3NY0A

Crystal structure of uree from helicobacter pylori (ni2+ bound form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
147
Chain Sequence
IIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 37
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3ny0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3ny0A02
2HFVA 3TJAA 3LA0A 2Q2GA 3L9ZA 1XAOA 3NY0A 4J80A 3NXZA 2B26A 3I38A 3TJ9A 2QLDA 1GMWD 1GMUA 1NLTA 3AGXA 3LZ8A 1C3GA 3TJ8A 1GMVA 3AGYA 1GMWA 1EB0A 4L3KA 1EARA 3AGZA
chains in the Genus database with same CATH superfamily
1EHWA 3FFIA 1VK8A 4IRKA 1SV5A 4X66J 1CJTA 2CADA 1Q7LB 2M0GB 1Q16B 1WG5A 2OPQB 4AD6A 4R25A 4ZDNA 4FVMA 1AUSL 1RU1A 5FD1A 2L9WA 4RNMA 2NSBA 3FQKA 1WTFA 2BX6A 2QSWA 1L3VA 4Y65A 4NCGA 1U4BA 2K7JA 1FD2A 2R7VA 4OHYA 3Q83A 4JI0J 1PJ7A 2XMJA 3QAUA 3NNHA 2FB0A 3OTCA 2M2BA 4PUOA 5FDLB 4NLGA 1HW9A 1RKJA 2XSFA 1S59A 5KFLA 3LQVA 4F36A 4QIEA 2KRBA 3UVJA 3I0RA 3GJSB 3OW2R 3R5CA 1JKHB 1I94J 4MFBA 1S57A 2CPYA 4IOAQ 2CPDA 3PHEA 1N5VA 2GVZA 3MMCB 2POKA 2KB2A 4V19J 1SKRA 1RA7A 2JLEA 2HMIB 4RW8A 3D66A 2AV5A 3OVAA 1N88A 1Q78A 1KDNA 1B0PA 2Z2MA 1HWIA 4OLOA 1W26A 2FHJA 5K5MA 1NEEA 4MT1A 3FSYA 3I55S 1VHIA 2AYGA 4C2MA 3M2RA 3W1YC 3VAGA 2FJEB 3ZTQA 2DIUA 2HS0A 2CAJA 2EFPA 1JXEA 3CCQS 1T9VA 3H98A 3MPWA 3NGSA 3EGWB 1XMOJ 4UOGA 4MIAA 5KFKA 2JVOA 4FPIA 4O3OA 2L48A 3ZO7A 1JB0C 2C28A 4LREA 1FA0A 5HO4A 4M5MA 3TAQA 3P5BP 2BV3A 5F8LA 2CQCA 3GIJA 4K4WA 1UFWA 4ANCA 1VJQA 2RILA 2V2ZA 2RT3A 1KD1T 1NUEA 4ID8A 1FEEA 3O1LA 2C2DA 3Q8VA 1YJWS 2YXLA 4CNYA 1VQYA 4CTAA 2KDOA 1N36J 1PYSB 4DBQA 3CC4S 4DR3J 2L08A 2D9PA 3IR6B 1YZ7A 3HX9A 2HHUA 3PYGA 3LTOA 1XR6A 4DV4F 3CTRA 1UAWA 1JNRB 1KSPA 2MKJA 5M2PA 4GC7A 1VLOA 1YBUA 3KK3A 3KJVB 4WFAQ 1R0AB 3W3SA 5HL7Q 3LAMA 2LEPA 1C1BB 3K5MA 1B64A 1YSJA 4BWJA 4OZLA 5KT4A 4TLRA 5FLXY 3GV7B 2VG5B 4DLEA 1V3ZA 1V6HA 1EIYB 3LF0A 2LU2A 2JRSA 1PSDA 1RT7A 3ISND 2MHNA 3TAMA 2V9WA 2H65B 1HNXF 4I67A 4DPTA 4N8OA 4ZPWR 2QLFB 3OJUA 2JZ5A 4ZVQB 1O51A 2BYCA 2MZQA 1KLMA 1NH7A 1SI9A 3BO3A 1NO8A 2JX2A 2RRNA 2DY9A 1KQGB 3HSGA 3AY0A 1Q0NA 5ETVA 5C2GA 2P8IA 2YKMB 1UW4A 2F9DA 2WONA 1HBUA 2AW0A 3MPDA 1AW0A 4K4SA 1UVJA 5KG6A 3NCQA 4RZRA 1RSCA 4JV2A 2RQMA 3HFZB 1KTQA 1H2VZ 3OD2A 2LMIA 4X4SA 4C3LA 5CHCB 1EAYC 1Q5VA 2K1RB 3UW1A 5BR8J 2ROGA 4D3HA 2BDPA 2QA4S 2PFFB 7AT1B 3EXYA 3W8GA 1TL1B 2KXNB 3EVMA 2PI4A 4LQ9A 1VRUB 4TVAB 1B4SA 4K5RA 1Y3KA 2R2SA 1MWQA 2XHCA 2KFNA 1H73A 1NB7A 3KLGA 1U1PA 2BKOA 2DGUA 1UL3A 4LFAJ 4HI1A 4F3MA 4ZPDA 4L76A 3DRSA 4PWWA 2J7KA 3CNQP 2E1PA 1BQMB 3O3LA 1TZ0A 4QWEA 5IT9Y 4CZCA 4G1QA 1T9UA 2IBOA 1DARA 2DGVA 1NKBA 4LF9F 4WYWA 4YB1P 1HD0A 1IJFB 2W2QP 2HFZA 4DSIA 2JWNA 2V8GA 3QLHA 2MB0B 3BDPA 5KFPA 4F4KA 3ZZTA 3PO5A 3WZ0A 3MMBA 1V5VA 3PTWA 3Q24A 2XSJA 4LSLB 4ATNA 2CQIA 2JEFA 2IDLA 2HLUA 2GMJA 3CT9A 5CAAA 4X4PA 1R6VA 4CLTA 3KLFB 5I4MA 1NPPA 4RWWA 2G2OA 2Y9HA 2DXEA 3FZ2A 4Q2MA 2HWIA 3M32A 2UUTA 4CWBA 2KG0A 2OPQA 2CQ0A 3EGNA 3CD6S 3A3OB 2X7IA 5GAGU 2ROEA 3DLLQ 4DG1A 4IOCQ 2ZOFA 1DQ9A 1NSPA 3PACA 1F0XA 1N33J 3KDNA 2IC3B 1V3RA 3SDEA 3DRXA 3DGPA 2VF3A 3EMTA 4OL8A 1S1UB 2C2MB 2XHWA 3PRDA 1FCAA 1MW7A 2MZSA 3W66A 5FDLA 4BS2A 3R9LA 3VALA 1VISA 4MKAA 1NPKA 4J9QA 5LT5A 2ZUAA 3BV8A 1WG1A 5A8RB 1S1WA 5B09A 1CJKA 3MGJA 1Y5NB 1RAEB 1FEHA 2CVEA 3AXMA 2BJEA 1W2IA 5DETA 3ZZUA 3HJFA 1LW0B 3NLCA 1AB8A 1G2EA 1TAUA 2W9CB 1RACB 2J7UA 4ZVEA 3UCUP 3QRPA 4JI5F 4B3TF 1FDBA 3MM5B 1SQEA 2W01A 3G71S 1S97A 2VBXA 2J9DA 4JYAF 3I0SA 1I6JA 1HNVB 4L74A 5ETKA 5CCMA 2FUG9 4YY3F 1LW2A 1NRKA 2NR0A 2HQDA 2DITA 3C14B 3DRYA 3MEKA 3OLBA 4EK2A 5E3AA 2F40A 1HNIB 4BWMA 1GAOA 4DV7F 2OD4A 4HI2A 5ADZA 1QSSA 5HVFA 2JFDA 3G82A 1WACA 4UOHA 1JLCB 2C2EA 5RUBA 3IC1A 5KFEA 4DI6A 1S4FA 4FBUA 4LIRA 1PCAA 3A4TA 3KLIB 4LRBA 3L7PA 3IRWP 1QUVA 1HI8A 2MQQA 4OV1A 1T03B 3UD3P 2ZITA 1X0FA 3I4PA 4X4RA 2LEAA 2W4PA 4JV5J 4B3RJ 1GEHA 5DDQC 3QRRA 1AROP 3TWZA 3ISZA 4Z2XA 4F4XA 5DG9A 1U0HB 1NXIA 4B9UA 4Q44A 1F5BA 3KJVA 3R5AA 7FDRA 4I1TA 1R0AA 4NZ7A 2DO0A 4LF8J 4LVOP 1FDNA 1OIAA 4ED1A 4ZLLA 8RUCA 2RKIB 4JP8A 1QTNB 1FRMA 2KRRA 2V63A 4CT8A 3IP0A 3ZTRA 4GVBB 2LA6A 3OL8A 2ASYA 4A8YA 2VG5A 3IR7B 2F9JA 3BYRA 3J81Y 2VBWA 4HTIA 1E6YB 3QAEA 4BCAA 2F65A 5CYMB 5KFFA 1QE1A 3S6EA 2H3EB 5DDOC 2GGPB 4P7TA 4GKKJ 2N7YA 3BGOP 2F5GA 4B02A 1YLXA 3GFHA 2CJQA 3KXDA 4PG5A 1H98A 2FPHX 5A76A 2GQ2A 1IKXB 4C0HA 1QM9A 3F0NA 2LCWA 1H7XA 4K2XA 3ZZRA 1TKZB 2CQ3A 4O0IA 4WBFA 4EYHB 1RT4B 3JSBA 3DOLA 1VIOA 3DYAA 3I5AA 2ZM6F 4DV3F 4N41A 1LEOA 3F56A 2H4WB 1UVNA 2L3MA 2Z8QA 2X1BA 3SQGB 1TP7A 3C16A 1TFWA 4QWCA 2J76E 5F9LA 4LF5F 2DB1A 1GXTA 3ICLA 3UQSA 3RW7A 4DFKA 1S1VA 3DXSX 1NZAA 1GT8A 3GV8B 3L95X 4I68A 1VRUA 4PWDB 5LJ3Y 5D0GA 4K5SA 1EETA 1TFYA 4ES1A 2DR6A 2PT0A 3HJVA 4C8YA 4N8NA 1GQEA 2AGQA 4UOFA 3C2PA 3AH6A 3AJ1A 2XYPB 2CNOB 3ZNJ1 2XMAA 3T9NA 5ETNA 1BQMA 3BS9A 4Z7YA 3I5CA 3HHKA 3BQ1A 4U7UD 1ZM2A 5DLFA 3C46A 1HMVA 4UZCA 2BACA 2AU0A 5IWAJ 1R8BA 2MPUA 3RJMB 1P27B 5HAOA 4A8XA 1JLEA 1JLFB 4JI6J 2BW2A 2XLJA 2EFNA 4B9NA 2F4VJ 4DL4A 4C98A 4XTTA 2UU9F 5HN0A 3K5PA 4A46A 3ISNC 1RT3A 4DL5A 2QTWA 5HMWA 2DD8S 2XULA 4RX6A 3EJMA 1NKEA 1PYOB 1FWKA 3N6MA 1HBOB 3KLFA 3H5UA 3PW4A 3DOKA 4NX9A 3TOQA 3T1AA 4NLSA 1KN6A 3WDOA 2E1AA 1DBDA 3RBDA 3FSXA 2HK2A 1EP4A 1UW9A 2VQFF 2AT1B 5CABA 3EVWA 1NU4A 3MPUB 4CLKA 3GLJA 2MQNA 3PW0A 2R8HA 2Z58B 4OIXA 4JI4J 2XLIA 4F25A 2ZJPQ 1RCOB 3RRHA 2Z2ZA 1XNRF 1UA0A 3HSDA 2A0FB 1ZM4A 3QQCD 1CG2A 5B0BA 3J80Y 3L3CA 2VU5A 3C6TB 3CJRA 5HMXA 4QR2A 2KYZA 3KG1A 1WHXA 3DMJA 2W7OA 1CEZA 4RLEA 1N6QB 2MQMA 4PYDA 3T3FA 2QG9B 3KUHA 3GJQB 4WFXA 2LP4A 2GO8A 2ZKUA 4DQIA 4GO5X 3PV8A 2H48B 1VBKA 4MK9A 4Y0FA 4DPWA 4J9VA 1KS2A 4FP9A 3W2VB 4HYKA 5M2RA 3O2IA 4DR1J 5JMNA 3FVYA 3GFYA 5HMYA 2ZNYA 3I31A 5KOWA 5JXSA 3G87A 3UN5A 1WC4A 2V4JA 1J5EF 2W9CA 4CNZA 5LSOA 2J0QD 3PW2A 2ADCA 5CD4A 3MM5A 2R8GA 3JQJA 4NLPA 4YDXA 2PGCA 4DS4A 4LR9A 2R9LA 1PG5B 1PYTA 3QFWA 2UUWA 4USJC 1HNVA 3DLJA 5ETPA 3UDLA 4LBPA 2PFDA 3ELHA 2W24A 2G4BA 1RAAB 2VFSA 4OYIA 1TK8A 1WORA 4ES3A 2R3VA 2Y1IA 3R2DJ 5HVHA 3EM1A 3EICA 5AXKA 3UN3A 4K0KF 3HHEA 4Y34A 3JAMU 1RAHB 2XC9A 2HHSA 3U27A 5E3PA 1LWEA 2K06A 3W62A 4NASA 3I82A 2RHSB 3D3BJ 5E5NA 4YR3A 3HCXA 2LXUA 2E9TA 3M30A 5JUMA 1UEUA 4DSJA 4Z7CA 2UP1A 1X60A 4DV6J 4O3PA 4IQXA 1VQOS 2QLWA 4RW7B 1HNZF 2QFIA 1D9DA 1RU2A 1VRQC 5A8WA 3L4BC 3E2EA 3ENAA 2RKIA 5J1EB 2WBMA 4OZNA 2LQ8A 1NJIT 4KSEB 4NYPA 3K89A 3RBEA 2J6SA 2ZWOA 1FRIA 4DR6J 1RKIA 2KFYA 4CI0B 4I2PB 2IY5B 4X66F 5IT0A 3W9HA 4QWDA 5CYMA 2W8LA 3BBCA 1YITS 2L9NA 4OYAA 5KFOA 4M5KA 3RBXA 3UR0A 5A0YB 2JZ8A 1PJ5A 1KKHA 4TN2A 1SB6A 3GB0A 4G1IA 1S6UA 4KY3A 2KU7A 1OWXA 3HT3A 3IS9B 2QA1A 5C24A 4C97A 5T41A 1TKZA 4JI0F 2HW3A 4RW6B 1MLAA 2ZBIA 4OYOA 1A9NB 2YPZA 3GYGA 2ABYA 4ZLPA 4QYZJ 2CPZA 2ZDPA 3DI6B 4R8UB 2XZDB 2UXDJ 3PKYA 4NLVA 3P6YC 3VVTA 2V8HA 2HVHA 3H2LA 2H54B 3ZC4A 3M7VA 3I4HX 1XN9A 4NE9C 1UETA 4PWDA 4RW9A 2R2UA 4C3KA 4CRJA 4EEYA 1N5YB 3V6JA 1VLYA 1XK8A 4LR7A 3QIDA 2IIHA 4FNHA 3MEDB 1R8HA 4NMXA 3CULA 3CDBA 3NGTA 5E3CA 5F9NA 2CZ4A 4C7QA 3AFGA 4WWSA 3I96A 2YNIA 4PG7A 4DQQA 1XIQA 1OJ4A 1KRPA 1FXDA 3ZZZA 3OJSA 5DGAA 1XMOF 2UUBJ 5I42A 4WTOB 4QIVA 2MEWA 1UVIA 5CD4H 3M8ZA 2BQ3A 2P9EA 5F41A 3J7A1 4KO0B 1VQNS 2GFFA 2DNMA 2GNKA 4EMDA 2MTLA 3DFEA 1T02A 2XI2A 3N5BA 1T0TV 4KFBA 2DR5A 2Z4PA 3OHBA 2DXDA 3CD7A 2QX0A 2M9KA 4O0NA 2J9CA 3KLEB 4CO3A 2VFVA 2Y8YA 3KK1B 1M5PC 1ZTWA 1ZAVA 4I2QB 3H4BA 4DUZJ 4OHWA 2PI5A 3G2XA 4IUFA 2QRRA 3QBCA 1N36F 2DNNA 4BDPA 4BHQA 2EI5A 2DRBA 2V34A 4DR3F 3HT0A 5KFXA 2VG6A 1NK4A 2BUNA 4PG8A 2QL5B 4O4RA 2FLPA 1H0HB 3HVWA 1HLWA 2NUHA 4OQJA 4DL6A 9RUBA 2HS4A 3ILIA 3J7Z5 3H4DA 2WVBA 3MM8B 4HKQA 4DCOB 3T19A 3OV7A 3FEZA 2VG7B 3VCDA 4CT9A 2ATCB 2OEKA 4KT0C 2ZZTA 2PO4A 3PX0A 3MEEB 2HNDA 1RAGB 2KL8A 2YWWA 1ZAXA 3GILA 5EDWA 1HQUB 3LALA 4OI4A 5GAEU 4WK3A 2JDJA 1RI7A 2BOAA 3PJ9A 4HACA 2MZJA 1LOUA 2WZ1A 3OUYB 3KOAA 3W2VA 3EYZA 5ETRA 1KTVA 4MYTA 2P2CB 2O01C 4GO7X 2LDYA 2RMLA 3TZWA 3CC7S 1B7YB 4CH0S 4F67A 3WIVA 1WEYA 4YB6A 5HP1B 5J2PA 2GIRA 3L09A 3D28A 4PG4A 4P72A 2YKAA 1ZPWX 4N47A 2HBRB 4ILLA 2EKNA 4ER8A 4A8FA 1WC0A 2ZE2B 1S1TB 3TJ8A 2X3DA 4ECWA 1TUGB 2APOA 3E8OA 2BE9B 1RLDA 1GX5A 3CCZA 1RWKB 4OI0A 4FDFA 4CLFA 5KFDA 2DNLA 5BR8F 3EZ5A 4ECSA 4LFBJ 2FYXA 3CO9A 1QSLA 2MKSA 2ALZA 2JH3A 1NDCA 2BJ7A 2QJ3A 1IQTA 5J2NB 4EBCA 1S72S 1AZSB 2IDEA 4LSNA 5JVHQ 3AGXA 5F8JA 3C19A 2BKPA 2ZH7A 1YVFA 4MYUA 4LFAF 2QA2A 1REVB 2Z2YB 2RDDA 1RT1A 5DS7A 2N4CA 1UTAA 4L75A 4JB8B 4CO0A 3NS6A 3MFHA 5L1JA 3M8QA 4PR6A 5J2MA 3UFCX 5I3QA 4YR0A 2HVEA 4QU6A 4ZP8A 2CNNB 4WJBA 3J7YU 5IC6B 1Y4ZB 1M5VC 4RW7A 3KLHB 3CJKA 5D78A 1TL5A 3R6LB 1OPZA 3O8WA 4Y2AA 4ZITA 3DRRB 2B9WA 5F8HA 1KP6A 2UUCJ 4L3KA 4C4WA 2J8AA 2BXJA 2FZKB 1PKUA 1TKTA 3B54A 3IRXB 3AQPA 2M70A 4F4WA 3GSDA 4PABA 3TO8A 4PXEA 5A0YA 3P3DA 4DCJB 3QT8A 1RWVB 4NLDA 5H1SV 1OSDA 4BBYA 3X1LB 1N33F 2DH9A 1RWPB 2LQ5A 4P2XA 4V1Ak 3CJTA 1N5SA 1WI8A 2XCAA 2O66A 2OTLS 2CPJA 3QT5A 1RYRA 4B3SJ 4RBVA 2SXLA 3TEHB 3D6MB 1YJRA 1KQFB 4JBCA 1TV6A 4M95A 2KJWA 4I7FA 2H1YA 2DGQA 2C3OA 1Q81T 4UQGA 4DV1J 1SJ3P 1CVJA 4R8UA 3KYLA 3R7NB 2XNQA 2DNQA 1EQ0A 1IM6A 3GWCA 1WSVA 1NNDA 3G9CA 1Q95G 3HI9A 5GADU 2NREA 2Q3PA 2YH0A 3MAAB 1NSQA 2PMZD 2DPIA 1B99A 4WKRA 1WKKA 3D1HA 2OO4A 2XY7A 1ACMB 2RVJA 4ECVA 1N5YA 2Y1RI 3DHXA 3AGYA 1HWLA 3M1VB 3DDIA 2E5HA 2FJWA 1HNXJ 2HHTA 4Q8EA 5AJ3J 2WVDA 1FNXH 4DL2A 3CCUS 2PA8D 1UA1A 4IG3B 3CCMS 4OMFG 2I6WA 2UXCJ 3QO9A 1BQNA 1HA1A 3DNCA 1NJXA 4KO0A 1UP1A 4R0JA 2DHAA 4BLGA 1BD6A 4A8QA 3ENVA 3GZ7A 4W4MA 2V4RA 3LWMA 1Q7YT 1R3NA 1TKXB 1JLQB 3KLEA 2BJDA 1VQ5S 1N48A 4W98A 3KK1A 4ICLB 1GMVA 3A1YG 1PAEX 2CDQA 3SBMA 1U24A 2V9KA 2ZVSA 4ZHRA 3C3LA 2B43A 5I3PA 4ZP7A 1YI2S 4NCBA 3SQOP 3SCLE 4DS5A 2BRLA 1LWCB 1S9GB 4JV5F 2YKNA 4B3RF 3KNAA 4NRTA 3CJ0A 4DR4J 2A18A 4I69A 3SCJE 2C1EB 1IR2A 1OY6A 3EDRB 2ATLA 4LF8F 4I56A 3R5GA 3V2UC 4DSFA 4M5DA 2MJUA 1YWXA 1KWMA 4K4VA 2XZTB 2NLWA 5MLCV 2BKNA 1IR1A 5ETQA 1KVKA 3PYEA 1S10A 1U8WA 2WHOA 4QJVA 2I5JB 1PC5A 3H40A 2Q79A 4GKKF 2VC1A 3T5KA 3UWTA 3AJDA 1CULA 3BGRA 2KO1A 5KFJA 3QWUA 1HBNB 1PILA 2NCKL 4AE5A 3MEGA 2CXEA 4ZVFA 1F3FA 1IKWA 3M8SA 2DNYA 2D3ZA 