KHLA 3M1VA 3AB2B 1T0TV 4C0OC 3QT8A 4OZ1A 3TZXA 3A8EA 1Q95G 2GMLA 2CPDA 1CG2A 4TU7A 2ZITA 2QO3A 2ZH1A 1ZM4A 3IBFB 4CTAA 4JI5F 5EX0A 3MURP 2YH0A 2U1AA 3G6VA 4H54A 1CJVB 2QC3A 5EUHA 2WB4A 3IRWP 2WSFC 2YQ1A 1VBXA 3R1HA 2W2PP 4P75A 2ZOFA 2MDAA 3H5SA 2UVVA 2FVSA 5D4NA 2BQRA 3MAAA 3WIUA 4ELTA 2AKWB 2C3UA 1CS4A 4KAIA 4EO8A 4AL5A 2LFVA 2QLBB 4JP8A 1RTIB 1W7WA 4QR0A 1S1TA 4NMXA 1FRMA 3L9ZA 1RUSA 3E01B 4AXJA 4KKOA 4USJC 5HO4A 5CYQA 4NLGA 1SJ3P 2GFFA 2NXEA 4E8UA 3OTOJ 4L6V3 4KIAA 4OHZA 2XO7A 3IR7B 4Y2AA 3KJVA 1KTVA 2V69A 2ASJA 4ZOSA 1FO1A 4M5DB 3FNNA 5KFDA 2BACA 1UA1A 2H5EA 2RB7A 3FGVA 4HACA 1AFJA 1ZYQA 1HNXF 1SC6A 3Q8SB 1X4GA 2UUBJ 2VF3A 4JI1J 2IAJA 3HCXA 1Q86T 2GC8A 2LEPA 2B6AB 3L4BC 2IHR1 3C6TA 5DETA 1FF2A 2ZH5A 1JLBA 1TL1B 2KDOA 3ADAC 1IQTA 3FSYA 5CXTA 4BBYA 5KG5A 4ZPTR 1XNRF 3CJKB 2D41A 4M5JA 3BF4A 2X1GA 1IKWB 2P9GA 1XMQJ 5IOLA 1RT5A 3AQPA 3TA2A 2PMHA 3B54A 3ZZ0A 2N3OA 4X4RA 2JZ5A 1R31A 1RWOB 1UW9A 3D7SB 1M5KC 2OUGA 1VQNS 2QIFA 1F2HA 1FRKA 3HSDA 4RUHA 1XR5A 5KFMA 2F8MA 4OLPA 5DDQC 2ZH3A 1RADB 4CLYA 2ALZA 2KZZA 2MQNA 3W62A 5U47A 3SYZA 2XM3A 4Y2MA 3EVMA 1KC8T 2FVRA 4ZDNA 3DLLQ 3MR2A 2WW4A 2YKAA 2YNGA 4ZP9A 4GRSA 1NDLA 1AROP 1NM2A 5KT2A 1LFWA 4W92B 1NSAA 1S9GA 3H0PA 3LP1A 2RDJA 3EXYA 4HH0A 4U8VA 2M8DB 1IKVB 2R42A 3I55S 3VAFA 2P6TA 4RR5A 1KVKA 4JI2J 1OSCA 1SKRA 3T3FA 1ZZFA 4LIWA 1TKTB 2G4BA 4X64F 1KEKA 3Q8RB 1D1UA 4TLQA 3J81U 3MEGA 4ECUA 3T9NA 4M5HA 3LZ8A 3IAM9 3CDUA 2EKNA 1S6UA 3CCLS 2ZWOA 5I4MA 4FBUA 4QPXA 2B4OA 4WYWA 4TY8A 1WF0A 3DOKB 5CHCB 1AT1B 1A9NB 4HEA9 1NSKL 3PRBA 3CD7A 2MKYA 1SL2A 1WDDA 2WRMA 2XS7A 4B08A 2HNYB 1BWVA 2R7RA 1CVJA 1VDHA 2BUNA 1RAAB 4P7VA 2YWKA 2NUHA 5A2QY 3V4MA 1S49A 2EG2A 5KTQA 4LFAF 3H42A 3GE9A 3GMGA 5HJXA 2IC3B 3LALA 1FTRA 3UN5A 1UCNA 2ACMA 3GPAA 1BQNA 1VQ9S 4DBQA 4OIXA 2DHXA 2OLWA 3RGIA 4FS1A 3MECA 4ED4A 3GB0A 1TL7B 4V1Ak 3W2VA 3M2UA 4A8QA 4MJKA 3MMCB 3DLGA 1Y4ZB 1PILA 4LF4F 5KFJA 1GAOA 1KP6A 4OZLA 3Q8QB 4DZ6A 4I1TA 4PPDA 2F5GA 3AA8A 2AEFA 5T7LA 1VQ4S 4Y2IA 5G0RA 4C11B 4OLOA 2ROEA 4JYAF 1T3OA 4GKKF 3GG1A 1WHYA 4EUVA 2MMYA 1ZM3A 4PYDA 3TARA 3AB4B 4PR6A 4YUDA 2GAHC 4WP9A 4DL5A 3CXCR 1XR6A 4MMOA 3PW0A 3I56S 4USUA 4IH5A 4LSLB 2HLUA 4ZK7M 4QWEA 4FKYA 3JTNA 4H4MA 2ZBPA 1HWUA 3KDNA 4CH0S 4C48A 4CLZA 4TU9A 3B8HA 1RCXB 5C25A 3TUZC 2HBYB 4LRCA 3DLHA 1WDTA 2AU0A 3OUYA 5GAHI 2BXJA 4Q43A 5LMNJ 3TX0A 1HARA 3OTBA 4C7QA 4PXBA 3TEHB 2XB2D 2AWZA 2UXDF 1R43A 2AT1B 3SV3A 2FPHX 3HSZA 4MIWA 3HDSA 4KGZB 1NCLA 3H5UA 1QD1A 4A8MP 5KFUA 5HVFA 1PGZA 3P6YC 2LQ8A 3GJQB 2FJBB 4YOEA 2HYIB 4FF4A 5GVQA 2ZE2A 3FRYA 2L48A 5KFRA 3CD6S 1RTJB 3SQOP 3LP0B 2ZJQQ 3KK2B 3QSIA 2DR7A 1Y3KA 2HS3A 4MKAA 1OSDA 4YN3B 2BABA 1HBNB 3D1QA 2PA8D 4J80A 5AXNA 3RBDA 1T9XA 3NNHA 2HHXA 2RKIA 4URSA 1RJJA 2BE2B 1H7WA 1S1VA 4PPZA 2GIRA 4N7TA 2DEIA 4NZ7A 5K8OA 1NDCA 3PEHA 1KLMA 2RHQB 5D4OA 4LFBF 2ZHBA 2F3JA 2NSBA 3RBZA 3NBPA 5KFHA 5J2PB 4C8ZA 1SUQB 2EKYA 4F8RA 2MZJA 1EAYC 4RW8A 3D9BA 3MEKA 4Y6IA 2LDYA 1HA1A 3DU5A 3HZEA 5LSLA 2RS8A 3BO3A 3QGHA 2VICA 1IR0A 3KLGA 3MEEA 1S9EA 1VMBA 2AJQA 3TZZA 3HI9A 4WE1B 3A3PB 3BPDA 3DDIA 3MM7A 2VQFF 1OMSA 2R8GA 4HT5A 1H38A 2KT3A 3BDPA 1JKHA 3RYLA 2ZZNA 4LMZA 4DXLA 5LT5A 1JLFA 2FZKB 4WK1A 4ZVRB 3CGIA 3I87A 1E6YB 2YKMA 1QVGR 3TJ8A 1DQAA 3SEOA 5HJYA 3PO4A 1CULB 3DYAB 1FK9B 2E5JA 1TMJA 4LBHA 4A8SA 1IBLJ 3F56A 3CC4S 1N54B 3IA0A 4JI8F 5HBMA 3VQTA 2V4JB 1M90T 5T41A 4ZVPB 4DQIA 3GR0A 5GAEU 3M8QA 3V6HA 3QJLA 4BWJA 1NDKA 1KWMA 2ROPA 3IGVA 4WIQA 3VF0B 4IO1A 1RT1A 1TUVA 3DOMA 2FC9A 1R3NA 4C0BA 5DDPC 2HGLA 2W8LA 2GZOA 1RT2B 3UI3A 4W90B 2GV1A 2RRBA 5BXIA 7FDRA 2MQ8A 3EYZA 1QM9A 3HKZD 1Q78A 2KG1A 4MFBA 4RW4B 2QMWA 2FHJA 4JI7J 3UQSA 1HBUA 2HNZA 1PG5B 4B9SA 2MKIA 1XK8A 2YTCA 2IVFB 2DCLA 2OPQA 2XMMA 4QYZJ 1WC0A 3QGPA 3AGXA 5LL6d 5H9FK 2ZD1A 4FYDA 4LREA 3W2WA 4LF8J 1SXLA 4U96A 3C14B 1GMUA 1R8AA 4HTIA 1KONA 2XSJB 1CJTA 1RP5A 4UY8T 2XWYA 3HHLA 2LKZA 2W2NP 3R5BA 4YP3A 4M94A 3N5FA 3KHHA 2FGCA 5BR8J 2CVEA 4CNYA 3F41A 4C8YA 4N8NA 4YEAA 2O01C 4O3OA 3CCES 2PE8A 5EWFA 4B9TA 3GIIA 2VPYB 2B51A 4FXDA 2RF2A 2OEMA 1TZ0A 2FB0A 2DISA 1R8CA 2B4VA 4F0HA 3SZ2A 4ID5A 4P72A 1FKOA 3A8KA 2G9OA 2HNDA 1C0TA 2OSRA 2ASDA 1GT8A 3GR1A 4KH0B 4DCJB 3M2VA 4ZPVR 3UCUP 5ETLA 2DIVA 3CJTA 5A2QU 4NCGA 3LAKA 2Y1IA 2B9WA 2VG7A 2WVCA 2BJ3A 4KE5A 4YMEA 4A8OA 4OX9J 3GP9A 3FEZA 4I67A 2VG6B 3ELHA 1BWEA 1Y7PA 2A6OA 1IJFB 3QAUA 5I42A 4HDGA 3TAQA 5KFBA 3IAS9 1KBRA 2JSXA 3G6ES 1ZM2A 2DGUA 3SSQA 1BD6A 2YY3A 1DQ9A 2B0GA 2HEKA 2GVDB 1RU1A 4WU3A 4DQSA 3CCMS 4DR4J 3M32B 1QDUB 2E5HA 2M8HA 2G1HA 4QIVA 3FQKA 3M8PB 4AXIA 1HD0A 4ZP7A 1RWMB 1REVB 1TELA 1RLDA 2VJVA 2B7BB 3GIMA 1EP4A 4WCEQ 2CIMA 3F73A 4F2SA 4E0DA 3MM8B 4RNOA 4CM0A 1M1KT 5HL7Q 3MCOA 4DR1J 5F8NA 4GVLA 3DLJA 5F0UA 4O3QA 2UXCF 5F3ZA 4I64A 4IFYB 1YJVA 2WOMA 3WX4A 2KVIA 4ERDA 5J2MA 2ZZMA 2KYXA 1ZOTA 2G1DA 4KGVB 4USHA 4LRAA 4R5PA 4DSIA 1HBMB 3QJPA 5HMXA 2X1BA 1FWKA 4YDXA 4AQYF 1UVMA 4Y3CA 2D3UA 1PAUB 5J2QA 7AT1B 4YHHJ 3BGRA 3ZZZA 2ZKUA 3ETOA 3UR3C 4B3RF 4FP9A 2BJ9A 3SQGB 5B08A 4YB5A 2ZNZA 2HHUA 4QQBA 1IKYA 3IWNC 5JVHQ 3GYXB 3E51A 5HSPA 1CEZA 1HPZA 1NRKA 3ILLA 1C4AA 3N01A 3G82A 4F3OA 3SCJE 5MAOA 1B3TA 1RWNB 4O44B 4WWSA 3QLHB 3JSMA 2FGOA 3IO1A 5B0AA 1YJNS 2V8PA 3DI6A 1JB0C 5AE3A 4DR5F 1H72C 4OHVA 2IDLA 1SL0A 4N41A 3ICLA 4X84A 2LQBA 3VGTA 4QR1A 2VUGA 1RKIA 2DPIA 2Y3YA 3TJ9A 1L3KA 3PDNA 5EDWA 2JX2A 4O3NA 2ZKTA 3G8SA 1NK8A 2NLWA 2E9ZA 2KO1A 2F4VF 2JFKA 1S6OA 4RLEA 4QIWD 4PXEA 2ZM6J 3KLHB 3KLVA 4DDFA 1JLGB 2MKHA 4GVBA 4AL7A 2BV3A 2RQKA 1QE1A 2QMUB 5AJ3F 1ZETA 2X1AA 4EFAC 5HQMA 3H7HB 4EBCA 2DNLA 2ZVSA 3DRXA 4P52A 2FIUA 2CJBA 2AGPA 4RX6A 4IDKB 2HQGA 1XC9A 2MY7A 3HT0A 4DR7J 1UZDA 3GYGA 3FZBA 2B4PA 2GVZA 2FLPA 5CAAA 3SCKE 2FYXA 4QIFA 4U95A 5C2GA 2HHTA 4LF2A 2F40A 3S01A 4QIGA 5D78A 1W2BR 3UVJA 3HFKA 5KFYA 1UW4A 2AGQA 4YY3J 4LF6J 3LOUA 1TL3A 5HN0A 1WOSA 2B26A 1RI7A 2HPUA 3BSOA 4Q44A 2ERRA 4RW6B 1KN6A 5I3UB 3PIPQ 4NLQA 5AE2A 4NCBA 3NCQA 3CO9A 4OHWA 3AQOA 3D28A 2GQQA 3PIOQ 4OYOA 3T41A 1DTTB 2I0XA 2QG9B 4WIIA 5KFAA 2DNRA 4B9MA 3AJ1A 5FDLA 1TVRA 2ZC4A 1UAWA 2KFZA 2PA3A 2DGXA 3H4DA 3W3SA 4M95A 3FBFA 2KYZA 3OXGA 3ISND 3BGUA 3FBBA 2MLXA 2AJFE 3PFOA 4DL0C 3TZYA 1T9UA 1YRXA 1C0UB 3NWRA 3TUPA 2E5LJ 1O5JA 1SVDA 2HW3A 3NXZA 4X4UA 4WXOA 5MLCV 5KT3A 3FCVA 4IOBA 3M2RB 1NSPA 1PJ5A 2B3TB 5LM7E 2G2ZA 1SC4B 2HQCA 3UD4P 3JQMA 2XZDB 3CCJS 2M88A 1YJWS 2ZBRA 4DL6A 3G86A 2OAUA 3OPKA 4PG6A 4UOHA 3VR1A 1WUUA 4LRBA 1MU2B 2VFTA 3GILA 2RILA 1XMBA 2V94A 4JI0F 2MQOA 4XPEA 2WVEA 1N88A 3MM9B 3F0NA 2BQUA 3QIDA 3VGVA 2LXIA 3J7YI 1KHVA 4J91A 3FFIB 1DTQB 3QO9A 5IM0B 2GJIA 4KC5A 2HFOA 2ZBQA 3ISZA 4WZQA 5KT4A 4O4RA 4ED8A 1PYTA 1Y3JA 4XAKA 4FPRA 3E8OA 1KHWA 4USTA 3VVUA 3MPDA 4C8MA 2CPEA 4KYZA 3B4DA 4WKYA 3OTOF 1R0AB 2V68A 1CJUB 1U1OA 4CYUA 3GYNA 1S6PA 1QAYA 3TAMA 2QYCA 3LA0A 3LP2A 1R8HA 3ZC4A 2W7AA 3H2VE 1MNEA 3SCIE 1FFWB 1U48A 3KLIB 1BQMB 2RD5C 4HDHA 4CO2A 2UUBF 4JI4J 5L8RC 4JI1F 2KT2A 4HLBA 1U0HB 3ZNUA 3KLEB 4PYAA 5B0CA 1U24A 1KFSA 3AA9A 2IMOA 2AV5A 3PTWA 1SQFA 4DF4A 1Z2LA 2Z2YB 1CQNA 1HNVA 3AOBA 5JVGQ 3DRRB 4RKUC 2WONA 2J7WA 1AYEA 5HMYA 2OKQA 4QCLA 2RUGA 3DLBA 5DQGA 3N4WA 3DLEA 3DOLA 2CJAA 1JQGA 4NA1A 3UDLA 3TP2A 2VH7A 2DT9A 1Q79A 1UPPA 