3NY0A

Crystal structure of uree from helicobacter pylori (ni2+ bound form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
147
Chain Sequence
IIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
total genus 37
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3ny0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3ny0A02
1NLTA 1EARA 2Q2GA 3TJ9A 1GMUA 4L3KA 1EB0A 3TJ8A 3LZ8A 3NXZA 1XAOA 2B26A 2HFVA 3AGXA 1GMWA 3I38A 3L9ZA 3TJAA 1C3GA 3LA0A 3NY0A 1GMWD 3AGYA 3AGZA 4J80A 1GMVA 2QLDA
chains in the Genus database with same CATH superfamily
1RHQB 3HHDA 2JVMA 3X3UA 2UU9J 5EWFA 1VC5A 4RW9B 5KG3A 2GHVC 2BMBA 5HMYA 1H98A 4M8LA 2E9RX 5DGBA 5HBMB 4B9UA 3TAPA 4O4RA 1R43A 3G71S 5L8RC 4ED6A 1U47A 3BM7A 4H4MB 5IOLA 2F4VF 4YFUA 2LXIA 1BXNA 5D0EA 4C6AA 1I51B 1QAYA 3MURP 5LMUF 1DTTB 1JLQA 4K50A 1YWXA 1YG0A 4OYWA 5HP1A 2VG7A 4WKRA 1Y5NB 2C3UA 1RAFB 3FMBA 4OYMA 3MTKA 1IBLF 2Z56B 4WYLA 4LSNB 4F3QA 3OLAA 2O1PA 3SSSA 3KFWX 4YQWA 2QFJA 2F4VJ 1D1UA 2EFOA 4LF8F 2AIRB 1UPPA 2DR6A 3H5SA 2DO0A 1T05B 2QA1A 1OY9A 5LMUJ 3M30B 1KONA 4USWA 2CJAA 3MECA 2XMMA 3GG1A 5HROA 3TQEA 2DISA 1IBLJ 3PW2A 3RB0A 4KTQA 4PAAA 4FVMA 4DUYF 3D3BJ 1RHUB 5LOQA 1UJ6A 4USKA 1PBUA 4LF8J 1XERA 4CLSA 1H73A 1X4BA 1NK6A 5AJ3F 3ILJA 2NZCA 2BJ7A 3LO3A 4F50A 3Q2TC 4IH5A 2ZFHA 4ZN1A 4EUVA 2FVQA 5KOWA 1LWXA 3PYDA 2EC0A 2RRNA 1R3NA 2QMUB 4WYWA 1Q79A 3VV2B 3DNCA 4B9SA 2DNHA 1ZYQA 1RBAA 1J5EJ 4Y00A 2CNNB 4Q45A 4JYAF 4LBIA 5AJ3J 1U45A 1WEXA 4O4GA 3O1LA 1RWKB 2G13A 1R31A 4CP5A 5L46A 2VJUA 5LJ5Y 3NL0A 2FYXA 1FDAA 3D6TB 1U1MA 1V6HA 1UWBB 2BJDA 3OHAA 1DY3A 4PQUB 3JTNA 2OI2A 5I3UA 4KHMA 1KSPA 1KFDA 4ZVUB 1S1UA 2HHSA 1TV6A 4RUBA 4JYAJ 2DKOB 2R7UA 1MWQA 1HBNB 3O44A 1U1QA 4P10A 2MY7A 3R7BB 3PKMA 4GVBA 3EE3A 3I0RA 2CNKB 4OHXA 2R9LA 1WOOA 1NEEA 4MKYA 3TX0A 1TKXB 4LFBF 1BWVA 5D0RA 5F8GA 2OJ3A 2CQGA 3AJ2A 5KFHA 2NS1B 4JI4F 4PXCA 4QWCA 1VMBA 3N4WA 2XNQA 3OVBA 1NDLA 2BKNA 4NI2B 3NG8A 2VV5A 2VQEF 1XTZA 5KFGA 5JVHQ 2I2YA 2DGOA 1HQEA 2ZC3A 2VC0A 4LFBJ 1OPZA 1RAGB 1FKOB 3MEEB 2RRAA 4I68A 4K4XA 3ENVA 4EEYA 5HMZA 5A8RA 5KT6A 1VK8A 4JI4J 2IJRA 3BGLA 2ILZA 5GMKa 2J0XA 3DLJA 3U27A 1Q7YT 4GC6A 2VQEJ 1JX4A 2NYHA 1RXOB 1TL4A 1REVB 1S99A 4OLOA 1TU0B 1HNVA 4G1QB 1YBAA 2E9TA 3UO0A 1RZMA 2AJ0A 1S7IA 1WI6A 2VQFF 3N6MA 5D0HA 3WZ0A 4X4QA 2CFXA 4IUFA 1JLFB 1CJTB 5CXTA 2GA7A 3SCLE 3TJAA 1M5VC 2HHXA 2R8HA 3DRPA 2HRYA 2RQMA 4DLGA 2YWKA 1GMVA 1XMBA 3EVOA 2R7XA 2EXUA 2PEHA 3NCQA 3CJRA 3EWGA 4ZDNA 3K2YA 2ALZA 2WVCA 1WG1A 2I0XA 2IY5B 4EO8A 5DM6Q 1IWGA 3DGPB 1H3DA 3ZTPA 4I67A 3K59A 2JFKA 3E01A 4ZCIA 2H4WB 1U1KA 2HNDA 2J9EA 2VQFJ 3D1QA 4ZOSA 3T41A 4ZKAA 1R7IA 4G1PA 4B9LA 3ZZTA 4ZLJA 1X4HA 3U1NA 1L3VA 1A6LA 2QLJB 2JEIA 2XO6A 2CPYA 2DGVA 2E44A 1X5OA 4B3SF 1U8WA 4EBDA 3MMAB 5KT2A 2FVPA 3WIUA 2IM1A 1K44A 2YKMA 3S7RA 3ZTQA 3AGYA 3C66A 4NCAA 2Y8YA 5K8MA 2DNKA 3M2UA 4B02A 4BWMA 3OL6A 3NCRA 1XQIA 2G2OA 1S57A 1K0TA 4NE9C 1W2BR 2G0JA 4C3MA 1PKUA 5B0EA 2RU3A 4OHWA 2CKWA 5LM7E 2M88A 2JEJA 1KR4A 2N3LA 3UVJB 4KE5A 1S9GB 1PO6A 1NHKL 3QIDA 4C8LA 2LU2A 2HRUA 3TX8A 5GAEI 1A7GE 4CLKA 1VQYA 2ZZTA 2P9EA 4QW8A 4B3SJ 2CJ9A 5H9FJ 4WFNQ 2YNFB 4R0JA 3D68A 1KVIA 2IVYA 2XMWA 4P2SA 3I38A 5AXNA 1H7XA 4CRJA 1RJJA 3CSKA 3KUHA 1Q8BA 4IQXA 2ZHBA 2CQ4A 3UD4P 3MAQA 3R6GB 3POTA 4RO0A 4C3LA 3SV3A 5ITHA 4MMOA 2HFNA 1RBLA 2BJ1A 2BXJA 4LQ3A 4UY8T 1AUSL 1CQNA 5KFQA 1RSCA 2FVCA 3W5ZA 1JKHA 2DNOA 3TYTA 4YDDB 5IM0B 3O8WA 5J2QA 5D4OA 3H2UB 3THVA 2E1PA 4ES1A 2EEYA 2VOPA 4ZP9A 2ZKTA 5DG9A 1IKVB 2IPOB 1K8AT 4Y28C 2V63A 3FCWA 2UVRA 5A2QY 2BQ3A 2MLXA 4NLQA 3UDVA 2EK1A 2A18A 1T8EA 4BHQA 5KTQA 3SQOP 3M6VA 4HH1A 3GIIA 2F8EX 4ZP6A 1H7WA 4OV6A 4IFYB 2DTJA 4DPWA 5F41A 4L76A 2RD5C 1YJUA 4H4OB 2LA6A 2C2EA 2HZVA 4ED7A 2KL8A 5G4DA 5HMXA 4F04B 2B9XA 4H4KA 2LQ9A 4EI2A 2DHXA 1UW9A 1IWAA 4A47A 1SQFA 5CYMB 1IR1A 3MEKA 2V2VA 2X1GA 3OJSA 2IDLA 4NASA 2JFDA 4GKKF 2VG6A 4DPXA 2O01C 2I5JA 2XS7A 2ODXA 4F4AA 1HQUA 1B7YB 4PUOB 2XZDB 3LPEA 1HL6A 1RABB 3GILA 2ZITA 1MWYA 3GONA 3D6HB 2KI2A 3TZYA 1NPPA 5I42A 3FK4A 3KLIA 5FIIA 1GNKA 1UVMA 1VQSA 3M2VB 1ZM9A 2ZOMA 3Q8SB 1JK9B 4ZK7M 1SIZA 3A3OB 3KWMA 1HNWF 3DI6A 1S6PA 2J7KA 5KFUA 2FJXA 1U1PA 4A8OA 2RHQB 2ZBIA 3I6PA 4J9RA 1B0TA 4HI2A 4ANDA 5B0CA 2FJEB 3FBCA 2CQ0A 3OSNA 2AGPA 3L7PA 3NGKA 3UDEA 4ELTA 1X4FA 3V81A 1M1HA 3ISNC 2QLDA 2CJKA 4P7TA 1M5HA 4RW7A 2XI3A 4LF4F 5J1EB 3IAS9 2OELA 1HNWJ 1SV5B 5T7LA 3C14B 4WU2A 2UP1A 2R8GA 4USVA 3PJWA 5KFMA 5CD4A 2NSCA 1E6VB 3TVYA 2YNGB 2I9SA 1NXIA 2M4MA 2AMCB 4D3HA 3EZ5A 4PG6A 1RT5B 1NZAA 2MKIA 1TKTB 1FXLA 4DV7F 4A8KA 2Q66A 4LF4J 4PABA 3TO8A 1FWPA 3OL9A 3QWUA 3KK2B 3QRQA 3PX4A 5ETRA 2FZKB 4IG0A 2OPQA 3NLCA 4MKBA 2HMIA 2GJIA 3H5YA 4M94A 3SDEA 4PG4A 1Y3KA 3KLGA 3LTOA 3R1LA 5EX3A 2JLEA 1RACB 3KLVA 4CYUB 2ZOGA 1RTJA 2GCFA 2XS2A 3ZC4A 3GIMA 2AT1B 2M5YA 4URQU 2Q43A 5EX0A 1MU2B 3Q8QB 1UA0A 2R7QA 1U48A 2R7VA 2Y3YA 4PPDA 4DV7J 1UETA 3JSMB 2B51A 3HJFA 2W4CA 3SZ2A 2VG5B 2I38A 2OFGX 4IFVA 4NLVA 1HR0F 4IYQA 4F0MA 3DXSX 4P2MA 1TVRB 5E0OA 2VB6A 3QSYB 4R5PA 2QA2A 4QWBA 3PIPQ 5A2QU 3ZZOA 1KOOA 3DYAB 1I3OB 6FDRA 3NNAA 1VCTA 4M5JA 2GIFA 2V9KA 2RQCA 3OD2A 1S4EA 4EMDA 2FIUA 3AQPA 4DS5A 2BM0A 4RU2A 1CQMA 2H48B 1YRXA 4J9LA 1S9FA 1HWIA 2V69A 2EKNA 3FZBA 5CA5A 4YB1P 1HR0J 1HFEL 4WK3A 1WHYA 3MF5A 3MM9B 4I7FB 3AXMA 4WE1A 4U6PA 5SUHA 2F9JA 4CQ1A 4F8RA 1RAOA 1SH3A 2PA8D 3M9NB 2R2TA 1N33F 4I69A 2UVUA 4MFBA 1L3KA 1SH0A 2DPJA 3EPGA 2F8MA 3J7YI 2R7OA 4DCPB 2BE7D 4RUHA 1KBRA 2KRBA 2QSFA 3OTBA 4NLPA 2E7XA 3ISZA 2UXBF 1RWOB 3HVWA 3KHHA 5GAHI 4GRSA 1K9MT 3O6QA 1TFWA 4RNHA 2J0SD 3ZTRA 3KHLA 3ZZUA 3DDKA 4KO0A 