4NLRA 5HANA 2JVMA 2KHDA 1ZZFA 3NBPA 5BYSA 3SXLA 4ZVPB 4KAIA 5HBMB 1NKCA 2MGZA 1S1TA 4XDDA 1EX8A 2GJFA 4LBIA 2BQUA 3NRBA 5IT4A 3G6VA 2R8JA 3ENQA 4RNOA 2RRAA 1H38A 1DTQA 3LPEA 4YUDA 1X0PA 2HNYB 4UOCA 4DU8A 2BVZA 4O44B 4NA1A 2XO6A 5KFUA 2ZKTA 3HVTB 3H42A 2B8PA 1FX4A 2F1FA 3UD4P 1X9SA 3I32A 1AZSA 2KM8B 2XM3A 1RTDB 3W9IA 3M2UA 2NYHA 1WDDA 3C15A 1M1KT 3MR2A 3QFHA 4M5IA 1SH2A 1K9MT 2FHMA 1UZDA 2WOMA 3AB2B 1RWWB 5GMEA 1S76D 1Q4RA 2CFXA 1MWZA 2IM2A 4LF6J 2DVIA 2BE2B 3H0PA 3H5XA 3F41A 4DZ6A 1BHNA 5IWAF 2GAHC 3J7ZT 3E01A 1HKAA 2JEGA 4J9MA 4JI6F 2HAIA 1PAUB 2F4VF 2B9YA 2UVWA 2M52A 4CO2A 1YRTA 1RZMA 4RNFA 1UJ4A 1T9TA 1G4CA 3JSRA 5LM7E 1S1XB 1QAIA 4N5SA 4P2MA 2ASLA 4FYXB 3OLAA 3BO4A 3WIUA 1JLAA 3OVBA 4ZPVR 2EPIA 3HKWA 1DQ8A 5H9FJ 1U1LA 4AL5A 3IMQJ 3GIIA 1PGZA 1FDDA 3QT6A 4KHPF 1YGYA 4M5GA 3ZTPA 1RHQB 3EDQB 1VMBA 1X4BA 1LWXA 1ICEB 3MR3A 3SSSA 4RUHA 1W2BR 3ZTSA 4DQSA 3KG4A 5IM0B 1RWUA 4JI4F 1RT2A 1FKPB 4X4UA 2FVPA 2MDAA 2H51B 2H5JB 4ELUA 2X51A 2MY7A 2E5JA 2R7TA 3R7SB 4FF1A 2EKYA 1XBWA 2GX8A 2VZ9A 5J1NA 3MECB 4ZPAA 1JXVA 3RU0A 2LDIA 4A8SA 5AXMA 1SUQB 1S49A 4KE5A 2MKIA 1JLBB 3VAIA 3IBFB 2F8MA 3D2WA 4Y6IA 4AYBD 4Q5VA 2CG8A 4J9UE 4PYAA 3TVZA 5HSPA 3Q22A 5KFZA 4ZVGA 3KHLA 2R2TA 1TU0B 4DR1F 3MAAA 3OL7A 2JNJA 1QJHA 2HBYB 4TY9A 2LQBA 4JI7J 3IM9A 4PQUB 1TQLA 1WF0A 3M8PA 2V4QA 1U1MA 3CWJA 3HMJG 4DFPA 2BOPA 2OEMA 4USHA 4FF4A 2DEJA 3CJSA 1RBOB 4H4KC 1FKOB 1YTYA 1FHTA 1HPZB 4Z37A 4RW4B 4J37A 1F9HA 2B5JB 2FD2A 4RWXA 3D9BA 1RHMB 1Z1ZA 2RQ4A 4ZJQA 4KHMA 1U7LA 1YK9A 2E5IA 2G2ZA 3V4MA 2G13A 2WSCC 1XC9A 3GFXA 2DKOB 2NZ4A 4KR0B 4Q2LA 3EGVA 2WVCA 3ITHB 2CZ9A 2VKZG 3SEOA 4YHHJ 3ET6B 3CCES 3DRPB 4LF2A 3TUIC 1SKWA 4RU2A 3CJ2A 1J27A 4IOBA 4DX7A 1S6QA 4NXNJ 3O6QA 4ILMA 2Y3YA 4OX8A 3FGVA 4ZJLA 2JJ4D 4ZVOB 1OQ3A 5DZ7A 2YWFA 2XS2A 1NDPA 2B6AB 3TX0A 2EXUA 1S9GA 1HQEB 2JC1A 4NI2A 4DV6F 1ITPA 2JVRA 4ZOSA 5DLGA 3B8HA 3RZAA 4KRWA 3K2YA 5T7LA 1R31A 1SVDA 4KGMA 3MM7B 2ZD1A 4H4OB 3BSAA 3IXQA 2E7VA 2ADBA 1H3DA 4K4XA 2OPPA 5HI7A 1GMWD 3QSIA 4NEZA 2OMLA 1S7HA 1RTJB 4DR6F 2NXJA 2Y1JA 4OX6A 3PNIA 2CPIA 2PC6A 2HFOA 2V67A 1NHUA 3PX6A 3CUNA 4ECZA 2FLNA 4OX9J 1VFJA 4J9RA 1ZS6A 2BANB 2IJFA 3N6NA 3VGSA 4QR1A 3HXMA 1D8YA 3SFUA 1WDTA 1S7IA 1OMSA 3RAMA 4Q0BA 2K3KA 1FE0A 5K9FA 3ENWA 2LXFA 2HHXA 3RG6A 3BM7A 1L3TA 2G1HA 1QTMA 3OR2B 5KT3A 1U2CA 2ALYB 1K0VA 5G0RB 3RYLA 1FJEB 1XWLA 4HVZA 3WBZA 2YNHA 1HBMB 3CJ3A 3P5TL 3HULA 4TY8A 4C0BA 2UXDF 1X4GA 3JAMY 3ILOA 2WSFC 3QNWB 1RJJA 1IBLJ 3FCVA 3CJ4A 1SJ4P 5HROB 3CJ8A 1RA6A 2OSRA 3W5YA 3GYXB 5ETLA 1RTDA 4MMOA 3OXGA 2HK3A 4ECXA 2V8VA 2LECA 4WKYA 1N32J 1U02A 5KFWA 4OFZA 1WF2A 2HPUA 2Z57B 4DR7J 2ZHAA 1VQ4S 2E1MC 2JSXA 4NLWA 3VZHA 2WAQD 2EFQA 4IFVB 1E6VA 4JV1A 2DHGA 2DR7A 2W2MP 2OFHX 3GIKA 3AT1B 3UDVA 3TUPA 2G1DA 4DF4A 1OO0B 1TR0A 4FYDA 2VD3A 2RDJA 2UUBF 2MLZA 4EBEA 5J2QB 4QYZK 4J80A 2NZCA 3JSYA 4LFCJ 4OYMA 1SL1A 2CRLA 2N82B 2B3TB 2D74B 4H4KA 4TYAA 1W25A 1FK9A 5KFYA 3V6HA 4ZCLA 1PIEA 3HFVA 4WU2A 2RUSA 1SXLA 1S9FA 3MM9B 2KXHA 5E7OB 4IFYB 1IWAA 5HLFB 2J0WA 4DUZF 3ZFVA 3JTOA 1X8DA 5CYJA 3GSIA 1VOMA 1CQMA 3MCMA 3PW5A 4F4YA 5B0CA 4TLQA 2M88A 1EZZB 4UQTA 1RE1B 2VDIA 2HNZB 1TMMA 1Y5LB 1IBKJ 2CDRB 5IM0A 4JI1J 4Y28C 3EXCX 1RAFB 1LV5A 3CJ5A 1FJGJ 3PFOA 3WX4A 1M5OC 2R7OA 3NGRA 4HLBA 4A8OA 1KC8T 1WWHA 4MKBA 3M8RA 1NBEB 2I9SA 4ELTA 1MMDA 1RT6B 1M5HA 4O3QA 2UUAJ 4QPXA 2IAJB 5AE1A 3SV4A 2IBKA 1MN9A 2Q6CA 5KG7A 1MG7A 2KHCA 1Q8KA 2XWXA 4LRFA 4CO1A 1B3TA 4Y2CA 1CS4B 1FE4A 2FZGB 2FVSA 4WE1B 5IZHA 3HKZD 3DLEB 3B4DA 2GVDB 2I1RA 1N5QA 2CG4A 1J5OA 3I6PA 3PR4A 4PQUA 1XR7A 2LVWA 4ED8A 1FF2A 3KK2B 5I3UA 1UPPA 4URQU 1CC7A 2J5AA 2FVCA 1Z2LA 1FTCA 2RF2B 4USWA 1Q8IA 1U48A 5SUHA 1FT8A 3FBEA 4IO9Q 3MWBA 5DGBA 4PXCA 1KVIA 2N4DA 4N7TA 2E29A 3K7RA 1Y00A 2KJVA 2QYCA 3U1LA 2IPOB 3VQSA 4LFBF 1WG4A 2G0CA 3CDUA 4FYYB 3K5OA 3BGFA 2QLJB 1QAYA 3KJNB 1H74A 4NMLA 1QSYA 2YWHA 3FC9A 2R7UA 3H2VE 2RAQA 1KONA 4B3MF 1CQNA 4OZ1A 1QLNA 2W2OP 3ET6A 4FVCA 1YJVA 5GAHI 4I6YA 4K4UA 2YTCA 1SC1B 4BC7A 3MI7X 2CQ4A 3ZTOA 5F8IA 1HYSB 5IT9U 2B6AA 4GMKA 2AJ1A 1HQEA 3OR1B 5HVGA 3FMWA 4YN3B 2AZ1A 1VRTB 5LXYA 1D1UA 1SC4B 1K1SA 5G4DA 5D3GA 3AA9A 2ZNZA 3AOAA 4M63A 4MIWA 2LXIA 4ZVHA 4PCQA 4WFYA 2W7PA 3PIPQ 2EC0A 2O1PA 3TNVA 2BM0A 4IDKA 4X4TA 3EZUA 2KVQE 4ERDA 1SQGA 4F26A 3WQPA 5L9XA 1RTJA 2UUCF 2MKCA 1WEXA 2W4DA 3T5HA 5DQHA 5DG7A 4ID5A 3UDCA 4C8MA 4ANDA 2ZZMA 2DPJA 2ACYA 2V2VA 2R42A 3P4UB 1TVRA 4H4MA 4B17A 4UTGA 4IRDA 4ED0A 3JSMA 4WF9Q 3TI0A 2EWHA 4N56A 5DM7Q 3T1YJ 4RBUA 3VZIA 4GVLA 5KFAA 4IO1A 1JXLA 1D8ZA 3PO4A 2DY1A 3TR5A 2LFVA 2X1FA 4R5PA 4B3SF 2WBRA 2CWXA 2FY1A 5KFRA 3MFIA 4P74A 1LNQA 1R8AA 1P1TA 3HZEA 4HHHA 1BLUA 4P52A 2MY8A 4CLSA 1WOPA 4DV1F 2D41A 3G86A 1O0PA 1K73T 3KFWX 4YR2A 2OJ3A 1FVSA 3AJ2A 1L3SA 3R5JB 3G8QA 4U9RA 1SKUB 2UZAA 5CCLA 1LWFB 1P8GA 1OSCA 2ILYA 1JIHA 2BRKA 4C11A 2HAFA 1NMEB 5KG3A 2HFSA 3DLGB 3U02A 1L3KA 3QWPA 3M9MB 3Q2TC 1K44A 1NK8A 4C9DA 3LGMA 3NAIA 2IHR1 3MDFA 2HS3A 3CCWA 4I6WA 4OYPA 1B7FA 3JQMA 1VGYA 1X9WA 2CPXA 4UUWA 5KFSA 5C7PA 1C4AA 2XMWA 2ZVIA 4OZ5A 5AJ3F 2J8SA 2MYFA 1MU2B 2IRYA 2NXEA 2F4FA 2CQ2A 1VIXA 2UXCF 1ZH5A 2N3OA 3MUTP 3RBZA 3KMSA 3OFFA 1B0TA 1UWAA 2U2FA 4UW2A 5KFTA 4ZVUB 3JYTA 4DV0J 4RUCA 3K57A 2HEKA 2XI3A 1UEVA 3NXZA 2MSSA 2B4UA 4YFUA 1XQIA 1C2PA 3MM9A 2GS8A 4B08A 2NQPA 2EC2A 4IFYA 3AAWB 1HI0P 4DV2J 2OPSB 3DOMB 1CSJA 2MZTA 3CVKA 1C0TB 4DUTA 2WB4A 1WJ9A 3UPFA 4P73A 2IYGA 3PJXA 3DLKA 3VV2B 5EUHA 4IKAA 2B7BB 2AYBA 1N4LA 2DNOA 5C42A 2OSQA 4DR4F 2HHHJ 2HNZA 1HW8A 1VBXA 2IRXA 2M8DB 4G6VB 3V6DB 3H25A 4DN0A 3AHPA 4WK1A 2HYIB 1Z2ZA 1IKVA 2CUYA 3CMES 2AMCB 3BJYA 2A3JA 1HNWJ 3DKDA 3NS7B 4LUBA 4YMEA 2AJFE 1SC6A 1G6BA 4NZ0A 1AA1B 2YNFB 4P7VA 3RRKA 1HARA 2C2OB 1GMUA 1BC6A 1Y10A 1FRKA 3WC0A 3P8BB 3C66A 1S48A 1MROA 2IAJA 3QJLA 1NM2A 4CLPA 2VDHA 1FFWB 2OD6A 4HHJA 4P2SA 4EFAC 4FF2A 3G96A 4DV5J 3DLEA 1Q53A 1PBAA 4CIOA 2MKKA 3NOGA 2CQGA 4F0MA 3BQ2A 2R8IA 3R8YA 1U25A 1YDLA 2ZZNA 5D4OA 1FXRA 2XS7A 1RBLA 1S0MA 2BMBA 1S0OA 3D4JA 2YBVA 1FI4A 2DCUB 4AQYJ 1TK5A 4NOHA 1TUVA 3O44A 3MHYA 1FRHA 1S79A 2NPIA 5K8MA 2HFUA 5IQ6A 1HWJA 1PJ6A 4NXMJ 1ZETA 3PXGa 3QZ8A 3VGVA 5GVQA 2X3GA 4KH0B 1TUWA 3V81B 1TK0A 2M3DA 3MR6A 2IMWP 2EBGA 4UF4A 3DM2B 1C0UB 4PXBA 4P71A 3HHLB 2R7XA 4MK8A 4EGLA 5F3TA 4A48A 3C6UB 1JKHA 3QIPB 3MOZA 2PMHA 2XMUA 3KJQB 4LF6F 3AOCA 2IVFB 3MMCA 4RUBA 2B9EA 2HMIA 1H2UX 2MHEA 1VRTA 4WYLA 1DLOB 2COLA 2WTFA 4QWAA 4IG0B 1D9FA 4JI8J 2VBZA 2HVDA 1RHRB 2AQ4A 3MM6B 1U1OA 3KNGA 1SJRA 5DM6Q 3FFIB 2JL9A 4OX7A 4LRAA 4E2FB 1NK5A 2VV5A 1CJTB 1MMNA 2EG1A 3DU5A 3MMJA 7FD1A 5KFNA 3NEKA 4P9SA 4YB5A 2HQCA 3D1OA 5ETSA 2HBQB 3N6LA 4M1KA 2WVEA 3IG1B 4XAKA 1GMWA 4FXWA 3RTVA 3CF5Q 3OTEA 3EPGA 4C8KA 2VB6A 4CP5A 2EG2A 4U7UK 2ZH9A 4NCGB 4J7CA 2VASA 1ZA2B 3R97A 1IKYB 3D54A 2D9OA 3NAHA 2HVZA 4IRCA 4P10A 4FKYA 3NGKA 2GHWA 1HQ2A 1QD1A 3TVKA 3IR5B 1MSWD 4PUOB 4U95A 3US5A 2XY6A 1VQMS 9ATCB 1TMJA 4Y00A 1UWBB 4LT6A 3CDAA 4YEAA 3LGNA 1U26A 3UVJB 3CXCR 4MIBA 5HATA 1LXNA 3U1MA 3MAQA 6FDRA 4MFBB 4OI6A 3NGDA 2B4PA 2GVZB 2ILZA 5ETMA 1NJYA 1HR0J 2QL7B 3T1HJ 4RW8B 3UNGC 1T05B 2EFGA 3MXHP 1LWFA 1C1BA 3THVA 5H9FK 2OUGA 2J6TA 2E1RA 1U09A 1BE4A 4KC5A 4X2BA 2F63A 4OHVA 4JI7F 5L46A 3NG8A 1F9EB 2C42A 2RUGA 1FERA 2XCPA 3N5FA 1OY8A 3ZZPA 3HK2A 2DHXA 1KHWA 1RYSA 3FRYA 1U1NA 2HLTA 3M4XA 3CCLS 1MNEA 2B8QA 2UVRA 1EB0A 3DC2A 3D6FB 2E1CA 5A6PA 3N79A 5JJBA 4UUXA 2N3LA 2KG1A 3A8JA 1UPMB 3GONA 2B4VA 3IBCB 4KQZA 1U45A 1IBMJ 2VBYA 4EBDA 1VC0A 1RAIB 4ECYA 3P45B 3KUGA 2X1AA 3OFGA 2GAGC 3CE8A 3Q89A 1T3OA 5CZXA 1EQMA 2YKMA 1AXQA 1H2TZ 3OVSA 2XTJP 2HWTA 4RBTA 4WIQA 4IR9A 3NKYA 1C3GA 3I5BA 1Y9OA 2OELA 3ONQA 4FNIA 4CTAB 4YHHF 2PEHA 1NHVA 4EUVA 4U7CA 2P6SA 4QWBA 1NLKL 4RL1A 2K1RA 2I0XA 3FSIA 4NXNF 2OPSA 3DOMA 1U2FA 2I8EA 2CVIA 1TL1A 1KVJA 3RB6A 2AF6A 1C0TA 1EARA 1UFLA 4NLUA 1YRXA 3W5ZA 2RQCA 3KK3B 4I4BA 3K8VA 3DGVA 3BPDA 2YVSA 2KVIA 3CJQA 1FKAF 3M8WA 1D09B 5B7WA 3V6DA 3OFEA 1RLCL 3TJAA 5L9NA 1T94A 3GP9A 3VF0B 4HH0A 2VPZB 2DRAA 4HHUA 2DXFA 2YNFA 1RT7B 2NXNA 2W8KA 3NNAA 3DN9A 3TAMB 2FJDB 3C8YA 2E5LJ 1WI6A 2DNGA 2AKWB 3D0IE 3LP1B 2BA9A 3LA0A 5KOXA 1MWYA 5A2QU 1WTBA 4QIGA 4CM0A 1BY9A 1U8SA 2BJ1A 3HHDA 2YY3A 1KLMB 3EE3A 3VAJA 4OX9F 2WVFA 2EBEA 2PIIA 2KTQA 4LSLA 4PWUA 5IV4A 2DH8A 4KGXB 2WONB 4C3MA 1HBUB 1SJ1A 2HQGA 3EUNA 5FJ4A 2XLKA 5AXLA 4MH8A 2H9ZA 1M1HA 4KHPJ 4MAKA 3ZXWA 1LFPA 3CCTA 2A1BA 4EO8A 3S7RA 3LGHA 5EX3A 5THWA 2Z30B 2XQCA 2XGPA 3IWXA 4KPYA 4Y2IA 3HSZA 4NL5A 1RXOB 4ZMMA 2IA6A 4X65J 4LMZA 3P96A 3B4MA 2IC3A 3W5XA 3A3PB 4TU7A 3PR5B 3KLGB 2C3MA 5E3QA 1IBLF 4DUYJ 3V81A 3D0GE 4CLLA 1S1UA 1LQ9A 3DRSB 1ZA1B 4USKA 3AODA 3I9V9 3R5BA 4DHVA 3DM2A 5KG0A 1C0UA 2VPWB 2GHPA 2KZZA 4G1QB 5K8NA 3BYPA 5A8RA 3CIMA 5KT5A 1N32F 1T95A 3FEYB 4DR7F 1UFKA 2DNHA 4RPFA 2C2KB 5B0DA 1U2RA 2GMLA 2IM3A 3QLHB 4WP3A 2VPYB 1LW0A 4PXDA 3PDNA 2OGUA 2QV6A 4NA2A 5CA5A 2DR9A 2G0JA 3V6KA 2NXCA 2XSJB 1CBKA 2YH1A 4IG0A 4ALZA 2IMOA 1YHQS 4LFCF 1K47A 1H7WA 1TTHB 3MM6A 5CH7B 1R6YA 3POTB 4FYWB 1JX4A 2GCFA 4XO0A 3M32B 4OJGA 2Y8WA 1EKRA 1SIZA 2XYHB 3C14A 3KMQA 1UMJA 2DH7A 2RU9A 5KFMA 4DG1B 4L6V3 3IG1A 5E0OA 5HQLA 4ZPTR 1HNIA 2DNKA 3I56S 4X4VA 4QR0A 2FGCA 1N0VC 1IKYA 3SDEB 3VQTA 5BYQA 3AKOB 1JLCA 1IWGA 2FIUA 3DGPB 3PIOQ 1IBKF 2BM1A 2CJ9A 3MTJA 4JI1F 1X4EA 1A0OB 1FNMA 1FJGF 2QSFA 1SIWB 3KLIA 3MF5A 3EZOA 2DHSA 1W7WA 1UWBA 5HJXA 3LWLA 1F2HA 1T03A 1PO6A 1S1WB 3CW2C 3OPKA 1CJKB 3KHGA 5L1IA 1ZTTA 3K5NA 5CYQB 3KWMA 2YKOA 2QMXA 3FEXB 1N34J 3GCXP 2UUAF 4NZ6A 1YX2A 4TNOA 2AWZA 3JQKA 1U0HA 3J81j 2DNPA 3G4SS 2ZOGA 1YBAA 2QLXA 3LUYA 1T05A 5ITHA 1LK5A 3CGIA 2F8EX 2GW8A 1UZHA 4ED3A 3EX7B 1JWWA 4OLPA 3R2CJ 2BW7A 3I0SB 4DR2J 4GVBA 2PSZA 5KFIA 5C2CA 1M90T 3GPAA 3QGIA 1LW2B 1UJ5A 1E6YA 2H4YB 3QATA 5KT2A 3EWGA 1RB0A 3NL0A 1X5OA 1WSRA 1HL6A 4LRCA 1KQKA 4A8MP 5CQGA 1Y3JA 2GGPA 4GC6A 4Q45A 3D68A 3GU0A 5LXRA 3MR5A 1FJCA 4XIUA 3RB0A 1WD6A 3T6BA 4KGZB 3EGZA 3G82B 2RHQB 3MCSA 1IKXA 1SKSA 1DFDA 1NK0A 4DPYA 1HHQA 3HO1A 2FHOB 2ZJRQ 2HGMA 1QVFR 1RGVA 1WUUA 1RT4A 3GYNA 4ZJOA 4DPOA 4F2RA 2HZAA 2Z2LA 3W65A 2R7QA 2PD1A 3CPWR 5LMUJ 1IM4A 1CC8A 3SQGA 4RUAA 