1RAHB 2FJAB 3GSIA 3IGNA 3EGVA 1RLCL 5RUBA 3O44A 4X65J 4F4XA 1FVQA 2OSQA 1UETA 5GAHU 3C16B 3EZ5A 4DLEA 2AYBA 2X1FA 2BKPA 3K7RA 3SDEA 2BYCA 4O23A 3NWGA 1UMJA 1IR1A 2LQ9A 3VAJA 1S1WB 2RIJA 4NZ6A 1N0VC 4KB7A 5H1SV 4JI5J 4CLSA 4Q2MA 3MR7A 1NSQA 3QBCA 2C2DA 4AUKA 3SIPB 1FXRA 2H4WB 1NK9A 1HYSB 3HSGA 3PO5A 5AXMA 4DCOB 2M0GB 2CJ9A 4ECWA 3FDSA 1S59A 4Q0BA 4CLPA 2COLA 5ETKA 5F9LA 1LWCA 3AGZA 4QU7A 4M1KA 4FVMA 4K2XA 2V4RA 3L09A 1RHJB 2MZQA 4M5KA 3CO0P 4O3RA 1SPBP 1FESA 2WSCC 2KT5A 3FBCA 3DMJA 5KFSA 1U2CA 5EGYA 1X5PA 4BC9A 4D3HA 3BR8A 1S76D 3VZHA 1NJWA 4ZVHA 1N36J 5KG3A 3Q8PB 3RB0A 1HQ2A 4X62F 3KMQA 2ILYA 1KTQA 2GIQA 4CO3A 4Q45A 1SQEA 3Q8YA 3DN9A 2XCAA 4ZIWA 5F8MA 1JJCB 3T9ZA 2WCXA 2DNNA 1HMVA 2QJ3A 4CWBA 3RTVA 1SC1B 1Y10A 4ZN1A 1WC5A 3OSNA 1JLAA 3T5KA 1OQ3A 3IC1A 5LXRA 4DJBA 3EDRB 1ZZNA 1EHWA 3WC2A 4KHPF 3OL6A 4I4BA 4C8OA 1NO8A 4P9SA 4C97A 1MG7A 2KJVA 2JLEA 2EBEA 1XNRJ 2LXFA 1S6QB 1C4CA 2Y8YA 3EGZA 1NPPA 2O5DA 3AD9C 3OR2B 4PCQA 2IJFA 1MMNA 5HROA 1VLYA 2Z4PA 2BZ2A 3ZZUA 2RJZA 2AZ1A 1VC0A 3CUNA 2ZDPA 1F3FA 2DEJA 4WFXA 1DBDA 5ETMA 5CD4H 2QA2A 4USVA 1U26A 1S48A 3CMES 1QSYA 4G6VB 1KR4A 2DY1A 4WZMA 2HKEA 3VAGA 2O67A 3OLBA 1UVNA 4CTAB 4ILMA 1VISA 1JLCA 2VPXB 3U27A 2HQIA 4RNMA 2CA9A 3J7Z5 2IRUA 2BE9B 1HQUA 1RHQB 1VK3A 4YR0A 1V6HA 4KV8A 2VBZA 1MN9A 1V9OA 2QT7A 4YB7A 2W01A 4EZ9A 3MMAA 3MAAB 1CS4B 1RHKB 4X64J 4O3PA 1NK4A 3CVKA 5LMNF 3TYTA 4P2SA 2R8JA 5FLXY 1RZMA 2HRUA 4X66F 3HVAA 4ZJQA 2ZBIA 4C6AA 2OTLS 5EWEA 4FBTA 3VVTA 2EI5A 1Q81T 2YWFA 2XMWA 4HACB 4ZJOA 2X51A 5HLFB 1NHKL 2Y0SD 1U1QA 2WAQD 4KTQA 4NPOA 1KFDA 2GJFA 4OHYA 1UJ5A 1FJGF 1HNIA 2YKNB 4TYBA 5GMDA 1WOOA 1VR6A 2Z30B 5B0DA 4WXWA 2DXEA 4K4VA 3H98A 4ILLA 3GSDA 1VRTA 5KFCA 3K89A 2K7KA 1IBMJ 4LFCJ 3KJQB 3EVWA 1XNQJ 4LFAJ 5LXYA 3QQCD 1YI2S 5E2QA 3R6GB 1S10A 2CNOB 1YTYA 2BDPA 1SH3A 4ED1A 4IG3A 4X4SA 4OYPA 5ETSA 4U9RA 4DEZA 1RT5B 2UVUA 2B4UA 1VQ7S 3G2XA 4G1QA 3VQSA 1EIYB 2G13A 3K5LA 5KFPA 2QTWA
chains in the Genus database with same CATH topology
1XAOA 1GMWD 1GMUA 3LA0A 1GMVA 4L3KA 1C3GA 3I38A 1GMWA 3LZ8A 3TJ9A 3NY0A 2Q2GA 3TJ8A 2HFVA 3AGYA 2B26A 3NXZA 1EARA 1EB0A 3TJAA 3AGXA 2QLDA 1NLTA 3AGZA 3L9ZA 4J80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XAO A;  1GMW D;  1GMU A;  3LA0 A;  1GMV A;  4L3K A;  1C3G A;  3I38 A;  1GMW A;  3LZ8 A;  3TJ9 A;  3NY0 A;  2Q2G A;  3TJ8 A;  2HFV A;  3AGY A;  2B26 A;  3NXZ A;  1EAR A;  1EB0 A;  3TJA A;  3AGX A;  2QLD A;  1NLT A;  3AGZ A;  3L9Z A;  4J80 A; 
#chains in the Genus database with same CATH topology
 2M5Y A;  3RRK A;  2CQ0 A;  2NR0 A;  2AX1 A;  4ECV A;  4DV1 F;  3ZTO A;  4B3M F;  3DLK A;  2CZ4 A;  2PI4 A;  2UP1 A;  2XYG B;  3FCH A;  3QT7 A;  2CKW A;  4EBD A;  3ENA A;  3N5B A;  3ILI A;  2CPX A;  4JYA J;  3I4H X;  5D0E A;  3R7S B;  1Z2Z A;  2XLK A;  3O2I A;  5AXK A;  2JRR A;  2OPR B;  1RYS A;  2MQP A;  3LP1 B;  1VRU B;  3W5Y A;  3MTJ A;  2XZT B;  2BAN A;  4JOU A;  2XS5 A;  1N56 A;  4AND A;  1C1C B;  2KFN A;  2ZVI A;  1VIO A;  6FD1 A;  5L1J A;  4DMZ A;  2HHH F;  4BCA A;  2W9A A;  4Z7C A;  2UUC J;  2CJK A;  1VBK A;  2V6A A;  2A0F B;  3VGS A;  2XGQ A;  4H4O B;  3K2Y A;  4MAK A;  5IV3 A;  3CIZ A;  3Q0A A;  4UY8 5;  1JWW A;  4RW7 A;  7FD1 A;  4DR2 F;  4ZVF A;  3PJW A;  4J9P A;  1XIQ A;  1KD1 T;  3OL9 A;  2V2Z A;  4OYZ A;  2BMB A;  2IRX A;  2UXD J;  2JDJ A;  4TY8 B;  4EI2 A;  2DRA A;  3TX8 A;  2XYP B;  2LLZ A;  3A13 A;  4WFB Q;  3BYP A;  2LXU A;  2VPW B;  2WBR A;  1UVL A;  4OYM A;  4FXW A;  4QZV B;  1YZ7 A;  2BJE A;  4PQU A;  3P8B B;  2HIY A;  2W7O A;  1RB0 A;  5DJB A;  5D6G A;  2J6U A;  3T6J A;  1Y11 A;  4JI7 F;  2QFI A;  4PUO A;  1LK5 A;  3EJM A;  1PAE X;  1BQN B;  3EGW B;  4W98 A;  2A1B A;  4NYO A;  3IM8 A;  5D3G A;  1IN0 A;  3MEC B;  4MYT A;  2DTJ A;  4RNN A;  4PWD A;  4DOZ A;  1VHF A;  4LF8 F;  4DX7 A;  1F5C A;  2ZJR Q;  1E6V A;  4ANC A;  3GG0 A;  4MIA A;  3I6P A;  3K8W A;  3O5T B;  1SJF A;  5DG8 A;  5DO2 A;  3D3B J;  3RW7 A;  4LFB J;  2CQP A;  3BPS P;  1YQH A;  5BR8 F;  4AL6 A;  5T7L B;  4O3S A;  1HR0 J;  2HVD A;  3PEJ A;  5KFX A;  1TK5 A;  5G0R B;  5HP1 A;  4F3Q A;  1NHV A;  4RPF A;  4MIB A;  3HLU A;  1HIY A;  3M30 A;  4B3O A;  4PG4 A;  4UQG A;  3HT3 A;  2KXN B;  3EUN A;  3EVO A;  3W61 A;  2XSF A;  4U6P A;  8AT1 B;  4TN2 A;  4CNZ A;  4JV5 F;  1V3R A;  2W8K A;  4A46 A;  5D4P A;  2G2O A;  1IKX B;  1X4C A;  1LEO A;  3IG1 B;  1WHV A;  4DUY F;  1CJK A;  1QTM A;  2W1B A;  1UEV A;  4B9V A;  2MZS A;  3OUY B;  3EPG A;  4KR0 B;  2V8G A;  4C8K A;  5J1E A;  1AW0 A;  4UOG A;  4ED3 A;  1IBC B;  1X4A A;  3AFG A;  4ETX A;  2L08 A;  2EFV A;  4DR6 J;  3KKF A;  2BKN A;  2RQ4 A;  3P5B P;  4IG0 A;  1YSJ A;  5L1K A;  3OFG A;  4ILR A;  1S1U B;  2HAF A;  4RO0 A;  3TNV A;  2CRL A;  3R5G A;  4XO0 A;  2FJD B;  4ZVE A;  2PI5 A;  1NND A;  2MJU A;  3TEG A;  1XN9 A;  4DR4 F;  3BKT A;  3TZW A;  2QLX A;  1OYD A;  3KUH A;  5GME A;  4OJG A;  2ZE2 B;  1X5O A;  5M2U A;  1HNW F;  1Q8I A;  3G8Q A;  2J6S A;  1R7I A;  1CJV A;  3NAH A;  2ZNY A;  4EYI B;  1DRZ A;  1MW7 A;  1RTH A;  1N32 F;  2W7P A;  4Y2C A;  3EZU A;  4CP5 A;  2FTR A;  1ICE B;  2IA6 A;  3H5Y A;  4TQS A;  3P3D A;  2KL8 A;  1S1V B;  3W9J A;  4DV6 J;  1S0M A;  3D6F B;  1RTI A;  3VWS A;  2V4Q A;  4HR2 A;  2BR0 A;  1IVZ A;  3DNC A;  4C8N A;  3M8R A;  2IM2 A;  5KT5 A;  4WP8 A;  2OJ3 A;  3HJF A;  3JAM Y;  3W9I A;  1FE0 A;  2RHS B;  2PEB A;  4H4K C;  1WWH A;  4XK8 C;  2VC0 A;  2N82 B;  2CDQ A;  2BQ3 A;  4LQ3 A;  4M5D A;  1NB2 A;  2Z2M A;  2Z57 B;  3OSP A;  3ULH A;  2IRY A;  4F26 A;  2JC1 A;  4YFU A;  1X5T A;  5CCM A;  5L9N A;  4K4W A;  4IH7 A;  2PN6 A;  4UZC A;  2B6A A;  3MEE B;  1I6J A;  3MM5 A;  2CWX A;  1JNZ B;  2U2F A;  3LO3 A;  1TL1 A;  3TRG A;  3QSY B;  5K14 B;  1FNX H;  2OPS B;  3LWM A;  1KS2 A;  3MI7 X;  2BJ7 A;  1VK8 A;  4TXS A;  1AUS L;  1JKH B;  3J7Y U;  4F4K A;  2H1Y A;  1U45 A;  2CPH A;  3GU0 A;  4K4U A;  4B3T J;  1JMT A;  2XMA A;  3I5C A;  4ZS6 A;  4FNH A;  3RBE A;  3DM2 B;  3B6B A;  4O0I A;  2QV6 A;  2KZM A;  1UVJ A;  1UJ6 A;  5IZH A;  1Y5N B;  3J80 Y;  1L3S A;  4QWB A;  4ZVU B;  2ZDO A;  1WC3 A;  2ZM6 F;  5IC6 B;  5KFE A;  3T5H A;  2IM1 A;  2QLW A;  1B0P A;  1GFW B;  4C9D A;  1I5O B;  1UWB A;  4TU8 A;  1RT1 B;  4A8X A;  1BGX T;  1H74 A;  3G96 A;  1GXL A;  1LXJ A;  4DWI A;  4I0W A;  3BRE A;  1M0S A;  2DNQ A;  1IQZ A;  4NA2 A;  2VBX A;  1X9W A;  1RWV B;  4ES3 A;  3KJN B;  4I2Q B;  1IKV A;  2CPY A;  5JMN A;  2BA9 A;  2BRK A;  3AD8 C;  1VQ8 S;  1H7X A;  1U47 A;  2JEG A;  3MR3 A;  1TKT A;  4L76 A;  1LXN A;  1VRQ C;  2B9Y A;  2F4F A;  1AZS A;  2OPQ B;  2H9Z A;  3DXB A;  5DLG A;  4YY3 F;  4LF6 F;  1G1X A;  4ICL A;  1SIW B;  4C3M A;  1VLO A;  4PG7 A;  4DQP A;  3KNA A;  3HO1 A;  2IM0 A;  2VPZ B;  3RUB L;  2XC9 A;  3DHW C;  1KSP A;  1HI1 A;  2AMC B;  1CJT B;  3BDE A;  3D0H E;  3HHL B;  1HI8 A;  3DOK A;  1F6T A;  4ZIT A;  3CCS S;  1SV5 A;  1AB8 A;  3ETM A;  2YPZ A;  1Z4U A;  2DNM A;  3SSR A;  3V5R A;  3F44 A;  4Q2L A;  1RCO B;  2DXD A;  2HNY A;  4B3R J;  3W8P A;  1GTH A;  2QLF B;  2LEB A;  5IS2 A;  4ED7 A;  4MK7 A;  2NQP A;  2L9W A;  4ID5 B;  5HAT A;  2ACY A;  