2YY3A 4W98A 3AOBA 3BPSP 4CTAB 1N33J 3W7BA 2VDHA 5CHCB 1ZM4A 4WIQA 3IC1A 4QPTA 1HD1A 1FKPB 4HACA 3A8KA 3GU0A 2VPYB 4ZJQA 3ET6B 5HANA 4QJVA 4CH0S 5FJ4A 4J80A 4N76A 4G3IA 2UXBJ 3LP2B 3MWBA 5DS7A 2FY8A 2RU9A 3KXDA 3K5PA 1GMWD 4Y65A 3MM6B 2KDOA 1G4CA 4CO3A 2DGXA 3J7Z5 1GFWB 3TNVA 2HQDA 2BEFA 3BN7A 2MMYA 1S9EA 1URRA 1NLKL 4F0HA 2FD2A 4HTIA 2PMWA 4EGLA 1ZM3A 4C7QA 2CAJA 5DM7Q 2VIHA 5HATA 1Y5IB 3SV4A 3W2VA 3M8YA 4KGMA 3SMZA 1IKWB 2W4DA 2NCKL 5E33A 2C3OA 1IKXA 1OWXA 4ZVTB 4CLTA 3PJXA 5J1NA 4M5DB 2EVZA 4DV5F 1LWEB 3Q8YA 2IRYA 1T3OA 2AV5A 5EWGA 1FRXA 5B09A 4IR9A 1R27B 2W2PP 5J2PA 4TY8B 1KQKA 2QYGA 1HHTP 4B3TF 1V3ZA 3H90A 1X60A 1ZZFA 2EFGA 3KMQA 3GV5B 1C0TA 3N01A 4ATNA 3E8OA 4F7VA 4ILMA 2VHGA 2XCPA 2VA3A 2VF3A 4DQIA 1RE1B 4IDKA 3LUYA 4NLSA 3D2WA 3M32B 3P5TL 4Q0BB 3M05A 2LCWA 3DU6A 4DV5J 2KT2A 5A8KA 1RP5A 3W3SA 2H54B 5B0DA 3CDAA 3MAAB 4I64A 2HG4A 3CCRS 3OV7A 5J2MA 1XR7A 2B6AA 1R8AA 4WJBA 4C0HA 2M3DA 1RT7B 2AEJA 1XBWA 1HBUA 4Q43A 4B3TJ 4FXDA 4IQMA 3ZO7A 3GQCA 3PX6A 3VAGA 5LSOA 1C1BA 2XB2D 3R5DA 2PDAA 3D5MA 1C0UB 1Y5LB 1MMNA 4YR0A 2DVIA 4LSLA 1M90T 2ZKUA 2V94A 4PXDA 1LNQA 1SC1B 1RT4B 1BUXA 2VFTA 1XMQJ 4IH7A 2F63A 2HHTA 2HQ3A 4DU7A 4EZ9A 1SJQA 4I2QA 3UQSA 2WVFA 3ZNUA 1OY8A 1U02A 3AAWB 2KFYA 2YNIA 1PAEX 3DN9A 2OD4A 2EFPA 2HURA 3GR0A 4AQYF 2RF2A 1MNEA 1HWUA 4DX6A 4FYWB 4B3OB 1JJHA 5HJXA 4OJHA 4BWJA 1U49A 3ZZRA 3T6JA 2ACYA 4LT6A 2CWKA 1DZ5A 2QSWA 2HPUA 1VQ4S 2KRRA 3OJUA 2VPXB 1S0MA 2ZH1A 2RAQA 1U24A 4NRUA 5EWEA 2LECA 3GG0A 4LF7F 2X3DA 2A1BA 2JH3A 4URSA 4USMA 3AQOA 4NEZA 4LRFA 1RISA 3W66A 1FJEB 2Z0GA 1EETB 2Y8WA 4AQYJ 3KK1B 4GO5X 1SKUB 3DLGB 1N32F 1ZAWA 2CQHA 4K2XA 4FDFA 4MAKA 1SQGA 2WRMA 1FK9B 3HLUA 3GE9A 4LF7J 1B70B 5A8WB 1WWHA 4DR6F 1TTHB 2HZCA 2O67A 3VGVA 4FF1A 4NCGA 1Y10A 2UZAA 4RW8B 3HXMA 1Q5VA 3W8PA 3LP1A 3HSJA 2YPZA 3S6EA 1L3TA 3WIVA 2JOQA 2AYGA 4WPAA 2KO1A 1SCJB 1N32J 4JOUA 4A8YA 1EQMA 4B9VA 2C2MB 2LXUA 1BE4A 1FDDA 2CVIA 3R5JB 1LXJA 4FVCA 2HRTA 2AEFA 5B0GA 3BSOA 2QEXS 3PO4A 3Q24A 1X4EA 1P1LA 2YX1A 4FF2A 4BLGA 3SEOA 2MZRA 4J9SA 5B0AA 2HK2A 2N82B 3N6NA 2X1FA 4GO7X 4NMLA 2AX0A 4ZIVA 5E3RA 3F0NA 2XZWA 3VQTA 5F3TA 3Q8RB 1VC0A 1CJVB 4F4XA 1VISA 2CZ9A 3BO3A 4TNOA 1TK8A 1FRLA 3IM8A 2W9BB 3TJ9A 1OIAA 2M7SA 5I4MA 1P27B 1LK7A 2GMHA 3MOJB 2CPZA 3JB9k 1IR2A 2XMAA 3W8GA 2W9CA 3IRWP 4KAIA 1EARA 1KLMB 3CCVS 1WTBA 3BGOP 3GB0A 2FVSA 1YZ6A 2D9OA 2GAGC 3F44A 3TAMA 3SI8A 2DHSA 4P9SA 5HO4A 5L1KA 1FJCA 2G1HA 4KR0B 3MXHP 3CCWA 3LWMA 2IA0A 4J9KA 2MEWA 1AA1B 1IQTA 1F9FA 2IAJA 4QWDA 3UCUP 1S1VA 4B3RF 1SJ4P 2UUWA 3VGTA 1NDKA 1UEVA 4J9VA 3IRXB 4KKOB 3HHLA 1HYSB 2FPHX 1N34F 4KH1B 3DMJA 4LRCA 3OW2R 4QBUA 4F02A 3QAUA 2N7CA 1U26A 4J9NA 4FBTA 3UNYA 1SC3B 4BC9A 3VAIA 2BKOA 3NGUA 4OZ5A 2H5IB 4ALZA 1UFWA 3QPIA 2QN6B 2MHNA 4MKVA 1RUSA 5D78A 4FF3A 2QLWA 2BM1A 4B3RJ 2NPIA 4FPRA 3KLFA 3CD5A 3FUYA 1FRJA 2HFOA 3RBZA 4DL3A 4MIWA 3D3CJ 4P6QA 2V4JA 1FI4A 4R0EA 1N34J 1AZSA 3JYTA 5KFAA 3HT0A 1F5CA 2JRSA 5HVFA 3V6DB 1N4LA 1HKAA 3I82A 3W65A 1EAYC 1WOSA 3R5BA 4F4YA 2DRAA 5C42B 4CNZA 1VGYA 5A0YB 3BR9A 3CDBA 1CS4B 3W5XA 1N5YA 3JSYA 1MROA 1D8YA 4DCOB 2VFUA 3B78A 3Q8UA 2PMHA 3ISND 3AKOB 1WKLA 4YR2A 1UVKA 2L9NA 4A8SA 2ZJRQ 1DTQB 3MEGA 3QAEA 1OS5A 5BYRA 2CQ3A 3MM8A 1T0TV 3NGSA 3CC2S 2ZH7A 4F4KA 3MCOA 5CH7B 2L08A 3H4BA 4E0DA 3QT6A 1RT1A 3V4MA 3AT1B 4JI5F 1TL3A 3MGJA 2VA2A 1T3NA 3R3TA 1S6QB 3PDNA 3I9ZA 4ZVGA 5KG6A 2LFVA 3BEGB 5CZXA 2OO4A 2ZM6F 3C6TA 3R2CJ 4MYUA 4AL6A 2XGQA 4J9QA 2AYEA 3TUIC 2LQJA 4C2MA 4OYZA 1CJUA 5DDRC 1CULB 1RWUA 3OSPA 3GR1A 3VTIA 1C3GA 3IWLA 4DEZA 2NYIA 4JI5J 4ZVOB 4K59A 3IR7B 5KFWA 2I8EA 3TA0A 2YKOA 3KDNA 4OI6A 1SL1A 2XG8A 2YKNB 4Q2LA 2AGQA 1RTHB 5GMDA 2WBMA 1DFDA 2JZ8A 2MYFA 2ZM6J 2VU5A 2YKQA 5M2RA 2VASA 1FHTA 1ZTTA 3CD0A 2RDDA 2BZ2A 2MKCA 1HI8A 3J7A1 3DM2B 3BDPA 3HT3A 3GJRB 1G6BA 2FGCA 3TWZA 1LV5A 1WTFA 1VBKA 2GVDB 3QQCD 4X4NA 2EG1A 2HKEA 3DOKB 3JTOA 3V4IB 1V9OA 4ECYA 1U0SA 3MPYA 3R5CA 3ZTOA 3DLEB 3MPWA 4LVOP 1U7LA 4QOTA 4USTA 4WWSA 4YN3B 3MR2A 1CPZA 1XC9A 3A13A 5LL6d 1U1RA 4RX6A 4ANCA 2BW7A 2HYIB 2KHDA 4RW6B 3EYZA 3WQPA 4C9DA 2KVIA 4V19X 2R42A 2HHHF 3PKYA 1V3RA 3B82A 5IXUA 2AF6A 2V8DA 4U95A 2FHOB 4M5MA 2V67A 1HBMB 3MMCB 4ZVQB 4DF4A 2MTLA 5IV3A 3NNCA 3BKUA 1XNQF 3KJQB 2YX7A 5JVGQ 1FJ7A 1FFWB 3P45B 3OFGA 3KNAA 4QYZK 2VICA 5E3PA 1WELA 2XMKA 2DITA 3PFEA 4JI3F 2HHHJ 4RR5A 1KFSA 3I56S 2HLUA 4PG5A 3BQ2A 2Y1RI 1UCNA 2RS2A 2XHCA 2VG7B 1AT1B 3AB2B 3I4PA 4DR3F 4QPXA 2GQQA 5LXRA 2BE2A 5LSLA 1XNQJ 2FLNA 2GMLA 3H8YA 2DGUA 4HVZA 4Q7AA 2L3MA 3DLKA 3R97A 4ED5A 5IQ6A 2WVBA 1J2VA 2FC9A 3DHWC 4TYBA 4M5IA 1HMVB 1FRHA 1NDCA 2RKIA 4JI3J 2BYCA 1TK5A 5HI7A 2OEKA 4TLRA 3TA1A 3T5LA 3MZIA 1U4BA 3O5TB 3S1TA 4DG1A 4DR3J 4ICLB 5HBMA 4NLWA 5AT1B 2DY9A 5D15A 5KT3A 1RU1A 2MZJA 1TMJA 4OYBA 4HKQA 1FEHA 3LGHA 2RH3A 4X4SA 3PIOQ 3EGVA 4X4VA 1RHKB 2CVEA 1DTTA 2HIQA 1ZA1B 5C2GA 1Z1ZA 1HPZB 2GFFA 4FNHA 3J80Y 1M1GA 2FLPA 4C8ZA 5GAGI 4G6VB 2P2CB 2EWHA 2HSEB 2DCLA 1XEZA 4UQGA 1KVKA 1Z2LA 4WTYA 1R0BG 2HQIA 1CC8A 4DL5A 1NSPA 4LSNA 4WP8A 5KFLA 3NP5A 4DLEA 4HT7A 2WSCC 2DIUA 1KTQA 3T6BA 5EHHA 3BZQA 4NRTA 3CC4S 3DCAA 1T05A 1KQFB 2KJWA 1SKWA 4QIGA 2OHDA 4O4GB 1K1SA 1AYEA 3G96A 3CE8A 3I96A 4BDPA 4Y3CA 5D3GB 4WFXA 4J9UE 4KQZA 1SI9A 4KH0B 3JS9A 2D41A 4X84A 2QL5B 3MOZA 2BQUA 2E1MC 4UY85 4K8RA 2V8GA 4CLWA 5I3UB 1XNRJ 4HHJA 4DX8H 4OX7A 2ZJQQ 2HHQA 1S1UB 3EX7B 3A8IA 4ZPAA 2XS5A 1TV6B 2U2FA 3FFIB 1IQZA 4TXSA 2O3DA 3DFEA 1D9AA 1N8RT 1NO8A 5DRKA 3UCZP 2LVWA 3J7AN 1HD0A 3EPIA 3NEKA 2HLTA 2X1BA 4NWBA 3KJNB 2BA9A 5KT5A 4J90A 2DD8S 4A46A 3ZZYA 2LQ8A 3B6BA 3UD3P 1D9FA 3GMGA 