5LMNJ 3WX8A 3SFGA 3W7BA 4P6QA 4O3NA 2G0IA 5E41A 2C3UA 3OT9A 1TL3B 4LF4J 3NWGA 2HVIA 1Y5IB 3I87A 4OI3A 4HL9A 3G8TA 2LYVA 1YZ6A 1VI7A 3A8KA 2MLYA 3I38A 2KN4A 3TZXA 2VHGA 2KFZA 3BH7B 2HHPA 2V94A 3NGUA 3H59A 1OYDA 5GMDA 1ULRA 3TA0A 3BSCA 1QE1B 1BUXA 4RNHA 4EYIB 3B78A 2C2ZB 4WFNQ 3Q8UA 4N77A 2QFJA 2QGFB 3LP1A 3U1NA 1JLFA 1SL2A 2J9DE 1GTEA 3SSRA 4DFJA 1NJWA 2C2NA 2XZWA 4BC9A 1GTHA 2NYIA 2V50A 5D0EA 2AX1A 4YP3A 1YJNS 2LA4A 1N54B 3T1YF 4ELVA 1RTZA 3QRQA 2XY5A 1DJ0A 4QQBA 5K14B 1HBOA 1RABB 3FK4A 3VAKA 3DOLB 3PX4A 3HD1A 1UKUA 3QGHA 3DDNA 3RW6A 1KOHA 3DYAB 3DCAA 2EEYA 1GXLA 4AT1B 1CLFA 5ETTA 5F8MA 1O6XA 2DIVA 1N8RT 3TEGA 1L3UA 1P9QC 5IXUA 3C16B 1X4AA 2ZH1A 3A3NB 1Q82T 5EWGA 2R4FA 1S1VB 2P9GA 5DJBA 2M5YA 1KOOA 2GC8A 1U6FA 1A7GE 2E44A 1EETB 3HHNB 2ROPA 3TUJC 2BR0A 3C6TA 4A4JA 1N5TA 1T9YA 1Y11A 1NPRA 1N6QA 1Q1KA 4AL7A 2CPFA 2JLFA 4PZVA 3W2WB 3BF4A 4KHRA 2R8KA 1HMVB 1H72C 2HGLA 1QDUB 1R8CA 1RISA 4WFZA 3HDSA 1FFSB 3FBFA 1JLEB 1GFWB 3K17A 1HI1A 1F60B 1L5UA 4PEOA 4DZDA 1FTRA 4K7QA 4W90B 4WPAA 3TQ1A 5B0GA 4AUKA 1RT3B 3UD5A 4XK8C 4X4OA 2AJQA 5HQ8A 4Q7AA 2M4MA 2L41A 2VH7A 2CKWA 3SMZA 3PCOB 3POTA 3DOKB 4U67Q 1R89A 1NH8A 4DV0F 1AT1B 3LP0B 4PPZA 4IH6A 4K8RA 2EFVA 4N76A 1PC4A 1EP4B 2QLBB 1CPZA 4DV2F 4QIFA 4OZ0A 4DL3A 2UXBJ 2JEJA 3MZIA 4KV8B 1U1QA 3M6XA 1B70B 1FX2A 3NY0A 3FMBA 4J91A 3CB4A 3KG0A 2HHHF 5C5JA 4B3MJ 3TJ9A 3LOUA 3SV3A 4OYBA 4NLTA 4X62J 1WOOA 4O4GB 3DMJB 1HNWF 4UT4A 1YJ9S 2G9OA 2J7WA 2VFRA 2GIQA 1APSA 2ZH6A 2Q2GA 5CYQA 2CNLB 4X64J 5AT1B 1MMLA 1ROFA 2QEXS 2OTJS 2D3UA 3H5SA 2DR8A 2V4JB 3MD3A 4J9LA 3BKUA 1ZYQA 2VKRA 1BWEA 2YQ0A 3QPIA 2ZH3A 3K58A 2FJVA 4DV5F 3WC2A 5L38A 1ZM3A 3X3UA 5J1EA 3L7UA 1NSAA 4O3RA 2IM1A 1FXLA 1RQ0A 1WF1A 3GJRB 2GIFA 6AT1B 3R6GB 1TKDA 4I2PA 4DL0C 2AEMA 1AUDA 2WRMA 2CNKB 2FZCB 4WIIA 1EKSA 1XNQJ 1X7VA 3OQ2A 4AQYF 1SL0A 5GAGI 2RIJA 1RWMB 2JEIA 2AX0A 1Q79A 3P49B 2ZC3A 4ZPBA 3GIRA 4ECQA 2K7KA 4NXMF 2DT9A 1QUPA 4DR5J 3W60A 3IS9A 5EWFA 1BQXA 3HD2A 4RW6A 1LWEB 1F1BB 2QL9B 5BYRA 1KFSA 1IR0A 3IM8A 3PM9A 1XERA 4HEA9 1NK9A 5IS2A 3B6BA 2WW8A 3DI6A 4PPDA 3O5TB 3M30B 4WCEQ 2XMTA 3G6XA 4B9TA 2WW4A 2LEBA 4NYOA 3G6YA 4F02A 2DCLA 3S8SA 3PHTA 3EVOA 4AXJA 4K50A 1U1KA 3BH6B 2AJ0A 2DO4A 2IVMA 2AP6A 1N52B 1TL3A 3THPA 1GH8A 5A8WB 4UZBA 4JI8F 3KTQA 2VUGA 4CQ1A 2QA4G 2MXYA 5HQMA 1GXUA 4HDHA 1VQLS 3MEDA 1DQAA 2FHKA 1K1QA 4GKJJ 4CH7A 4E98A 2W4CA 1RHUB 5DDPC 4F4AA 4K2JA 4M94A 1TL7B 4C48A 2JC0A 2WB1D 1VQSA 2HIQA 1K0TA 1S99A 3FRZA 4M5HA 5EHHA 1S0NA 3OXLA 2V0NA 4FN5A 2VOPA 4WFBQ 1BWVA 1WC5A 2XYGB 3DLBA 3QJPA 2DNRA 3RB4A 2ZBRA 4XDCA 5C24B 4FXVA 4NWBA 5BJRA 4OI1A 2ZWPA 5K14A 2IYIA 3M6WA 4I2QA 1DZ5A 1T9WA 3MD1A 4OHXA 3UN2A 1LK7A 3OTBA 4B9MA 3PYFA 2B4OA 3D6TB 3SCKE 1GX6A 4OZJA 2BJ9A 1F3VA 3MOJB 3UNYA 1KBRA 3MMAB 2ZH8A 3VGTA 3DDKA 3G8SA 3N4WA 1VC5A 1HR0F 1KEKA 2CZVC 3T1HF 4RW9B 1U49A 3MM8A 1Q86T 4LSZB 2ZFHA 2XS5A 3FZBA 1T3NA 2RE1A 3FBCA 3NCPA 3TVYA 4FF3A 2VG7A 5J1PA 2MQ8A 3TX8A 1QAJA 3H5YA 1S9EB 4KH1B 2V2QA 3CMAS 4CLWA 3MEEA 1JNZB 2FJAB 4CCHA 2L9DA 2IVYA 1HQUA 2RH3A 3W2WA 2GJ2A 2YNIB 4LJMA 1X5PA 3A12A 5H9EK 3ETMA 3CIZA 3OUYA 5I42B 4CDIA 3GG1A 2B56A 5AE3A 1YIJS 1M0SA 1FDAA 2MZRA 1I5OB 2MZ1A 4DMZA 4MKYA 1IBMF 4KFBB 1NK6A 5HP1A 2NUUG 2WK4A 1WC1A 2DGWA 5D4NA 4WTYA 3VVUA 2YKPA 3CD0A 2W2PP 2DNZA 5K20B 1P1LA 2BBEA 4CM2A 4DF8A 3HLUA 2ZE2A 3JTNA 3D5MA 2BE7D 1FFGB 2AIRB 3LP0A 4USIA 4FYVB 3VTIA 1SBRA 3M2VB 3GR0A 2FY8A 1JJHA 2VG6B 2CPEA 4F3OA 4ZN1A 1X4HA 3TAPA 4IQMA 4M5NA 1WNEA 3BO2A 4KV8A 2YQ1A 3TA1A 1JJ4A 3IWLA 2V5HG 3TZZA 5J2NA 4DLGA 2OEJA 4WZMA 2GO9A 2KI2A 4LVNP 1V5IB 3Q0AA 3RUBL 2AHOB 1REVA 4O4GA 3H20A 4OYWA 5DQIA 3BN4A 4DQRA 2HNDB 2D69A 4HH1A 4L3NA 2W2NP 3KJFB 2FVRA 2E5LF 1RDRA 3BPSP 4HACB 4ZPCA 1FRJA 2KYXA 3DLHA 2E7XA 4NLYA 2Q1LA 2ZHBA 2ZBQA 3KLHA 4KKOB 3K5LA 3ILLA 5J2PB 3T5LA 1SQFA 4L72B 3QYYA 3MPVA 4KGVB 1SPBP 3DRRA 2AEFA 3HZGA 1R8PA 5HMZA 4M8LA 2AGPA 3S1TA 3UO0A 1QAXA 2XEXA 5LJ5Y 2PA3A 4JV0A 2FJXA 5B0FA 2R7WA 3OTOJ 4E0DA 1SCJB 3AXKA 3IRXA 4AFFA 2V8DA 4ZK7M 4DU7A 1FVQA 2CQ1A 4RJVA 1D0EA 3R1LA 1RT5B 2DGTA 4X65F 2FLLA 3HPOA 1RTHB 4LSNB 1RAOA 2DGOA 4CYUB 4DUYF 3N28A 3CSKA 2CJKA 1IUJA 2RD5C 3PRBA 4GRSA 3IA0A 2GJIA 2KM8C 2HRTA 1CJVB 2HG4A 1WEZA 1RT1B 2RS8A 3SYZA 4F4ZA 1F6TA 2QMUB 1OY9A 3M8QB 2WCXA 5J2MB 2DISA 2ASJA 3PY8A 3CCJS 1P6TA 2XMKA 3V4IB 2N7CA 2MKYA 4DEZA 4Y2KA 1VC6A 1IQZA 2RJZA 3CJKB 2H5EA 4F8RA 1YBTA 5E33A 1UVMA 4A47A 2VFTA 4FZVA 4AXIA 2QC3A 5DG8A 4MTPA 3MCNA 3T6JA 3GMGA 3M1VA 1RHJB 3IGVA 5A2QY 3R27A 4LF1A 1R27B 3T41A 2OI2A 1TKTB 4KTQA 4Q43A 5DRKA 3S01A 5F8GA 3MPYA 3K8WA 1RHKB 3MTKA 4QCLA 1U6ZA 4C6AA 1S0VA 1FD8A 4IG3A 2B9XA 1TL7A 5D8HB 4OI2A 3J7AN 2ZH4A 1OQ6A 4K4TA 3PEJA 3KKFA 1X9MA 4JI3J 1HIYA 3NWRA 4USUA 3MUMP 4WZQA 4KBIA 4DN9A 2I38A 5E3RA 1KFDA 5MAOA 2XO7A 3BB5A 1TKXA 2W9BB 1JLQA 2G2YA 2PMWA 4ICLA 1TV6B 2O3DA 3GV5B 4I7FB 1NAQA 3I9ZA 5KFHA 5KFVA 1VCTA 2BABA 4QBUA 3DU6A 1XMQJ 3PFEA 4PKDB 1LWCA 5KFBA 3F44A 3Q8QB 3RAXA 1N34F 4J9SA 3D0HE 3MMAA 1I94F 3LH2S 2HIYA 4MJKA 4CLYA 2KT5A 2XGQA 2IM0A 1VHFA 3AOBA 3LP2B 3LANA 4WU3A 4NLOA 4DR2F 2Z56B 2V8PA 2F7VA 5DZ6A 2QT7A 1S9EA 2ZH5A 4C8NA 1T8EA 4DX8H 1KHVA 1JK9B 2Z0GA 5F3ZA 5CZVA 1S12A 1NDKA 3A8EA 1S5ZA 2I5JA 2C2RA 3BQ0A 3R1HA 3M9NB 5BXIA 4ZN3A 2HWHA 1NHKL 2XWYA 3JB9k 4YQWA 3QO9B 1FWLA 1HBNA 1BQNB 1VYAA 1WELA 3QT7A 2D3OR 2KT2A 1VQPS 3MCOA 2K2PA 4DOZA 2EFOA 4DCPB 4C8ZA 4ED5A 1JJCB 4ZS6A 2QIFA 3BKFA 5KG5A 3UCGA 2PE8A 4LQ3A 5HBMA 2DTJA 2QMWA 2V6AA 2JRRA 4ZP9A 2B26A 1Y7PA 1M5KC 5K8OA 4NLQA 4ZHRB 2HHVA 4LF7J 5LMUF 1X31C 2K3IA 3UCZP 4ECRA 4Y3CA 4ZVTB 1F2GA 3FDSA 3M2VA 1Q5YA 1TAQA 2JOQA 5D6GA 2YKNB 1DTTB 1Y0HA 1S6OA 4IYQA 5LMNF 3TW0A 4RNNA 2HNYA 4O44A 4YOEA 1RBAA 5KT6A 2QE5A 4U96A 3HVTA 4B3OB 4FXDA 4ETZA 2VFUA 4LF4F 2LU1A 1ZBTA 4MKVA 4M5DB 3M6VA 2HZCA 3IFEA 2OP5A 1HD1A 3PVXA 3TP2A 2V68A 2OMOA 2VQEJ 4HT7A 3HVAA 1XJWB 4XPCA 2BE2A 4ZCIA 1WKLA 2D7SA 1ZOTA 2QLDA 4U8YA 4JI2J 3ADAC 5LOQA 4USMA 1DURA 1TELA 2P9CA 1X5TA 2HQ3A 3GQCA 1CULB 3BGRB 3GCWP 1BXNA 2BEFA 3QSYB 2J0SD 2UV8A 4DSKA 4KYZA 3MEGB 3KLVA 1RWOB 3IN5A 1VQ9S 4KKOA 2OFGX 4DDFA 3FKBA 3BBBA 1IKWB 3IBWA 1MN7A 1DRZA 4USTA 2DBBA 3MR7A 2EW9A 1S1XA 4ES2A 1X5SA 3NBPB 2OKQA 2LKZA 2RQKA 4TU9A 2MGZB 2PDAA 3NP5A 2OHDA 2CPHA 1Z4UA 1G1XA 1TL4A 1NJZA 1DTQB 3CCRS 2AJ2A 4A8KA 4TU8A 4QU7A 1NDLA 1RT5A 1FKPA 2KT3A 1HWUA 3K59A 4KJIA 1RTHA 5B0AA 4CO5A 1X4DA 4NLXA 3M2UB 3Q2SC 3R7BB 1UEKA 1V9OA 4CYUA 3UDEA 5GAHU 3C15B 1FRLA 3MECA 5EX0A 4KIAA 2JFKA 4K59A 1CJVA 2WOMB 2MJNA 1SUQA 1X4FA 5FLXU 2DK2A 4AL6A 3CEDA 1JLBA 4B9SA 1C1CB 2K8GA 5L1KA 2HKEA 2RU3A 4NEYA 1FWPA 5GAEI 3IO1A 3BZQA 3E01B 4NRUA 4FPRA 5B0EA 2EK6A 4KGKA 1EJ7L 3V4IA 2Y0SD 3H8YA 1DY3A 2MSTA 2A10A 4B9LA 2UVUA 1VQ7S 3CD5A 3TYTA 2CWKA 2HFVA 3DXBA 2HSEB 2YX1A 3KUEA 4DQPA 2W9AA 4X4NA 3LAKA 4F04B 1NLTA 1JLAB 1FKOA 1FESA 2AEJA 1HPZA 5LSLA 4RW4A 2B5JA 4G3IA 2J6UA 5GMKa 4E8UA 1FNOA 2JLGA 3QJJA 2UVVA 3FQLA 4YDDB 1KR4A 2YWKA 2VJUA 1X4CA 2UXBF 3JS9A 2E7WA 1RT2B 1IXKA 2FC9A 2B0GA 3IAM9 2ZOMA 5IOLA 4V19X 3HHLD 4WP9A 1R0BG 1N56A 4DL7A 2P6TA 1HHTP 3ITHA 4ZCKA 1XMBA 4IH7A 4A8WA 2HRYA 5A8KB 4LIWA 2W9BA 3C5XC 4X62F 3DRPA 2CJAA 4PG6A 2IRUA 4ZVRB 2GV1A 5KFQA 2DGSA 2WSEC 3ETOA 1YJ7A 3H7HB 3HSJA 3NMAA 1JLGB 4DV4J 1REGX 5D4PA 1WHVA 3VHQA 4X64F 3RR7A 3FCHA 2MQPA 4OZ3A 2I2YA 1ZPVA 5HJYA 3LO3A 2DRDA 3Q8YA 1U1RA 2A2DA 3OSNA 2Q6BA 3J7YI 1YG0A 2HBZB 1IVZA 3M8PB 5K8PA 1XAOA 2VJVA 3LP2A 1I51B 3GE9A 3MM7A 4H4OA 2O5DA 3A8IA 4ZIWA 4IH5A 1P9YA 2DGXA 1F5AA 3NOCA 1VQ8S 3E51A 3OTDA 1ELOA 1S4EA 3Q8SB 3PW7A 3TARA 1UVLA 4FBTA 1RTIB 3B82A 1XTZA 3EPIA 1XNQF 2KH9A 2HFNA 2BANA 2KZMA 4HTJA 3JXOA 4OJ1A 4J9OA 2M7SA 2GQCA 3BGLA 4G1PA 3Q86A 3KDOA 3LW5C 1WHWA 4DR5F 5DO2A 5C25B 3NMRA 5DQGA 4J5OA 1WC6A 4ECUA 3M6UA 3OR2A 4PAAA 3OFHA 2GA7A 1SH3A 3GR1A 1S6QB 5G0RA 1DAXA 2QYGA 1RADB 2V69A 3DHWC 2D3O1 5D15A 2NXUA 2OPRB 1HBMA 1RUSA 4JOUA 3UI3A 1DHMA 1DTTA 2RNEA 2FHJD 2W1BA 2ODXA 4NI2B 1B0VA 3AGZA 1KQSR 5KG1A 2FC8A 5GADI 2YNGB 1NK7A 2DEIA 3IGNA 4DX6A 2GHVC 4B3OA 2CJXB 5HROA 3VGUA 5T7LB 2E9RX 3W63A 3V5RA 2RDIA 1JMTA 2ZD1B 1AFJA 4YS2A 4QPTA 5KAKA 1T7PA 4FS1A 2FGOA 2OPPB 4P2FA 4PRFA 4LF9J 3BREA 2YX4A 3R5DA 1G7CB 1T11A 1GK8A 4GKJF 3RR8A 2HHQA 4IFVA 2ZBCA 5IC4B 3RRGA 4J9PA 4IR1A 2A6OA 3FJ2A 3AA8A 1SH0A 4PQAA 1I3OB 2MKHA 4F50A 4DPXA 1IN0A 4QZVB 4ZLJA 1D3WA 5J2QA 4ITSA 2QO3A 4USVA 2NS1B 1K8AT 2XMVA 3RAQA 5U47A 4Q0BB 3OL9A 3T5JA 4CH1A 1CJUB 2FVQA 2ZJQQ 1RAJA 2O67A 1WHYA 2CQPA 2VA3A 4RKUC 1NSKL 5KFCA 2CJYB 5SZTA 5HLFA 3G6ES 4ZP6A 3L9ZA 3F73A 4FS2A 3PJWA 2YNHB 3WHIA 2CA9A 3BKTA 4ED6A 3HFKA 3D1QA 4C0OC 5JVGQ 3IWNC 4OYZA 1U0SA 4TY8B 2Q43A 2YWGA 3GFZA 1M1GA 5D77A 3E3XA 2JHEA 3N0VA 2XBPA 4UY85 1J2VA 2GZOA 2QN6B 2CIMA 4U8VA 2YWEA 2R7SA 5F8NA 1NCLA 3BSNA 3R3TA 1IBCB 3ULHA 5IFMA 4KPCA 6FD1A 1RWNB 4ANEA 5D0HA 4TQSA 4J90A 5LL6d 4B9VA 2IJRA 4RO0A 2VA2A 2UV8G 1OS5A 3BDEA 4M5JA 5KG4A 2IJNA 1R7IA 2XG8A 3LZ8A 4EZ9A 3NCRA 1YRUA 1RT6A 4QW8A 3VWSA 1RWXB 4ZLNA 3TRGA 3J81U 1C1CA 3OBIA 1E6VB 5IV3A 4ETXA 2J9EA 2ZBPA 3TA2A 3W64A 4JI5J 3W61A 4B3TJ 1BGXT 1CS4A 2OIHA 1XR5A 1D9AA 2FTRA 4L73A 2CQHA 4WE1A 2MQOA 4K4YA 2ZC4A 1ZZNA 2GVDA 3HP6A 3OL6A 2HURA 4JYAJ 2XMMA 1QY7A 4YY3J 1FK9B 3KK2A 2VL1A 4DSLA 2U1AA 1KLNA 4I6AA 1U47A 1WOSA 2RF2A 3OHAA 3D3CJ 3FNNA 1QVGR 4LRDA 2NPFA 4Y2MA 4F2SA 2YPYA 2C3PA 2FJBB 4C8LA 2IA0A 4F3QA 1S6PB 1XEZA 4DV7J 2A6MA 3PG9A 1YKWA 4ZVSB 4CLUA 2CQDA 4TKTA 2HGNA 4HDGA 4J9NA 2KXFA 2PN6A 2Q66A 2A2CA 4EZ6A 4NCAA 3Q8RB 2GQQA 3QMQA 3W8PA 1VQKS 3W9JA 5KT7A 5KFGA 5EN1A 1BMQB 3OXFA 2RS2A 5A8KA 2BZ2A 3CCVS 2W7AA 2YX7A 1VK3A 5EGYA 2ACMA 2OH2A 3BEGB 5L1LA 3HF5A 1R0CB 4J9KA 3BGUA 3D6HB 1JLGA 4F0KA 2ZUGA 1HYSA 4QW9A 3M9OB 3N9UC 2E5GA 1FO1A 3OR1A 1URNA 3BBFA 1VDHA 4ZA1A 1OYEA 4OV6A 2PEBA 1FJ7A 4EO6A 4Q8FA 1SC3B 2OAUA 3FUYA 2HZVA 2ZHOA 1J5OB 4EWTA 5IQQA 2AZ3A 3FCWA 1R43A 1NZ8A 2BJ3A 3TUZC 2HRUA 1JJ2R 4DX5A 1SV5B 4OZ2A 5I3UB 2HHWA 2YQ3A 2FDNA 2J0XA 4DJBA 3H2UB 3L7OA 3PZPA 2YKQA 4CLZA 4CO4A 4X4QA 3OTOF 3NS5A 2CYYA 4QOTA 1N0UA 1SJQA 1RTIA 1HHSA 2Y0BB 2LQ9A 2VODA 4LR8A 3PEHA 2F8HA 4U6PA 3TZYA 3HVRA 5FIIA 5H9EJ 4TXSA 2M8HA 5F0UA 