1FKO B;  1SKW A;  4PXC A;  1C0T B;  2W2Q P;  2CPF A;  4QU6 A;  2KRB A;  2IC3 A;  3M2V B;  5C7P A;  3M6X A;  4CT9 A;  4ECY A;  5HVG A;  4CQ1 A;  2HGM A;  1U09 A;  2W2M P;  4OX6 A;  4ECX A;  2FJE B;  2IYG A;  2JEJ A;  1TL7 A;  5IT4 A;  2NRE A;  5HK4 A;  1MRO B;  3RAQ A;  3LGN A;  3PRV A;  3ZTP A;  2P2C B;  2VBY A;  3BO2 A;  1FFG B;  2ZH9 A;  3NP5 A;  1S99 A;  2LMI A;  2F4V J;  3NNC A;  3C3L A;  3DKD A;  3TR5 A;  2AD9 A;  3S7R A;  3IM9 A;  3DRY A;  1R6V A;  4LSL A;  3D6H B;  3WC0 A;  3R9L A;  4FPI A;  3CJR A;  1UL3 A;  1CQM A;  3R8Y A;  3I9Z A;  3CDE A;  1XQI A;  2Z56 B;  2R7Q A;  1FRI A;  1JLE B;  4KQZ A;  4JV1 A;  3QGI A;  1H2T Z;  4EYH B;  2AYE A;  1VBZ A;  1VCT A;  1X8D A;  3FJ2 A;  1U1N A;  1VQ5 S;  2WOM B;  5DQI A;  5L46 A;  3JTP A;  2CQD A;  2Y0B B;  1J5O A;  2EBG A;  3QRP A;  2P9C A;  2YBV A;  2V67 A;  3GJS B;  1K0T A;  2XHC A;  4IFV A;  1OO0 B;  3PFE A;  1YRU A;  4F67 A;  2I9S A;  3C6E C;  4WJB A;  3R7B B;  3SV4 A;  3MTK A;  3MD3 A;  1WF1 A;  4ZKA A;  2Y9H A;  5C42 B;  3PV8 A;  1RTJ A;  2D7S A;  2DVI A;  5J1N A;  3KK2 A;  9RUB A;  4OV6 A;  2HS0 A;  1X9S A;  5A6W A;  1W2I A;  1B0T A;  4K5R A;  1HPZ B;  2GMJ A;  2AYM A;  3OV7 A;  1HBN A;  2YXL A;  2R2T A;  3G82 B;  2KN4 A;  1PBU A;  2ASY A;  4XDC A;  4GC7 A;  1XBW A;  1U02 A;  3G9C A;  1FEE A;  1ELO A;  4X65 F;  2Z2Z A;  3V4I A;  3C6U A;  1S97 A;  3I0S B;  3MMB B;  4P2F A;  4I6W A;  3TVK A;  4OYI A;  1WG1 A;  1Q82 T;  2HRT A;  2R7W A;  5J2P A;  4V19 X;  2F9D A;  2OD4 A;  1C3G A;  5A6P A;  4DFP A;  3X1L B;  4Z37 A;  3JAM U;  4R0E A;  4ANE A;  3H2U B;  2DR9 A;  1RT6 A;  3THP A;  4R0J A;  3S8S A;  4J5O A;  2KG0 A;  3AD7 C;  3MM6 B;  3US5 A;  2M7S A;  1YX2 A;  4JI0 J;  2UXB F;  2MXY A;  1G7C B;  3AKO B;  1KVJ A;  2NXN A;  4WE1 A;  1LWF B;  4MYU A;  1FHT A;  2GHP A;  2EFQ A;  1RYR A;  2GVZ B;  1SH0 A;  3N9U C;  2DR8 A;  2K06 A;  3CCU S;  3PJ9 A;  1JJ2 R;  1E6Y A;  3HZG A;  2F9J A;  3KFW X;  3UVJ B;  1GX6 A;  2HQD A;  4QPT A;  1TL5 A;  4I2P A;  3VAM A;  3TI0 A;  2KI2 A;  4Y34 A;  1CUL A;  1TL3 B;  3DYA A;  1FK9 A;  1WEL A;  1N36 F;  1R0B G;  1RAB B;  4F2R A;  1TUW A;  4CH7 A;  4OX8 A;  4FVC A;  2HGN A;  2OIH A;  2OO4 A;  1WEZ A;  2CQH A;  4QYZ K;  1FJ7 A;  2DNP A;  2J7K A;  2J9E A;  1RA7 A;  5FDL B;  4PG5 A;  4J9M A;  2JL9 A;  1TVR B;  4ED0 A;  2AW0 A;  5IV4 A;  1Q8B A;  1S12 A;  2XUL A;  3RW6 A;  3J80 U;  4RBU A;  2AX0 A;  2XI3 A;  2ZC3 A;  1P6T A;  5BJR A;  2GHV C;  3OD2 A;  5E0O A;  4DV4 J;  3HD2 A;  2H51 B;  4LBP A;  4M5L A;  3W65 A;  4Q5V A;  2LVW A;  3UW1 A;  3BBB A;  4DPX A;  5CD4 A;  3KWM A;  3M6U A;  1HWL A;  1I51 B;  2DKO B;  1FD2 A;  3H2L A;  4A8W A;  1ZBT A;  2MLY A;  3NGK A;  4OZN A;  1T9W A;  1P27 B;  1HHQ A;  2QX0 A;  2YKQ A;  3POT A;  5D0G A;  3NGS A;  1WI8 A;  3RB6 A;  3QFH A;  3R1L A;  4FYW B;  3HHE A;  3W60 A;  2I2Y A;  2UZA A;  4DLG A;  1NJZ A;  1FJC A;  3M8Y A;  4KO0 A;  2DNK A;  3DC2 A;  4KPC A;  3VGU A;  3CDB A;  1JX4 A;  5DM6 Q;  3OXF A;  2MEW A;  1MMD A;  3QO9 B;  2Q66 A;  1SKS A;  4C4W A;  3ENW A;  3Q83 A;  4OJ1 A;  4CLU A;  1N5Y A;  2HUR A;  1FVS A;  3BN7 A;  2J6T A;  1FWP A;  2FUG 9;  4K5S A;  2O3D A;  4HI1 A;  3QGG A;  3SFU A;  2MY8 A;  1RGV A;  4JI3 F;  4EWT A;  2VG6 A;  1GXU A;  5H9E J;  4CYU B;  4WFY A;  2JVM A;  2D9P A;  3TAM B;  5BYS A;  1F60 B;  1LW2 B;  2CQB A;  4DSE A;  2ADB A;  3PXG a;  4FF1 A;  3LP2 B;  2HWT A;  2HMI A;  4X62 J;  2Y1R I;  2HK3 A;  3I5B A;  3FEY B;  3FKB A;  2QLJ B;  2AEJ A;  3V6J A;  2CAD A;  4NLR A;  2V8H A;  4FF3 A;  2E44 A;  5A8W A;  2MZT A;  1QSS A;  3M6W A;  2W2O P;  4ZPC A;  3M32 A;  3A3N B;  3GV5 B;  3JSR A;  2OEK A;  4R8U A;  2RRN A;  4OYA A;  2M2B A;  2RU3 A;  4CO1 A;  1HNV B;  1IBM F;  4OYX A;  4LFC F;  1XNQ F;  2XMJ A;  1HWK A;  2VQE F;  2R4F A;  4OJH A;  2JHE A;  4KHP J;  3QPI A;  3BQ1 A;  1D09 B;  3OHA A;  2XYH B;  3MM8 A;  3DLE B;  2BW7 A;  1TKX A;  3IBW A;  3BSA A;  1JIH A;  3MFH A;  1N5T A;  2KU7 A;  2HFV A;  2J0Q D;  2CJX B;  1NHU A;  2QSF A;  3IBC B;  3SBM A;  2MZR A;  5KT7 A;  1ZA2 B;  2NYI A;  1Q5Y A;  4X4Q A;  2IA0 A;  4A48 A;  2AQ4 A;  2L9N A;  2KVQ E;  1AUD A;  1MML A;  3SDE B;  1KQG B;  3PY8 A;  2AHO B;  1JJ4 A;  5IFM A;  3AOC A;  1HBO B;  3CJ2 A;  5KFT A;  1BC6 A;  2MPU A;  3PAC A;  2FC8 A;  4CRJ A;  2BKO A;  3ZFV A;  3R2C J;  3W64 A;  2JLG A;  2CPJ A;  2HZA A;  2W9B B;  1EET A;  1PYO B;  2UUC F;  5D4L A;  5L9X A;  2RSQ A;  3DHX A;  5E5N A;  4Q7A A;  2A10 A;  2FLN A;  1U0S A;  3GIJ A;  4CH1 A;  4O44 A;  5DDO C;  1M5P C;  4IQM A;  1RXO B;  2QL9 B;  4ZA1 A;  2XMU A;  1N33 F;  2PO4 A;  3CDW A;  1YIJ S;  1UEK A;  4HTJ A;  1P1L A;  4DS5 A;  1SC3 B;  5IT0 A;  1NKB A;  4ALZ A;  3G4S S;  1WC4 A;  5K5M A;  1APS A;  4EO6 A;  3ZTQ A;  2L3M A;  5HMZ A;  3KG0 A;  4DS4 A;  5BYR A;  2XY7 A;  3DMJ B;  3RJM B;  1TFY A;  4X66 J;  1LK7 A;  2E1C A;  5F41 A;  1BXN A;  1NPK A;  2JEI A;  1T3N A;  1UP1 A;  2DBB A;  4F4W A;  3NL0 A;  1VYA A;  5DS7 A;  2K7J A;  2APO A;  1GTE A;  3HD1 A;  1HMV B;  2F8E X;  2ADC A;  2ROG A;  4P2X A;  1I94 J;  3CCQ S;  2YQ0 A;  1FJG J;  3UN3 A;  2IYI A;  1JLQ B;  3O8W A;  3JTO A;  3MGJ A;  3G87 A;  2GJ2 A;  2POK A;  4G1I A;  3JS9 A;  1T94 A;  4CLF A;  2CQG A;  3QIP B;  1X0F A;  1DHM A;  3R5D A;  5C24 A;  3Q23 A;  3ISN C;  3J7Z T;  2EFG A;  3CCV S;  1S77 D;  5GMK a;  2JEF A;  2D9O A;  5THW A;  4KT0 C;  1G2E A;  3D67 A;  3UFC X;  3CB4 A;  5HRO B;  2FHM A;  3E3X A;  2O66 A;  4DN0 A;  1YJ9 S;  4PKD B;  1BUX A;  3PKY A;  2D74 B;  1G3O A;  3VHQ A;  4ZIV A;  2ZJP Q;  1N0U A;  3KK1 B;  3THV A;  2PSZ A;  4J7C A;  1HR0 F;  4RW6 A;  4HKQ A;  4DV1 J;  1HQE B;  2V8V A;  3I82 A;  3JXO A;  2HFS A;  3UPF A;  4URG A;  5HAO A;  4B3M J;  4BWM A;  1LQ9 A;  2K2P A;  3CJ4 A;  1DTT A;  3CUL A;  2B5J B;  4ZVS B;  3MZI A;  5LSR A;  2MJN A;  5ETO A;  2MYF A;  3AY0 A;  1YWX A;  4Y2K A;  2BJ8 A;  4KV8 B;  1JXV A;  1QVF R;  2GO9 A;  1WOR A;  1YG0 A;  3D4J A;  3W63 A;  3PM9 A;  5CCL A;  2HHH J;  3HP6 A;  1LWE B;  2PDA A;  3KK3 B;  2KTQ A;  2MQL A;  3K17 A;  1J5E F;  2BE7 D;  2OTJ S;  2RNE A;  4DF8 A;  2UU9 J;  3K5N A;  2RDD A;  1FRJ A;  5CYJ A;  1T9V A;  3M2R A;  3TQE A;  4DR6 F;  4DR2 J;  2CPZ A;  4DU7 A;  1L3T A;  1I1G A;  1URN A;  3FSI A;  4RNH A;  1CLF A;  2MGZ B;  3Q2T C;  3W5Z A;  2KXH A;  3OFF A;  3BQ0 A;  2HBQ B;  1QAX A;  4LF9 F;  2CQ3 A;  2VJU A;  2FHO B;  4TQR A;  4YB6 A;  2R8H A;  2YNI A;  1NJY A;  2XG8 A;  1HNI B;  1S5Z A;  3TUI C;  2QZ8 A;  1GK8 A;  1MU2 A;  1YBT A;  1N5V A;  2YX4 A;  1X4E A;  3KHG A;  2HFU A;  5K20 B;  3MM9 A;  2WVB A;  3H5X A;  4P71 A;  2PFD A;  3FBE A;  4L75 A;  4KFB A;  2C22 A;  3FFI A;  2FHJ D;  5IM0 A;  2XLI A;  3HVT A;  3MFI A;  4IRD A;  5F8L A;  3BBF A;  1UVK A;  2C3O A;  3V6D B;  3BS9 A;  2A2D A;  4DV6 F;  4QIE A;  5A8R B;  2FLL A;  1FTC A;  4A8Y A;  1FRX A;  5A0Y A;  1NJX A;  2QA4 G;  1RBO B;  4A4J A;  2W25 A;  4G1Q B;  2K1R B;  1S72 S;  2J9C A;  1PKU A;  1YLX A;  1R0A A;  1CJU A;  1TTH B;  2NXJ A;  4IRC A;  3HHL D;  5KFK A;  4DSK A;  1B7Y B;  2WVF A;  2P6S A;  2OI2 A;  2ATC B;  2C2M B;  2VU5 A;  2Q1L A;  1BQM A;  