3LPYA 1BMQB 1LKZA 1NM2A 4K7QA 3IG1A 2V4QA 4KB7A 1B3TA 2IYGA 4O3PA 4Q8EA 3D0HE 1CEZA 1TL7B 1MWZA 1QE1B 1RU2A 3CCLS 4NOHA 1ACMB 2CQDA 3CIZA 3IM9A 3CD6S 3OUYB 4F26A 2W8KA 1Q1KA 3BGRA 5IQQA 3NWRA 4PQUA 2LLZA 3CDWA 4IRDA 4NA1A 4PWWA 4RNFA 5KT4A 1UA1A 3AA8A 1PJ5A 3D7SB 3D28A 3DKDA 4V19J 1HBNA 4O0NA 4KYZA 3VR1A 5D6GA 2XLJA 1T7PA 1LXNA 2RUSA 3CB4A 4A4JA 1ZPVA 2CXEA 1TKXA 2FUG9 4IG3B 1RTIB 1D9DA 4E98A 4X65F 2F65A 4I6YA 5HVHA 2Y1LB 5E5NA 2UXCF 1F9HA 1HNXF 1EZZB 3K8WA 4DL0C 4X4OA 2KHCA 3I0SB 3VVUA 4DX7A 2J9CA 3BO4A 3TZWA 3QJJA 2IYIA 1Y3JA 1L3SA 1B64A 2E5GA 4QIFA 3OFEA 3QFWA 2HHPA 3H7HB 3KUGA 3MEEA 3FSIA 2HNDB 3MHYA 4X65J 5ETPA 3FBFA 4ITSA 4J9MA 3AY0A 5KFPA 4QW9A 1XWLA 2UXCJ 3J80U 3CGIA 2ROGA 3M8ZA 3RGIA 1HNXJ 4CT9A 3P8BB 4RL1A 2IHR1 1XN9A 4P2XA 1WF1A 1UFLA 1UEUA 4IKAA 5F9NA 2AW0A 3J81Y 5K14B 3QT5A 1YQHA 2YKMB 4O23A 1REVA 2ZNZA 4TY9A 3N79A 3LQVA 3US5A 4G1QA 2QRRA 2CDRB 3M8WA 2GS8A 1KQGB 2HBZB 3MM7B 2IMOA 1RAEB 1S1XB 2QLXA 5L1LA 5F8NA 1UEKA 3SQGA 3VF0B 3SBMA 1PAUB 5C5JA 2AWZA 5LT5A 3UPFA 5ADZA 2R8KA 4MJKA 1GX5A 4EZ6A 4DJBA 3VCDA 2CADA 3AODA 3B4MA 2R2SA 2LU1A 2BDPA 1RCXB 3DGPA 3GCXP 2RQ4A 3U7JA 4ECRA 3LANA 1SJ1A 2C3PA 3HM9A 1AB8A 1FRMA 3MPVA 3L3CA 1PJ7A 1BC6A 1S7HA 1WD6A 2KM8C 2RNEA 2PA3A 4CZCA 3IBCB 1SPBP 2DXDA 4CO2A 2P5VA 3CJTA 1T02A 1RT6B 1UVIA 5HLFB 1YJ7A 2C2RA 2DHAA 3MMAA 3HPOA 3AOAA 2AYMA 4G1IA 3ICLA 2QLFB 2LYVA 1S59A 4NPOA 4CLFA 3HHNB 1W2IA 3W62A 3QO9A 4ER8A 4WBFA 1I1GA 3P3DA 4ZMMA 2XYGB 3FEXB 2E5LF 4DR1F 2B0GA 4LIWA 3UVJA 5MAOA 5DZ7A 1S9GA 3FZ2A 4TU8A 4F25A 1S77D 3IR6B 1Q8IA 2JJ4D 1WNEA 4ZLLA 1KOHA 1UVJA 2RDJA 4DFMA 2QL7B 3KUEA 4MIAA 1LW2B 2WSFC 1FFSB 2VG6B 4CNYA 1YBTA 2H9ZA 1M5OC 2E5LJ 4DR1J 1H0HB 5A6WA 5IZHA 1V3SA 4P7VA 3PV8A 3G82B 4DSEA 3ZNJ1 3MEDA 3QMQA 3PRDA 3N5FA 2FHKA 3CCMS 5IM0A 4ZVHA 4EWTA 5I42B 1IM6A 2KVQE 1NPKA 2HVHA 5B0FA 3KTQA 3G9CA 2C22A 1IKVA 2ZD1A 2AJFE 2BJ9A 3PW0A 2EBGA 2BABA 3EJMA 2ERRA 2N3OA 2J0QD 2R7RA 3DRRB 7FD1A 1NLTA 2FB0A 1RAJA 4TYAA 1YDLA 4BBYA 4IFYA 2LP4A 4YY3F 2QZ8A 4FXVA 4YUDA 2VBXA 2IDEA 3MFHA 3QWPA 3MDFA 4F67A 3LGMA 1GX6A 1QVFR 3DOMB 2HQFA 3OTEA 2WZ1A 1CJKB 2YWFA 3X1LB 2FJDB 3NRBA 4RW7B 4IRCA 1O6XA 4RNOA 2XTJP 3QATA 2V6AA 3EVWA 5KFNA 2OAUA 2IVMA 3G8QA 4WCEQ 2VH7A 4D3GA 5AXMA 2OPPA 2M8HA 2J6TA 1VRTA 4FNIA 4LRAA 1SXLA 2CQIA 4RBTA 3J81U 4NEYA 4YY3J 2CYYA 4CWBA 4PUOA 1Y11A 2KFZA 3IFEA 2YNHB 1SBRA 2MXYA 2PE8A 4LR7A 2DCUB 4B9TA 1P6TA 3IAM9 4LR8A 2W2MP 3K7RA 2OPSA 3M2VA 4PYAA 4O3OA 1N54B 2AKWB 1VQPS 2OPQB 2OSQA 4DUTA 1N6QB 4CM2A 4ZVEA 2HVIA 2IJNA 1S76D 3AD7C 3W9IA 1QY7A 3OXLA 1ITPA 2ZHAA 3TUZC 2VJVA 4LMZA 3OT9A 4Q8FA 2RQKA 2HS3A 3DDIA 5K8NA 4URGA 1Q53A 2JLFA 4KGXB 1F2GA 2KJVA 4HHHA 5J1EA 3WX8A 3DLLQ 1M1KT 4TN2A 1S6UA 1FT8A 1HHSA 1S5ZA 3GLJA 5ETNA 2JRRA 1S1WA 1F6TA 5DG7A 1FO1A 2LDYA 3C14A 2CPJA 3M6XA 3RUBL 1T95A 3VZHA 4DR4F 3PACA 2MSTA 2JX2A 1E6VA 2YNGA 1B0VA 4JI2F 3K5LA 3QJLA 3CCSS 3R2DJ 2BV3A 1RT5A 1TKTA 1NK0A 5C24A 3OTOF 1LW0A 5M2UA 1VLYA 4YHHF 3KK2A 5D4NA 4DV2F 3KYLA 4PXEA 2GW8A 4EBEA 1JXEA 2DRBA 4LSZB 1LQ9A 4WE1B 4K5RA 4DR4J 3ADAC 4JUZA 1SVDA 3HDSA 3GFZA 3SFGA 1FDNA 4JI2J 3GCWP 1LEOA 3DOLB 3GFXA 2KG1A 1LWCB 4DFJA 2CPIA 1UP1A 5LMNF 3UNGC 3TUPA 1TMMA 5ETLA 2XWYA 3JSMA 4PWDB 1EB0A 2VG5A 1K1QA 2F5GA 4RU9A 4YHHJ 3A3NB 2XMVA 3D0GE 5DZ6A 3K57A 1F3VA 4DV2J 3ENAA 2MHEA 4RW4B 4U7UK 1PJ6A 4JI0F 2Z4PA 8AT1B 1TVRA 2RMLA 4ELUA 4ZPDA 4AFFA 5U47A 3I9V9 1QSLA 3NBPB 1Q7LB 2COLA 3PR4A 1IJEB 4BCAA 2VDIA 3CPWR 1QTMA 3DYAA 1DARA 3QT7A 2BX6A 3C19A 4B3MF 5LMNJ 1TR0A 3IBWA 3FVYA 4FP9A 3R5AA 3RG6A 4KBIA 4FKYA 2D3O1 3AD9C 1JWWA 2E5JA 3D6MB 4H4KC 4M5NA 2YKPA 1N0UA 3EXCX 2XYPB 3Q22A 4LUBA 4JI0J 6FD1A 3MM9A 5DDPC 2MZ1A 4ZITA 4NLGA 2OUGA 4KV8B 1XR5A 1NRKA 2YWHA 1B99A 4DUYJ 3OR1A 2G2YA 4B3MJ 4C8YA 1RQ0A 2HQCA 3T5JA 4CIOA 4QR2A 5L1IA 4FS1A 2C42A 1QUVA 1ZETA 3QIPB 4PQAA 2UV8A 2XM3A 4HT5A 4J5OA 4W90B 3Q86A 1NBEB 2V68A 2BOAA 1VC6A 2HEKA 3LGNA 1ELOA 2V2QA 4WP3A 5ETSA 2E29A 2V8VA 3PYEA 4L72B 5L1JA 1FXDA 5L39A 2XSJB 2ZUGA 4CTAA 1FD2A 3PFOA 4OZ2A 3VQSA 2HGNA 2YWEA 3QLHB 3R7SB 3ULHA 2MGZB 4B9MA 1FKPA 3T3FA 3KK3A 1G7CB 3ET6A 1VS3A 2QA4G 1NK7A 3SYZA 2IA6A 1VHFA 3BSNA 4IOCQ 3LP2A 1OYDA 1YKWA 1SC4B 1HQ2A 1TAUA 3D1OA 4C11B 4C8MA 1CVJA 3IN5A 1PG5B 2R4FA 1I94F 3MM6A 3SCJE 3HP6A 1C0TB 3CO0P 4ZVFA 1H72C 4I2PA 3CDUA 4IDKB 4NLDA 4OZLA 2KKHA 2B43A 3M8SA 1FESA 1YVFA 4ZJOA 4FYYB 3T9NA 2V9WA 1JLAB 2DGSA 4B17A 4AYBD 3PNIA 2CJQA 4Z7YA 3OFHA 1FX4A 3CMQA 3CJ0A 3HKZD 4PG7A 4ZP7A 2A0FB 1N5QA 2K3KA 2VKZG 1HBUB 4NYZA 2C2DA 3IBFB 4YR3A 3BDEA 2OIHA 1I94J 4OZJA 2E1CA 1GQEA 4NLOA 2DHHA 4F3OA 2J8SA 4QIVA 1Q5YA 4DV0F 1N88A 4RJVA 1EKSA 1H2VZ 2PEBA 5G0RB 1ZA2B 1LWEA 4I6WA 3LOUA 1U0HB 5LSRA 1F60B 3ZZ0A 3RBDA 4OV1A 3MR7A 4A48A 3CW2C 4CO5A 4OI3A 4OI1A 4I2QB 3CJ3A 1TKZB 4TY8A 1R8CA 3QBCA 2JVOA 4WF9Q 3RW7A 2K1RB 2OTLS 1LWFB 4ZJLA 2NQPA 3OTDA 5DDQC 3RRHA 2BRKA 2PFFB 3N6LA 1S0NA 1VQ6S 1XIQA 2UVWA 2W2NP 1F9EB 2N4DA 2PD1A 1H6KX 4J9OA 4MKAA 5L9XA 4DV0J 2JEFA 1XAOA 2MSSA 3M32A 4Q0BA 4YB5A 1CSJA 1RADB 4C8OA 3TI0A 4DL6A 1YSJA 4U96A 2QTWA 2D69A 1RWXB 1RT7A 2RRBA 4ED3A 3G6YA 2J7WA 4GKJF 2LXFA 1KHWA 3CJKB 1C4AA 4K0KF 1Z4UA 1GMUA 2DIVA 1SKRA 2BJ8A 3V6JA 3TARA 5ETMA 4PR6A 4K4WA 1UAWA 4CH7A 3EUNA 2B4UA 4NZ7A 3T9ZA 1RT4A 3M8QB 1DJ0A 3FRZA 4P71A 3OTCA 3CCES 2ASDA 4RWXA 3T5HA 5E3CA 2HWIA 2IBKA 2B26A 2CJBA 4CI0B 3TZXA 4CLZA 2XLIA 4UOCA 2EFQA 3C16B 5GAGU 2FY1A 4PEOA 4DOZA 5KFCA 4NXNF 1Y7PA 4Z2XA 2F9DA 1ZBTA 3ENQA 4K0KJ 4C0OC 2CRLA 1Z2ZA 1NPRA 4OMFG 4KFBB 3MFIA 4ERDA 2PI4A 1U2FA 2B4PA 4TU7A 3UR3C 1ZTWA 3RRKA 1TL1A 1YJWS 3CDEA 3THTA 1SQEA 2UV8G 