2B7CB 5C25A 3SZ2A 2ZM6J 4DWIA 4DV3J 3RB3A 4ZIVA 3THTA 3I0RB 1HWKA 3J80U 4I0WA 3AD9C 1YJUA 1LKZA 1Q8BA 4LF5J 3HHLC 2ZEJA 4URSA 2RSQA 3CCSS 2OPRA 4NYZA 2H5IB 3FBBA 1M5SA 1IJEB 3GJTB 2HQIA 3SSQA 3KHRA 5E2QA 3K0JA 5D3GB 4DXLA 1PBUA 3VAMA 2YNGA 4WXWA 5EWEA 3DLGA 5D0RA 3M2RB 1SJFA 4NPOA 1VJWA 4HR2A 3BR9A 3M05A 3PRVA 3ILJA 4IDKB 2RB7A 3HM9A 4F7VA 3VR1A 2DJWA 4JUZA 2HQFA 4ENOA 2LQJA 3CDEA 2FLOA 5T14A 2OLWA 4ID5B 3C6EC 4X84A 4XPEA 2VPXB 1MU2A 1TVRB 4H4MB 2P5VA 3UR3C 2UU9J 4TQRA 3JSMB 3N01A 3T9ZA 5AXNA 2AJ4A 3PKMA 5B08A 4ED4A 5CXTA 1ZAWA 3AD8C 4JI3F 3MURP 3QGGA 2X1GA 4DPUA 2FQQB 1CJUA 2XB2D 2IFXA 4P75A 4R5PB 5A6WA 3VAHA 2CJBA 2NSCA 3M8YA 4H54A 2ASDA 3BN7A 5L39A 1T9XA 2VQFJ 4HT5A 3SCIE 4D3GA 3MAHA 3GIMA 2QZ8A 1RCXB 3CC2S 2E9ZA 2C22A 3Q8PB 1HFEL 3ZZ0A 2VC0A 1G3OA 1XMQF 2ERRA 4NA3A 3CMQA 1XNRJ 4G65A 1YQHA 1RK8A 4C11B 1LXJA 2AYMA 5KTQA 2BJ8A 2AD9A 1NB2A 4RU9A 4F0HA 2R7RA 2MMYA 4DFMA 1Q8LA 3BR8A 1A6LA 1I1GA 3RGIA 3A13A 1F5CA 2KKHA 1RP5A 2EVZA 1GNKA 2BQRA 2F3JA 3H90A 3VAFA 2VIHA 5LSRA 3JTPA 4OJHA 3MUVP 3GTYX 8ATCB 2C3YA 2D1CA 4OYXA 3SIPB 3NNCA 2MQLA 4DSEA 1J5EJ 2LLZA 4FKXA 4I64A 2AGOA 2RRBA 8AT1B 3BSOA 1VBZA 5HK4A 1VQ6S 3ZZYA 4R0EA 1URRA 2DHHA 3U7JA 1KNZA 2Y1LB 1OPIA 3Q23A 1S77D 3AD7C 3JYTB 2VOOA 4MK7A 3D67A 1AFIA 1FRXA 4ED7A 5D4LA 4M5LA 4QIWD 4URGA 1WC3A 2V2KA 4O3SA 2DYAA 1V3SA 4ZCMA 1O8BA 2W25A 4S0MA 4RR5A 2VICA 4EU0A 2ZH2A 5F0WA 4LF7F 1O5JA 4WP8A 1S6PA 4EI2A 2VONA 3SI8A 4TYBA 3QZ7A 2XNRA 3AQOA 3CDWA 3TANA 3DLKB 5KG2A 2AYEA 1UVKA 1C4CA 5C42B 1WKJA 5DDRC 5M2UA 4K0KJ 5AE2A 4ECTA 4WXOA 2B51A 4ED2A 4QYRA 2MLXA 5ETOA 4OHZA 1AYEA 1UCNA 3TQEA 1VR6A 4LBHA 4OJ3A 1IKVB 2GMHA 4K4ZA 1U6BA 3CO0P 3OSPA 3KHHA 3HHLA 1YJTA 1UJ6A 3ZNUA 3AB4B 1LFWA 3GG0A 3C6UA 4W92B 1ZM9A 3QIPA 3UE2A 1JQGA 2VQEF 2E66A 1H6KX 1MROB 4ILRA 1VS3A 4YB7A 4UY8T 4O23A 4KB7A 3PYDA 4JI2F 2CQBA 1F9FA 2ZDOA 3QGPA 1VBYA 3IAS9 1HNZJ 3MMBB 4ZKAA 3LPYA 1DLOA 3ZZOA 3D7SB 2EK1A 5L8RC 4C8OA 2R2RA
chains in the Genus database with same CATH topology
2HFVA 3TJAA 3LA0A 2Q2GA 3L9ZA 1XAOA 3NY0A 4J80A 3NXZA 2B26A 3I38A 3TJ9A 2QLDA 1GMWD 1GMUA 1NLTA 3AGXA 3LZ8A 1C3GA 3TJ8A 1GMVA 3AGYA 1GMWA 1EB0A 4L3KA 1EARA 3AGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFV A;  3TJA A;  3LA0 A;  2Q2G A;  3L9Z A;  1XAO A;  3NY0 A;  4J80 A;  3NXZ A;  2B26 A;  3I38 A;  3TJ9 A;  2QLD A;  1GMW D;  1GMU A;  1NLT A;  3AGX A;  3LZ8 A;  1C3G A;  3TJ8 A;  1GMV A;  3AGY A;  1GMW A;  1EB0 A;  4L3K A;  1EAR A;  3AGZ A; 
#chains in the Genus database with same CATH topology
 1EHW A;  3FFI A;  1VK8 A;  4IRK A;  1SV5 A;  4X66 J;  1CJT A;  2CAD A;  1Q7L B;  2M0G B;  1Q16 B;  1WG5 A;  2OPQ B;  4AD6 A;  4R25 A;  4ZDN A;  4FVM A;  1AUS L;  1RU1 A;  5FD1 A;  2L9W A;  4RNM A;  2NSB A;  3FQK A;  1WTF A;  2BX6 A;  2QSW A;  1L3V A;  4Y65 A;  4NCG A;  1U4B A;  2K7J A;  1FD2 A;  2R7V A;  4OHY A;  3Q83 A;  4JI0 J;  1PJ7 A;  2XMJ A;  3QAU A;  3NNH A;  2FB0 A;  3OTC A;  2M2B A;  4PUO A;  5FDL B;  4NLG A;  1HW9 A;  1RKJ A;  2XSF A;  1S59 A;  5KFL A;  3LQV A;  4F36 A;  4QIE A;  2KRB A;  3UVJ A;  3I0R A;  3GJS B;  3OW2 R;  3R5C A;  1JKH B;  1I94 J;  4MFB A;  1S57 A;  2CPY A;  4IOA Q;  2CPD A;  3PHE A;  1N5V A;  2GVZ A;  3MMC B;  2POK A;  2KB2 A;  4V19 J;  1SKR A;  1RA7 A;  2JLE A;  2HMI B;  4RW8 A;  3D66 A;  2AV5 A;  3OVA A;  1N88 A;  1Q78 A;  1KDN A;  1B0P A;  2Z2M A;  1HWI A;  4OLO A;  1W26 A;  2FHJ A;  5K5M A;  1NEE A;  4MT1 A;  3FSY A;  3I55 S;  1VHI A;  2AYG A;  4C2M A;  3M2R A;  3W1Y C;  3VAG A;  2FJE B;  3ZTQ A;  2DIU A;  2HS0 A;  2CAJ A;  2EFP A;  1JXE A;  3CCQ S;  1T9V A;  3H98 A;  3MPW A;  3NGS A;  3EGW B;  1XMO J;  4UOG A;  4MIA A;  5KFK A;  2JVO A;  4FPI A;  4O3O A;  2L48 A;  3ZO7 A;  1JB0 C;  2C28 A;  4LRE A;  1FA0 A;  5HO4 A;  4M5M A;  3TAQ A;  3P5B P;  2BV3 A;  5F8L A;  2CQC A;  3GIJ A;  4K4W A;  1UFW A;  4ANC A;  1VJQ A;  2RIL A;  2V2Z A;  2RT3 A;  1KD1 T;  1NUE A;  4ID8 A;  1FEE A;  3O1L A;  2C2D A;  3Q8V A;  1YJW S;  2YXL A;  4CNY A;  1VQY A;  4CTA A;  2KDO A;  1N36 J;  1PYS B;  4DBQ A;  3CC4 S;  4DR3 J;  2L08 A;  2D9P A;  3IR6 B;  1YZ7 A;  3HX9 A;  2HHU A;  3PYG A;  3LTO A;  1XR6 A;  4DV4 F;  3CTR A;  1UAW A;  1JNR B;  1KSP A;  2MKJ A;  5M2P A;  4GC7 A;  1VLO A;  1YBU A;  3KK3 A;  3KJV B;  4WFA Q;  1R0A B;  3W3S A;  5HL7 Q;  3LAM A;  2LEP A;  1C1B B;  3K5M A;  1B64 A;  1YSJ A;  4BWJ A;  4OZL A;  5KT4 A;  4TLR A;  5FLX Y;  3GV7 B;  2VG5 B;  4DLE A;  1V3Z A;  1V6H A;  1EIY B;  3LF0 A;  2LU2 A;  2JRS A;  1PSD A;  1RT7 A;  3ISN D;  2MHN A;  3TAM A;  2V9W A;  2H65 B;  1HNX F;  4I67 A;  4DPT A;  4N8O A;  4ZPW R;  2QLF B;  3OJU A;  2JZ5 A;  4ZVQ B;  1O51 A;  2BYC A;  2MZQ A;  1KLM A;  1NH7 A;  1SI9 A;  3BO3 A;  1NO8 A;  2JX2 A;  2RRN A;  2DY9 A;  1KQG B;  3HSG A;  3AY0 A;  1Q0N A;  5ETV A;  5C2G A;  2P8I A;  2YKM B;  1UW4 A;  2F9D A;  2WON A;  1HBU A;  2AW0 A;  3MPD A;  1AW0 A;  4K4S A;  1UVJ A;  5KG6 A;  3NCQ A;  4RZR A;  1RSC A;  4JV2 A;  2RQM A;  3HFZ B;  1KTQ A;  1H2V Z;  3OD2 A;  2LMI A;  4X4S A;  4C3L A;  5CHC B;  1EAY C;  1Q5V A;  2K1R B;  3UW1 A;  5BR8 J;  2ROG A;  4D3H A;  2BDP A;  2QA4 S;  2PFF B;  7AT1 B;  3EXY A;  3W8G A;  1TL1 B;  2KXN B;  3EVM A;  2PI4 A;  4LQ9 A;  1VRU B;  4TVA B;  1B4S A;  4K5R A;  1Y3K A;  2R2S A;  1MWQ A;  2XHC A;  2KFN A;  1H73 A;  1NB7 A;  3KLG A;  1U1P A;  2BKO A;  2DGU A;  1UL3 A;  4LFA J;  4HI1 A;  4F3M A;  4ZPD A;  4L76 A;  3DRS A;  4PWW A;  2J7K A;  3CNQ P;  2E1P A;  1BQM B;  3O3L A;  1TZ0 A;  4QWE A;  5IT9 Y;  4CZC A;  4G1Q A;  1T9U A;  2IBO A;  1DAR A;  2DGV A;  1NKB A;  4LF9 F;  4WYW A;  4YB1 P;  1HD0 A;  1IJF B;  2W2Q P;  2HFZ A;  4DSI A;  2JWN A;  2V8G A;  3QLH A;  2MB0 B;  3BDP A;  5KFP A;  4F4K A;  3ZZT A;  3PO5 A;  3WZ0 A;  3MMB A;  1V5V A;  3PTW A;  3Q24 A;  2XSJ A;  4LSL B;  4ATN A;  2CQI A;  2JEF A;  2IDL A;  2HLU A;  2GMJ A;  3CT9 A;  5CAA A;  4X4P A;  1R6V A;  4CLT A;  3KLF B;  5I4M A;  1NPP A;  4RWW A;  2G2O A;  2Y9H A;  2DXE A;  3FZ2 A;  4Q2M A;  2HWI A;  3M32 A;  2UUT A;  4CWB A;  2KG0 A;  2OPQ A;  2CQ0 A;  3EGN A;  3CD6 S;  3A3O B;  2X7I A;  5GAG U;  2ROE A;  3DLL Q;  4DG1 A;  4IOC Q;  2ZOF A;  1DQ9 A;  1NSP A;  3PAC A;  1F0X A;  1N33 J;  3KDN A;  2IC3 B;  1V3R A;  3SDE A;  3DRX A;  3DGP A;  2VF3 A;  3EMT A;  4OL8 A;  1S1U B;  2C2M B;  2XHW A;  3PRD A;  1FCA A;  1MW7 A;  2MZS A;  3W66 A;  5FDL A;  4BS2 A;  3R9L A;  3VAL A;  1VIS A;  4MKA A;  1NPK A;  4J9Q A;  5LT5 A;  2ZUA A;  3BV8 A;  1WG1 A;  5A8R B;  1S1W A;  5B09 A;  1CJK A;  3MGJ A;  1Y5N B;  1RAE B;  1FEH A;  2CVE A;  3AXM A;  2BJE A;  1W2I A;  5DET A;  3ZZU A;  3HJF A;  1LW0 B;  3NLC A;  1AB8 A;  1G2E A;  1TAU A;  2W9C B;  1RAC B;  2J7U A;  4ZVE A;  3UCU P;  3QRP A;  4JI5 F;  4B3T F;  1FDB A;  3MM5 B;  1SQE A;  2W01 A;  3G71 S;  1S97 A;  2VBX A;  2J9D A;  4JYA F;  3I0S A;  1I6J A;  1HNV B;  4L74 A;  5ETK A;  5CCM A;  2FUG 9;  4YY3 F;  1LW2 A;  1NRK A;  2NR0 A;  2HQD A;  2DIT A;  3C14 B;  3DRY A;  3MEK A;  3OLB A;  4EK2 A;  5E3A A;  2F40 A;  1HNI B;  4BWM A;  1GAO A;  4DV7 F;  2OD4 A;  4HI2 A;  5ADZ A;  1QSS A;  5HVF A;  2JFD A;  3G82 A;  1WAC A;  4UOH A;  1JLC B;  2C2E A;  5RUB A;  3IC1 A;  5KFE A;  4DI6 A;  1S4F A;  4FBU A;  4LIR A;  1PCA A;  3A4T A;  3KLI B;  4LRB A;  3L7P A;  3IRW P;  1QUV A;  1HI8 A;  2MQQ A;  4OV1 A;  1T03 B;  3UD3 P;  2ZIT A;  1X0F A;  3I4P A;  4X4R A;  2LEA A;  2W4P A;  4JV5 J;  4B3R J;  1GEH A;  5DDQ C;  3QRR A;  1ARO P;  3TWZ A;  3ISZ A;  4Z2X A;  4F4X A;  5DG9 A;  1U0H B;  1NXI A;  4B9U A;  4Q44 A;  1F5B A;  3KJV A;  3R5A A;  7FDR A;  4I1T A;  1R0A A;  4NZ7 A;  2DO0 A;  4LF8 J;  4LVO P;  1FDN A;  1OIA A;  4ED1 A;  4ZLL A;  8RUC A;  2RKI B;  4JP8 A;  1QTN B;  1FRM A;  2KRR A;  2V63 A;  4CT8 A;  3IP0 A;  3ZTR A;  4GVB B;  2LA6 A;  3OL8 A;  2ASY A;  4A8Y A;  2VG5 A;  3IR7 B;  2F9J A;  3BYR A;  3J81 Y;  2VBW A;  4HTI A;  1E6Y B;  3QAE A;  4BCA A;  2F65 A;  5CYM B;  5KFF A;  1QE1 A;  3S6E A;  2H3E B;  5DDO C;  2GGP B;  4P7T A;  4GKK J;  2N7Y A;  3BGO P;  2F5G A;  4B02 A;  1YLX A;  3GFH A;  2CJQ A;  3KXD A;  4PG5 A;  1H98 A;  2FPH X;  5A76 A;  2GQ2 A;  1IKX B;  4C0H A;  1QM9 A;  3F0N A;  2LCW A;  1H7X A;  4K2X A;  3ZZR A;  1TKZ B;  2CQ3 A;  4O0I A;  4WBF A;  4EYH B;  1RT4 B;  3JSB A;  3DOL A;  1VIO A;  3DYA A;  3I5A A;  2ZM6 F;  4DV3 F;  4N41 A;  1LEO A;  3F56 A;  2H4W B;  1UVN A;  2L3M A;  2Z8Q A;  2X1B A;  3SQG B;  1TP7 A;  3C16 A;  1TFW A;  4QWC A;  2J76 E;  5F9L A;  4LF5 F;  2DB1 A;  1GXT A;  3ICL A;  3UQS A;  3RW7 A;  4DFK A;  1S1V A;  3DXS X;  1NZA A;  1GT8 A;  3GV8 B;  3L95 X;  4I68 A;  1VRU A;  4PWD B;  5LJ3 Y;  5D0G A;  4K5S A;  1EET A;  1TFY A;  4ES1 A;  2DR6 A;  2PT0 A;  3HJV A;  4C8Y A;  4N8N A;  1GQE A;  2AGQ A;  4UOF A;  3C2P A;  3AH6 A;  3AJ1 A;  2XYP B;  2CNO B;  3ZNJ 1;  2XMA A;  3T9N A;  5ETN A;  1BQM A;  3BS9 A;  4Z7Y A;  3I5C A;  3HHK A;  3BQ1 A;  4U7U D;  1ZM2 A;  5DLF A;  3C46 A;  1HMV A;  4UZC A;  2BAC A;  2AU0 A;  5IWA J;  1R8B A;  2MPU A;  3RJM B;  1P27 B;  5HAO A;  4A8X A;  1JLE A;  1JLF B;  4JI6 J;  2BW2 A;  2XLJ A;  2EFN A;  4B9N A;  2F4V J;  4DL4 A;  4C98 A;  4XTT A;  2UU9 F;  5HN0 A;  3K5P A;  4A46 A;  3ISN C;  1RT3 A;  4DL5 A;  2QTW A;  5HMW A;  2DD8 S;  2XUL A;  4RX6 A;  3EJM A;  1NKE A;  1PYO B;  1FWK A;  3N6M A;  1HBO B;  3KLF A;  3H5U A;  3PW4 A;  3DOK A;  4NX9 A;  3TOQ A;  3T1A A;  4NLS A;  1KN6 A;  3WDO A;  2E1A A;  1DBD A;  3RBD A;  3FSX A;  2HK2 A;  1EP4 A;  1UW9 A;  2VQF F;  2AT1 B;  5CAB A;  3EVW A;  1NU4 A;  3MPU B;  4CLK A;  3GLJ A;  2MQN A;  3PW0 A;  2R8H A;  2Z58 B;  4OIX A;  4JI4 J;  2XLI A;  4F25 A;  2ZJP Q;  1RCO B;  3RRH A;  2Z2Z A;  1XNR F;  1UA0 A;  3HSD A;  2A0F B;  1ZM4 A;  3QQC D;  1CG2 A;  5B0B A;  3J80 Y;  3L3C A;  2VU5 A;  3C6T B;  3CJR A;  5HMX A;  4QR2 A;  2KYZ A;  3KG1 A;  1WHX A;  3DMJ A;  2W7O A;  1CEZ A;  4RLE A;  1N6Q B;  2MQM A;  4PYD A;  3T3F A;  2QG9 B;  3KUH A;  3GJQ B;  4WFX A;  2LP4 A;  2GO8 A;  2ZKU A;  4DQI A;  