3U02 A;  3O1L A;  3FCW A;  1KOO A;  1WKK A;  1XWL A;  2VDH A;  4DV5 F;  1PC4 A;  3HM9 A;  3TA1 A;  1HWI A;  2NYH A;  2PMW A;  1TFW A;  3QZ7 A;  4TNO A;  3MED B;  3C15 B;  1PBA A;  3DGV A;  2A18 A;  3DRR A;  2ZH4 A;  3AXK A;  2D69 A;  3MPY A;  2OGU A;  2BAN B;  4JB8 B;  3AT1 B;  2CNL B;  4TY9 A;  3DRS B;  2XY5 A;  2D1C A;  2HQF A;  3PW7 A;  4JV5 J;  2N7Y A;  3JSY A;  1L5U A;  4F02 A;  4B3T F;  3B4M A;  1YZ6 A;  1QUV A;  5ETP A;  3VAI A;  2I38 A;  4WFN Q;  2F65 A;  2KFY A;  4DUY J;  3OJS A;  3RZA A;  3TAN A;  2G0C A;  4RW7 B;  1S7H A;  5JXS A;  3PYE A;  4WF9 Q;  1D9D A;  4EU0 A;  5A76 A;  2OP5 A;  1RWP B;  1VC5 A;  3ET6 B;  5SUH A;  4UZB A;  2HSE B;  1J27 A;  5KFL A;  2E7X A;  4M5N A;  1FI4 A;  3N28 A;  3N6N A;  1YDL A;  5FJ4 A;  1RA6 A;  2QN6 B;  1YKW A;  5IWA F;  1O0P A;  4LR9 A;  2HG4 A;  5GAD I;  4LF7 F;  2VIH A;  3N6L A;  1VFJ A;  2QRR A;  1WOP A;  1HNW J;  2J76 E;  3K0J A;  5LSO A;  2E1M C;  1UFW A;  4F0M A;  5KFV A;  1HYS A;  3ITH A;  3E2E A;  1N32 J;  3KG4 A;  1D3W A;  2FHK A;  1GH8 A;  5E7O B;  3VV2 B;  1O8B A;  4YB1 P;  4ECZ A;  4P10 A;  1N6Q B;  3P96 A;  3ZTR A;  3M8S A;  5D3G B;  4EK2 A;  2RRA A;  2BJD A;  1IBK F;  4CDI A;  3MR5 A;  3HHN B;  1EZZ B;  3NCR A;  5DM7 Q;  3GFX A;  5KOX A;  4KPY A;  2ZZT A;  1S1X A;  2F8H A;  2HHQ A;  3TA0 A;  3OR1 B;  3RR8 A;  1YIT S;  4F0K A;  3CED A;  4NLT A;  2GA7 A;  4L73 A;  1XR7 A;  3WQP A;  1RAJ A;  4KY3 A;  2KB2 A;  4AE5 A;  1ULR A;  1FDD A;  5KFI A;  1DAR A;  5HP1 B;  1Q0N A;  3FK4 A;  4F4Y A;  4L3N A;  3LAN A;  2DGW A;  3UD3 P;  3KHR A;  4UQT A;  2EK1 A;  4B3O B;  1C1B B;  3D6T B;  1NLK L;  1CPZ A;  4OQJ A;  2MSS A;  2V2Q A;  2CAJ A;  2Z2L A;  3BSN A;  3OVB A;  2FQQ B;  2DO0 A;  4CZC A;  4FZV A;  3QWU A;  2MKC A;  1N4L A;  2YX7 A;  1WD6 A;  2BRL A;  2PT0 A;  1NAQ A;  3IRX B;  3A3O B;  1CJK B;  2FJW A;  1S6Q A;  4G3I A;  4NLP A;  2NPI A;  1WHX A;  4LVN P;  4NZ0 A;  5J2N B;  1U49 A;  5J1E B;  2CFX A;  1GMW A;  1WKL A;  2HS4 A;  6FDR A;  1B7F A;  3I32 A;  2PC6 A;  3MPV A;  1SL1 A;  2N3L A;  1S0N A;  3Q2S C;  4IG0 B;  3HX9 A;  1PJ6 A;  1EX8 A;  1YJT A;  4CLT A;  2CJY B;  3D54 A;  3H4B A;  4NLV A;  3OL8 A;  3LWL A;  3IS9 A;  2JJ4 D;  3QT6 A;  3BH7 B;  2BEF A;  4IQX A;  1RT7 B;  2AJ1 A;  2R8K A;  1RTH B;  2DH9 A;  3DDK A;  1FDA A;  2ZOG A;  3ZZO A;  2VD3 A;  2AJ2 A;  1QJH A;  5B09 A;  2VKZ G;  5F8I A;  1RDR A;  3ZZR A;  4AT1 B;  2CZ9 A;  3G6Y A;  2DGO A;  2DGQ A;  1RT3 B;  1WSV A;  1WTB A;  2QE5 A;  5A8K A;  1GNK A;  1TV6 A;  2YVS A;  2B8Q A;  2OEL A;  3N0V A;  1OPZ A;  3FVY A;  1NJI T;  2LU2 A;  3K5M A;  2EVZ A;  4ECS A;  2XEX A;  1FKP A;  2R3V A;  4D3G A;  4DG1 B;  1H3D A;  3HMJ G;  5ETN A;  5HLF A;  3Q22 A;  1Y5I B;  2C2E A;  4ATN A;  4OI1 A;  3RB4 A;  4KH1 B;  3MAH A;  1JNR B;  2YKN A;  5BYQ A;  5DZ7 A;  1A6L A;  4ZCM A;  4DCP B;  2J5A A;  1VJW A;  3MM5 B;  4A47 A;  1V5I B;  5F8H A;  4JV2 A;  2E7V A;  4CO0 A;  4UW2 A;  2C2R A;  3OFH A;  1WG5 A;  3T1A A;  3LF0 A;  4P74 A;  1LNQ A;  3FMW A;  1K1Q A;  1MN7 A;  4QOT A;  1WC1 A;  3NRB A;  4J9R A;  1RT4 B;  4BS2 A;  2VFS A;  3ZTS A;  1VQ6 S;  4DV0 J;  1R8P A;  2M70 A;  1HL6 A;  4WPA A;  4MTP A;  4H4K A;  1K47 A;  4UF4 A;  2DB1 A;  4KBI A;  4CT8 A;  2R2S A;  3KJF B;  3BKU A;  5KG0 A;  4I68 A;  2X7I A;  3OVA A;  1WAC A;  5CYM A;  2KH9 A;  2XQC A;  2YKP A;  1SBR A;  2VG5 B;  3OTC A;  2QA4 S;  1GEH A;  1UWB B;  2L9D A;  3CJ0 A;  1RBL A;  2EXU A;  1QAI A;  5LMU F;  1TK8 A;  3WZ0 A;  2E1P A;  2R7O A;  3TOQ A;  4DFK A;  2OPR A;  2GO8 A;  4DX6 A;  1YJ7 A;  1VRU A;  1YBA A;  1BQX A;  2VOP A;  1A0O B;  5B0B A;  4NRT A;  3DDN A;  3CMQ A;  1WJ9 A;  4OYB A;  2MKJ A;  1C1C A;  5HI7 A;  4OJ3 A;  2H4Y B;  3MHY A;  2HVE A;  5HAN A;  4EZ6 A;  5KFW A;  1LW0 A;  2VZ9 A;  5KFG A;  4H4O A;  1AZS B;  1SJ1 A;  1NKE A;  4ICL B;  3VAK A;  4FYV B;  3WHI A;  1I3O B;  1K73 T;  1IM4 A;  4RU2 A;  1DLO B;  4AYB D;  3RAM A;  3A1Y G;  4LR7 A;  1RKJ A;  2JFD A;  4DL3 A;  2KKH A;  3CNQ P;  4U8Y A;  5GAG I;  2CQC A;  3CE8 A;  3DGP A;  3OQ2 A;  1FE4 A;  4DHV A;  2YNH B;  2Y1L B;  4RUA A;  3R5C A;  2DHG A;  3I96 A;  1SV5 B;  3GV8 B;  3CJ8 A;  3MOJ B;  4MK9 A;  3D1H A;  1F3V A;  2VOD A;  3BYR A;  3RRH A;  2YQ3 A;  5EWG A;  3M6V A;  3H20 A;  1KQF B;  4DPU A;  4BHQ A;  4LF5 J;  2R8I A;  3OBI A;  4QWC A;  4ECT A;  3NGT A;  3CTR A;  4N76 A;  1AXQ A;  3W7B A;  4DV4 F;  2QL5 B;  1NXI A;  1NH7 A;  4U7U D;  1Y00 A;  3BGF A;  2DO4 A;  3CCT A;  3DRP A;  3KUG A;  2V0N A;  2C1E B;  2L41 A;  4OI2 A;  1U6Z A;  2WW8 A;  3BM7 A;  3T6B A;  2WK4 A;  1T95 A;  2GGP A;  4Y00 A;  3I0R B;  4OZ2 A;  2NSC A;  2GCF A;  3LUY A;  2YWE A;  3R2D J;  1HNZ J;  3JQK A;  1SQG A;  4HHU A;  2XLJ A;  4TYA A;  4XIU A;  2E5I A;  4IRK A;  4F04 B;  1BY9 A;  2RML A;  4OHX A;  2YNF A;  4UTG A;  2N4C A;  1RWU A;  4K4Y A;  4I7F A;  4KJI A;  2CNK B;  3D66 A;  3MPU B;  3U1N A;  1HI0 P;  4WFA Q;  4DQQ A;  1K8A T;  3FUY A;  1X31 C;  4BDP A;  4ZJL A;  1DY3 A;  3CJS A;  3KLF B;  3PX4 A;  3CC7 S;  1X5S A;  2F63 A;  1MWZ A;  4ES1 A;  2A3J A;  1QY7 A;  5IXU A;  3AGY A;  3UO0 A;  2HWI A;  4X2B A;  5EN1 A;  3IN5 A;  4ZLJ A;  2UXB J;  1Y5L B;  2W4P A;  4TKT A;  3H8Y A;  4B9U A;  1U2R A;  4WFZ A;  3V81 B;  2IVM A;  4NI2 B;  1H2V Z;  1IKX A;  1NKC A;  1WEY A;  2C2Z B;  3JYT B;  2G0J A;  3NGR A;  3IG1 A;  2HIQ A;  4Z7Y A;  1T03 A;  2ZHA A;  3EM1 A;  2JOQ A;  3NMR A;  3PW5 A;  4A8K A;  2DGT A;  2JWN A;  2JRS A;  5I3P A;  2LCW A;  2HRY A;  2WB1 D;  2WZ1 A;  1J5O B;  3AJD A;  4NLU A;  2W4C A;  5E3R A;  4PZV A;  4IFV B;  3HKW A;  4DR3 F;  3L3C A;  4LSN A;  3PKM A;  1DAX A;  1KNZ A;  4NLY A;  4MKV A;  1IWG A;  1S1U A;  5KT6 A;  1JJH A;  3I31 A;  1TKZ A;  4QWD A;  2HHP A;  1RTD A;  2BVZ A;  3MWB A;  4NOH A;  2WHO A;  3QRR A;  3MD1 A;  2XO6 A;  2OFH X;  1OY8 A;  3C8Y A;  4B02 A;  1U25 A;  4DUT A;  3MF5 A;  4C3K A;  3ZXW A;  1RAO A;  4F4Z A;  2P8I A;  2WSE C;  2RAQ A;  3R3T A;  1N8R T;  4KHM A;  1FXL A;  3HFV A;  1DQ8 A;  4XTT A;  1ZTW A;  4I6A A;  2FVQ A;  4RW9 A;  2YWW A;  2ZH8 A;  2Z8Q A;  3WDO A;  2WVD A;  3QT5 A;  1DZ5 A;  1TR0 A;  4DFM A;  3IXQ A;  3V4I B;  2FDN A;  3C6U B;  4MT1 A;  4WKR A;  5LJ3 Y;  4J9K A;  3T5L A;  2CQ1 A;  5F8G A;  3RBX A;  3BGO P;  5HQ8 A;  3M1V B;  3T1Y F;  3NEK A;  4KGK A;  4OZJ A;  4L74 A;  2YWH A;  5DQH A;  4JBC A;  3ZO7 A;  4NYZ A;  2O1P A;  4L3K A;  3CPW R;  4Y65 A;  1RT6 B;  2H3E B;  1Q5V A;  4RWW A;  5LJ5 Y;  3MMJ A;  2ZBC A;  4CO4 A;  3NS7 B;  1C2P A;  1YJR A;  2NS1 B;  2LQJ A;  3A4T A;  4IR1 A;  1M5H A;  4AFF A;  4P7T A;  2OML A;  1S4F A;  1MSW D;  4KRW A;  4HHJ A;  2FLO A;  5K14 A;  2OPS A;  2CPI A;  2E66 A;  1RBA A;  3S6E A;  2OPP A;  1NK5 A;  4B3S J;  4IOC Q;  4EBE A;  2YPY A;  1S1T B;  4N77 A;  2NXU A;  2C2N A;  3SMZ A;  3EGN A;  3OTD A;  4FYY B;  4I2P B;  3IWX A;  4IUF A;  4KKO B;  2E9R X;  3ENQ A;  3DM2 A;  2ATL A;  5CYQ B;  4JI3 J;  2NUU G;  2DH8 A;  2OD6 A;  3KJV B;  3P45 B;  3QAT A;  1NZ8 A;  4X4O A;  3U1L A;  5JUM A;  1OQ6 A;  2GNK A;  1D8Y A;  2ALY B;  1H2U X;  5KFO A;  1SKU B;  3R97 A;  1I94 F;  3UNY A;  4E2F B;  2H5I