4WTOB 4NXNJ 1FXRA 3JSRA 2FZGB 1KNZA 4J91A 1EETA 2KYZA 2Z30B 1EP4A 3RB6A 1I6JA 1VIOA 3KK1A 2HHVA 1KDNA 2X3GA 3DLGA 3TVKA 4EK2A 4TVAB 2PC6A 1YHQS 2WVDA 4DSJA 1FFGB 3T1HF 1YRTA 2EW9A 2J0WA 3I55S 1X5PA 5F8JA 2Y9HA 2A10A 1X7VA 4MK9A 2PFDA 3PYFA 2CQ1A 4F2RA 1FK9A 2GX8A 3HFVA 4A8XA 5A8WA 4X2BA 2HVEA 4RW8A 4KPYA 3N9UC 2W9CB 2ZH3A 1RWNB 1VBXA 2HNZA 2E66A 4K4ZA 1R8PA 3AJDA 1KQSR 2YH1A 4ZA1A 1A0OB 2OPRB 1NJIT 1RTDB 3T1HJ 2KXNB 1RAAB 5AXLA 4CLPA 4FYXB 1FRKA 2RJZA 5KOXA 1S1VB 5E41A 4DHVA 2OLWA 2XI2A 4HLBA 2R7SA 1IVZA 3MPDA 4HI1A 5CZVA 3K5OA 3DMJB 4E2FB 3LW5C 3D54A 5EGYA 2P8IA 3NWGA 3LP0A 2N7YA 4FN5A 5ETTA 2W2QP 3ETOA 3ETMA 5JUMA 2ZUAA 3JQJA 2W9BA 3BF4A 3KLFB 1RK8A 2XCAA 5CAAA 3TEGA 4JP8A 3AFGA 4GKKJ 1SIWB 3MR3A 4HYKA 1AZSB 3JYTB 1HA1A 1C1CA 2GGPB 1S12A 5DG8A 2YQ0A 1JIHA 4OIXA 3ELHA 4EYHB 2BJ3A 5F8HA 5KFEA 2LMIA 3H20A 2VFRA 2GVZB 1RWPB 2VC1A 3Q0AA 1VQ9S 2WOMB 2OEJA 1TL5A 2EBEA 2F40A 2NXEA 1WDTA 4JI6F 3KJFB 2JWNA 5KFSA 4KKOA 2G1DA 5IFMA 1X0PA 1L5UA 3VAKA 3MTJA 3I31A 3UN2A 3BS9A 2H1YA 3PR5B 3QRPA 2CQ2A 2E5HA 3BSCA 4QCLA 3FRYA 4KPCA 3IGNA 3CD7A 3MM5B 2W24A 3CMES 2YVSA 4ZCLA 1A9NB 1YX2A 4JI6J 2CPFA 2HGLA 2B5JA 4J7CA 2C2NA 4FBUA 2FQQB 3PX0A 4HHUA 3V6DA 3NGRA 1SL2A 4PWUA 2FTRA 1R0AA 2KN4A 3AB4B 1RAIB 3PEHA 2R8JA 1G1XA 5DQGA 4AXIA 5A0YA 1CS4A 4WFZA 2NREA 2KG0A 3MD3A 4BC7A 3VZIA 5J2NB 2GHPA 3F73A 4M1KA 3LALA 4MH8A 4Y2CA 4PRFA 4DSKA 1DTQA 3KJVB 3OFFA 3OLBA 2NUHA 1J5OA 1X4CA 1QUPA 1X4AA 1F5AA 4IO9Q 2P9CA 1D8ZA 3H98A 5GVQA 3HZEA 2XMTA 1RWWB 1NH8A 4O44A 2K8GA 3AJ1A 4LJMA 2CUYA 2O66A 2IIHA 1S6QA 2QE5A 4KJIA 3GJQB 2ZVSA 4PZVA 4ZIWA 5DQIA 3D4JA 2E9ZA 2RHSB 3GPAA 4Y2KA 3TQ1A 3C2PA 4IR1A 2XQCA 2GO8A 2MQQA 1U1OA 1S0OA 2E5IA 2EI5A 1FNXH 1VRQC 3CF5Q 3MD1A 3RAQA 3DRSB 1B4SA 2NXCA 4KHRA 1F3FA 4LF6F 2YKNA 3E2EA 4P75A 1RTHA 4FKXA 4USUA 3AHPA 2R3VA 2YKAA 4U67Q 2A3JA 3CULA 1Y9OA 2B3TB 2GO9A 3R6LB 3L7OA 3Q23A 4LR9A 3DM2A 2EG2A 2MJUA 2MQLA 5KG1A 2FGOA 3CNQP 2GZOA 1KLNA 1IBCB 3NOGA 4DI6A 3PVXA 4OJ1A 2GVDA 3C15B 2XC9A 5E3QA 3H5XA 4LF9F 4RWWA 1M5PC 4ZVRB 2L41A 1VLOA 3V4IA 2KFNA 1T94A 4X4RA 1WC5A 4QR1A 1RT3A 4CO4A 4QYZJ 3M7VA 5L9NA 4ECSA 4KY3A 2QJ3A 2HS0A 2XYHB 3KLEB 2PGCA 4LF1A 4ENOA 4LRDA 3NS7B 1U6FA 4KT0C 4YEAA 1Y0HA 5KFBA 3CVKA 2QL9B 4XPCA 4P52A 2ZH4A 3RBEA 3IS9B 1W25A 3HHLC 3VVTA 4LIRA 2HHUA 1XK8A 1JLCB 4K4SA 2B9YA 3Q2SC 4LF9J 2NUUG 1QD1A 1RBOB 1T03B 4X4PA 1HBMA 4DG1B 3MMCA 5F0WA 4P74A 1X4GA 2W25A 3BH7B 2D3OR 2ILYA 4KIAA 4Q44A 2MQMA 5KFTA 4XAKA 4CLLA 4DL4A 2Z57B 1DURA 5B0BA 1NK4A 2B9WA 2ZJPQ 3BPDA 2H4YB 2X7IA 4UUXA 2HZAA 1TUVA 2EFVA 5M2PA 5J1PA 2FC8A 1FRIA 2GNKA 5K20B 3PW5A 1YK9A 2BKPA 2VKRA 3SSQA 2ZHOA 4DXLA 3QGGA 2I6WA 3FBBA 4UZBA 4J37A 4UW2A 2MDAA 4UF4A 1GXLA 2QX0A 2CG8A 3WHIA 3QGIA 2ZH5A 2JZ5A 3CJ5A 2W1BA 4U8VA 6AT1B 1NDPA 4JV5F 1HMVA 1BQXA 5IT4A 4LBPA 1AROP 1JJCB 4DUZF 1EIYB 4QWEA 2QYCA 2UVVA 2VBWA 3IXQA 4YS2A 3BB5A 3OVSA 2KU7A 1GH8A 2HK3A 3T5KA 4ICLA 3TOQA 4OFZA 4HL9A 1HNZF 2WW8A 2HWHA 4ZPBA 3FCVA 3FEZA 3P6YC 5HK4A 5IV4A 1FD8A 3CT9A 1J5EF 3NS5A 3ILLA 2K06A 2QG9B 3ONQA 1RA7A 4JV5J 1G2EA 1P8GA 1WHXA 1WC0A 3NMAA 1HHQA 3PHTA 3G6XA 1RHMB 2ZDOA 4DUZJ 3WC0A 3PTWA 2G2ZA 3LWLA 3I5CA 1HPZA 2PI5A 2DBBA 1FVQA 2Q6CA 4DV3F 3C8YA 3UW1A 1NH7A 1PC5A 4O0IA 1HNZJ 5B7WA 2XZTB 4Z37A 1R6VA 2B7BB 3MUTP 1X5SA 2J7UA 3R27A 5C7PA 4PG8A 1IBKF 4YB6A 3IG1B 2CIMA 5HJYA 2FHJD 2V34A 4ID8A 1RAHB 2E7WA 4PCQA 3JSBA 1R8BA 2RT3A 4UQTA 3C46A 4USHA 5D3GA 4FF4A 4DV3J 4U7CA 2H5EA 1E6YA 3U1MA 4ZHRA 2DGQA 3SIPB 2I1RA 2M2BA 4M63A 2CPXA 3BGRB 4Y6IA 1JLEA 1RT2B 1IBKJ 3N0VA 1K47A 3GYNA 1U25A 3FKBA 3BBBA 3DDNA 3QZ7A 3BGUA 1AUDA 3FFIA 2MB0B 2HNYA 5FLXY 2EKYA 3EZUA 4C0BA 1WHVA 2R2UA 3M6WA 1X9MA 4ILLA 2YBVA 3QNWB 2L9DA 3BBFA 1MSWD 4ID5B 4LFAF 1I5OB 5HN0A 3BKTA 4ZLNA 4JV2A 1WC1A 2BUNA 3FEYB 2CPEA 4OHYA 4DCJB 1Q8LA 3H25A 2MZTA 1ZM2A 4JV0A 2W8LA 1KEKA 2ZWPA 1NJXA 1DQAA 2FZCB 1S97A 2IC3B 4Y2AA 3GSDA 2HBQB 3IO1A 4DPOA 1PYSB 3ZXWA 1UW4A 2PSZA 4O3SA 4WZQA 1FVSA 1TL7A 3HD1A 1X0FA 2J5AA 1QE1A 4QIEA 1NMEB 3CCZA 5H9EK 4LFAJ 3CCTA 3OUYA 1PCAA 2HAFA 4KGZB 1UJ4A 3HX9A 2AJQA 2EPIA 3EGZA 2J9DE 4DR6J 1S10A 4ECWA 3CXCR 1S1TB 4FYDA 3A12A 5B08A 1YRUA 1OPIA 4ECTA 2VZ9A 2U1AA 2XEXA 5C25B 1F5BA 3EDQB 4OZ3A 2WONB 3TR5A 5CYQA 5F8LA 3LZ8A 3NMRA 5D8HB 5ETVA 5FDLA 3K8VA 3W2WB 3D6FB 4IG3A 3M4XA 3DRXA 3CJ8A 1RTIA 3H42A 3B4DA 2BBEA 8ATCB 1GTEA 1FJGF 2DNRA 1EKRA 4DSIA 2QLBB 3SQGB 3C6UA 4KGKA 3PHEA 4RZRA 1R0CB 2XMUA 1SKSA 1HBOA 2MQNA 4AT1B 3I0SA 2D3ZA 2EK6A 1VQ5S 2Q6BA 1G3OA 2C3YA 3LAKA 3M1VA 4OYPA 1DLOB 4PKDB 2FJBB 3ZZZA 5EUHA 2O5DA 2R7WA 2DNPA 3PCOB 3D1HA 1FJGJ 1HWKA 1M0SA 1U2RA 1T9VA 1ULRA 3KDOA 5I3PA 2ZE2B 1Q82T 1BQNA 1HI0P 1U6BA 4GMKA 3OXFA 2UXDF 4USJC 2LA4A 1U8SA 2DGWA 2MKKA 2KXHA 2Z8QA 5K14A 4M5HA 2XY7A 4I56A 4KC5A 4QYRA 1YIJS 1ROFA 2IM3A 3QO9B 3JQMA 1TZ0A 3MM7A 3TJ8A 1S1XA 5GADI 3RR8A 3VAMA 1NSKL 2GHWA 3MI7X 4I1TA 1WACA 5FD1A 2V8HA 3HFKA 1HNIB 3NNHA 3TZZA 1S48A 2KZZA 2UXDJ 1MW7A 4P73A 4C97A 3VAJA 1XR6A 1DQ8A 1UWAA 3RZAA 2OGUA 2IVFB 3GSIA 3M2RB 4ZCKA 3D0IE 1FERA 4UOFA 4CLUA 3DXBA 3LF0A 4A8QA 5FLXU 5KG5A 3KKFA 4DPUA 4L74A 4QIWD 2A6MA 2MQPA 2EFNA 3DGVA 1WEZA 4W4MA 3TVZA 1Q8KA 1CBKA 3U02A 3W9JA 1NU4A 2XY6A 2ASLA 5DJBA 1SUQB 1BQMA 5IC4B 2Q2GA 1RT6A 1WHWA 3MEDB 5HLFA 4X4TA 4Z7CA 2XMJA 1R8HA 1RLCL 1NSAA 3M8PA 3T1YF 1LK5A 4N5SA 4MIBA 2ZD1B 4ZN3A 2VBZA 3QGPA 2ZNYA 4KGVB 4MK7A 4WIIA 2AJ4A 5F8MA 1FWLA 2XHWA 2ZC4A 4DQPA 3K5MA 3OBIA 3H4DA 1Q78A 1DBDA 3KLHB 5KAKA 5AXKA 3GYGA 2KXFA 1GMWA 3P4UB 1JLBA 4EU0A 3T1YJ 4IO1A 4ELVA 4LQ9A 4X62F 3NGDA 3HF5A 1KD1T 2WAQD 1QM9A 4TKTA 4WU3A 1JLGB 4OI2A 3OR2B 