4GO5 X;  3PV8 A;  2H48 B;  1VBK A;  4MK9 A;  4Y0F A;  4DPW A;  4J9V A;  1KS2 A;  4FP9 A;  3W2V B;  4HYK A;  5M2R A;  3O2I A;  4DR1 J;  5JMN A;  3FVY A;  3GFY A;  5HMY A;  2ZNY A;  3I31 A;  5KOW A;  5JXS A;  3G87 A;  3UN5 A;  1WC4 A;  2V4J A;  1J5E F;  2W9C A;  4CNZ A;  5LSO A;  2J0Q D;  3PW2 A;  2ADC A;  5CD4 A;  3MM5 A;  2R8G A;  3JQJ A;  4NLP A;  4YDX A;  2PGC A;  4DS4 A;  4LR9 A;  2R9L A;  1PG5 B;  1PYT A;  3QFW A;  2UUW A;  4USJ C;  1HNV A;  3DLJ A;  5ETP A;  3UDL A;  4LBP A;  2PFD A;  3ELH A;  2W24 A;  2G4B A;  1RAA B;  2VFS A;  4OYI A;  1TK8 A;  1WOR A;  4ES3 A;  2R3V A;  2Y1I A;  3R2D J;  5HVH A;  3EM1 A;  3EIC A;  5AXK A;  3UN3 A;  4K0K F;  3HHE A;  4Y34 A;  3JAM U;  1RAH B;  2XC9 A;  2HHS A;  3U27 A;  5E3P A;  1LWE A;  2K06 A;  3W62 A;  4NAS A;  3I82 A;  2RHS B;  3D3B J;  5E5N A;  4YR3 A;  3HCX A;  2LXU A;  2E9T A;  3M30 A;  5JUM A;  1UEU A;  4DSJ A;  4Z7C A;  2UP1 A;  1X60 A;  4DV6 J;  4O3P A;  4IQX A;  1VQO S;  2QLW A;  4RW7 B;  1HNZ F;  2QFI A;  1D9D A;  1RU2 A;  1VRQ C;  5A8W A;  3L4B C;  3E2E A;  3ENA A;  2RKI A;  5J1E B;  2WBM A;  4OZN A;  2LQ8 A;  1NJI T;  4KSE B;  4NYP A;  3K89 A;  3RBE A;  2J6S A;  2ZWO A;  1FRI A;  4DR6 J;  1RKI A;  2KFY A;  4CI0 B;  4I2P B;  2IY5 B;  4X66 F;  5IT0 A;  3W9H A;  4QWD A;  5CYM A;  2W8L A;  3BBC A;  1YIT S;  2L9N A;  4OYA A;  5KFO A;  4M5K A;  3RBX A;  3UR0 A;  5A0Y B;  2JZ8 A;  1PJ5 A;  1KKH A;  4TN2 A;  1SB6 A;  3GB0 A;  4G1I A;  1S6U A;  4KY3 A;  2KU7 A;  1OWX A;  3HT3 A;  3IS9 B;  2QA1 A;  5C24 A;  4C97 A;  5T41 A;  1TKZ A;  4JI0 F;  2HW3 A;  4RW6 B;  1MLA A;  2ZBI A;  4OYO A;  1A9N B;  2YPZ A;  3GYG A;  2ABY A;  4ZLP A;  4QYZ J;  2CPZ A;  2ZDP A;  3DI6 B;  4R8U B;  2XZD B;  2UXD J;  3PKY A;  4NLV A;  3P6Y C;  3VVT A;  2V8H A;  2HVH A;  3H2L A;  2H54 B;  3ZC4 A;  3M7V A;  3I4H X;  1XN9 A;  4NE9 C;  1UET A;  4PWD A;  4RW9 A;  2R2U A;  4C3K A;  4CRJ A;  4EEY A;  1N5Y B;  3V6J A;  1VLY A;  1XK8 A;  4LR7 A;  3QID A;  2IIH A;  4FNH A;  3MED B;  1R8H A;  4NMX A;  3CUL A;  3CDB A;  3NGT A;  5E3C A;  5F9N A;  2CZ4 A;  4C7Q A;  3AFG A;  4WWS A;  3I96 A;  2YNI A;  4PG7 A;  4DQQ A;  1XIQ A;  1OJ4 A;  1KRP A;  1FXD A;  3ZZZ A;  3OJS A;  5DGA A;  1XMO F;  2UUB J;  5I42 A;  4WTO B;  4QIV A;  2MEW A;  1UVI A;  5CD4 H;  3M8Z A;  2BQ3 A;  2P9E A;  5F41 A;  3J7A 1;  4KO0 B;  1VQN S;  2GFF A;  2DNM A;  2GNK A;  4EMD A;  2MTL A;  3DFE A;  1T02 A;  2XI2 A;  3N5B A;  1T0T V;  4KFB A;  2DR5 A;  2Z4P A;  3OHB A;  2DXD A;  3CD7 A;  2QX0 A;  2M9K A;  4O0N A;  2J9C A;  3KLE B;  4CO3 A;  2VFV A;  2Y8Y A;  3KK1 B;  1M5P C;  1ZTW A;  1ZAV A;  4I2Q B;  3H4B A;  4DUZ J;  4OHW A;  2PI5 A;  3G2X A;  4IUF A;  2QRR A;  3QBC A;  1N36 F;  2DNN A;  4BDP A;  4BHQ A;  2EI5 A;  2DRB A;  2V34 A;  4DR3 F;  3HT0 A;  5KFX A;  2VG6 A;  1NK4 A;  2BUN A;  4PG8 A;  2QL5 B;  4O4R A;  2FLP A;  1H0H B;  3HVW A;  1HLW A;  2NUH A;  4OQJ A;  4DL6 A;  9RUB A;  2HS4 A;  3ILI A;  3J7Z 5;  3H4D A;  2WVB A;  3MM8 B;  4HKQ A;  4DCO B;  3T19 A;  3OV7 A;  3FEZ A;  2VG7 B;  3VCD A;  4CT9 A;  2ATC B;  2OEK A;  4KT0 C;  2ZZT A;  2PO4 A;  3PX0 A;  3MEE B;  2HND A;  1RAG B;  2KL8 A;  2YWW A;  1ZAX A;  3GIL A;  5EDW A;  1HQU B;  3LAL A;  4OI4 A;  5GAE U;  4WK3 A;  2JDJ A;  1RI7 A;  2BOA A;  3PJ9 A;  4HAC A;  2MZJ A;  1LOU A;  2WZ1 A;  3OUY B;  3KOA A;  3W2V A;  3EYZ A;  5ETR A;  1KTV A;  4MYT A;  2P2C B;  2O01 C;  4GO7 X;  2LDY A;  2RML A;  3TZW A;  3CC7 S;  1B7Y B;  4CH0 S;  4F67 A;  3WIV A;  1WEY A;  4YB6 A;  5HP1 B;  5J2P A;  2GIR A;  3L09 A;  3D28 A;  4PG4 A;  4P72 A;  2YKA A;  1ZPW X;  4N47 A;  2HBR B;  4ILL A;  2EKN A;  4ER8 A;  4A8F A;  1WC0 A;  2ZE2 B;  1S1T B;  3TJ8 A;  2X3D A;  4ECW A;  1TUG B;  2APO A;  3E8O A;  2BE9 B;  1RLD A;  1GX5 A;  3CCZ A;  1RWK B;  4OI0 A;  4FDF A;  4CLF A;  5KFD A;  2DNL A;  5BR8 F;  3EZ5 A;  4ECS A;  4LFB J;  2FYX A;  3CO9 A;  1QSL A;  2MKS A;  2ALZ A;  2JH3 A;  1NDC A;  2BJ7 A;  2QJ3 A;  1IQT A;  5J2N B;  4EBC A;  1S72 S;  1AZS B;  2IDE A;  4LSN A;  5JVH Q;  3AGX A;  5F8J A;  3C19 A;  2BKP A;  2ZH7 A;  1YVF A;  4MYU A;  4LFA F;  2QA2 A;  1REV B;  2Z2Y B;  2RDD A;  1RT1 A;  5DS7 A;  2N4C A;  1UTA A;  4L75 A;  4JB8 B;  4CO0 A;  3NS6 A;  3MFH A;  5L1J A;  3M8Q A;  4PR6 A;  5J2M A;  3UFC X;  5I3Q A;  4YR0 A;  2HVE A;  4QU6 A;  4ZP8 A;  2CNN B;  4WJB A;  3J7Y U;  5IC6 B;  1Y4Z B;  1M5V C;  4RW7 A;  3KLH B;  3CJK A;  5D78 A;  1TL5 A;  3R6L B;  1OPZ A;  3O8W A;  4Y2A A;  4ZIT A;  3DRR B;  2B9W A;  5F8H A;  1KP6 A;  2UUC J;  4L3K A;  4C4W A;  2J8A A;  2BXJ A;  2FZK B;  1PKU A;  1TKT A;  3B54 A;  3IRX B;  3AQP A;  2M70 A;  4F4W A;  3GSD A;  4PAB A;  3TO8 A;  4PXE A;  5A0Y A;  3P3D A;  4DCJ B;  3QT8 A;  1RWV B;  4NLD A;  5H1S V;  1OSD A;  4BBY A;  3X1L B;  1N33 F;  2DH9 A;  1RWP B;  2LQ5 A;  4P2X A;  4V1A k;  3CJT A;  1N5S A;  1WI8 A;  2XCA A;  2O66 A;  2OTL S;  2CPJ A;  3QT5 A;  1RYR A;  4B3S J;  4RBV A;  2SXL A;  3TEH B;  3D6M B;  1YJR A;  1KQF B;  4JBC A;  1TV6 A;  4M95 A;  2KJW A;  4I7F A;  2H1Y A;  2DGQ A;  2C3O A;  1Q81 T;  4UQG A;  4DV1 J;  1SJ3 P;  1CVJ A;  4R8U A;  3KYL A;  3R7N B;  2XNQ A;  2DNQ A;  1EQ0 A;  1IM6 A;  3GWC A;  1WSV A;  1NND A;  3G9C A;  1Q95 G;  3HI9 A;  5GAD U;  2NRE A;  2Q3P A;  2YH0 A;  3MAA B;  1NSQ A;  2PMZ D;  2DPI A;  1B99 A;  4WKR A;  1WKK A;  3D1H A;  2OO4 A;  2XY7 A;  1ACM B;  2RVJ A;  4ECV A;  1N5Y A;  2Y1R I;  3DHX A;  3AGY A;  1HWL A;  3M1V B;  3DDI A;  2E5H A;  2FJW A;  1HNX J;  2HHT A;  4Q8E A;  5AJ3 J;  2WVD A;  1FNX H;  4DL2 A;  3CCU S;  2PA8 D;  1UA1 A;  4IG3 B;  3CCM S;  4OMF G;  2I6W A;  2UXC J;  3QO9 A;  1BQN A;  1HA1 A;  3DNC A;  1NJX A;  4KO0 A;  1UP1 A;  4R0J A;  2DHA A;  4BLG A;  1BD6 A;  4A8Q A;  3ENV A;  3GZ7 A;  4W4M A;  2V4R A;  3LWM A;  1Q7Y T;  1R3N A;  1TKX B;  1JLQ B;  3KLE A;  2BJD A;  1VQ5 S;  1N48 A;  4W98 A;  3KK1 A;  4ICL B;  1GMV A;  3A1Y G;  1PAE X;  2CDQ A;  3SBM A;  1U24 A;  2V9K A;  2ZVS A;  4ZHR A;  3C3L A;  2B43 A;  5I3P A;  4ZP7 A;  1YI2 S;  4NCB A;  3SQO P;  3SCL E;  4DS5 A;  2BRL A;  1LWC B;  1S9G B;  4JV5 F;  2YKN A;  4B3R F;  3KNA A;  4NRT A;  3CJ0 A;  4DR4 J;  2A18 A;  4I69 A;  3SCJ E;  2C1E B;  1IR2 A;  1OY6 A;  3EDR B;  2ATL A;  4LF8 F;  4I56 A;  3R5G A;  3V2U C;  4DSF A;  4M5D A;  2MJU A;  1YWX A;  1KWM A;  4K4V A;  2XZT B;  2NLW A;  5MLC V;  2BKN A;  1IR1 A;  5ETQ A;  1KVK A;  3PYE A;  1S10 A;  1U8W A;  2WHO A;  4QJV A;  2I5J B;  1PC5 A;  3H40 A;  2Q79 A;  4GKK F;  2VC1 A;  3T5K A;  3UWT A;  3AJD A;  1CUL A;  3BGR A;  2KO1 A;  5KFJ A;  3QWU A;  1HBN B;  1PIL A;  2NCK L;  4AE5 A;  3MEG A;  2CXE A;  4ZVF A;  1F3F A;  1IKW A;  3M8S A;  2DNY A;  2D3Z A;  4NLR A;  5HAN A;  2JVM A;  2KHD A;  1ZZF A;  3NBP A;  5BYS A;  3SXL A;  4ZVP B;  4KAI A;  5HBM B;  1NKC A;  2MGZ A;  1S1T A;  4XDD A;  1EX8 A;  2GJF A;  4LBI A;  2BQU A;  3NRB A;  5IT4 A;  3G6V A;  2R8J A;  3ENQ A;  4RNO A;  2RRA A;  1H38 A;  1DTQ A;  3LPE A;  4YUD A;  1X0P A;  2HNY B;  4UOC A;  4DU8 A;  2BVZ A;  4O44 B;  4NA1 A;  2XO6 A;  5KFU A;  2ZKT A;  3HVT B;  3H42 A;  2B8P A;  1FX4 A;  2F1F A;  3UD4 P;  1X9S A;  3I32 A;  1AZS A;  2KM8 B;  2XM3 A;  1RTD B;  3W9I A;  3M2U A;  2NYH A;  1WDD A;  3C15 A;  1M1K T;  3MR2 A;  3QFH A;  4M5I A;  1SH2 A;  1K9M T;  2FHM A;  1UZD A;  2WOM A;  3AB2 B;  1RWW B;  5GME A;  1S76 D;  1Q4R A;  2CFX A;  1MWZ A;  2IM2 A;  4LF6 J;  2DVI A;  2BE2 B;  3H0P A;  3H5X A;  3F41 A;  4DZ6 A;  1BHN A;  5IWA F;  2GAH C;  3J7Z T;  3E01 A;  1HKA A;  2JEG A;  4J9M A;  4JI6 F;  2HAI A;  1PAU B;  2F4V F;  2B9Y A;  2UVW A;  2M52 A;  4CO2 A;  1YRT A;  1RZM A;  4RNF A;  1UJ4 A;  1T9T A;  1G4C A;  3JSR A;  5LM7 E;  1S1X B;  1QAI A;  4N5S A;  4P2M A;  2ASL A;  4FYX B;  3OLA A;  3BO4 A;  3WIU A;  1JLA A;  3OVB A;  4ZPV R;  2EPI A;  3HKW A;  1DQ8 A;  5H9F J;  1U1L A;  4AL5 A;  3IMQ J;  3GII A;  1PGZ A;  1FDD A;  3QT6 A;  4KHP F;  1YGY A;  4M5G A;  3ZTP A;  1RHQ B;  3EDQ B;  1VMB A;  1X4B A;  1LWX A;  1ICE B;  3MR3 A;  3SSS A;  4RUH A;  1W2B R;  3ZTS A;  4DQS A;  3KG4 A;  5IM0 B;  1RWU A;  4JI4 F;  1RT2 A;  1FKP B;  4X4U A;  2FVP A;  2MDA A;  2H51 B;  2H5J B;  4ELU A;  2X51 A;  2MY7 A;  2E5J A;  2R7T A;  3R7S B;  4FF1 A;  2EKY A;  1XBW A;  2GX8 A;  2VZ9 A;  5J1N A;  3MEC B;  4ZPA A;  1JXV A;  3RU0 A;  2LDI A;  4A8S A;  5AXM A;  1SUQ B;  1S49 A;  4KE5 A;  2MKI A;  1JLB B;  3VAI A;  3IBF B;  2F8M A;  3D2W A;  4Y6I A;  4AYB D;  4Q5V A;  2CG8 A;  4J9U E;  4PYA A;  3TVZ A;  5HSP A;  3Q22 A;  5KFZ A;  4ZVG A;  3KHL A;  2R2T A;  1TU0 B;  4DR1 F;  3MAA A;  3OL7 A;  2JNJ A;  1QJH A;  2HBY B;  4TY9 A;  2LQB A;  4JI7 J;  3IM9 A;  4PQU B;  1TQL A;  1WF0 A;  3M8P A;  2V4Q A;  1U1M A;  3CWJ A;  3HMJ G;  4DFP A;  2BOP A;  2OEM A;  4USH A;  4FF4 A;  2DEJ A;  3CJS A;  1RBO B;  4H4K C;  1FKO B;  1YTY A;  1FHT A;  1HPZ B;  4Z37 A;  4RW4 B;  4J37 A;  1F9H A;  2B5J B;  2FD2 A;  4RWX A;  3D9B A;  1RHM B;  1Z1Z A;  2RQ4 A;  4ZJQ A;  4KHM A;  1U7L A;  1YK9 A;  2E5I A;  2G2Z A;  3V4M A;  2G13 A;  2WSC C;  1XC9 A;  3GFX A;  2DKO B;  2NZ4 A;  4KR0 B;  4Q2L A;  3EGV A;  2WVC A;  3ITH B;  2CZ9 A;  2VKZ G;  3SEO A;  4YHH J;  3ET6 B;  3CCE S;  3DRP B;  4LF2 A;  3TUI C;  1SKW A;  4RU2 A;  3CJ2 A;  1J27 A;  4IOB A;  4DX7 A;  1S6Q A;  4NXN J;  3O6Q A;  4ILM A;  2Y3Y A;  4OX8 A;  3FGV A;  4ZJL A;  2JJ4 D;  4ZVO B;  1OQ3 A;  5DZ7 A;  2YWF A;  2XS2 A;  1NDP A;  2B6A B;  3TX0 A;  2EXU A;  1S9G A;  1HQE B;  2JC1 A;  4NI2 A;  4DV6 F;  1ITP A;  2JVR A;  4ZOS A;  5DLG A;  3B8H A;  3RZA A;  4KRW A;  3K2Y A;  5T7L A;  1R31 A;  1SVD A;  4KGM A;  3MM7 B;  2ZD1 A;  4H4O B;  3BSA A;  3IXQ A;  2E7V A;  2ADB A;  1H3D A;  4K4X A;  2OPP A;  5HI7 A;  1GMW D;  3QSI A;  4NEZ A;  2OML A;  1S7H A;  1RTJ B;  4DR6 F;  2NXJ A;  2Y1J A;  4OX6 A;  3PNI A;  2CPI A;  2PC6 A;  2HFO A;  2V67 A;  1NHU A;  3PX6 A;  3CUN A;  4ECZ A;  2FLN A;  4OX9 J;  1VFJ A;  4J9R A;  1ZS6 A;  2BAN B;  2IJF A;  3N6N A;  3VGS A;  4QR1 A;  3HXM A;  1D8Y