B;  4PAB A;  2IAJ B;  1XJW B;  1NK7 A;  3SCL E;  2JVO A;  2XMK A;  4NEY A;  2JVR A;  4LQ9 A;  3C6T B;  1DFD A;  2DRD A;  4F36 A;  1JLB B;  2ZEJ A;  1ACM B;  2VQE J;  4I2Q A;  4DFJ A;  2J0W A;  1QSL A;  3HHK A;  5E3P A;  3U1M A;  1A7G E;  3NKY A;  4K0K J;  3D68 A;  1T05 A;  2M4M A;  4WYL A;  2X3D A;  3NCP A;  3DFE A;  4DN9 A;  4ER8 A;  3O3L A;  5IQ6 A;  3BH6 B;  2PMZ D;  3W1Y C;  1N34 J;  3GZ7 A;  4DV2 F;  3H25 A;  4ITS A;  3I38 A;  4HH1 A;  2ZUG A;  5F3T A;  1RAC B;  2CNN B;  4OV1 A;  2UUA F;  4OL8 A;  2IPO B;  2PEH A;  3POT B;  2FJV A;  2LYV A;  2HVI A;  3S1T A;  4AD6 A;  2HBZ B;  3AAW B;  1YBU A;  3T1H F;  1YGY A;  1G6B A;  5M2R A;  2YNG B;  1EB0 A;  4KO0 B;  2J9D A;  3UDV A;  2E5G A;  1VQK S;  3V6K A;  3GTY X;  1S9G B;  4WTY A;  2IBK A;  4OFZ A;  1FFS B;  5GAD U;  3OXL A;  4K4T A;  4EMD A;  2N7C A;  2XGP A;  1BLU A;  2C2O B;  3CDA A;  1LKZ A;  5B0E A;  2EFO A;  2FVC A;  1BE4 A;  4KSE B;  3L7O A;  1ITP A;  4M5M A;  1N5Y B;  1PJ7 A;  1VC6 A;  3MEG B;  3QYY A;  2QSW A;  1N33 J;  1ZAW A;  2UU9 F;  2QYG A;  3CD0 A;  2DY9 A;  3GCW P;  1EAR A;  1S0O A;  4NXN F;  4I56 A;  3C19 A;  1MRO A;  3GV7 B;  1F1B B;  3D3C J;  2X3G A;  1W25 A;  2V2V A;  4O4G A;  2HMI B;  2DD8 S;  1ZAX A;  1CBK A;  1S57 A;  4PG8 A;  5D15 A;  3A8I A;  4ZVT B;  2VHG A;  1WEX A;  3U7J A;  4I69 A;  5A8W B;  4NLD A;  3UWT A;  4YR2 A;  2W9C A;  2QA1 A;  1S0V A;  3BV8 A;  2LU1 A;  1TKD A;  4R8U B;  1IUJ A;  1TAU A;  1F5B A;  2N4D A;  1M5O C;  1RWW B;  2DGV A;  3BB5 A;  3CMA S;  3UN2 A;  2A6M A;  3MR6 A;  1RU2 A;  4ID8 A;  1JXE A;  1Q1K A;  2J9D E;  3RRG A;  1OY9 A;  4DL4 A;  3NOC A;  1TKX B;  3QAE A;  1VQO S;  4ECQ A;  2EPI A;  1JLE A;  3P49 B;  4B9N A;  4K4Z A;  3QJJ A;  4NML A;  1UJ4 A;  1O6X A;  3W2V B;  2GHW A;  3M2U B;  4F4A A;  1HW8 A;  3DLG B;  2V2K A;  1NUE A;  3PYD A;  3MOZ A;  2P9E A;  3L95 X;  1H73 A;  2FD2 A;  1ZA1 B;  2DH7 A;  4ZPB A;  4B17 A;  4GO7 X;  4KGX B;  3KXD A;  1FKA F;  1T7P A;  3CW2 C;  1YHQ S;  2DNY A;  2XY6 A;  3IWL A;  2HVZ A;  3RR7 A;  2DGS A;  1FWL A;  1R8B A;  3KOA A;  1FNM A;  4DV3 J;  2VOO A;  2GW8 A;  5C42 A;  5EHH A;  3B78 A;  1AA1 B;  2OMO A;  3MUT P;  3GCX P;  4H4M B;  4Z2X A;  1KRP A;  1EET B;  1FXD A;  2V63 A;  2HAI A;  3GIK A;  4ZHR A;  3JSB A;  3AHP A;  4DX8 H;  5C25 B;  4DV7 F;  1P8G A;  3GFY A;  1IR2 A;  1SIZ A;  1F9F A;  1J5E J;  1ZM9 A;  4M8L A;  1X0P A;  3HF5 A;  3GQC A;  1WKJ A;  3OFE A;  3EIC A;  2I5J A;  1VJQ A;  4F50 A;  1WSR A;  3I0S A;  1X60 A;  3MMB A;  2ZHO A;  3LGH A;  1JK9 B;  2DR5 A;  2UUT A;  4LIR A;  4ED6 A;  2IJN A;  2XTJ P;  2EEY A;  4LF9 J;  1K0V A;  3EX7 B;  2DXF A;  2AZ3 A;  4UOF A;  4GKJ F;  2M52 A;  3PX0 A;  4OZ5 A;  1B99 A;  4XPC A;  3HSJ A;  2LDI A;  1U4B A;  4K7Q A;  3MM6 A;  1U6B A;  2XWX A;  3BN4 A;  2CVI A;  1TP7 A;  2D3O 1;  1K1S A;  2XMT A;  2RT3 A;  3UDC A;  3Q24 A;  2RS2 A;  2YX1 A;  5C24 B;  1LWF A;  2IY5 B;  1UEU A;  5ETV A;  2G0I A;  3HVR A;  3PR4 A;  2RKI B;  4MH8 A;  5CZX A;  5KG1 A;  2B7C B;  4QBU A;  3WX8 A;  3PW2 A;  3E01 A;  4ED2 A;  3X3U A;  5FD1 A;  4ZLP A;  2QEX S;  1KLM B;  4DPW A;  3Q86 A;  2Q3P A;  2V8D A;  4RL1 A;  4FDF A;  5KG2 A;  3FEX B;  2RVJ A;  4LVO P;  2OEJ A;  3UD5 A;  3NBP B;  1T02 A;  3NGD A;  5JJB A;  3C66 A;  1NPR A;  1U1R A;  1OJ4 A;  3PYF A;  4NXM F;  3FMB A;  3MAQ A;  4ETZ A;  2GMH A;  4DUZ J;  4CLW A;  1N52 B;  4M63 A;  5FLX U;  4RW8 B;  3MUV P;  4IYQ A;  4DV5 J;  4ED5 A;  5E3C A;  1BHN A;  1FJE B;  2LA4 A;  3OL7 A;  2J0S D;  1VS3 A;  4HT7 A;  2BBE A;  3KLG B;  1S9E B;  2C2K B;  2VC1 A;  1GQE A;  1T11 A;  1TAQ A;  1ZS6 A;  1IM6 A;  2GS8 A;  4QJV A;  3HXM A;  3MM7 B;  1N5Q A;  1B4S A;  2DJW A;  2R9L A;  5DDR C;  2CDR B;  2IIH A;  2NPF A;  2D3Z A;  5ETT A;  1JLF B;  5AXL A;  3CJK A;  2YKM B;  3K58 A;  1IKW A;  4CM2 A;  2UV8 G;  3N79 A;  2H65 B;  5KFF A;  4JI6 F;  1YK9 A;  5B0F A;  3CC2 S;  4C3L A;  3R27 A;  4Q8F A;  4LR8 A;  2ASL A;  1J2V A;  3QZ8 A;  4YDD B;  3RB3 A;  2R7S A;  3D0I E;  5HBM B;  5KFN A;  2NZ4 A;  1K9M T;  2EC2 A;  2JH3 A;  4RBV A;  4F25 A;  3M8Q B;  3B82 A;  4NEZ A;  1BMQ B;  2B8P A;  2HQ3 A;  5GAG U;  8RUC A;  5E3Q A;  5H9E K;  1NBE B;  5IWA J;  2YNI B;  5DLF A;  3DOM B;  4LF7 J;  4KHR A;  1OY6 A;  4HI2 A;  4UT4 A;  1WC6 A;  2VDI A;  3MXH P;  1TUG B;  1U8W A;  1GXT A;  4OI6 A;  3CCW A;  4KFB B;  4LRF A;  1Q7L B;  1F9E B;  1RHM B;  2MLZ A;  4MFB B;  2YH1 A;  3BGL A;  1V3S A;  3HVT B;  3MCS A;  5L1I A;  4JUZ A;  1IXK A;  2FJX A;  1HBU B;  2HNZ B;  1XMO J;  5A0Y B;  2R7V A;  5KFQ A;  2RH3 A;  4WP3 A;  1RHR B;  3WIV A;  4PWW A;  1D8Z A;  1IBK J;  2ZD1 B;  3DXS X;  3KUE A;  4USK A;  4U7C A;  3W2W B;  5K8M A;  1QTN B;  4DPT A;  3NS5 A;  2XNQ A;  1FT8 A;  2DYA A;  3EPI A;  1LW2 A;  3TW0 A;  3D2W A;  2MZ1 A;  2XS2 A;  1FNO A;  2Q2G A;  2ZOM A;  4LF1 A;  3W5X A;  3WBZ A;  5DG9 A;  3GFZ A;  2F1F A;  2MKK A;  4R25 A;  1P1T A;  4HYK A;  4DL7 A;  1V5V A;  2C42 A;  3K57 A;  2E7W A;  2RF2 B;  4NWB A;  1M5V C;  4RU9 A;  2UV8 A;  5K9F A;  4ELV A;  2HVH A;  3MCN A;  2DHA A;  2HZC A;  2MQQ A;  4ZLL A;  2HND B;  1X4F A;  5H9F J;  1R27 B;  4N5S A;  3ONQ A;  2H5J B;  3BBC A;  2JLF A;  1XEZ A;  2XHW A;  4N47 A;  4FF2 A;  3AXM A;  3TAP A;  4ZLN A;  1XMQ F;  4NCG B;  2DIU A;  2VG7 B;  4DV0 F;  2XI2 A;  2E1R A;  1X7V A;  3D1O A;  1SJR A;  3PVX A;  2CQI A;  1F0X A;  1M1G A;  1WI6 A;  1P9Y A;  4QYR A;  1RK8 A;  3MMC A;  4NX9 A;  5I42 B;  4ZVO B;  3HPO A;  4C2M A;  4S0M A;  2CZV C;  3NY0 A;  4QR2 A;  3M7V A;  1AFI A;  4C11 A;  3KG1 A;  4NE9 C;  1CC7 A;  4P6Q A;  5E33 A;  1VGY A;  4I6Y A;  2ILZ A;  3ILJ A;  3PZP A;  4J90 A;  4ZPA A;  1HBO A;  5IT9 Y;  4ELU A;  1U1K A;  4IO9 Q;  2Q6B A;  3TVY A;  5KG6 A;  1CC8 A;  2NXC A;  1RAE B;  1RAF B;  1EP4 B;  3ITH B;  4DSJ A;  4JI2 F;  2MST A;  1SJ4 P;  5CAB A;  1EKS A;  5L1L A;  2W9B A;  4ZVQ B;  4DPO A;  4L72 B;  5DGB A;  4J9V A;  3EXC X;  3CD5 A;  4CCH A;  5IQQ A;  1MLA A;  3L7U A;  1B0V A;  3GIR A;  4U67 Q;  1SH2 A;  2WBM A;  3ZNJ 1;  3DCA A;  1L3V A;  2CQ2 A;  2DNZ A;  3LPE A;  4USM A;  3CWJ A;  1OYE A;  2XBP A;  5E41 A;  5K8N A;  1S1X B;  5J2M B;  1WG4 A;  4OI4 A;  3KNG A;  4ES2 A;  4R5P B;  3LGM A;  2RE1 A;  2H48 B;  4FKX A;  2CYY A;  3K5O A;  1TQL A;  1YRT A;  5B7W A;  5J2Q B;  3FQL A;  4DQR A;  2VBW A;  4CLK A;  1TL4 A;  2ZH2 A;  1RAG B;  2LEC A;  3ZZP A;  3BGR B;  4G65 A;  1HNX J;  4LF5 F;  1HW9 A;  1HHS A;  1IKY B;  3LP0 A;  4RZR A;  2AYG A;  1MWY A;  1JLQ A;  2D3O R;  2EK6 A;  3BO4 A;  1UPM B;  2QMX A;  4ZCK A;  5ETQ A;  1F9H A;  3OTE A;  1KKH A;  2VKR A;  3QIP A;  2HHV A;  1WNE A;  2WTF A;  3D5M A;  2BM0 A;  3JSM B;  4OMF G;  1M1H A;  3MUM P;  1H98 A;  3R5A A;  2V9W A;  3DI6 B;  4RJV A;  4XDD A;  1SJQ A;  4CI0 B;  1HNZ F;  2BE2 A;  3HUL A;  4NRU A;  3I5A A;  2A2C A;  3NGU A;  2VB6 A;  4CIO A;  1D9A A;  3C46 A;  4WU2 A;  4RBT A;  2HFN A;  3LAM A;  4NLX A;  4ZPW R;  1UKU A;  1N48 A;  3KK1 A;  2FZC B;  1RTZ A;  1HQE A;  4K59 A;  3QWP A;  4NAS A;  1SUQ A;  2MTL A;  2GQC A;  1URR A;  2B5J A;  3IS9 B;  5KOW A;  4YQW A;  4B9L A;  1V3Z A;  3M05 A;  4GVB B;  4OI0 