1N5VA 3CJQA 1LW2A 3IWNC 3ZZPA 5GAEU 4ED1A 3FSXA 1HARA 2OPPB 3KMSA 1VRUB 1VRTB 5I3QA 2AZ3A 2CPHA 1FF2A 2P6TA 3OPKA 3I32A 2MQ8A 1TKDA 3G82A 2ZH8A 1FE0A 4CM0A 2OFHX 1KHVA 2Z58B 4M5KA 4X62J 1H74A 2BACA 4OX8A 3RYLA 4ED0A 4K5SA 2BE9B 2OPSB 3P49B 3GJSB 2F7VA 1C2PA 3MCNA 4F2SA 3DRRA 3CCJS 4DR2F 3H2VE 2ZZMA 2ZVIA 3HVTA 2QA4S 1QLNA 3PG9A 2AJ2A 4R8UA 3DOMA 1PIEA 3ITHB 1L3UA 1CJKA 2C1EB 1CLFA 7AT1B 1W7WA 5ETOA 2ZH6A 4DR2J 1XMOF 1S1WB 3F41A 2V2KA 1M5SA 2DNQA 3JXOA 5DO2A 3NGTA 2OKQA 4ECQA 4DZ6A 4UUWA 2YNHA 5AE1A 5KT7A 2DO4A 5D77A 2H65B 3PRBA 2L48A 3NOCA 2MKHA 3J81j 2UUAF 3A1YG 1DRZA 3MMBA 2JLGA 4IRKA 5C24B 2A2CA 1LW0B 3TAQA 2Y0SD 2FHMA 1MLAA 2C3MA 1SC6A 4XO0A 1JLQB 5F3ZA 3IWXA 1N6QA 1XMOJ 2VONA 5HP1B 4JI8F 1N5TA 1IKYA 3EVMA 5KFOA 2F3JA 2OP5A 4ZVPB 2IRUA 1UJ5A 4DMZA 2RSQA 1VQOS 4CCHA 2BANA 1YLXA 3FBEA 1X9WA 2Y0BB 1N52B 3OL7A 3BYRA 1H38A 3JAMY 2B8PA 5HQMA 4DQQA 2XBPA 2UUAJ 2M70A 2FHJA 2DNYA 2IMWP 1EHWA 2DR8A 1JQGA 1KRPA 2ZBPA 2C2OB 4JI8J 3QJPA 3HHLD 4RW9A 3G4SS 3MECB 4DU8A 1YI2S 1NHVA 4N7TA 5HROB 1TELA 2AYBA 5D4LA 3PYGA 2V5HG 3KG1A 2B9EA 3EMTA 2M0GB 3W5YA 1SJFA 4DPYA 4NX9A 1UPMB 4H4MA 1QSYA 3A8EA 3RBXA 3G8SA 3L95X 4FXWA 1B7FA 1N5SA 2CZVC 1R6YA 3GIJA 1F2HA 2IM0A 3PJ9A 3T1AA 2CPDA 5E2QA 3D66A 2KM8B 1OYEA 2VFSA 3RRGA 1GTHA 3HJVA 2P6SA 5C2CA 1DAXA 4F36A 4XIUA 2VPZB 5BR8F 3EICA 5KFKA 3OR1B 3DRYA 1NJWA 3DOLA 1LWCA 4AE5A 5BYSA 1RTZA 2C28A 2PT0A 4PWDA 2LEAA 1X31C 2WCXA 3M30A 1UVLA 3GV7B 4O3QA 2SXLA 1F1BB 2W7PA 3QT8A 4RW4A 3I87A 3QFHA 3SSRA 4EFAC 5CQGA 3BR8A 2MKYA 3CUNA 1SJRA 2DR7A 3NBPA 3NAIA 3FSYA 2FJAB 5BR8J 3L09A 3A3PB 4S0MA 2RILA 1FWKA 2HWTA 1WJ9A 1ZAVA 3EGNA 5CCLA 3KK3B 3TEHB 3GP9A 4NA3A 3RW6A 3RTVA 4ECUA 3UCGA 1X4DA 4GVBB 3A8JA 2CNLB 3DU5A 3I0RB 5KG0A 5H1SV 1PGZA 2D7SA 3E51A 4DSLA 1NNDA 2JNJA 1ZS6A 1SL0A 1OJ4A 4KV8A 5KFDA 4JI7F 4I2PB 2XWXA 2CA9A 1HW8A 1NK9A 2RE1A 2ACMA 1WOPA 1ZAXA 5HVGA 5HQLA 2DH8A 4ES3A 4DV1F 5CYJA 1U2CA 4L75A 4N8OA 1JXLA 1ZH5A 4ED8A 3QIPA 3TA2A 3E3XA 1PILA 2ZH2A 2LEBA 1HQEB 2DEIA 1APSA 2HBRB 3J7YU 1QSSA 2UUBF 1D0EA 2RB7A 2XSJA 1UWBA 3TW0A 2QMXA 1VI7A 4JI7J 1BWEA 5A8RB 4HDGA 3OVAA 3QLHA 5GAHU 2DR9A 2MGZA 1N0VC 3G8TA 3GWCA 4DV1J 2VFVA 4QR0A 1N36F 2YXLA 3EZOA 5F8IA 1RI7A 3JAMU 4C11A 3BH6B 4QQBA 3N28A 1HNVB 4C48A 4IH6A 1H2UX 2UUBJ 1WKJA 2RS8A 2V50A 1VK3A 1TUGB 1T9XA 3OXGA 3UWTA 1LFWA 3AGXA 5IS2A 3UFCX 4P2FA 2NSBA 2ROPA 2KT3A 3CMAS 1WG4A 1QTNB 4OZ0A 5BXIA 5SZTA 3PO5A 3BQ1A 3DRPB 2JEGA 1X5TA 3HULA 1N36J 4ZS6A 3MR6A 1JLAA 1O5JA 4XTTA 4NI2A 1XMQF 1OQ3A 2NLWA 2KB2A 2LKZA 3DLBA 4GVLA 1CG2A 1S72S 2QFIA 5DQHA 5DLFA 2YWGA 1EQ0A 2XLKA 2XULA 2W9AA 4RNMA 3WX4A 3UR0A 2MQOA 2PIIA 2CNOB 3E01B 2MLYA 4UOHA 1FKOA 1TK0A 2QIFA 3UE2A 2B56A 1X9SA 1KKHA 4ILRA 3RAXA 4IOAQ 1WSRA 4PYDA 4PPZA 1YGYA 3MUVP 5CD4H 5G0RA 3PEJA 1P9YA 1HWLA 2V8PA 2HQGA 3R1HA 4ZPWR 4DL7A 1U0HA 2MLZA 4YDXA 3ILOA 4OQJA 2G9OA 1T9WA 2NR0A 3H5UA 1JJ2R 1TKZA 1BLUA 1MG7A 2RUGA 2K1RA 3SCKE 5JJBA 1LWFA 3M2UB 3MUMP 2H5JB 3UN5A 2X51A 2V2ZA 4ED4A 9RUBA 3OHBA 4Q5VA 1GEHA 3QRRA 5KG2A 3BREA 2Y1JA 2DNZA 4DN0A 3IGVA 1Q0NA 1JLFA 3HVRA 1CJTA 3CO9A 3PZPA 1K0VA 2LQBA 4WFAQ 1IM4A 2OH2A 2BR0A 2H3EB 2DNNA 5HQ8A 4AL7A 4WP9A 1TL1B 1PSDA 3VAFA 5KFRA 3QGHA 2RDIA 3G87A 4N41A 1NAQA 1IN0A 2L9WA 3CJKA 1NJZA 3PW7A 3T19A 3POTB 4M5GA 3UI3A 1EP4B 3KHRA 2DK2A 4LREA 2FLLA 3KG4A 1OY6A 2DH9A 4DFPA 4ZLPA 3M8QA 5LJ3Y 4FZVA 3FCHA 4USIA 3EXYA 1JKHB 5J2QB 1NKBA 3TRGA 4WKYA 1YJNS 3R7NB 2VODA 4LF5F 4RUCA 2HW3A 5IT0A 1FTRA 5A6PA 5K8PA 2X1AA 2E1RA 4XDDA 2H51B 4U8YA 4ZPVR 3B54A 3C16A 1S49A 5H9FK 5KG4A 2DRDA 2HFSA 2HNZB 5MLCV 1VDHA 3VGUA 2WK4A 1JJ4A 3EM1A 2DY1A 2CQPA 2HFUA 2VL1A 4KFBA 3CTRA 2GIQA 3K17A 1BD6A 2YNFA 2WSEC 2YQ1A 1PC4A 5IC6B 4LF5J 4JI1F 1LFPA 4OZ1A 2C2ZB 4HH0A 3QZ8A 3W64A 2YTCA 4C98A 4MK8A 2I5JB 4ED2A 2JSXA 1HI1A 4ECXA 1WG5A 4DF8A 1HQUB 2YQ3A 3LAMA 2EC2A 3LP0B 5KG7A 3C5XC 3HHKA 1EJ7L 1UZDA 3AGZA 2K7JA 3CEDA 3I5AA 3RR7A 3KLIB 2FVRA 3BJYA 4NLRA 3HCXA 2JC1A 4JI1J 3HZGA 2DNMA 3O3LA 3AA9A 1RHRB 1OSDA 3DI6B 2ZH9A 2AEMA 3M9MB 1S6PB 2HVZA 3P5BP 2D3UA 1KN6A 1C1CB 1MN9A 1W26A 2D9PA 2OPRA 3NKYA 1TAQA 2NXJA 2W7AA 4H4OA 2AQ4A 2DXEA 4C3KA 2VD3A 1RTDA 1JNRB 5IT9Y 2KZMA 1ZZNA 2D74B 1MMLA 3G6ES 3V81B 4N56A 1B0PA 1WEYA 3M6UA 1UFKA 4K4UA 2MJNA 2BJEA 4OL8A 3BSAA 5CYMA 2XNRA 5D0GA 4PXBA 1O8BA 4OX6A 2WHOA 3KNGA 4ES2A 4NLUA 5T7LB 3NAHA 4WZMA 2RIJA 1OO0B 2F1FA 4ECVA 3ZFVA 2YPYA 2R7TA 3WC2A 2UUTA 4NZ6A 2DGTA 2Z2YB 5D4PA 1F0XA 1CC7A 2B7CB 4TQSA 3CJSA 3GTYX 4O3RA 1VJWA 5K9FA 4A8WA 4IG0B 1V5IB 2HMIB 1PBAA 4LRBA 1ZOTA 3SDEB 2AHOB 2B5JB 5HAOA 3FQKA 3KLGB 3Q8VA 2GGPA 3UDLA 2DT9A 1RTJB 4OI4A 2DEJA 5A76A 7FDRA 4K4YA 2POKA 1GXTA 3L7UA 1R0AB 2GVZA 2WOMA 5JMNA 2HFVA 3FNNA 4RUAA 1RHJB 4KSEB 3P96A 1RB0A 1FTCA 2IFXA 1RYRA 2DPIA 1S4FA 1Q81T 1NB2A 1OSCA 2DHGA 2ABYA 5LXYA 2ZOFA 4HDHA 2KTQA 4IFVB 3IMQJ 2ZBRA 4XK8C 1SV5A 1HWJA 3AOCA 1KTVA 2BVZA 2DXFA 4OI0A 2HHWA 4JV1A 1J5OB 4R5PB 2DNLA 4KHPF 3QSIA 5RUBA 1FKAF 1FNMA 3ENWA 1J27A 2Z2MA 3HKWA 3S01A 5DETA 1D09B 4O44B 4Y2MA 3BYPA 4XDCA 4K4TA 4L6V3 3K5NA 4DR7F 2OMOA 3MM5A 1WC4A 1RGVA 1YBUA 2LDIA 2ASYA 2GJ2A 1K73T 4WK1A 1IR0A 8RUCA 4M95A 5GADU 1KVJA 3JTPA 4CYUA 5DGAA 2W2OP 3H40A 1FDBA 3G86A 4KHPJ 1DQ9A 3G6VA 4NYPA 1QAIA 4RBVA 1ICEB 4MFBB 4UTGA 4GC7A 3N5BA 2GJFA 4RBUA 1MU2A 1SH2A 2XSFA 1KS2A 4OLPA 4DV4F 4DR7J 4P72A 3OTOJ 2W4PA 5DLGA 5J2NA 2DB1A 5THWA 1NKEA 3AD8C 2GQCA 3H2LA 4X66F 3HD2A 3KJVA 2IRXA 3BQ0A 3GIRA 4I4BA 2GV1A 5K8OA 5T41A 2W7OA 3VALA 4KO0B 1YJRA 1BY9A 3BN4A 4L3NA 1WUUA 4YP3A 2DR5A 4HACB 4DFKA 1NK8A 4DV4J 4QU6A 1RT3B 4NLXA 3DHXA 5IT9U 4EO6A 2CDQA 4YMEA 