A;  3SFU A;  1WDT A;  1S7I A;  1OMS A;  3RAM A;  4Q0B A;  2K3K A;  1FE0 A;  5K9F A;  3ENW A;  2LXF A;  2HHX A;  3RG6 A;  3BM7 A;  1L3T A;  2G1H A;  1QTM A;  3OR2 B;  5KT3 A;  1U2C A;  2ALY B;  1K0V A;  5G0R B;  3RYL A;  1FJE B;  1XWL A;  4HVZ A;  3WBZ A;  2YNH A;  1HBM B;  3CJ3 A;  3P5T L;  3HUL A;  4TY8 A;  4C0B A;  2UXD F;  1X4G A;  3JAM Y;  3ILO A;  2WSF C;  3QNW B;  1RJJ A;  1IBL J;  3FCV A;  3CJ4 A;  1SJ4 P;  5HRO B;  3CJ8 A;  1RA6 A;  2OSR A;  3W5Y A;  3GYX B;  5ETL A;  1RTD A;  4MMO A;  3OXG A;  2HK3 A;  4ECX A;  2V8V A;  2LEC A;  4WKY A;  1N32 J;  1U02 A;  5KFW A;  4OFZ A;  1WF2 A;  2HPU A;  2Z57 B;  4DR7 J;  2ZHA A;  1VQ4 S;  2E1M C;  2JSX A;  4NLW A;  3VZH A;  2WAQ D;  2EFQ A;  4IFV B;  1E6V A;  4JV1 A;  2DHG A;  2DR7 A;  2W2M P;  2OFH X;  3GIK A;  3AT1 B;  3UDV A;  3TUP A;  2G1D A;  4DF4 A;  1OO0 B;  1TR0 A;  4FYD A;  2VD3 A;  2RDJ A;  2UUB F;  2MLZ A;  4EBE A;  5J2Q B;  4QYZ K;  4J80 A;  2NZC A;  3JSY A;  4LFC J;  4OYM A;  1SL1 A;  2CRL A;  2N82 B;  2B3T B;  2D74 B;  4H4K A;  4TYA A;  1W25 A;  1FK9 A;  5KFY A;  3V6H A;  4ZCL A;  1PIE A;  3HFV A;  4WU2 A;  2RUS A;  1SXL A;  1S9F A;  3MM9 B;  2KXH A;  5E7O B;  4IFY B;  1IWA A;  5HLF B;  2J0W A;  4DUZ F;  3ZFV A;  3JTO A;  1X8D A;  5CYJ A;  3GSI A;  1VOM A;  1CQM A;  3MCM A;  3PW5 A;  4F4Y A;  5B0C A;  4TLQ A;  2M88 A;  1EZZ B;  4UQT A;  1RE1 B;  2VDI A;  2HNZ B;  1TMM A;  1Y5L B;  1IBK J;  2CDR B;  5IM0 A;  4JI1 J;  4Y28 C;  3EXC X;  1RAF B;  1LV5 A;  3CJ5 A;  1FJG J;  3PFO A;  3WX4 A;  1M5O C;  2R7O A;  3NGR A;  4HLB A;  4A8O A;  1KC8 T;  1WWH A;  4MKB A;  3M8R A;  1NBE B;  2I9S A;  4ELT A;  1MMD A;  1RT6 B;  1M5H A;  4O3Q A;  2UUA J;  4QPX A;  2IAJ B;  5AE1 A;  3SV4 A;  2IBK A;  1MN9 A;  2Q6C A;  5KG7 A;  1MG7 A;  2KHC A;  1Q8K A;  2XWX A;  4LRF A;  4CO1 A;  1B3T A;  4Y2C A;  1CS4 B;  1FE4 A;  2FZG B;  2FVS A;  4WE1 B;  5IZH A;  3HKZ D;  3DLE B;  3B4D A;  2GVD B;  2I1R A;  1N5Q A;  2CG4 A;  1J5O A;  3I6P A;  3PR4 A;  4PQU A;  1XR7 A;  2LVW A;  4ED8 A;  1FF2 A;  3KK2 B;  5I3U A;  1UPP A;  4URQ U;  1CC7 A;  2J5A A;  2FVC A;  1Z2L A;  1FTC A;  2RF2 B;  4USW A;  1Q8I A;  1U48 A;  5SUH A;  1FT8 A;  3FBE A;  4IO9 Q;  3MWB A;  5DGB A;  4PXC A;  1KVI A;  2N4D A;  4N7T A;  2E29 A;  3K7R A;  1Y00 A;  2KJV A;  2QYC A;  3U1L A;  2IPO B;  3VQS A;  4LFB F;  1WG4 A;  2G0C A;  3CDU A;  4FYY B;  3K5O A;  3BGF A;  2QLJ B;  1QAY A;  3KJN B;  1H74 A;  4NML A;  1QSY A;  2YWH A;  3FC9 A;  2R7U A;  3H2V E;  2RAQ A;  1KON A;  4B3M F;  1CQN A;  4OZ1 A;  1QLN A;  2W2O P;  3ET6 A;  4FVC A;  1YJV A;  5GAH I;  4I6Y A;  4K4U A;  2YTC A;  1SC1 B;  4BC7 A;  3MI7 X;  2CQ4 A;  3ZTO A;  5F8I A;  1HYS B;  5IT9 U;  2B6A A;  4GMK A;  2AJ1 A;  1HQE A;  3OR1 B;  5HVG A;  3FMW A;  4YN3 B;  2AZ1 A;  1VRT B;  5LXY A;  1D1U A;  1SC4 B;  1K1S A;  5G4D A;  5D3G A;  3AA9 A;  2ZNZ A;  3AOA A;  4M63 A;  4MIW A;  2LXI A;  4ZVH A;  4PCQ A;  4WFY A;  2W7P A;  3PIP Q;  2EC0 A;  2O1P A;  3TNV A;  2BM0 A;  4IDK A;  4X4T A;  3EZU A;  2KVQ E;  4ERD A;  1SQG A;  4F26 A;  3WQP A;  5L9X A;  1RTJ A;  2UUC F;  2MKC A;  1WEX A;  2W4D A;  3T5H A;  5DQH A;  5DG7 A;  4ID5 A;  3UDC A;  4C8M A;  4AND A;  2ZZM A;  2DPJ A;  2ACY A;  2V2V A;  2R42 A;  3P4U B;  1TVR A;  4H4M A;  4B17 A;  4UTG A;  4IRD A;  4ED0 A;  3JSM A;  4WF9 Q;  3TI0 A;  2EWH A;  4N56 A;  5DM7 Q;  3T1Y J;  4RBU A;  3VZI A;  4GVL A;  5KFA A;  4IO1 A;  1JXL A;  1D8Z A;  3PO4 A;  2DY1 A;  3TR5 A;  2LFV A;  2X1F A;  4R5P A;  4B3S F;  2WBR A;  2CWX A;  2FY1 A;  5KFR A;  3MFI A;  4P74 A;  1LNQ A;  1R8A A;  1P1T A;  3HZE A;  4HHH A;  1BLU A;  4P52 A;  2MY8 A;  4CLS A;  1WOP A;  4DV1 F;  2D41 A;  3G86 A;  1O0P A;  1K73 T;  3KFW X;  4YR2 A;  2OJ3 A;  1FVS A;  3AJ2 A;  1L3S A;  3R5J B;  3G8Q A;  4U9R A;  1SKU B;  2UZA A;  5CCL A;  1LWF B;  1P8G A;  1OSC A;  2ILY A;  1JIH A;  2BRK A;  4C11 A;  2HAF A;  1NME B;  5KG3 A;  2HFS A;  3DLG B;  3U02 A;  1L3K A;  3QWP A;  3M9M B;  3Q2T C;  1K44 A;  1NK8 A;  4C9D A;  3LGM A;  3NAI A;  2IHR 1;  3MDF A;  2HS3 A;  3CCW A;  4I6W A;  4OYP A;  1B7F A;  3JQM A;  1VGY A;  1X9W A;  2CPX A;  4UUW A;  5KFS A;  5C7P A;  1C4A A;  2XMW A;  2ZVI A;  4OZ5 A;  5AJ3 F;  2J8S A;  2MYF A;  1MU2 B;  2IRY A;  2NXE A;  2F4F A;  2CQ2 A;  1VIX A;  2UXC F;  1ZH5 A;  2N3O A;  3MUT P;  3RBZ A;  3KMS A;  3OFF A;  1B0T A;  1UWA A;  2U2F A;  4UW2 A;  5KFT A;  4ZVU B;  3JYT A;  4DV0 J;  4RUC A;  3K57 A;  2HEK A;  2XI3 A;  1UEV A;  3NXZ A;  2MSS A;  2B4U A;  4YFU A;  1XQI A;  1C2P A;  3MM9 A;  2GS8 A;  4B08 A;  2NQP A;  2EC2 A;  4IFY A;  3AAW B;  1HI0 P;  4DV2 J;  2OPS B;  3DOM B;  1CSJ A;  2MZT A;  3CVK A;  1C0T B;  4DUT A;  2WB4 A;  1WJ9 A;  3UPF A;  4P73 A;  2IYG A;  3PJX A;  3DLK A;  3VV2 B;  5EUH A;  4IKA A;  2B7B B;  2AYB A;  1N4L A;  2DNO A;  5C42 A;  2OSQ A;  4DR4 F;  2HHH J;  2HNZ A;  1HW8 A;  1VBX A;  2IRX A;  2M8D B;  4G6V B;  3V6D B;  3H25 A;  4DN0 A;  3AHP A;  4WK1 A;  2HYI B;  1Z2Z A;  1IKV A;  2CUY A;  3CME S;  2AMC B;  3BJY A;  2A3J A;  1HNW J;  3DKD A;  3NS7 B;  4LUB A;  4YME A;  2AJF E;  1SC6 A;  1G6B A;  4NZ0 A;  1AA1 B;  2YNF B;  4P7V A;  3RRK A;  1HAR A;  2C2O B;  1GMU A;  1BC6 A;  1Y10 A;  1FRK A;  3WC0 A;  3P8B B;  3C66 A;  1S48 A;  1MRO A;  2IAJ A;  3QJL A;  1NM2 A;  4CLP A;  2VDH A;  1FFW B;  2OD6 A;  4HHJ A;  4P2S A;  4EFA C;  4FF2 A;  3G96 A;  4DV5 J;  3DLE A;  1Q53 A;  1PBA A;  4CIO A;  2MKK A;  3NOG A;  2CQG A;  4F0M A;  3BQ2 A;  2R8I A;  3R8Y A;  1U25 A;  1YDL A;  2ZZN A;  5D4O A;  1FXR A;  2XS7 A;  1RBL A;  1S0M A;  2BMB A;  1S0O A;  3D4J A;  2YBV A;  1FI4 A;  2DCU B;  4AQY J;  1TK5 A;  4NOH A;  1TUV A;  3O44 A;  3MHY A;  1FRH A;  1S79 A;  2NPI A;  5K8M A;  2HFU A;  5IQ6 A;  1HWJ A;  1PJ6 A;  4NXM J;  1ZET A;  3PXG a;  3QZ8 A;  3VGV A;  5GVQ A;  2X3G A;  4KH0 B;  1TUW A;  3V81 B;  1TK0 A;  2M3D A;  3MR6 A;  2IMW P;  2EBG A;  4UF4 A;  3DM2 B;  1C0U B;  4PXB A;  4P71 A;  3HHL B;  2R7X A;  4MK8 A;  4EGL A;  5F3T A;  4A48 A;  3C6U B;  1JKH A;  3QIP B;  3MOZ A;  2PMH A;  2XMU A;  3KJQ B;  4LF6 F;  3AOC A;  2IVF B;  3MMC A;  4RUB A;  2B9E A;  2HMI A;  1H2U X;  2MHE A;  1VRT A;  4WYL A;  1DLO B;  2COL A;  2WTF A;  4QWA A;  4IG0 B;  1D9F A;  4JI8 J;  2VBZ A;  2HVD A;  1RHR B;  2AQ4 A;  3MM6 B;  1U1O A;  3KNG A;  1SJR A;  5DM6 Q;  3FFI B;  2JL9 A;  4OX7 A;  4LRA A;  4E2F B;  1NK5 A;  2VV5 A;  1CJT B;  1MMN A;  2EG1 A;  3DU5 A;  3MMJ A;  7FD1 A;  5KFN A;  3NEK A;  4P9S A;  4YB5 A;  2HQC A;  3D1O A;  5ETS A;  2HBQ B;  3N6L A;  4M1K A;  2WVE A;  3IG1 B;  4XAK A;  1GMW A;  4FXW A;  3RTV A;  3CF5 Q;  3OTE A;  3EPG A;  4C8K A;  2VB6 A;  4CP5 A;  2EG2 A;  4U7U K;  2ZH9 A;  4NCG B;  4J7C A;  2VAS A;  1ZA2 B;  3R97 A;  1IKY B;  3D54 A;  2D9O A;  3NAH A;  2HVZ A;  4IRC A;  4P10 A;  4FKY A;  3NGK A;  2GHW A;  1HQ2 A;  1QD1 A;  3TVK A;  3IR5 B;  1MSW D;  4PUO B;  4U95 A;  3US5 A;  2XY6 A;  1VQM S;  9ATC B;  1TMJ A;  4Y00 A;  1UWB B;  4LT6 A;  3CDA A;  4YEA A;  3LGN A;  1U26 A;  3UVJ B;  3CXC R;  4MIB A;  5HAT A;  1LXN A;  3U1M A;  3MAQ A;  6FDR A;  4MFB B;  4OI6 A;  3NGD A;  2B4P A;  2GVZ B;  2ILZ A;  5ETM A;  1NJY A;  1HR0 J;  2QL7 B;  3T1H J;  4RW8 B;  3UNG C;  1T05 B;  2EFG A;  3MXH P;  1LWF A;  1C1B A;  3THV A;  5H9F K;  2OUG A;  2J6T A;  2E1R A;  1U09 A;  1BE4 A;  4KC5 A;  4X2B A;  2F63 A;  4OHV A;  4JI7 F;  5L46 A;  3NG8 A;  1F9E B;  2C42 A;  2RUG A;  1FER A;  2XCP A;  3N5F A;  1OY8 A;  3ZZP A;  3HK2 A;  2DHX A;  1KHW A;  1RYS A;  3FRY A;  1U1N A;  2HLT A;  3M4X A;  3CCL S;  1MNE A;  2B8Q A;  2UVR A;  1EB0 A;  3DC2 A;  3D6F B;  2E1C A;  5A6P A;  3N79 A;  5JJB A;  4UUX A;  2N3L A;  2KG1 A;  3A8J A;  1UPM B;  3GON A;  2B4V A;  3IBC B;  4KQZ A;  1U45 A;  1IBM J;  2VBY A;  4EBD A;  1VC0 A;  1RAI B;  4ECY A;  3P45 B;  3KUG A;  2X1A A;  3OFG A;  2GAG C;  3CE8 A;  3Q89 A;  1T3O A;  5CZX A;  1EQM A;  2YKM A;  1AXQ A;  1H2T Z;  3OVS A;  2XTJ P;  2HWT A;  4RBT A;  4WIQ A;  4IR9 A;  3NKY A;  1C3G A;  3I5B A;  1Y9O A;  2OEL A;  3ONQ A;  4FNI A;  4CTA B;  4YHH F;  2PEH A;  1NHV A;  4EUV A;  4U7C A;  2P6S A;  4QWB A;  1NLK L;  4RL1 A;  2K1R A;  2I0X A;  3FSI A;  4NXN F;  2OPS A;  3DOM A;  1U2F A;  2I8E A;  2CVI A;  1TL1 A;  1KVJ A;  3RB6 A;  2AF6 A;  1C0T A;  1EAR A;  1UFL A;  4NLU A;  1YRX A;  3W5Z A;  2RQC A;  3KK3 B;  4I4B A;  3K8V A;  3DGV A;  3BPD A;  2YVS A;  2KVI A;  3CJQ A;  1FKA F;  3M8W A;  1D09 B;  5B7W A;  3V6D A;  3OFE A;  1RLC L;  3TJA A;  5L9N A;  1T94 A;  3GP9 A;  3VF0 B;  4HH0 A;  2VPZ B;  2DRA A;  4HHU A;  2DXF A;  2YNF A;  1RT7 B;  2NXN A;  2W8K A;  3NNA A;  3DN9 A;  3TAM B;  2FJD B;  3C8Y A;  2E5L J;  1WI6 A;  2DNG A;  2AKW B;  3D0I E;  3LP1 B;  2BA9 A;  3LA0 A;  5KOX A;  1MWY A;  5A2Q U;  1WTB A;  4QIG A;  4CM0 A;  1BY9 A;  1U8S A;  2BJ1 A;  3HHD A;  2YY3 A;  1KLM B;  3EE3 A;  3VAJ A;  4OX9 F;  2WVF A;  2EBE A;  2PII A;  2KTQ A;  4LSL A;  4PWU A;  5IV4 A;  2DH8 A;  4KGX B;  2WON B;  4C3M A;  1HBU B;  1SJ1 A;  2HQG A;  3EUN A;  5FJ4 A;  2XLK A;  5AXL A;  4MH8 A;  2H9Z A;  1M1H A;  4KHP J;  4MAK A;  3ZXW A;  1LFP A;  3CCT A;  2A1B A;  4EO8 A;  3S7R A;  3LGH A;  5EX3 A;  5THW A;  2Z30 B;  2XQC A;  2XGP A;  3IWX A;  4KPY A;  4Y2I A;  3HSZ A;  4NL5 A;  1RXO B;  4ZMM A;  2IA6 A;  4X65 J;  4LMZ A;  3P96 A;  3B4M A;  2IC3 A;  3W5X A;  3A3P B;  4TU7 A;  3PR5 B;  3KLG B;  2C3M A;  5E3Q A;  1IBL F;  4DUY J;  3V81 A;  3D0G E;  4CLL A;  1S1U A;  1LQ9 A;  3DRS B;  1ZA1 B;  4USK A;  3AOD A;  3I9V 9;  3R5B A;  4DHV A;  3DM2 A;  5KG0 A;  1C0U A;  2VPW B;  2GHP A;  2KZZ A;  4G1Q B;  5K8N A;  3BYP A;  5A8R A;  3CIM A;  5KT5 A;  1N32 F;  1T95 A;  3FEY B;  4DR7 F;  1UFK A;  2DNH A;  4RPF A;  2C2K B;  5B0D A;  1U2R A;  2GML A;  2IM3 A;  3QLH B;  4WP3 A;  2VPY B;  1LW0 A;  4PXD A;  3PDN A;  2OGU A;  2QV6 A;  4NA2 A;  5CA5 A;  2DR9 A;  2G0J A;  3V6K A;  2NXC A;  2XSJ B;  1CBK A;  2YH1 A;  4IG0 A;  4ALZ A;  2IMO A;  1YHQ S;  4LFC F;  1K47 A;  1H7W A;  1TTH B;  