A;  5CH7 B;  4HVZ A;  1QE1 B;  2HHS A;  3CIM A;  1CSJ A;  2DPJ A;  3PHE A;  3UNG C;  5LMU J;  1O51 A;  3GFH A;  4UOC A;  2Y1J A;  2YWG A;  1T9T A;  1KQS R;  3J7A N;  3SFG A;  3NOG A;  3PYG A;  5KAK A;  3BJY A;  1KDN A;  5DRK A;  3I9V 9;  1YJU A;  1LWE A;  3KK3 A;  2PII A;  2HFZ A;  3UCG A;  3N6M A;  3OW2 R;  4WK3 A;  5A8K B;  4YR3 A;  3MPW A;  3PR5 B;  2C28 A;  4BC7 A;  1TV6 B;  4ZP8 A;  2UUW A;  3OVS A;  3PX6 A;  2MGZ A;  4M5I A;  3W8G A;  2V4J A;  4IR9 A;  3HHL C;  1FKP B;  3AJ2 A;  2W24 A;  4X4N A;  1F5A A;  2XNR A;  3IR5 B;  2R7X A;  2PFF B;  2IBO A;  2KRR A;  2EW9 A;  2J0X A;  2AP6 A;  3OHB A;  4J9Q A;  1NH8 A;  1RT2 A;  2NCK L;  2VFR A;  3UE2 A;  3PHT A;  1UFL A;  3EE3 A;  1K44 A;  1HD1 A;  1H6K X;  1U7L A;  3L7P A;  5AE1 A;  4RW4 A;  1X4H A;  2EFP A;  3V6D A;  4CO5 A;  5DGA A;  2LQ5 A;  4V19 J;  1UVI A;  5A8R A;  5KG7 A;  3UDE A;  1D9F A;  1ROF A;  2IVY A;  2ZH6 A;  2GQ2 A;  2ZUA A;  2K1R A;  1OPI A;  1VQM S;  3C2P A;  3ILO A;  4ZP6 A;  3C14 A;  2XSJ A;  4LF4 J;  3THT A;  3PW4 A;  2C3P A;  2DCU B;  5LOQ A;  2OH2 A;  5CYM B;  3O6Q A;  2MQM A;  1KQK A;  4GKK J;  1PCA A;  1GX5 A;  3A8J A;  4Y28 C;  4NL5 A;  3R5J B;  3H59 A;  9ATC B;  3MED A;  1ZTT A;  3C15 A;  3BR9 A;  5F8J A;  1U1M A;  5D8H B;  2PGC A;  3IP0 A;  2EG1 A;  3DRS A;  4DL2 A;  2EC0 A;  2RQC A;  3MCM A;  4B3S F;  5B0G A;  4WBF A;  1LW0 B;  1FX4 A;  4IKA A;  5L39 A;  2MHN A;  1Q8L A;  3TUJ C;  2KHC A;  1F2G A;  2YKO A;  2J8S A;  2UVW A;  1IBL F;  1IJE B;  4DSF A;  1S6P B;  2I6W A;  3AH6 A;  3ET6 A;  2G2Y A;  1EQM A;  1KVI A;  4LJM A;  3DGP B;  1RSC A;  3BZQ A;  4DR3 J;  3HJV A;  4N8O A;  5SZT A;  1RAI B;  2QGF B;  2GVD A;  3RU0 A;  2OFG X;  2CQ4 A;  2VV5 A;  3QNW B;  2J8A A;  1RHU B;  1DUR A;  2KJW A;  2JZ8 A;  1VQY A;  3M8P A;  2FZG B;  1FRH A;  1REV A;  3G6X A;  4J9U E;  3RAX A;  2WON B;  1DJ0 A;  5ADZ A;  2DHS A;  1N5S A;  5C5J A;  4MKY A;  4NLW A;  4K0K F;  2AIR B;  2IJR A;  3DRP B;  2H54 B;  3M9N B;  3DOL B;  4TVA B;  4ZVG A;  5IT9 U;  2GGP B;  5CZV A;  1N6Q A;  2CG8 A;  5FII A;  3BQ2 A;  3LQV A;  2B9X A;  2K8G A;  1TU0 B;  2Y8W A;  1LFP A;  4IFY A;  1TMM A;  1N34 F;  3JB9 k;  1LV5 A;  2V9K A;  3D6M B;  4E98 A;  1FX2 A;  4ZMM A;  5ITH A;  3ENV A;  2E29 A;  3OR1 A;  1U2F A;  2YNF B;  3NG8 A;  2P5V A;  1LOU A;  3CF5 Q;  1HBM A;  4I7F B;  4QWA A;  2DRB A;  3T1Y J;  2DR6 A;  1S79 A;  3CCR S;  2RUS A;  3PG9 A;  1PC5 A;  4NYP A;  2MHE A;  1FCA A;  1ZAV A;  1Q7Y T;  2CXE A;  4LRD A;  3H90 A;  1U1L A;  2VAS A;  5HMW A;  1JXL A;  3SQG A;  2ABY A;  2K3I A;  4NLO A;  2Z58 B;  2UVR A;  2R7U A;  2DHH A;  1C1B A;  4PEO A;  1NU4 A;  3EWG A;  5T14 A;  2ZWP A;  3GLJ A;  4DPY A;  3OT9 A;  2IFX A;  4K50 A;  4X4V A;  4Q0B B;  1ZPV A;  5CQG A;  2VQF J;  3QLH A;  2QFJ A;  1LWC B;  2HBR B;  4ENO A;  5M2P A;  2GAG C;  1B64 A;  3UCZ P;  2B9E A;  1T03 B;  3IRX A;  5IC4 B;  3AOD A;  4OX9 F;  1ZPW X;  4FYX B;  1VOM A;  4NCA A;  2HK2 A;  1FER A;  5J2N A;  3NMA A;  2KM8 B;  3QRQ A;  1P9Q C;  3T19 A;  2CUY A;  3VZI A;  2M3D A;  2E1A A;  3FZ2 A;  2IM3 A;  2VFU A;  3CJ5 A;  4ZN3 A;  4J9O A;  4JI8 J;  4LSN B;  4C8L A;  3KYL A;  1S9F A;  1Y0H A;  5K8P A;  4RUC A;  4USI A;  1XTZ A;  1TKZ B;  1NLT A;  1UFK A;  1PYS B;  4DZD A;  1X4B A;  1RTD B;  3KLH A;  5E3A A;  5HQL A;  3SI8 A;  6AT1 B;  1JLG A;  2FY8 A;  2E9T A;  5DG7 A;  1JLA B;  4ZCL A;  3PNI A;  5D0R A;  1RT7 A;  1VBY A;  1R0C B;  3K59 A;  3TVZ A;  5D0H A;  1T9Y A;  1HHT P;  4MKB A;  4IDK A;  2FVP A;  1OS5 A;  1Z1Z A;  3CJQ A;  2I1R A;  3EMT A;  4DR1 F;  1H0H B;  2BOA A;  3CT9 A;  4F3M A;  4URQ U;  3P4U B;  4X4P A;  1EJ7 L;  2QL7 B;  2CG4 A;  3C5X C;  3T5J A;  4GC6 A;  4OYW A;  4RW9 B;  4EGL A;  1REG X;  3OLA A;  1RWX B;  1RT3 A;  1NEE A;  2LP4 A;  4QW8 A;  2DK2 A;  2VL1 A;  3EDQ B;  2GIF A;  4C0H A;  2HHW A;  4DV2 J;  2QLD A;  2DNG A;  3G71 S;  1U1P A;  3BSC A;  1D0E A;  4NA3 A;  1PIE A;  5I3U A;  2K3K A;  1X4D A;  2UUA J;  4YHH F;  4TLR A;  4DV3 F;  1NME B;  4PWU A;  3OJU A;  2J7U A;  1LWX A;  5KFZ A;  4DG1 A;  1JLC B;  3TQ1 A;  2OHD A;  3VAH A;  1QUP A;  2AF6 A;  2F7V A;  1VI7 A;  3Q8U A;  3T1H J;  3IMQ J;  1HQU B;  5F9N A;  2MKS A;  4J37 A;  3I4P A;  4ZCI A;  2AGO A;  1T8E A;  4GMK A;  4WTO B;  2AEM A;  3GJR B;  3K8V A;  3M9O B;  3EZO A;  1RQ0 A;  4ZPD A;  2SXL A;  4CLL A;  3IFE A;  1ZH5 A;  4USW A;  4DSL A;  3MMA B;  2OPP B;  3M8W A;  1G4C A;  1C0U A;  3HHD A;  2JNJ A;  4BLG A;  4Q8E A;  5CA5 A;  1RT4 A;  4YS2 A;  3M9M B;  1U8S A;  2EWH A;  4LT6 A;  5D77 A;  1RE1 B;  4N56 A;  1SB6 A;  4NXN J;  1WF2 A;  1VHI A;  3NAI A;  2VON A;  1U6F A;  1Q4R A;  3H40 A;  1VQP S;  1FDN A;  2DNH A;  1RIS A;  1KOH A;  3W9H A;  2VG5 A;  3LPY A;  1SCJ B;  3HVW A;  3KTQ A;  2LEA A;  3W66 A;  4EEY A;  2C3Y A;  4UUX A;  2V5H G;  2BOP A;  3MDF A;  4IOA Q;  3RG6 A;  1VRT B;  2RQM A;  2I8E A;  3JQJ A;  2CJQ A;  2HWH A;  1DTQ A;  2Q6C A;  1B70 B;  4DR7 F;  3D0G E;  3M8Z A;  4X4T A;  1KLN A;  1T05 B;  1NK0 A;  4IG3 B;  1PO6 A;  3SSS A;  1L3U A;  4NLS A;  2RDI A;  5AT1 B;  1UWA A;  3P5T L;  2UXC J;  4DX5 A;  1VQS A;  4OZ0 A;  3R6L B;  3UR0 A;  3QFW A;  1OWX A;  1DLO A;  4RUB A;  5GAE I;  4F7V A;  3J81 j;  3CCZ A;  3FRZ A;  3NNA A;  1QAJ A;  1S4E A;  3A12 A;  3DLK B;  3KLI A;  2BW2 A;  3VTI A;  1NDP A;  4A8F A;  4IH6 A;  1R6Y A;  4DUZ F;  4AQY J;  2YNH A;  3BKF A;  2ZFH A;  3VCD A;  3FSX A;  5EX3 A;  4GO5 X;  3LW5 C;  3CJ3 A;  1S7I A;  1U0H A;  3KLE A;  4K8R A;  2M9K A;  5HVH A;  2CWK A;  4JV0 A;  3VAL A;  2Q43 A;  2ODX A;  3J81 Y;  3HK2 A;  4J9L A;  4O0N A;  2AJ0 A;  1Q53 A;  4ECR A;  1XAO A;  4W4M A;  1FEH A;  4U7U K;  3PRD A;  3KDO A;  2V34 A;  1HWJ A;  1NZA A;  3ZZT A;  4K4S A;  2KXF A;  4P73 A;  3HFZ B;  3GJT B;  1UTA A;  1EKR A;  2E5L F;  4LBI A;  4M5G A;  3PJX A;  5G4D A;  3I0R A;  1NK6 A;  4DV7 J;  2B43 A;  3J7A 1;  4PRF A;  4DR5 J;  5ETR A;  3NLC A;  4FN5 A;  2NZC A;  4HHH A;  3QMQ A;  3K5P A;  3KMS A;  1X9M A;  1M5S A;  1TK0 A;  2BJ1 A;  2KM8 C;  1PSD A;  4OX7 A;  3BEG B;  4DU8 A;  4OI3 A;  3C16 A;  2IMW P;  3SXL A;  5J1P A;  1HLW A;  4O4G B;  3GWC A;  4OZ3 A;  2C3M A;  1Y9O A;  4J9S A;  3TJA A;  4K4X A;  1QLN A;  2B56 A;  3V2U C;  5C2C A;  2HZV A;  3FC9 A;  1S1W A;  2PD1 A;  1W26 A;  2W9C B;  4GKJ J;  3KLF A;  4PQA A;  2V50 A;  4PQU B;  2BM1 A;  4LSZ B;  2Q79 A;  1WTF A;  2BX6 A;  3ZZY A;  5AJ3 J;  1EQ0 A;  1HFE L;  1WHW A;  4UUW A;  3LH2 S;  4FXV A;  1NB7 A;  3Q8V A;  5L38 A;  1YVF A;  2XCP A;  4J9N A;  4PUO B;  1MWQ A;  3V81 A;  4FNI A;  3DU6 A;  4NI2 A;  4P2M A;  1XMO F;  2LA6 A;  3JYT A;  2W4D A;  4K2J A;  3GON A;  4PWD B;  4C98 A;  1VIX A;  1GMV A;  1HKA A;  3PCO B;  3IR6 B;  4KGM A;  2R2U A;  4QW9 A;  1E6V B;  1SI9 A;  3LTO A;  4Y0F A;  1FD8 A;  2XZW A;  1OIA A;  2Z0G A;  2VA3 A;  4LUB A;  3AOA A;  2DNO A;  2ZH7 A;  5I3Q A;  3TWZ A;  3M4X A;  1UA0 A;  1UZH A;  5F0W A;  1FA0 A;  2IDE A;  2GX8 A;  3Q89 A;  2MB0 B;  8ATC B;  1R89 A;  2DIT A;  4JI4 F;  5DZ6 A;  4NXM J;  2R2R A;  3CSK A;  3NS6 A;  3TO8 A;  2VFV A;  5KG4 A;  3M30 B;  2XMV A;  1VQL S;  2R7T A;  3R7N B;  2RU9 A;  