3VWSA 4Q2MA 3SXLA 2N4CA 1JXVA 4OJGA 4X66J 1VHIA 3GZ7A 4I7FA 4WXOA 4MT1A 1RKIA 2KH9A 1RWVB 4W92B 4RLEA 3CJ4A 3LA0A 4C8KA 1S9EB 1GXUA 3I5BA 3DRSA 5GMEA 3G2XA 4RKUC 4BS2A 2J8AA 3I4HX 4NMXA 4Y0FA 5BJRA 1V5VA 4OYAA 2QMWA 1C4CA 2WW4A 4WXWA 3QYYA 3HSDA 5E3AA 4EYIB 3RJMB 3FGVA 3CC7S 1REGX 2R8IA 1AFIA 2PN6A 4L3KA 2AJ1A 3WBZA 2CQCA 3W2VB 1VBZA 5F9LA 1RYSA 1IKXB 1WC6A 4RPFA 3VHQA 4DV6F 1X8DA 3C15A 4IOBA 1WKKA 3IP0A 2IJFA 3FC9A 4ZCMA 3S8SA 1YJVA 2HVDA 3PXGa 1WSVA 3KLEA 3HO1A 5J2PB 2BOPA 1VFJA 3HMJG 1GT8A 1BGXT 2KT5A 3M9OB 1FCAA 4LF2A 4DS4A 1T9TA 3IS9A 3HK2A 3NS6A 4DV6J 3GIKA 4M5LA 3LH2S 4NZ0A 4MTPA 1JLCA 2ROEA 4N47A 1NB7A 5KFZA 2BW2A 1T03A 5A8KB 3Q83A 5J2MB 4KRWA 2B6AB 4NA2A 4E8UA 2HS4A 1FE4A 1WDDA 4DPTA 3FMWA 2K7KA 3FDSA 5DDOC 1Q95G 3NCPA 4C8NA 1DHMA 1C1BB 3OL8A 1IKWA 1UZHA 1VQNS 2AZ1A 2F8HA 3V6HA 4LSLB 1TUWA 4OHZA 4M5DA 1QAJA 2ATLA 2M52A 1VQ7S 2B4OA 2ZZNA 1WF2A 2J9DA 4YOEA 3BO2A 3NY0A 2WTFA 2C2KB 2CJXB 5AE3A 1HIYA 4FS2A 4FYVB 4MYTA 3MR5A 1PYOB 1XNRF 3HHEA 2ATCB 1RKJA 1IXKA 4FPIA 2ZEJA 2YNIB 3CCUS 3HSZA 5IWAF 2IBOA 1VQLS 1RA6A 3CWJA 5CABA 2RF2B 4UOGA 5L38A 5KFYA 2XO7A 4QU7A 1YITS 2ZWOA 4DSFA 3EGWB 4ZP8A 4RNNA 5F0UA 1E6YB 4AUKA 4ZHRB 3MAAA 2OMLA 4XPEA 4AD6A 3K0JA 2K3IA 4HEA9 2J6SA 1RLDA 1Y00A 2D1CA 1P9QC 1JLEB 4F4ZA 4WFBQ 3PY8A 4N8NA 5BYQA 2IM2A 1OQ6A 9ATCB 5HSPA 3MCMA 4B08A 2MKSA 2A6OA 4F3MA 2HNYB 1QVGR 5KFXA 5IWAJ 1C0UA 2WVEA 2G0IA 1UTAA 4NLYA 5CCMA 3Q8PB 1UKUA 3NXZA 2HIYA 1NK5A 4WFYA 2NXNA 2J76E 3BV8A 3W61A 1NHUA 2ZBCA 5ETKA 1VQKS 3VGSA 1R89A 3CCQS 4TQRA 1O0PA 4DQSA 2HBYB 2YH0A 1VYAA 4GKJJ 1ZPWX 4EBCA 4CO1A 3F56A 4NCGB 2G0CA 1JB0C 2NPFA 3RB4A 3LP1B 3GFYA 3BKFA 4U9RA 4LFCF 3H59A 3K58A 4B3OA 2K2PA 4ETXA 2GQ2A 2MZSA 1AXQA 3PRVA 4HTJA 1H2TZ 3HI9A 1UVNA 1VIXA 1Q86T 3HSGA 4C4WA 3D67A 4DBQA 1RT2A 4OYOA 2QC3A 2NZ4A 3GYXB 1YJTA 5H9EJ 1FEEA 4JBCA 3KG0A 1NJYA 4Y2IA 4NXMF 4OX9F 4O3NA 3R9LA 4LFCJ 3HFZB 5CYQB 1GAOA 4LVNP 3W60A 2PO4A 5EDWA 2Z2ZA 2LQ5A 1EX8A 3UDCA 1QDUB 2CZ4A 5FDLB 2OD6A 3GV8B 4ETZA 2GMJA 1VR6A 2HFZA 4ID5A 4DWIA 3HVAA 2E7VA 1XJWB 2AGOA 1U1NA 3V5RA 2BQRA 2QV6A 1NCLA 1YJ9S 3C6UB 2V0NA 4LBHA 2WBRA 1WF0A 2W01A 3C3LA 3U1LA 4OHVA 1HW9A 1NZ8A 1T9UA 2IC3A 3THPA 2XGPA 2M8DB 1HBOB 1UMJA 4NXMJ 4OX9J 2JVRA 4ECZA 3TP2A 1YZ7A 2GC8A 4I0WA 1FA0A 2E1AA 4HR2A 2MY8A 2CQBA 3TAMB 2KYXA 3M1VB 3J7ZT 4R25A 1NKCA 1SB6A 3W9HA 4H54A 2B8QA 3FQLA 3K89A 1MMDA 2DYAA 2DJWA 3VAHA 2WB1D 2ZBQA 2IAJB 4F0KA 2GAHC 3IA0A 3B8HA 1RCOB 2A2DA 1S1TA 4QZVB 1BQNB 2MPUA 2R2RA 3BBCA 3MCSA 3HHLB 3CJ2A 2DH7A 4NYOA 3SFUA 5C25A 2VBYA 1JNZB 3IR5B 2WONA 1TP7A 5E7OB 3R8YA 4OZNA 2VOOA 1HLWA 3GJTB 1Q16B 3Q89A 4OYIA 5KFFA 1NSQA 3MPUB 3GFHA 1CJVA 4A8FA 3W2WA 4DL2A 1AFJA 2CWXA 4DN9A 2VUGA 3AXKA 5T14A 2ADBA 1D3WA 2Y1IA 3H0PA 1JMTA 4ZPTR 4B9NA 4CT8A 2AX1A 2QGFB 2AU0A 1N48A 3D9BA 4X4UA 2V4JB 2Q3PA 1KLMA 1RWMB 4UT4A 4ZVSB 3DC2A 5KFJA 3L4BC 1WC3A 2WB4A 1S0VA 4F4WA 1IJFB 3C6EC 1TFYA 4U7UD 3O2IA 4NLTA 1VBYA 1DLOA 3W63A 4TLQA 4V1Ak 4ANEA 1N56A 2B4VA 2Q79A 1N5YB 2JC0A 1TQLA 1MROB 2Q1LA 1T9YA 3W1YC 2FDNA 5KFVA 4TU9A 1BQMB 2ZE2A 1VJQA 3V6KA 3IRXA 4JB8B 1HYSA 1FX2A 4J9PA 2YX4A 2AD9A 3MEGB 3M8PB 3MM8B 2FJVA 4OJ3A 5HMWA 3RAMA 3PW4A 4I6AA 3TUJC 2RVJA 4DDFA 3AH6A 3L9ZA 4NCBA 4DX5A 2MZQA 1RT1B 3V2UC 2M9KA 2QT7A 1TL3B 1U09A 4AL5A 2ADCA 2OSRA 3SCIE 2NXUA 2ASJA 1WI8A 1HNIA 3ZTSA 3C6TB 4OYXA 2PMZD 3UN3A 4UZCA 1JLBB 3RB3A 1T11A 2UUCF 3RU0A 2FLOA 3M2RA 2ZDPA 4AXJA 4K4VA 1CJUB 2BRLA 4Y34A 5KFIA 5C42A 3BGFA 1OMSA 2CJYB 2APOA 1WORA 2F4FA 2CG4A 1KWMA 3M8RA 1SUQA 1O51A 2P9GA 3WDOA 3KHGA 4A8MP 5JXSA 3KOAA 3R5GA 4CO0A 2XY5A 4DQRA 1QJHA 2VPWB 2UUCJ 3CIMA 5K5MA 4DZDA 4X64F 5AE2A 5EN1A 1IBMF 4NL5A 1SJ3P 3HVTB 4L73A 1Q4RA 4K2JA 1VOMA 2FJWA 1NUEA 3KLHA 1Y4ZB 2JDJA 4R8UB 2ALYB 3EDRB 3TANA 1IUJA 1RDRA 1S79A 4DR5F 1M5KC 1AW0A 4G65A 4X64J 1QAXA 1PYTA 2MKJA 2QO3A 1IBMJ 4YB7A 1JLGA 2OEMA 3OR2A 1CULA 3MAHA 4ZPCA 2G4BA 2LEPA 2J6UA 1VRUA 1U6ZA 3MMJA 2JHEA 3DLHA 1BHNA 4QWAA 2OTJS 2JL9A 2YWWA 4CDIA 3FJ2A 4DR5J 1YTYA 4CH1A 3MMBB 4N77A 3OQ2A 1MN7A 3PM9A 1VQ8S 2DNGA 1KP6A 1S6OA 2HGMA 2UU9F 3DOKA 2AP6A 1IKYB 4CLYA 4LF6J 1P1TA 1UL3A 2BE2B 2BANB 3DLEA 1KC8T 1LOUA 2Z2LA 3JQKA 5ETQA 2HAIA 2GIRA 1U1LA 3DLKB 3ITHA 2V4RA 3ILIA 3UD5A 3A4TA 1GK8A 2RKIB 4RW6A 5HL7Q 1FNOA 1VQMS 1URNA
chains in the Genus database with same CATH topology
1NLTA 1EARA 2Q2GA 3TJ9A 1GMUA 4L3KA 1EB0A 3TJ8A 3LZ8A 3NXZA 1XAOA 2B26A 2HFVA 3AGXA 1GMWA 3I38A 3L9ZA 3TJAA 1C3GA 3LA0A 3NY0A 1GMWD 3AGYA 3AGZA 4J80A 1GMVA 2QLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLT A;  1EAR A;  2Q2G A;  3TJ9 A;  1GMU A;  4L3K A;  1EB0 A;  3TJ8 A;  3LZ8 A;  3NXZ A;  1XAO A;  2B26 A;  2HFV A;  3AGX A;  1GMW A;  3I38 A;  3L9Z A;  3TJA A;  1C3G A;  3LA0 A;  3NY0 A;  1GMW D;  3AGY A;  3AGZ A;  4J80 A;  1GMV A;  2QLD A; 
#chains in the Genus database with same CATH topology