3MM6 A;  5CH7 B;  1R6Y A;  3POT B;  4FYW B;  1JX4 A;  2GCF A;  4XO0 A;  3M32 B;  4OJG A;  2Y8W A;  1EKR A;  1SIZ A;  2XYH B;  3C14 A;  3KMQ A;  1UMJ A;  2DH7 A;  2RU9 A;  5KFM A;  4DG1 B;  4L6V 3;  3IG1 A;  5E0O A;  5HQL A;  4ZPT R;  1HNI A;  2DNK A;  3I56 S;  4X4V A;  4QR0 A;  2FGC A;  1N0V C;  1IKY A;  3SDE B;  3VQT A;  5BYQ A;  3AKO B;  1JLC A;  1IWG A;  2FIU A;  3DGP B;  3PIO Q;  1IBK F;  2BM1 A;  2CJ9 A;  3MTJ A;  4JI1 F;  1X4E A;  1A0O B;  1FNM A;  1FJG F;  2QSF A;  1SIW B;  3KLI A;  3MF5 A;  3EZO A;  2DHS A;  1W7W A;  1UWB A;  5HJX A;  3LWL A;  1F2H A;  1T03 A;  1PO6 A;  1S1W B;  3CW2 C;  3OPK A;  1CJK B;  3KHG A;  5L1I A;  1ZTT A;  3K5N A;  5CYQ B;  3KWM A;  2YKO A;  2QMX A;  3FEX B;  1N34 J;  3GCX P;  2UUA F;  4NZ6 A;  1YX2 A;  4TNO A;  2AWZ A;  3JQK A;  1U0H A;  3J81 j;  2DNP A;  3G4S S;  2ZOG A;  1YBA A;  2QLX A;  3LUY A;  1T05 A;  5ITH A;  1LK5 A;  3CGI A;  2F8E X;  2GW8 A;  1UZH A;  4ED3 A;  3EX7 B;  1JWW A;  4OLP A;  3R2C J;  2BW7 A;  3I0S B;  4DR2 J;  4GVB A;  2PSZ A;  5KFI A;  5C2C A;  1M90 T;  3GPA A;  3QGI A;  1LW2 B;  1UJ5 A;  1E6Y A;  2H4Y B;  3QAT A;  5KT2 A;  3EWG A;  1RB0 A;  3NL0 A;  1X5O A;  1WSR A;  1HL6 A;  4LRC A;  1KQK A;  4A8M P;  5CQG A;  1Y3J A;  2GGP A;  4GC6 A;  4Q45 A;  3D68 A;  3GU0 A;  5LXR A;  3MR5 A;  1FJC A;  4XIU A;  3RB0 A;  1WD6 A;  3T6B A;  4KGZ B;  3EGZ A;  3G82 B;  2RHQ B;  3MCS A;  1IKX A;  1SKS A;  1DFD A;  1NK0 A;  4DPY A;  1HHQ A;  3HO1 A;  2FHO B;  2ZJR Q;  2HGM A;  1QVF R;  1RGV A;  1WUU A;  1RT4 A;  3GYN A;  4ZJO A;  4DPO A;  4F2R A;  2HZA A;  2Z2L A;  3W65 A;  2R7Q A;  2PD1 A;  3CPW R;  5LMU J;  1IM4 A;  1CC8 A;  3SQG A;  4RUA A;  5LMN J;  3WX8 A;  3SFG A;  3W7B A;  4P6Q A;  4O3N A;  2G0I A;  5E41 A;  2C3U A;  3OT9 A;  1TL3 B;  4LF4 J;  3NWG A;  2HVI A;  1Y5I B;  3I87 A;  4OI3 A;  4HL9 A;  3G8T A;  2LYV A;  1YZ6 A;  1VI7 A;  3A8K A;  2MLY A;  3I38 A;  2KN4 A;  3TZX A;  2VHG A;  2KFZ A;  3BH7 B;  2HHP A;  2V94 A;  3NGU A;  3H59 A;  1OYD A;  5GMD A;  1ULR A;  3TA0 A;  3BSC A;  1QE1 B;  1BUX A;  4RNH A;  4EYI B;  3B78 A;  2C2Z B;  4WFN Q;  3Q8U A;  4N77 A;  2QFJ A;  2QGF B;  3LP1 A;  3U1N A;  1JLF A;  1SL2 A;  2J9D E;  1GTE A;  3SSR A;  4DFJ A;  1NJW A;  2C2N A;  2XZW A;  4BC9 A;  1GTH A;  2NYI A;  2V50 A;  5D0E A;  2AX1 A;  4YP3 A;  1YJN S;  2LA4 A;  1N54 B;  3T1Y F;  4ELV A;  1RTZ A;  3QRQ A;  2XY5 A;  1DJ0 A;  4QQB A;  5K14 B;  1HBO A;  1RAB B;  3FK4 A;  3VAK A;  3DOL B;  3PX4 A;  3HD1 A;  1UKU A;  3QGH A;  3DDN A;  3RW6 A;  1KOH A;  3DYA B;  3DCA A;  2EEY A;  1GXL A;  4AT1 B;  1CLF A;  5ETT A;  5F8M A;  1O6X A;  2DIV A;  1N8R T;  3TEG A;  1L3U A;  1P9Q C;  5IXU A;  3C16 B;  1X4A A;  2ZH1 A;  3A3N B;  1Q82 T;  5EWG A;  2R4F A;  1S1V B;  2P9G A;  5DJB A;  2M5Y A;  1KOO A;  2GC8 A;  1U6F A;  1A7G E;  2E44 A;  1EET B;  3HHN B;  2ROP A;  3TUJ C;  2BR0 A;  3C6T A;  4A4J A;  1N5T A;  1T9Y A;  1Y11 A;  1NPR A;  1N6Q A;  1Q1K A;  4AL7 A;  2CPF A;  2JLF A;  4PZV A;  3W2W B;  3BF4 A;  4KHR A;  2R8K A;  1HMV B;  1H72 C;  2HGL A;  1QDU B;  1R8C A;  1RIS A;  4WFZ A;  3HDS A;  1FFS B;  3FBF A;  1JLE B;  1GFW B;  3K17 A;  1HI1 A;  1F60 B;  1L5U A;  4PEO A;  4DZD A;  1FTR A;  4K7Q A;  4W90 B;  4WPA A;  3TQ1 A;  5B0G A;  4AUK A;  1RT3 B;  3UD5 A;  4XK8 C;  4X4O A;  2AJQ A;  5HQ8 A;  4Q7A A;  2M4M A;  2L41 A;  2VH7 A;  2CKW A;  3SMZ A;  3PCO B;  3POT A;  3DOK B;  4U67 Q;  1R89 A;  1NH8 A;  4DV0 F;  1AT1 B;  3LP0 B;  4PPZ A;  4IH6 A;  4K8R A;  2EFV A;  4N76 A;  1PC4 A;  1EP4 B;  2QLB B;  1CPZ A;  4DV2 F;  4QIF A;  4OZ0 A;  4DL3 A;  2UXB J;  2JEJ A;  3MZI A;  4KV8 B;  1U1Q A;  3M6X A;  1B70 B;  1FX2 A;  3NY0 A;  3FMB A;  4J91 A;  3CB4 A;  3KG0 A;  2HHH F;  5C5J A;  4B3M J;  3TJ9 A;  3LOU A;  3SV3 A;  4OYB A;  4NLT A;  4X62 J;  1WOO A;  4O4G B;  3DMJ B;  1HNW F;  4UT4 A;  1YJ9 S;  2G9O A;  2J7W A;  2VFR A;  2GIQ A;  1APS A;  2ZH6 A;  2Q2G A;  5CYQ A;  2CNL B;  4X64 J;  5AT1 B;  1MML A;  1ROF A;  2QEX S;  2OTJ S;  2D3U A;  3H5S A;  2DR8 A;  2V4J B;  3MD3 A;  4J9L A;  3BKU A;  1ZYQ A;  2VKR A;  1BWE A;  2YQ0 A;  3QPI A;  2ZH3 A;  3K58 A;  2FJV A;  4DV5 F;  3WC2 A;  5L38 A;  1ZM3 A;  3X3U A;  5J1E A;  3L7U A;  1NSA A;  4O3R A;  2IM1 A;  1FXL A;  1RQ0 A;  1WF1 A;  3GJR B;  2GIF A;  6AT1 B;  3R6G B;  1TKD A;  4I2P A;  4DL0 C;  2AEM A;  1AUD A;  2WRM A;  2CNK B;  2FZC B;  4WII A;  1EKS A;  1XNQ J;  1X7V A;  3OQ2 A;  4AQY F;  1SL0 A;  5GAG I;  2RIJ A;  1RWM B;  2JEI A;  2AX0 A;  1Q79 A;  3P49 B;  2ZC3 A;  4ZPB A;  3GIR A;  4ECQ A;  2K7K A;  4NXM F;  2DT9 A;  1QUP A;  4DR5 J;  3W60 A;  3IS9 A;  5EWF A;  1BQX A;  3HD2 A;  4RW6 A;  1LWE B;  1F1B B;  2QL9 B;  5BYR A;  1KFS A;  1IR0 A;  3IM8 A;  3PM9 A;  1XER A;  4HEA 9;  1NK9 A;  5IS2 A;  3B6B A;  2WW8 A;  3DI6 A;  4PPD A;  3O5T B;  3M30 B;  4WCE Q;  2XMT A;  3G6X A;  4B9T A;  2WW4 A;  2LEB A;  4NYO A;  3G6Y A;  4F02 A;  2DCL A;  3S8S A;  3PHT A;  3EVO A;  4AXJ A;  4K50 A;  1U1K A;  3BH6 B;  2AJ0 A;  2DO4 A;  2IVM A;  2AP6 A;  1N52 B;  1TL3 A;  3THP A;  1GH8 A;  5A8W B;  4UZB A;  4JI8 F;  3KTQ A;  2VUG A;  4CQ1 A;  2QA4 G;  2MXY A;  5HQM A;  1GXU A;  4HDH A;  1VQL S;  3MED A;  1DQA A;  2FHK A;  1K1Q A;  4GKJ J;  4CH7 A;  4E98 A;  2W4C A;  1RHU B;  5DDP C;  4F4A A;  4K2J A;  4M94 A;  1TL7 B;  4C48 A;  2JC0 A;  2WB1 D;  1VQS A;  2HIQ A;  1K0T A;  1S99 A;  3FRZ A;  4M5H A;  5EHH A;  1S0N A;  3OXL A;  2V0N A;  4FN5 A;  2VOP A;  4WFB Q;  1BWV A;  1WC5 A;  2XYG B;  3DLB A;  3QJP A;  2DNR A;  3RB4 A;  2ZBR A;  4XDC A;  5C24 B;  4FXV A;  4NWB A;  5BJR A;  4OI1 A;  2ZWP A;  5K14 A;  2IYI A;  3M6W A;  4I2Q A;  1DZ5 A;  1T9W A;  3MD1 A;  4OHX A;  3UN2 A;  1LK7 A;  3OTB A;  4B9M A;  3PYF A;  2B4O A;  3D6T B;  3SCK E;  1GX6 A;  4OZJ A;  2BJ9 A;  1F3V A;  3MOJ B;  3UNY A;  1KBR A;  3MMA B;  2ZH8 A;  3VGT A;  3DDK A;  3G8S A;  3N4W A;  1VC5 A;  1HR0 F;  1KEK A;  2CZV C;  3T1H F;  4RW9 B;  1U49 A;  3MM8 A;  1Q86 T;  4LSZ B;  2ZFH A;  2XS5 A;  3FZB A;  1T3N A;  2RE1 A;  3FBC A;  3NCP A;  3TVY A;  4FF3 A;  2VG7 A;  5J1P A;  2MQ8 A;  3TX8 A;  1QAJ A;  3H5Y A;  1S9E B;  4KH1 B;  2V2Q A;  3CMA S;  4CLW A;  3MEE A;  1JNZ B;  2FJA B;  4CCH A;  2L9D A;  2IVY A;  1HQU A;  2RH3 A;  3W2W A;  2GJ2 A;  2YNI B;  4LJM A;  1X5P A;  3A12 A;  5H9E K;  3ETM A;  3CIZ A;  3OUY A;  5I42 B;  4CDI A;  3GG1 A;  2B56 A;  5AE3 A;  1YIJ S;  1M0S A;  1FDA A;  2MZR A;  1I5O B;  2MZ1 A;  4DMZ A;  4MKY A;  1IBM F;  4KFB B;  1NK6 A;  5HP1 A;  2NUU G;  2WK4 A;  1WC1 A;  2DGW A;  5D4N A;  4WTY A;  3VVU A;  2YKP A;  3CD0 A;  2W2P P;  2DNZ A;  5K20 B;  1P1L A;  2BBE A;  4CM2 A;  4DF8 A;  3HLU A;  2ZE2 A;  3JTN A;  3D5M A;  2BE7 D;  1FFG B;  2AIR B;  3LP0 A;  4USI A;  4FYV B;  3VTI A;  1SBR A;  3M2V B;  3GR0 A;  2FY8 A;  1JJH A;  2VG6 B;  2CPE A;  4F3O A;  4ZN1 A;  1X4H A;  3TAP A;  4IQM A;  4M5N A;  1WNE A;  3BO2 A;  4KV8 A;  2YQ1 A;  3TA1 A;  1JJ4 A;  3IWL A;  2V5H G;  3TZZ A;  5J2N A;  4DLG A;  2OEJ A;  4WZM A;  2GO9 A;  2KI2 A;  4LVN P;  1V5I B;  3Q0A A;  3RUB L;  2AHO B;  1REV A;  4O4G A;  3H20 A;  4OYW A;  5DQI A;  3BN4 A;  4DQR A;  2HND B;  2D69 A;  4HH1 A;  4L3N A;  2W2N P;  3KJF B;  2FVR A;  2E5L F;  1RDR A;  3BPS P;  4HAC B;  4ZPC A;  1FRJ A;  2KYX A;  3DLH A;  2E7X A;  4NLY A;  2Q1L A;  2ZHB A;  2ZBQ A;  3KLH A;  4KKO B;  3K5L A;  3ILL A;  5J2P B;  3T5L A;  1SQF A;  4L72 B;  3QYY A;  3MPV A;  4KGV B;  1SPB P;  3DRR A;  2AEF A;  3HZG A;  1R8P A;  5HMZ A;  4M8L A;  2AGP A;  3S1T A;  3UO0 A;  1QAX A;  2XEX A;  5LJ5 Y;  2PA3 A;  4JV0 A;  2FJX A;  5B0F A;  2R7W A;  3OTO J;  4E0D A;  1SCJ B;  3AXK A;  3IRX A;  4AFF A;  2V8D A;  4ZK7 M;  4DU7 A;  1FVQ A;  2CQ1 A;  4RJV A;  1D0E A;  3R1L A;  1RT5 B;  2DGT A;  4X65 F;  2FLL A;  3HPO A;  1RTH B;  4LSN B;  1RAO A;  2DGO A;  4CYU B;  4DUY F;  3N28 A;  3CSK A;  2CJK A;  1IUJ A;  2RD5 C;  3PRB A;  4GRS A;  3IA0 A;  2GJI A;  2KM8 C;  2HRT A;  1CJV B;  2HG4 A;  1WEZ A;  1RT1 B;  2RS8 A;  3SYZ A;  4F4Z A;  1F6T A;  2QMU B;  1OY9 A;  3M8Q B;  2WCX A;  5J2M B;  2DIS A;  2ASJ A;  3PY8 A;  3CCJ S;  1P6T A;  2XMK A;  3V4I B;  2N7C A;  2MKY A;  4DEZ A;  4Y2K A;  1VC6 A;  1IQZ A;  2RJZ A;  3CJK B;  2H5E A;  4F8R A;  1YBT A;  5E33 A;  1UVM A;  4A47 A;  2VFT A;  4FZV A;  4AXI A;  2QC3 A;  5DG8 A;  4MTP A;  3MCN A;  3T6J A;  3GMG A;  3M1V A;  1RHJ B;  3IGV A;  5A2Q Y;  3R27 A;  4LF1 A;  1R27 B;  3T41 A;  2OI2 A;  1TKT B;  4KTQ A;  4Q43 A;  5DRK A;  3S01 A;  5F8G A;  3MPY A;  3K8W A;  1RHK B;  3MTK A;  4QCL A;  1U6Z A;  4C6A A;  1S0V A;  1FD8 A;  4IG3 A;  2B9X A;  1TL7 A;  5D8H B;  4OI2 A;  3J7A N;  2ZH4 A;  1OQ6 A;  4K4T A;  3PEJ A;  3KKF A;  1X9M A;  4JI3 J;  1HIY A;  3NWR A;  4USU A;  3MUM P;  4WZQ A;  4KBI A;  4DN9 A;  2I38 A;  5E3R A;  1KFD A;  5MAO A;  2XO7 A;  3BB5 A;  1TKX A;  2W9B B;  1JLQ A;  2G2Y A;  2PMW A;  4ICL A;  1TV6 B;  2O3D A;  3GV5 B;  4I7F B;  1NAQ A;  3I9Z A;  5KFH A;  5KFV A;  1VCT A;  2BAB A;  4QBU A;  3DU6 A;  1XMQ J;  3PFE A;  4PKD B;  1LWC A;  5KFB A;  3F44 A;  3Q8Q B;  3RAX A;  1N34 F;  4J9S A;  3D0H E;  3MMA A;  1I94 F;  3LH2 S;  2HIY A;  4MJK A;  4CLY A;  2KT5 A;  2XGQ A;  2IM0 A;  1VHF A;  3AOB A;  3LP2 B;  3LAN A;  4WU3 A;  4NLO A;  4DR2 F;  2Z56 B;  2V8P A;  2F7V A;  5DZ6 A;  2QT7 A;  1S9E A;  2ZH5 A;  4C8N A;  1T8E A;  4DX8 H;  1KHV A;  1JK9 B;  2Z0G A;  5F3Z A;  5CZV A;  1S12 A;  1NDK A;  3A8E A;  1S5Z A;  2I5J A;  2C2R A;  3BQ0 A;  3R1H A;  3M9N B;  5BXI A;  4ZN3 A;  2HWH A;  1NHK L;  2XWY A;  3JB9 k;  4YQW A;  3QO9 B;  1FWL A;  1HBN A;  1BQN B;  1VYA A;  1WEL A;  3QT7 A;  2D3O R;  2KT2 A;  1VQP S;  3MCO A;  2K2P A;  4DOZ A;  2EFO A;  4DCP B;  4C8Z A;  4ED5 A;  1JJC B;  4ZS6 A;  2QIF A;  3BKF A;  5KG5 A;  3UCG A;  2PE8 A;  4LQ3 A;  5HBM A;  2DTJ A;  2QMW A;  2V6A A;  2JRR A;  4ZP9 A;  2B26 A;  1Y7P A;  1M5K C;  5K8O A;  4NLQ A;  4ZHR B;  2HHV A;  4LF7 J;  5LMU F;  1X31 C;  2K3I A;  3UCZ P;  4ECR A;  4Y3C A;  4ZVT B;  1F2G A;  3FDS