1IWA A;  4MK8 A;  2FY1 A;  4RNF A;  2KHD A;  2JC0 A;  4ZHR B;  1Q16 B;  4HL9 A;  2AJ4 A;  4RWX A;  1Q8K A;  1FRL A;  4FS2 A;  2EFN A;  4PAA A;  4DI6 A;  4G1P A;  1XER A;  2VA2 A;  3OR2 A;  1GMW D;  4JI6 J;  1RWK B;  3G8T A;  2I5J B;  2HLT A;  4PXD A;  1FDB A;  3KHL A;  3M1V A;  3AB2 B;  1T0T V;  4C0O C;  3QT8 A;  4OZ1 A;  3TZX A;  3A8E A;  1Q95 G;  2GML A;  2CPD A;  1CG2 A;  4TU7 A;  2ZIT A;  2QO3 A;  2ZH1 A;  1ZM4 A;  3IBF B;  4CTA A;  4JI5 F;  5EX0 A;  3MUR P;  2YH0 A;  2U1A A;  3G6V A;  4H54 A;  1CJV B;  2QC3 A;  5EUH A;  2WB4 A;  3IRW P;  2WSF C;  2YQ1 A;  1VBX A;  3R1H A;  2W2P P;  4P75 A;  2ZOF A;  2MDA A;  3H5S A;  2UVV A;  2FVS A;  5D4N A;  2BQR A;  3MAA A;  3WIU A;  4ELT A;  2AKW B;  2C3U A;  1CS4 A;  4KAI A;  4EO8 A;  4AL5 A;  2LFV A;  2QLB B;  4JP8 A;  1RTI B;  1W7W A;  4QR0 A;  1S1T A;  4NMX A;  1FRM A;  3L9Z A;  1RUS A;  3E01 B;  4AXJ A;  4KKO A;  4USJ C;  5HO4 A;  5CYQ A;  4NLG A;  1SJ3 P;  2GFF A;  2NXE A;  4E8U A;  3OTO J;  4L6V 3;  4KIA A;  4OHZ A;  2XO7 A;  3IR7 B;  4Y2A A;  3KJV A;  1KTV A;  2V69 A;  2ASJ A;  4ZOS A;  1FO1 A;  4M5D B;  3FNN A;  5KFD A;  2BAC A;  1UA1 A;  2H5E A;  2RB7 A;  3FGV A;  4HAC A;  1AFJ A;  1ZYQ A;  1HNX F;  1SC6 A;  3Q8S B;  1X4G A;  2UUB J;  2VF3 A;  4JI1 J;  2IAJ A;  3HCX A;  1Q86 T;  2GC8 A;  2LEP A;  2B6A B;  3L4B C;  2IHR 1;  3C6T A;  5DET A;  1FF2 A;  2ZH5 A;  1JLB A;  1TL1 B;  2KDO A;  3ADA C;  1IQT A;  3FSY A;  5CXT A;  4BBY A;  5KG5 A;  4ZPT R;  1XNR F;  3CJK B;  2D41 A;  4M5J A;  3BF4 A;  2X1G A;  1IKW B;  2P9G A;  1XMQ J;  5IOL A;  1RT5 A;  3AQP A;  3TA2 A;  2PMH A;  3B54 A;  3ZZ0 A;  2N3O A;  4X4R A;  2JZ5 A;  1R31 A;  1RWO B;  1UW9 A;  3D7S B;  1M5K C;  2OUG A;  1VQN S;  2QIF A;  1F2H A;  1FRK A;  3HSD A;  4RUH A;  1XR5 A;  5KFM A;  2F8M A;  4OLP A;  5DDQ C;  2ZH3 A;  1RAD B;  4CLY A;  2ALZ A;  2KZZ A;  2MQN A;  3W62 A;  5U47 A;  3SYZ A;  2XM3 A;  4Y2M A;  3EVM A;  1KC8 T;  2FVR A;  4ZDN A;  3DLL Q;  3MR2 A;  2WW4 A;  2YKA A;  2YNG A;  4ZP9 A;  4GRS A;  1NDL A;  1ARO P;  1NM2 A;  5KT2 A;  1LFW A;  4W92 B;  1NSA A;  1S9G A;  3H0P A;  3LP1 A;  2RDJ A;  3EXY A;  4HH0 A;  4U8V A;  2M8D B;  1IKV B;  2R42 A;  3I55 S;  3VAF A;  2P6T A;  4RR5 A;  1KVK A;  4JI2 J;  1OSC A;  1SKR A;  3T3F A;  1ZZF A;  4LIW A;  1TKT B;  2G4B A;  4X64 F;  1KEK A;  3Q8R B;  1D1U A;  4TLQ A;  3J81 U;  3MEG A;  4ECU A;  3T9N A;  4M5H A;  3LZ8 A;  3IAM 9;  3CDU A;  2EKN A;  1S6U A;  3CCL S;  2ZWO A;  5I4M A;  4FBU A;  4QPX A;  2B4O A;  4WYW A;  4TY8 A;  1WF0 A;  3DOK B;  5CHC B;  1AT1 B;  1A9N B;  4HEA 9;  1NSK L;  3PRB A;  3CD7 A;  2MKY A;  1SL2 A;  1WDD A;  2WRM A;  2XS7 A;  4B08 A;  2HNY B;  1BWV A;  2R7R A;  1CVJ A;  1VDH A;  2BUN A;  1RAA B;  4P7V A;  2YWK A;  2NUH A;  5A2Q Y;  3V4M A;  1S49 A;  2EG2 A;  5KTQ A;  4LFA F;  3H42 A;  3GE9 A;  3GMG A;  5HJX A;  2IC3 B;  3LAL A;  1FTR A;  3UN5 A;  1UCN A;  2ACM A;  3GPA A;  1BQN A;  1VQ9 S;  4DBQ A;  4OIX A;  2DHX A;  2OLW A;  3RGI A;  4FS1 A;  3MEC A;  4ED4 A;  3GB0 A;  1TL7 B;  4V1A k;  3W2V A;  3M2U A;  4A8Q A;  4MJK A;  3MMC B;  3DLG A;  1Y4Z B;  1PIL A;  4LF4 F;  5KFJ A;  1GAO A;  1KP6 A;  4OZL A;  3Q8Q B;  4DZ6 A;  4I1T A;  4PPD A;  2F5G A;  3AA8 A;  2AEF A;  5T7L A;  1VQ4 S;  4Y2I A;  5G0R A;  4C11 B;  4OLO A;  2ROE A;  4JYA F;  1T3O A;  4GKK F;  3GG1 A;  1WHY A;  4EUV A;  2MMY A;  1ZM3 A;  4PYD A;  3TAR A;  3AB4 B;  4PR6 A;  4YUD A;  2GAH C;  4WP9 A;  4DL5 A;  3CXC R;  1XR6 A;  4MMO A;  3PW0 A;  3I56 S;  4USU A;  4IH5 A;  4LSL B;  2HLU A;  4ZK7 M;  4QWE A;  4FKY A;  3JTN A;  4H4M A;  2ZBP A;  1HWU A;  3KDN A;  4CH0 S;  4C48 A;  4CLZ A;  4TU9 A;  3B8H A;  1RCX B;  5C25 A;  3TUZ C;  2HBY B;  4LRC A;  3DLH A;  1WDT A;  2AU0 A;  3OUY A;  5GAH I;  2BXJ A;  4Q43 A;  5LMN J;  3TX0 A;  1HAR A;  3OTB A;  4C7Q A;  4PXB A;  3TEH B;  2XB2 D;  2AWZ A;  2UXD F;  1R43 A;  2AT1 B;  3SV3 A;  2FPH X;  3HSZ A;  4MIW A;  3HDS A;  4KGZ B;  1NCL A;  3H5U A;  1QD1 A;  4A8M P;  5KFU A;  5HVF A;  1PGZ A;  3P6Y C;  2LQ8 A;  3GJQ B;  2FJB B;  4YOE A;  2HYI B;  4FF4 A;  5GVQ A;  2ZE2 A;  3FRY A;  2L48 A;  5KFR A;  3CD6 S;  1RTJ B;  3SQO P;  3LP0 B;  2ZJQ Q;  3KK2 B;  3QSI A;  2DR7 A;  1Y3K A;  2HS3 A;  4MKA A;  1OSD A;  4YN3 B;  2BAB A;  1HBN B;  3D1Q A;  2PA8 D;  4J80 A;  5AXN A;  3RBD A;  1T9X A;  3NNH A;  2HHX A;  2RKI A;  4URS A;  1RJJ A;  2BE2 B;  1H7W A;  1S1V A;  4PPZ A;  2GIR A;  4N7T A;  2DEI A;  4NZ7 A;  5K8O A;  1NDC A;  3PEH A;  1KLM A;  2RHQ B;  5D4O A;  4LFB F;  2ZHB A;  2F3J A;  2NSB A;  3RBZ A;  3NBP A;  5KFH A;  5J2P B;  4C8Z A;  1SUQ B;  2EKY A;  4F8R A;  2MZJ A;  1EAY C;  4RW8 A;  3D9B A;  3MEK A;  4Y6I A;  2LDY A;  1HA1 A;  3DU5 A;  3HZE A;  5LSL A;  2RS8 A;  3BO3 A;  3QGH A;  2VIC A;  1IR0 A;  3KLG A;  3MEE A;  1S9E A;  1VMB A;  2AJQ A;  3TZZ A;  3HI9 A;  4WE1 B;  3A3P B;  3BPD A;  3DDI A;  3MM7 A;  2VQF F;  1OMS A;  2R8G A;  4HT5 A;  1H38 A;  2KT3 A;  3BDP A;  1JKH A;  3RYL A;  2ZZN A;  4LMZ A;  4DXL A;  5LT5 A;  1JLF A;  2FZK B;  4WK1 A;  4ZVR B;  3CGI A;  3I87 A;  1E6Y B;  2YKM A;  1QVG R;  3TJ8 A;  1DQA A;  3SEO A;  5HJY A;  3PO4 A;  1CUL B;  3DYA B;  1FK9 B;  2E5J A;  1TMJ A;  4LBH A;  4A8S A;  1IBL J;  3F56 A;  3CC4 S;  1N54 B;  3IA0 A;  4JI8 F;  5HBM A;  3VQT A;  2V4J B;  1M90 T;  5T41 A;  4ZVP B;  4DQI A;  3GR0 A;  5GAE U;  3M8Q A;  3V6H A;  3QJL A;  4BWJ A;  1NDK A;  1KWM A;  2ROP A;  3IGV A;  4WIQ A;  3VF0 B;  4IO1 A;  1RT1 A;  1TUV A;  3DOM A;  2FC9 A;  1R3N A;  4C0B A;  5DDP C;  2HGL A;  2W8L A;  2GZO A;  1RT2 B;  3UI3 A;  4W90 B;  2GV1 A;  2RRB A;  5BXI A;  7FDR A;  2MQ8 A;  3EYZ A;  1QM9 A;  3HKZ D;  1Q78 A;  2KG1 A;  4MFB A;  4RW4 B;  2QMW A;  2FHJ A;  4JI7 J;  3UQS A;  1HBU A;  2HNZ A;  1PG5 B;  4B9S A;  2MKI A;  1XK8 A;  2YTC A;  2IVF B;  2DCL A;  2OPQ A;  2XMM A;  4QYZ J;  1WC0 A;  3QGP A;  3AGX A;  5LL6 d;  5H9F K;  2ZD1 A;  4FYD A;  4LRE A;  3W2W A;  4LF8 J;  1SXL A;  4U96 A;  3C14 B;  1GMU A;  1R8A A;  4HTI A;  1KON A;  2XSJ B;  1CJT A;  1RP5 A;  4UY8 T;  2XWY A;  3HHL A;  2LKZ A;  2W2N P;  3R5B A;  4YP3 A;  4M94 A;  3N5F A;  3KHH A;  2FGC A;  5BR8 J;  2CVE A;  4CNY A;  3F41 A;  4C8Y A;  4N8N A;  4YEA A;  2O01 C;  4O3O A;  3CCE S;  2PE8 A;  5EWF A;  4B9T A;  3GII A;  2VPY B;  2B51 A;  4FXD A;  2RF2 A;  2OEM A;  1TZ0 A;  2FB0 A;  2DIS A;  1R8C A;  2B4V A;  4F0H A;  3SZ2 A;  4ID5 A;  4P72 A;  1FKO A;  3A8K A;  2G9O A;  2HND A;  1C0T A;  2OSR A;  2ASD A;  1GT8 A;  3GR1 A;  4KH0 B;  4DCJ B;  3M2V A;  4ZPV R;  3UCU P;  5ETL A;  2DIV A;  3CJT A;  5A2Q U;  4NCG A;  3LAK A;  2Y1I A;  2B9W A;  2VG7 A;  2WVC A;  2BJ3 A;  4KE5 A;  4YME A;  4A8O A;  4OX9 J;  3GP9 A;  3FEZ A;  4I67 A;  2VG6 B;  3ELH A;  1BWE A;  1Y7P A;  2A6O A;  1IJF B;  3QAU A;  5I42 A;  4HDG A;  3TAQ A;  5KFB A;  3IAS 9;  1KBR A;  2JSX A;  3G6E S;  1ZM2 A;  2DGU A;  3SSQ A;  1BD6 A;  2YY3 A;  1DQ9 A;  2B0G A;  2HEK A;  2GVD B;  1RU1 A;  4WU3 A;  4DQS A;  3CCM S;  4DR4 J;  3M32 B;  1QDU B;  2E5H A;  2M8H A;  2G1H A;  4QIV A;  3FQK A;  3M8P B;  4AXI A;  1HD0 A;  4ZP7 A;  1RWM B;  1REV B;  1TEL A;  1RLD A;  