 1RHQ B;  3HHD A;  2JVM A;  3X3U A;  2UU9 J;  5EWF A;  1VC5 A;  4RW9 B;  5KG3 A;  2GHV C;  2BMB A;  5HMY A;  1H98 A;  4M8L A;  2E9R X;  5DGB A;  5HBM B;  4B9U A;  3TAP A;  4O4R A;  1R43 A;  3G71 S;  5L8R C;  4ED6 A;  1U47 A;  3BM7 A;  4H4M B;  5IOL A;  2F4V F;  4YFU A;  2LXI A;  1BXN A;  5D0E A;  4C6A A;  1I51 B;  1QAY A;  3MUR P;  5LMU F;  1DTT B;  1JLQ A;  4K50 A;  1YWX A;  1YG0 A;  4OYW A;  5HP1 A;  2VG7 A;  4WKR A;  1Y5N B;  2C3U A;  1RAF B;  3FMB A;  4OYM A;  3MTK A;  1IBL F;  2Z56 B;  4WYL A;  4LSN B;  4F3Q A;  3OLA A;  2O1P A;  3SSS A;  3KFW X;  4YQW A;  2QFJ A;  2F4V J;  1D1U A;  2EFO A;  4LF8 F;  2AIR B;  1UPP A;  2DR6 A;  3H5S A;  2DO0 A;  1T05 B;  2QA1 A;  1OY9 A;  5LMU J;  3M30 B;  1KON A;  4USW A;  2CJA A;  3MEC A;  2XMM A;  3GG1 A;  5HRO A;  3TQE A;  2DIS A;  1IBL J;  3PW2 A;  3RB0 A;  4KTQ A;  4PAA A;  4FVM A;  4DUY F;  3D3B J;  1RHU B;  5LOQ A;  1UJ6 A;  4USK A;  1PBU A;  4LF8 J;  1XER A;  4CLS A;  1H73 A;  1X4B A;  1NK6 A;  5AJ3 F;  3ILJ A;  2NZC A;  2BJ7 A;  3LO3 A;  4F50 A;  3Q2T C;  4IH5 A;  2ZFH A;  4ZN1 A;  4EUV A;  2FVQ A;  5KOW A;  1LWX A;  3PYD A;  2EC0 A;  2RRN A;  1R3N A;  2QMU B;  4WYW A;  1Q79 A;  3VV2 B;  3DNC A;  4B9S A;  2DNH A;  1ZYQ A;  1RBA A;  1J5E J;  4Y00 A;  2CNN B;  4Q45 A;  4JYA F;  4LBI A;  5AJ3 J;  1U45 A;  1WEX A;  4O4G A;  3O1L A;  1RWK B;  2G13 A;  1R31 A;  4CP5 A;  5L46 A;  2VJU A;  5LJ5 Y;  3NL0 A;  2FYX A;  1FDA A;  3D6T B;  1U1M A;  1V6H A;  1UWB B;  2BJD A;  3OHA A;  1DY3 A;  4PQU B;  3JTN A;  2OI2 A;  5I3U A;  4KHM A;  1KSP A;  1KFD A;  4ZVU B;  1S1U A;  2HHS A;  1TV6 A;  4RUB A;  4JYA J;  2DKO B;  2R7U A;  1MWQ A;  1HBN B;  3O44 A;  1U1Q A;  4P10 A;  2MY7 A;  3R7B B;  3PKM A;  4GVB A;  3EE3 A;  3I0R A;  2CNK B;  4OHX A;  2R9L A;  1WOO A;  1NEE A;  4MKY A;  3TX0 A;  1TKX B;  4LFB F;  1BWV A;  5D0R A;  5F8G A;  2OJ3 A;  2CQG A;  3AJ2 A;  5KFH A;  2NS1 B;  4JI4 F;  4PXC A;  4QWC A;  1VMB A;  3N4W A;  2XNQ A;  3OVB A;  1NDL A;  2BKN A;  4NI2 B;  3NG8 A;  2VV5 A;  2VQE F;  1XTZ A;  5KFG A;  5JVH Q;  2I2Y A;  2DGO A;  1HQE A;  2ZC3 A;  2VC0 A;  4LFB J;  1OPZ A;  1RAG B;  1FKO B;  3MEE B;  2RRA A;  4I68 A;  4K4X A;  3ENV A;  4EEY A;  5HMZ A;  5A8R A;  5KT6 A;  1VK8 A;  4JI4 J;  2IJR A;  3BGL A;  2ILZ A;  5GMK a;  2J0X A;  3DLJ A;  3U27 A;  1Q7Y T;  4GC6 A;  2VQE J;  1JX4 A;  2NYH A;  1RXO B;  1TL4 A;  1REV B;  1S99 A;  4OLO A;  1TU0 B;  1HNV A;  4G1Q B;  1YBA A;  2E9T A;  3UO0 A;  1RZM A;  2AJ0 A;  1S7I A;  1WI6 A;  2VQF F;  3N6M A;  5D0H A;  3WZ0 A;  4X4Q A;  2CFX A;  4IUF A;  1JLF B;  1CJT B;  5CXT A;  2GA7 A;  3SCL E;  3TJA A;  1M5V C;  2HHX A;  2R8H A;  3DRP A;  2HRY A;  2RQM A;  4DLG A;  2YWK A;  1GMV A;  1XMB A;  3EVO A;  2R7X A;  2EXU A;  2PEH A;  3NCQ A;  3CJR A;  3EWG A;  4ZDN A;  3K2Y A;  2ALZ A;  2WVC A;  1WG1 A;  2I0X A;  2IY5 B;  4EO8 A;  5DM6 Q;  1IWG A;  3DGP B;  1H3D A;  3ZTP A;  4I67 A;  3K59 A;  2JFK A;  3E01 A;  4ZCI A;  2H4W B;  1U1K A;  2HND A;  2J9E A;  2VQF J;  3D1Q A;  4ZOS A;  3T41 A;  4ZKA A;  1R7I A;  4G1P A;  4B9L A;  3ZZT A;  4ZLJ A;  1X4H A;  3U1N A;  1L3V A;  1A6L A;  2QLJ B;  2JEI A;  2XO6 A;  2CPY A;  2DGV A;  2E44 A;  1X5O A;  4B3S F;  1U8W A;  4EBD A;  3MMA B;  5KT2 A;  2FVP A;  3WIU A;  2IM1 A;  1K44 A;  2YKM A;  3S7R A;  3ZTQ A;  3AGY A;  3C66 A;  4NCA A;  2Y8Y A;  5K8M A;  2DNK A;  3M2U A;  4B02 A;  4BWM A;  3OL6 A;  3NCR A;  1XQI A;  2G2O A;  1S57 A;  1K0T A;  4NE9 C;  1W2B R;  2G0J A;  4C3M A;  1PKU A;  5B0E A;  2RU3 A;  4OHW A;  2CKW A;  5LM7 E;  2M88 A;  2JEJ A;  1KR4 A;  2N3L A;  3UVJ B;  4KE5 A;  1S9G B;  1PO6 A;  1NHK L;  3QID A;  4C8L A;  2LU2 A;  2HRU A;  3TX8 A;  5GAE I;  1A7G E;  4CLK A;  1VQY A;  2ZZT A;  2P9E A;  4QW8 A;  4B3S J;  2CJ9 A;  5H9F J;  4WFN Q;  2YNF B;  4R0J A;  3D68 A;  1KVI A;  2IVY A;  2XMW A;  4P2S A;  3I38 A;  5AXN A;  1H7X A;  4CRJ A;  1RJJ A;  3CSK A;  3KUH A;  1Q8B A;  4IQX A;  2ZHB A;  2CQ4 A;  3UD4 P;  3MAQ A;  3R6G B;  3POT A;  4RO0 A;  4C3L A;  3SV3 A;  5ITH A;  4MMO A;  2HFN A;  1RBL A;  2BJ1 A;  2BXJ A;  4LQ3 A;  4UY8 T;  1AUS L;  1CQN A;  5KFQ A;  1RSC A;  2FVC A;  3W5Z A;  1JKH A;  2DNO A;  3TYT A;  4YDD B;  5IM0 B;  3O8W A;  5J2Q A;  5D4O A;  3H2U B;  3THV A;  2E1P A;  4ES1 A;  2EEY A;  2VOP A;  4ZP9 A;  2ZKT A;  5DG9 A;  1IKV B;  2IPO B;  1K8A T;  4Y28 C;  2V63 A;  3FCW A;  2UVR A;  5A2Q Y;  2BQ3 A;  2MLX A;  4NLQ A;  3UDV A;  2EK1 A;  2A18 A;  1T8E A;  4BHQ A;  5KTQ A;  3SQO P;  3M6V A;  4HH1 A;  3GII A;  2F8E X;  4ZP6 A;  1H7W A;  4OV6 A;  4IFY B;  2DTJ A;  4DPW A;  5F41 A;  4L76 A;  2RD5 C;  1YJU A;  4H4O B;  2LA6 A;  2C2E A;  2HZV A;  4ED7 A;  2KL8 A;  5G4D A;  5HMX A;  4F04 B;  2B9X A;  4H4K A;  2LQ9 A;  4EI2 A;  2DHX A;  1UW9 A;  1IWA A;  4A47 A;  1SQF A;  5CYM B;  1IR1 A;  3MEK A;  2V2V A;  2X1G A;  3OJS A;  2IDL A;  4NAS A;  2JFD A;  4GKK F;  2VG6 A;  4DPX A;  2O01 C;  2I5J A;  2XS7 A;  2ODX A;  4F4A A;  1HQU A;  1B7Y B;  4PUO B;  2XZD B;  3LPE A;  1HL6 A;  1RAB B;  3GIL A;  2ZIT A;  1MWY A;  3GON A;  3D6H B;  2KI2 A;  3TZY A;  1NPP A;  5I42 A;  3FK4 A;  3KLI A;  5FII A;  1GNK A;  1UVM A;  1VQS A;  3M2V B;  1ZM9 A;  2ZOM A;  3Q8S B;  1JK9 B;  4ZK7 M;  1SIZ A;  3A3O B;  3KWM A;  1HNW F;  3DI6 A;  1S6P A;  2J7K A;  5KFU A;  2FJX A;  1U1P A;  4A8O A;  2RHQ B;  2ZBI A;  3I6P A;  4J9R A;  1B0T A;  4HI2 A;  4AND A;  5B0C A;  2FJE B;  3FBC A;  2CQ0 A;  3OSN A;  2AGP A;  3L7P A;  3NGK A;  3UDE A;  4ELT A;  1X4F A;  3V81 A;  1M1H A;  3ISN C;  2QLD A;  2CJK A;  4P7T A;  1M5H A;  4RW7 A;  2XI3 A;  4LF4 F;  5J1E B;  3IAS 9;  2OEL A;  1HNW J;  1SV5 B;  5T7L A;  3C14 B;  4WU2 A;  2UP1 A;  2R8G A;  4USV A;  3PJW A;  5KFM A;  5CD4 A;  2NSC A;  1E6V B;  3TVY A;  2YNG B;  2I9S A;  1NXI A;  2M4M A;  2AMC B;  4D3H A;  3EZ5 A;  4PG6 A;  1RT5 B;  1NZA A;  2MKI A;  1TKT B;  1FXL A;  4DV7 F;  4A8K A;  2Q66 A;  4LF4 J;  4PAB A;  3TO8 A;  1FWP A;  3OL9 A;  3QWU A;  3KK2 B;  3QRQ A;  3PX4 A;  5ETR A;  2FZK B;  4IG0 A;  2OPQ A;  3NLC A;  4MKB A;  2HMI A;  2GJI A;  3H5Y A;  4M94 A;  3SDE A;  4PG4 A;  1Y3K A;  3KLG A;  3LTO A;  3R1L A;  5EX3 A;  2JLE A;  1RAC B;  3KLV A;  4CYU B;  2ZOG A;  1RTJ A;  2GCF A;  2XS2 A;  3ZC4 A;  3GIM