A;  3M2V A;  1Q5Y A;  1TAQ A;  2JOQ A;  5D6G A;  2YKN B;  1DTT B;  1Y0H A;  1S6O A;  4IYQ A;  5LMN F;  3TW0 A;  4RNN A;  2HNY A;  4O44 A;  4YOE A;  1RBA A;  5KT6 A;  2QE5 A;  4U96 A;  3HVT A;  4B3O B;  4FXD A;  4ETZ A;  2VFU A;  4LF4 F;  2LU1 A;  1ZBT A;  4MKV A;  4M5D B;  3M6V A;  2HZC A;  3IFE A;  2OP5 A;  1HD1 A;  3PVX A;  3TP2 A;  2V68 A;  2OMO A;  2VQE J;  4HT7 A;  3HVA A;  1XJW B;  4XPC A;  2BE2 A;  4ZCI A;  1WKL A;  2D7S A;  1ZOT A;  2QLD A;  4U8Y A;  4JI2 J;  3ADA C;  5LOQ A;  4USM A;  1DUR A;  1TEL A;  2P9C A;  1X5T A;  2HQ3 A;  3GQC A;  1CUL B;  3BGR B;  3GCW P;  1BXN A;  2BEF A;  3QSY B;  2J0S D;  2UV8 A;  4DSK A;  4KYZ A;  3MEG B;  3KLV A;  1RWO B;  3IN5 A;  1VQ9 S;  4KKO A;  2OFG X;  4DDF A;  3FKB A;  3BBB A;  1IKW B;  3IBW A;  1MN7 A;  1DRZ A;  4UST A;  2DBB A;  3MR7 A;  2EW9 A;  1S1X A;  4ES2 A;  1X5S A;  3NBP B;  2OKQ A;  2LKZ A;  2RQK A;  4TU9 A;  2MGZ B;  2PDA A;  3NP5 A;  2OHD A;  2CPH A;  1Z4U A;  1G1X A;  1TL4 A;  1NJZ A;  1DTQ B;  3CCR S;  2AJ2 A;  4A8K A;  4TU8 A;  4QU7 A;  1NDL A;  1RT5 A;  1FKP A;  2KT3 A;  1HWU A;  3K59 A;  4KJI A;  1RTH A;  5B0A A;  4CO5 A;  1X4D A;  4NLX A;  3M2U B;  3Q2S C;  3R7B B;  1UEK A;  1V9O A;  4CYU A;  3UDE A;  5GAH U;  3C15 B;  1FRL A;  3MEC A;  5EX0 A;  4KIA A;  2JFK A;  4K59 A;  1CJV A;  2WOM B;  2MJN A;  1SUQ A;  1X4F A;  5FLX U;  2DK2 A;  4AL6 A;  3CED A;  1JLB A;  4B9S A;  1C1C B;  2K8G A;  5L1K A;  2HKE A;  2RU3 A;  4NEY A;  1FWP A;  5GAE I;  3IO1 A;  3BZQ A;  3E01 B;  4NRU A;  4FPR A;  5B0E A;  2EK6 A;  4KGK A;  1EJ7 L;  3V4I A;  2Y0S D;  3H8Y A;  1DY3 A;  2MST A;  2A10 A;  4B9L A;  2UVU A;  1VQ7 S;  3CD5 A;  3TYT A;  2CWK A;  2HFV A;  3DXB A;  2HSE B;  2YX1 A;  3KUE A;  4DQP A;  2W9A A;  4X4N A;  3LAK A;  4F04 B;  1NLT A;  1JLA B;  1FKO A;  1FES A;  2AEJ A;  1HPZ A;  5LSL A;  4RW4 A;  2B5J A;  4G3I A;  2J6U A;  5GMK a;  4E8U A;  1FNO A;  2JLG A;  3QJJ A;  2UVV A;  3FQL A;  4YDD B;  1KR4 A;  2YWK A;  2VJU A;  1X4C A;  2UXB F;  3JS9 A;  2E7W A;  1RT2 B;  1IXK A;  2FC9 A;  2B0G A;  3IAM 9;  2ZOM A;  5IOL A;  4V19 X;  3HHL D;  4WP9 A;  1R0B G;  1N56 A;  4DL7 A;  2P6T A;  1HHT P;  3ITH A;  4ZCK A;  1XMB A;  4IH7 A;  4A8W A;  2HRY A;  5A8K B;  4LIW A;  2W9B A;  3C5X C;  4X62 F;  3DRP A;  2CJA A;  4PG6 A;  2IRU A;  4ZVR B;  2GV1 A;  5KFQ A;  2DGS A;  2WSE C;  3ETO A;  1YJ7 A;  3H7H B;  3HSJ A;  3NMA A;  1JLG B;  4DV4 J;  1REG X;  5D4P A;  1WHV A;  3VHQ A;  4X64 F;  3RR7 A;  3FCH A;  2MQP A;  4OZ3 A;  2I2Y A;  1ZPV A;  5HJY A;  3LO3 A;  2DRD A;  3Q8Y A;  1U1R A;  2A2D A;  3OSN A;  2Q6B A;  3J7Y I;  1YG0 A;  2HBZ B;  1IVZ A;  3M8P B;  5K8P A;  1XAO A;  2VJV A;  3LP2 A;  1I51 B;  3GE9 A;  3MM7 A;  4H4O A;  2O5D A;  3A8I A;  4ZIW A;  4IH5 A;  1P9Y A;  2DGX A;  1F5A A;  3NOC A;  1VQ8 S;  3E51 A;  3OTD A;  1ELO A;  1S4E A;  3Q8S B;  3PW7 A;  3TAR A;  1UVL A;  4FBT A;  1RTI B;  3B82 A;  1XTZ A;  3EPI A;  1XNQ F;  2KH9 A;  2HFN A;  2BAN A;  2KZM A;  4HTJ A;  3JXO A;  4OJ1 A;  4J9O A;  2M7S A;  2GQC A;  3BGL A;  4G1P A;  3Q86 A;  3KDO A;  3LW5 C;  1WHW A;  4DR5 F;  5DO2 A;  5C25 B;  3NMR A;  5DQG A;  4J5O A;  1WC6 A;  4ECU A;  3M6U A;  3OR2 A;  4PAA A;  3OFH A;  2GA7 A;  1SH3 A;  3GR1 A;  1S6Q B;  5G0R A;  1DAX A;  2QYG A;  1RAD B;  2V69 A;  3DHW C;  2D3O 1;  5D15 A;  2NXU A;  2OPR B;  1HBM A;  1RUS A;  4JOU A;  3UI3 A;  1DHM A;  1DTT A;  2RNE A;  2FHJ D;  2W1B A;  2ODX A;  4NI2 B;  1B0V A;  3AGZ A;  1KQS R;  5KG1 A;  2FC8 A;  5GAD I;  2YNG B;  1NK7 A;  2DEI A;  3IGN A;  4DX6 A;  2GHV C;  4B3O A;  2CJX B;  5HRO A;  3VGU A;  5T7L B;  2E9R X;  3W63 A;  3V5R A;  2RDI A;  1JMT A;  2ZD1 B;  1AFJ A;  4YS2 A;  4QPT A;  5KAK A;  1T7P A;  4FS1 A;  2FGO A;  2OPP B;  4P2F A;  4PRF A;  4LF9 J;  3BRE A;  2YX4 A;  3R5D A;  1G7C B;  1T11 A;  1GK8 A;  4GKJ F;  3RR8 A;  2HHQ A;  4IFV A;  2ZBC A;  5IC4 B;  3RRG A;  4J9P A;  4IR1 A;  2A6O A;  3FJ2 A;  3AA8 A;  1SH0 A;  4PQA A;  1I3O B;  2MKH A;  4F50 A;  4DPX A;  1IN0 A;  4QZV B;  4ZLJ A;  1D3W A;  5J2Q A;  4ITS A;  2QO3 A;  4USV A;  2NS1 B;  1K8A T;  2XMV A;  3RAQ A;  5U47 A;  4Q0B B;  3OL9 A;  3T5J A;  4CH1 A;  1CJU B;  2FVQ A;  2ZJQ Q;  1RAJ A;  2O67 A;  1WHY A;  2CQP A;  2VA3 A;  4RKU C;  1NSK L;  5KFC A;  2CJY B;  5SZT A;  5HLF A;  3G6E S;  4ZP6 A;  3L9Z A;  3F73 A;  4FS2 A;  3PJW A;  2YNH B;  3WHI A;  2CA9 A;  3BKT A;  4ED6 A;  3HFK A;  3D1Q A;  4C0O C;  5JVG Q;  3IWN C;  4OYZ A;  1U0S A;  4TY8 B;  2Q43 A;  2YWG A;  3GFZ A;  1M1G A;  5D77 A;  3E3X A;  2JHE A;  3N0V A;  2XBP A;  4UY8 5;  1J2V A;  2GZO A;  2QN6 B;  2CIM A;  4U8V A;  2YWE A;  2R7S A;  5F8N A;  1NCL A;  3BSN A;  3R3T A;  1IBC B;  3ULH A;  5IFM A;  4KPC A;  6FD1 A;  1RWN B;  4ANE A;  5D0H A;  4TQS A;  4J90 A;  5LL6 d;  4B9V A;  2IJR A;  4RO0 A;  2VA2 A;  2UV8 G;  1OS5 A;  3BDE A;  4M5J A;  5KG4 A;  2IJN A;  1R7I A;  2XG8 A;  3LZ8 A;  4EZ9 A;  3NCR A;  1YRU A;  1RT6 A;  4QW8 A;  3VWS A;  1RWX B;  4ZLN A;  3TRG A;  3J81 U;  1C1C A;  3OBI A;  1E6V B;  5IV3 A;  4ETX A;  2J9E A;  2ZBP A;  3TA2 A;  3W64 A;  4JI5 J;  3W61 A;  4B3T J;  1BGX T;  1CS4 A;  2OIH A;  1XR5 A;  1D9A A;  2FTR A;  4L73 A;  2CQH A;  4WE1 A;  2MQO A;  4K4Y A;  2ZC4 A;  1ZZN A;  2GVD A;  3HP6 A;  3OL6 A;  2HUR A;  4JYA J;  2XMM A;  1QY7 A;  4YY3 J;  1FK9 B;  3KK2 A;  2VL1 A;  4DSL A;  2U1A A;  1KLN A;  4I6A A;  1U47 A;  1WOS A;  2RF2 A;  3OHA A;  3D3C J;  3FNN A;  1QVG R;  4LRD A;  2NPF A;  4Y2M A;  4F2S A;  2YPY A;  2C3P A;  2FJB B;  4C8L A;  2IA0 A;  4F3Q A;  1S6P B;  1XEZ A;  4DV7 J;  2A6M A;  3PG9 A;  1YKW A;  4ZVS B;  4CLU A;  2CQD A;  4TKT A;  2HGN A;  4HDG A;  4J9N A;  2KXF A;  2PN6 A;  2Q66 A;  2A2C A;  4EZ6 A;  4NCA A;  3Q8R B;  2GQQ A;  3QMQ A;  3W8P A;  1VQK S;  3W9J A;  5KT7 A;  5KFG A;  5EN1 A;  1BMQ B;  3OXF A;  2RS2 A;  5A8K A;  2BZ2 A;  3CCV S;  2W7A A;  2YX7 A;  1VK3 A;  5EGY A;  2ACM A;  2OH2 A;  3BEG B;  5L1L A;  3HF5 A;  1R0C B;  4J9K A;  3BGU A;  3D6H B;  1JLG A;  4F0K A;  2ZUG A;  1HYS A;  4QW9 A;  3M9O B;  3N9U C;  2E5G A;  1FO1 A;  3OR1 A;  1URN A;  3BBF A;  1VDH A;  4ZA1 A;  1OYE A;  4OV6 A;  2PEB A;  1FJ7 A;  4EO6 A;  4Q8F A;  1SC3 B;  2OAU A;  3FUY A;  2HZV A;  2ZHO A;  1J5O B;  4EWT A;  5IQQ A;  2AZ3 A;  3FCW A;  1R43 A;  1NZ8 A;  2BJ3 A;  3TUZ C;  2HRU A;  1JJ2 R;  4DX5 A;  1SV5 B;  4OZ2 A;  5I3U B;  2HHW A;  2YQ3 A;  2FDN A;  2J0X A;  4DJB A;  3H2U B;  3L7O A;  3PZP A;  2YKQ A;  4CLZ A;  4CO4 A;  4X4Q A;  3OTO F;  3NS5 A;  2CYY A;  4QOT A;  1N0U A;  1SJQ A;  1RTI A;  1HHS A;  2Y0B B;  2LQ9 A;  2VOD A;  4LR8 A;  3PEH A;  2F8H A;  4U6P A;  3TZY A;  3HVR A;  5FII A;  5H9E J;  4TXS A;  2M8H A;  5F0U A;  2B7C B;  5C25 A;  3SZ2 A;  2ZM6 J;  4DWI A;  4DV3 J;  3RB3 A;  4ZIV A;  3THT A;  3I0R B;  1HWK A;  3J80 U;  4I0W A;  3AD9 C;  1YJU A;  1LKZ A;  1Q8B A;  4LF5 J;  3HHL C;  2ZEJ A;  4URS A;  2RSQ A;  3CCS S;  2OPR A;  4NYZ A;  2H5I B;  3FBB A;  1M5S A;  1IJE B;  3GJT B;  2HQI A;  3SSQ A;  3KHR A;  5E2Q A;  3K0J A;  5D3G B;  4DXL A;  1PBU A;  3VAM A;  2YNG A;  4WXW A;  5EWE A;  3DLG A;  5D0R A;  3M2R B;  1SJF A;  4NPO A;  1VJW A;  4HR2 A;  3BR9 A;  3M05 A;  3PRV A;  3ILJ A;  4IDK B;  2RB7 A;  3HM9 A;  4F7V A;  3VR1 A;  2DJW A;  4JUZ A;  2HQF A;  4ENO A;  2LQJ A;  3CDE A;  2FLO A;  5T14 A;  2OLW A;  4ID5 B;  3C6E C;  4X84 A;  4XPE A;  2VPX B;  1MU2 A;  1TVR B;  4H4M B;  2P5V A;  3UR3 C;  2UU9 J;  4TQR A;  3JSM B;  3N01 A;  3T9Z A;  5AXN A;  2AJ4 A;  3PKM A;  5B08 A;  4ED4 A;  5CXT A;  1ZAW A;  3AD8 C;  4JI3 F;  3MUR P;  3QGG A;  2X1G A;  4DPU A;  2FQQ B;  1CJU A;  2XB2 D;  2IFX A;  4P75 A;  4R5P B;  5A6W A;  3VAH A;  2CJB A;  2NSC A;  3M8Y A;  4H54 A;  2ASD A;  3BN7 A;  5L39 A;  1T9X A;  2VQF J;  4HT5 A;  3SCI E;  4D3G A;  3MAH A;  3GIM A;  2QZ8 A;  1RCX B;  3CC2 S;  2E9Z A;  2C22 A;  3Q8P B;  1HFE L;  3ZZ0 A;  2VC0 A;  1G3O A;  1XMQ F;  2ERR A;  4NA3 A;  3CMQ A;  1XNR J;  4G65 A;  1YQH A;  1RK8 A;  4C11 B;  1LXJ A;  2AYM A;  5KTQ A;  2BJ8 A;  2AD9 A;  1NB2 A;  4RU9 A;  4F0H A;  2R7R A;  2MMY A;  4DFM A;  1Q8L A;  3BR8 A;  1A6L A;  1I1G A;  3RGI A;  3A13 A;  1F5C A;  2KKH A;  1RP5 A;  2EVZ A;  1GNK A;  2BQR A;  2F3J A;  3H90 A;  3VAF A;  2VIH A;  5LSR A;  3JTP A;  4OJH A;  3MUV P;  3GTY X;  8ATC B;  2C3Y A;  2D1C A;  4OYX A;  3SIP B;  3NNC A;  2MQL A;  4DSE A;  1J5E J;  2LLZ A;  4FKX A;  4I64 A;  2AGO A;  2RRB A;  8AT1 B;  3BSO A;  1VBZ A;  5HK4 A;  1VQ6 S;  3ZZY A;  4R0E A;  1URR A;  2DHH A;  3U7J A;  1KNZ A;  2Y1L B;  1OPI A;  3Q23 A;  1S77 D;  3AD7 C;  3JYT B;  2VOO A;  4MK7 A;  3D67 A;  1AFI A;  1FRX A;  4ED7 A;  5D4L A;  4M5L A;  4QIW D;  4URG A;  1WC3 A;  2V2K A;  4O3S A;  2DYA A;  1V3S A;  4ZCM A;  1O8B A;  2W25 A;  4S0M A;  4RR5 A;  2VIC A;  4EU0 A;  2ZH2 A;  5F0W A;  4LF7 F;  1O5J A;  4WP8 A;  1S6P A;  4EI2 A;  2VON A;  3SI8 A;  4TYB A;  3QZ7 A;  2XNR A;  3AQO A;  3CDW A;  3TAN A;  3DLK B;  5KG2 A;  2AYE A;  1UVK A;  1C4C A;  5C42 B;  1WKJ A;  5DDR C;  5M2U A;  4K0K J;  5AE2 A;  4ECT A;  4WXO A;  2B51 A;  4ED2 A;  4QYR A;  2MLX A;  5ETO A;  4OHZ A;  1AYE A;  1UCN A;  3TQE A;  1VR6 A;  4LBH A;  4OJ3 A;  1IKV B;  2GMH A;  4K4Z A;  1U6B A;  3CO0 P;  3OSP A;  3KHH A;  3HHL A;  1YJT A;  1UJ6 A;  3ZNU A;  3AB4 B;  1LFW A;  3GG0 A;  3C6U A;  4W92 B;  1ZM9 A;  3QIP A;  3UE2 A;  1JQG A;  2VQE F;  2E66 A;  1H6K X;  1MRO B;  4ILR A;  1VS3 A;  4YB7 A;  4UY8 T;  4O23 A;  4KB7 A;  3PYD A;  4JI2 F;  2CQB A;  1F9F A;  2ZDO A;  3QGP A;  1VBY A;  3IAS 9;  1HNZ J;  3MMB B;  4ZKA A;  3LPY A;  1DLO A;  3ZZO A;  3D7S B;  2EK1 A;  5L8R C;  4C8O A;  2R2R A; 
#chains in the Genus database with same CATH homology
 2HFV A;  3TJA A;  3LA0 A;  2Q2G A;  3L9Z A;  1XAO A;  3NY0 A;  4J80 A;  3NXZ A;  2B26 A;  3I38 A;  3TJ9 A;  2QLD A;  1GMW D;  1GMU A;  1NLT A;  3AGX A;  3LZ8 A;  1C3G A;  3TJ8 A;  1GMV A;  3AGY A;  1GMW A;  1EB0 A;  4L3K A;  1EAR A;  3AGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...