2VJV A;  2B7B B;  3GIM A;  1EP4 A;  4WCE Q;  2CIM A;  3F73 A;  4F2S A;  4E0D A;  3MM8 B;  4RNO A;  4CM0 A;  1M1K T;  5HL7 Q;  3MCO A;  4DR1 J;  5F8N A;  4GVL A;  3DLJ A;  5F0U A;  4O3Q A;  2UXC F;  5F3Z A;  4I64 A;  4IFY B;  1YJV A;  2WOM A;  3WX4 A;  2KVI A;  4ERD A;  5J2M A;  2ZZM A;  2KYX A;  1ZOT A;  2G1D A;  4KGV B;  4USH A;  4LRA A;  4R5P A;  4DSI A;  1HBM B;  3QJP A;  5HMX A;  2X1B A;  1FWK A;  4YDX A;  4AQY F;  1UVM A;  4Y3C A;  2D3U A;  1PAU B;  5J2Q A;  7AT1 B;  4YHH J;  3BGR A;  3ZZZ A;  2ZKU A;  3ETO A;  3UR3 C;  4B3R F;  4FP9 A;  2BJ9 A;  3SQG B;  5B08 A;  4YB5 A;  2ZNZ A;  2HHU A;  4QQB A;  1IKY A;  3IWN C;  5JVH Q;  3GYX B;  3E51 A;  5HSP A;  1CEZ A;  1HPZ A;  1NRK A;  3ILL A;  1C4A A;  3N01 A;  3G82 A;  4F3O A;  3SCJ E;  5MAO A;  1B3T A;  1RWN B;  4O44 B;  4WWS A;  3QLH B;  3JSM A;  2FGO A;  3IO1 A;  5B0A A;  1YJN S;  2V8P A;  3DI6 A;  1JB0 C;  5AE3 A;  4DR5 F;  1H72 C;  4OHV A;  2IDL A;  1SL0 A;  4N41 A;  3ICL A;  4X84 A;  2LQB A;  3VGT A;  4QR1 A;  2VUG A;  1RKI A;  2DPI A;  2Y3Y A;  3TJ9 A;  1L3K A;  3PDN A;  5EDW A;  2JX2 A;  4O3N A;  2ZKT A;  3G8S A;  1NK8 A;  2NLW A;  2E9Z A;  2KO1 A;  2F4V F;  2JFK A;  1S6O A;  4RLE A;  4QIW D;  4PXE A;  2ZM6 J;  3KLH B;  3KLV A;  4DDF A;  1JLG B;  2MKH A;  4GVB A;  4AL7 A;  2BV3 A;  2RQK A;  1QE1 A;  2QMU B;  5AJ3 F;  1ZET A;  2X1A A;  4EFA C;  5HQM A;  3H7H B;  4EBC A;  2DNL A;  2ZVS A;  3DRX A;  4P52 A;  2FIU A;  2CJB A;  2AGP A;  4RX6 A;  4IDK B;  2HQG A;  1XC9 A;  2MY7 A;  3HT0 A;  4DR7 J;  1UZD A;  3GYG A;  3FZB A;  2B4P A;  2GVZ A;  2FLP A;  5CAA A;  3SCK E;  2FYX A;  4QIF A;  4U95 A;  5C2G A;  2HHT A;  4LF2 A;  2F40 A;  3S01 A;  4QIG A;  5D78 A;  1W2B R;  3UVJ A;  3HFK A;  5KFY A;  1UW4 A;  2AGQ A;  4YY3 J;  4LF6 J;  3LOU A;  1TL3 A;  5HN0 A;  1WOS A;  2B26 A;  1RI7 A;  2HPU A;  3BSO A;  4Q44 A;  2ERR A;  4RW6 B;  1KN6 A;  5I3U B;  3PIP Q;  4NLQ A;  5AE2 A;  4NCB A;  3NCQ A;  3CO9 A;  4OHW A;  3AQO A;  3D28 A;  2GQQ A;  3PIO Q;  4OYO A;  3T41 A;  1DTT B;  2I0X A;  2QG9 B;  4WII A;  5KFA A;  2DNR A;  4B9M A;  3AJ1 A;  5FDL A;  1TVR A;  2ZC4 A;  1UAW A;  2KFZ A;  2PA3 A;  2DGX A;  3H4D A;  3W3S A;  4M95 A;  3FBF A;  2KYZ A;  3OXG A;  3ISN D;  3BGU A;  3FBB A;  2MLX A;  2AJF E;  3PFO A;  4DL0 C;  3TZY A;  1T9U A;  1YRX A;  1C0U B;  3NWR A;  3TUP A;  2E5L J;  1O5J A;  1SVD A;  2HW3 A;  3NXZ A;  4X4U A;  4WXO A;  5MLC V;  5KT3 A;  3FCV A;  4IOB A;  3M2R B;  1NSP A;  1PJ5 A;  2B3T B;  5LM7 E;  2G2Z A;  1SC4 B;  2HQC A;  3UD4 P;  3JQM A;  2XZD B;  3CCJ S;  2M88 A;  1YJW S;  2ZBR A;  4DL6 A;  3G86 A;  2OAU A;  3OPK A;  4PG6 A;  4UOH A;  3VR1 A;  1WUU A;  4LRB A;  1MU2 B;  2VFT A;  3GIL A;  2RIL A;  1XMB A;  2V94 A;  4JI0 F;  2MQO A;  4XPE A;  2WVE A;  1N88 A;  3MM9 B;  3F0N A;  2BQU A;  3QID A;  3VGV A;  2LXI A;  3J7Y I;  1KHV A;  4J91 A;  3FFI B;  1DTQ B;  3QO9 A;  5IM0 B;  2GJI A;  4KC5 A;  2HFO A;  2ZBQ A;  3ISZ A;  4WZQ A;  5KT4 A;  4O4R A;  4ED8 A;  1PYT A;  1Y3J A;  4XAK A;  4FPR A;  3E8O A;  1KHW A;  4UST A;  3VVU A;  3MPD A;  4C8M A;  2CPE A;  4KYZ A;  3B4D A;  4WKY A;  3OTO F;  1R0A B;  2V68 A;  1CJU B;  1U1O A;  4CYU A;  3GYN A;  1S6P A;  1QAY A;  3TAM A;  2QYC A;  3LA0 A;  3LP2 A;  1R8H A;  3ZC4 A;  2W7A A;  3H2V E;  1MNE A;  3SCI E;  1FFW B;  1U48 A;  3KLI B;  1BQM B;  2RD5 C;  4HDH A;  4CO2 A;  2UUB F;  4JI4 J;  5L8R C;  4JI1 F;  2KT2 A;  4HLB A;  1U0H B;  3ZNU A;  3KLE B;  4PYA A;  5B0C A;  1U24 A;  1KFS A;  3AA9 A;  2IMO A;  2AV5 A;  3PTW A;  1SQF A;  4DF4 A;  1Z2L A;  2Z2Y B;  1CQN A;  1HNV A;  3AOB A;  5JVG Q;  3DRR B;  4RKU C;  2WON A;  2J7W A;  1AYE A;  5HMY A;  2OKQ A;  4QCL A;  2RUG A;  3DLB A;  5DQG A;  3N4W A;  3DLE A;  3DOL A;  2CJA A;  1JQG A;  4NA1 A;  3UDL A;  3TP2 A;  2VH7 A;  2DT9 A;  1Q79 A;  1UPP A;  1RAH B;  2FJA B;  3GSI A;  3IGN A;  3EGV A;  1RLC L;  5RUB A;  3O44 A;  4X65 J;  4F4X A;  1FVQ A;  2OSQ A;  1UET A;  5GAH U;  3C16 B;  3EZ5 A;  4DLE A;  2AYB A;  2X1F A;  2BKP A;  3K7R A;  3SDE A;  2BYC A;  4O23 A;  3NWG A;  1UMJ A;  1IR1 A;  2LQ9 A;  3VAJ A;  1S1W B;  2RIJ A;  4NZ6 A;  1N0V C;  4KB7 A;  5H1S V;  4JI5 J;  4CLS A;  4Q2M A;  3MR7 A;  1NSQ A;  3QBC A;  2C2D A;  4AUK A;  3SIP B;  1FXR A;  2H4W B;  1NK9 A;  1HYS B;  3HSG A;  3PO5 A;  5AXM A;  4DCO B;  2M0G B;  2CJ9 A;  4ECW A;  3FDS A;  1S59 A;  4Q0B A;  4CLP A;  2COL A;  5ETK A;  5F9L A;  1LWC A;  3AGZ A;  4QU7 A;  4M1K A;  4FVM A;  4K2X A;  2V4R A;  3L09 A;  1RHJ B;  2MZQ A;  4M5K A;  3CO0 P;  4O3R A;  1SPB P;  1FES A;  2WSC C;  2KT5 A;  3FBC A;  3DMJ A;  5KFS A;  1U2C A;  5EGY A;  1X5P A;  4BC9 A;  4D3H A;  3BR8 A;  1S76 D;  3VZH A;  1NJW A;  4ZVH A;  1N36 J;  5KG3 A;  3Q8P B;  3RB0 A;  1HQ2 A;  4X62 F;  3KMQ A;  2ILY A;  1KTQ A;  2GIQ A;  4CO3 A;  4Q45 A;  1SQE A;  3Q8Y A;  3DN9 A;  2XCA A;  4ZIW A;  5F8M A;  1JJC B;  3T9Z A;  2WCX A;  2DNN A;  1HMV A;  2QJ3 A;  4CWB A;  3RTV A;  1SC1 B;  1Y10 A;  4ZN1 A;  1WC5 A;  3OSN A;  1JLA A;  3T5K A;  1OQ3 A;  3IC1 A;  5LXR A;  4DJB A;  3EDR B;  1ZZN A;  1EHW A;  3WC2 A;  4KHP F;  3OL6 A;  4I4B A;  4C8O A;  1NO8 A;  4P9S A;  4C97 A;  1MG7 A;  2KJV A;  2JLE A;  2EBE A;  1XNR J;  2LXF A;  1S6Q B;  1C4C A;  2Y8Y A;  3EGZ A;  1NPP A;  2O5D A;  3AD9 C;  3OR2 B;  4PCQ A;  2IJF A;  1MMN A;  5HRO A;  1VLY A;  2Z4P A;  2BZ2 A;  3ZZU A;  2RJZ A;  2AZ1 A;  1VC0 A;  3CUN A;  2ZDP A;  1F3F A;  2DEJ A;  4WFX A;  1DBD A;  5ETM A;  5CD4 H;  2QA2 A;  4USV A;  1U26 A;  1S48 A;  3CME S;  1QSY A;  4G6V B;  1KR4 A;  2DY1 A;  4WZM A;  2HKE A;  3VAG A;  2O67 A;  3OLB A;  1UVN A;  4CTA B;  4ILM A;  1VIS A;  1JLC A;  2VPX B;  3U27 A;  2HQI A;  4RNM A;  2CA9 A;  3J7Z 5;  2IRU A;  2BE9 B;  1HQU A;  1RHQ B;  1VK3 A;  4YR0 A;  1V6H A;  4KV8 A;  2VBZ A;  1MN9 A;  1V9O A;  2QT7 A;  4YB7 A;  2W01 A;  4EZ9 A;  3MMA A;  3MAA B;  1CS4 B;  1RHK B;  4X64 J;  4O3P A;  1NK4 A;  3CVK A;  5LMN F;  3TYT A;  4P2S A;  2R8J A;  5FLX Y;  1RZM A;  2HRU A;  4X66 F;  3HVA A;  4ZJQ A;  2ZBI A;  4C6A A;  2OTL S;  5EWE A;  4FBT A;  3VVT A;  2EI5 A;  1Q81 T;  2YWF A;  2XMW A;  4HAC B;  4ZJO A;  2X51 A;  5HLF B;  1NHK L;  2Y0S D;  1U1Q A;  2WAQ D;  4KTQ A;  4NPO A;  1KFD A;  2GJF A;  4OHY A;  1UJ5 A;  1FJG F;  1HNI A;  2YKN B;  4TYB A;  5GMD A;  1WOO A;  1VR6 A;  2Z30 B;  5B0D A;  4WXW A;  2DXE A;  4K4V A;  3H98 A;  4ILL A;  3GSD A;  1VRT A;  5KFC A;  3K89 A;  2K7K A;  1IBM J;  4LFC J;  3KJQ B;  3EVW A;  1XNQ J;  4LFA J;  5LXY A;  3QQC D;  1YI2 S;  5E2Q A;  3R6G B;  1S10 A;  2CNO B;  1YTY A;  2BDP A;  1SH3 A;  4ED1 A;  4IG3 A;  4X4S A;  4OYP A;  5ETS A;  4U9R A;  4DEZ A;  1RT5 B;  2UVU A;  2B4U A;  1VQ7 S;  3G2X A;  4G1Q A;  3VQS A;  1EIY B;  2G13 A;  3K5L A;  5KFP A;  2QTW A; 
#chains in the Genus database with same CATH homology
 1XAO A;  1GMW D;  1GMU A;  3LA0 A;  1GMV A;  4L3K A;  1C3G A;  3I38 A;  1GMW A;  3LZ8 A;  3TJ9 A;  3NY0 A;  2Q2G A;  3TJ8 A;  2HFV A;  3AGY A;  2B26 A;  3NXZ A;  1EAR A;  1EB0 A;  3TJA A;  3AGX A;  2QLD A;  1NLT A;  3AGZ A;  3L9Z A;  4J80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...