A;  2AT1 B;  2M5Y A;  4URQ U;  2Q43 A;  5EX0 A;  1MU2 B;  3Q8Q B;  1UA0 A;  2R7Q A;  1U48 A;  2R7V A;  2Y3Y A;  4PPD A;  4DV7 J;  1UET A;  3JSM B;  2B51 A;  3HJF A;  2W4C A;  3SZ2 A;  2VG5 B;  2I38 A;  2OFG X;  4IFV A;  4NLV A;  1HR0 F;  4IYQ A;  4F0M A;  3DXS X;  4P2M A;  1TVR B;  5E0O A;  2VB6 A;  3QSY B;  4R5P A;  2QA2 A;  4QWB A;  3PIP Q;  5A2Q U;  3ZZO A;  1KOO A;  3DYA B;  1I3O B;  6FDR A;  3NNA A;  1VCT A;  4M5J A;  2GIF A;  2V9K A;  2RQC A;  3OD2 A;  1S4E A;  4EMD A;  2FIU A;  3AQP A;  4DS5 A;  2BM0 A;  4RU2 A;  1CQM A;  2H48 B;  1YRX A;  4J9L A;  1S9F A;  1HWI A;  2V69 A;  2EKN A;  3FZB A;  5CA5 A;  4YB1 P;  1HR0 J;  1HFE L;  4WK3 A;  1WHY A;  3MF5 A;  3MM9 B;  4I7F B;  3AXM A;  4WE1 A;  4U6P A;  5SUH A;  2F9J A;  4CQ1 A;  4F8R A;  1RAO A;  1SH3 A;  2PA8 D;  3M9N B;  2R2T A;  1N33 F;  4I69 A;  2UVU A;  4MFB A;  1L3K A;  1SH0 A;  2DPJ A;  3EPG A;  2F8M A;  3J7Y I;  2R7O A;  4DCP B;  2BE7 D;  4RUH A;  1KBR A;  2KRB A;  2QSF A;  3OTB A;  4NLP A;  2E7X A;  3ISZ A;  2UXB F;  1RWO B;  3HVW A;  3KHH A;  5GAH I;  4GRS A;  1K9M T;  3O6Q A;  1TFW A;  4RNH A;  2J0S D;  3ZTR A;  3KHL A;  3ZZU A;  3DDK A;  4KO0 A;  2YY3 A;  4W98 A;  3AOB A;  3BPS P;  4CTA B;  1N33 J;  3W7B A;  2VDH A;  5CHC B;  1ZM4 A;  4WIQ A;  3IC1 A;  4QPT A;  1HD1 A;  1FKP B;  4HAC A;  3A8K A;  3GU0 A;  2VPY B;  4ZJQ A;  3ET6 B;  5HAN A;  4QJV A;  4CH0 S;  5FJ4 A;  4J80 A;  4N76 A;  4G3I A;  2UXB J;  3LP2 B;  3MWB A;  5DS7 A;  2FY8 A;  2RU9 A;  3KXD A;  3K5P A;  1GMW D;  4Y65 A;  3MM6 B;  2KDO A;  1G4C A;  4CO3 A;  2DGX A;  3J7Z 5;  1GFW B;  3TNV A;  2HQD A;  2BEF A;  3BN7 A;  2MMY A;  1S9E A;  1URR A;  1NLK L;  4F0H A;  2FD2 A;  4HTI A;  2PMW A;  4EGL A;  1ZM3 A;  4C7Q A;  2CAJ A;  5DM7 Q;  2VIH A;  5HAT A;  1Y5I B;  3SV4 A;  3W2V A;  3M8Y A;  4KGM A;  3SMZ A;  1IKW B;  2W4D A;  2NCK L;  5E33 A;  2C3O A;  1IKX A;  1OWX A;  4ZVT B;  4CLT A;  3PJX A;  5J1N A;  4M5D B;  2EVZ A;  4DV5 F;  1LWE B;  3Q8Y A;  2IRY A;  1T3O A;  2AV5 A;  5EWG A;  1FRX A;  5B09 A;  4IR9 A;  1R27 B;  2W2P P;  5J2P A;  4TY8 B;  1KQK A;  2QYG A;  1HHT P;  4B3T F;  1V3Z A;  3H90 A;  1X60 A;  1ZZF A;  2EFG A;  3KMQ A;  3GV5 B;  1C0T A;  3N01 A;  4ATN A;  3E8O A;  4F7V A;  4ILM A;  2VHG A;  2XCP A;  2VA3 A;  2VF3 A;  4DQI A;  1RE1 B;  4IDK A;  3LUY A;  4NLS A;  3D2W A;  3M32 B;  3P5T L;  4Q0B B;  3M05 A;  2LCW A;  3DU6 A;  4DV5 J;  2KT2 A;  5A8K A;  1RP5 A;  3W3S A;  2H54 B;  5B0D A;  3CDA A;  3MAA B;  4I64 A;  2HG4 A;  3CCR S;  3OV7 A;  5J2M A;  1XR7 A;  2B6A A;  1R8A A;  4WJB A;  4C0H A;  2M3D A;  1RT7 B;  2AEJ A;  1XBW A;  1HBU A;  4Q43 A;  4B3T J;  4FXD A;  4IQM A;  3ZO7 A;  3GQC A;  3PX6 A;  3VAG A;  5LSO A;  1C1B A;  2XB2 D;  3R5D A;  2PDA A;  3D5M A;  1C0U B;  1Y5L B;  1MMN A;  4YR0 A;  2DVI A;  4LSL A;  1M90 T;  2ZKU A;  2V94 A;  4PXD A;  1LNQ A;  1SC1 B;  1RT4 B;  1BUX A;  2VFT A;  1XMQ J;  4IH7 A;  2F63 A;  2HHT A;  2HQ3 A;  4DU7 A;  4EZ9 A;  1SJQ A;  4I2Q A;  3UQS A;  2WVF A;  3ZNU A;  1OY8 A;  1U02 A;  3AAW B;  2KFY A;  2YNI A;  1PAE X;  3DN9 A;  2OD4 A;  2EFP A;  2HUR A;  3GR0 A;  4AQY F;  2RF2 A;  1MNE A;  1HWU A;  4DX6 A;  4FYW B;  4B3O B;  1JJH A;  5HJX A;  4OJH A;  4BWJ A;  1U49 A;  3ZZR A;  3T6J A;  2ACY A;  4LT6 A;  2CWK A;  1DZ5 A;  2QSW A;  2HPU A;  1VQ4 S;  2KRR A;  3OJU A;  2VPX B;  1S0M A;  2ZH1 A;  2RAQ A;  1U24 A;  4NRU A;  5EWE A;  2LEC A;  3GG0 A;  4LF7 F;  2X3D A;  2A1B A;  2JH3 A;  4URS A;  4USM A;  3AQO A;  4NEZ A;  4LRF A;  1RIS A;  3W66 A;  1FJE B;  2Z0G A;  1EET B;  2Y8W A;  4AQY J;  3KK1 B;  4GO5 X;  1SKU B;  3DLG B;  1N32 F;  1ZAW A;  2CQH A;  4K2X A;  4FDF A;  4MAK A;  1SQG A;  2WRM A;  1FK9 B;  3HLU A;  3GE9 A;  4LF7 J;  1B70 B;  5A8W B;  1WWH A;  4DR6 F;  1TTH B;  2HZC A;  2O67 A;  3VGV A;  4FF1 A;  4NCG A;  1Y10 A;  2UZA A;  4RW8 B;  3HXM A;  1Q5V A;  3W8P A;  3LP1 A;  3HSJ A;  2YPZ A;  3S6E A;  1L3T A;  3WIV A;  2JOQ A;  2AYG A;  4WPA A;  2KO1 A;  1SCJ B;  1N32 J;  4JOU A;  4A8Y A;  1EQM A;  4B9V A;  2C2M B;  2LXU A;  1BE4 A;  1FDD A;  2CVI A;  3R5J B;  1LXJ A;  4FVC A;  2HRT A;  2AEF A;  5B0G A;  3BSO A;  2QEX S;  3PO4 A;  3Q24 A;  1X4E A;  1P1L A;  2YX1 A;  4FF2 A;  4BLG A;  3SEO A;  2MZR A;  4J9S A;  5B0A A;  2HK2 A;  2N82 B;  3N6N A;  2X1F A;  4GO7 X;  4NML A;  2AX0 A;  4ZIV A;  5E3R A;  3F0N A;  2XZW A;  3VQT A;  5F3T A;  3Q8R B;  1VC0 A;  1CJV B;  4F4X A;  1VIS A;  2CZ9 A;  3BO3 A;  4TNO A;  1TK8 A;  1FRL A;  3IM8 A;  2W9B B;  3TJ9 A;  1OIA A;  2M7S A;  5I4M A;  1P27 B;  1LK7 A;  2GMH A;  3MOJ B;  2CPZ A;  3JB9 k;  1IR2 A;  2XMA A;  3W8G A;  2W9C A;  3IRW P;  4KAI A;  1EAR A;  1KLM B;  3CCV S;  1WTB A;  3BGO P;  3GB0 A;  2FVS A;  1YZ6 A;  2D9O A;  2GAG C;  3F44 A;  3TAM A;  3SI8 A;  2DHS A;  4P9S A;  5HO4 A;  5L1K A;  1FJC A;  2G1H A;  4KR0 B;  3MXH P;  3CCW A;  3LWM A;  2IA0 A;  4J9K A;  2MEW A;  1AA1 B;  1IQT A;  1F9F A;  2IAJ A;  4QWD A;  3UCU P;  1S1V A;  4B3R F;  1SJ4 P;  2UUW A;  3VGT A;  1NDK A;  1UEV A;  4J9V A;  3IRX B;  4KKO B;  3HHL A;  1HYS B;  2FPH X;  1N34 F;  4KH1 B;  3DMJ A;  4LRC A;  3OW2 R;  4QBU A;  4F02 A;  3QAU A;  2N7C A;  1U26 A;  4J9N A;  4FBT A;  3UNY A;  1SC3 B;  4BC9 A;  3VAI A;  2BKO A;  3NGU A;  4OZ5 A;  2H5I B;  4ALZ A;  1UFW A;  3QPI A;  2QN6 B;  2MHN A;  4MKV A;  1RUS A;  5D78 A;  4FF3 A;  2QLW A;  2BM1 A;  4B3R J;  2NPI A;  4FPR A;  3KLF A;  3CD5 A;  3FUY A;  1FRJ A;  2HFO A;  3RBZ A;  4DL3 A;  4MIW A;  3D3C J;  4P6Q A;  2V4J A;  1FI4 A;  4R0E A;  1N34 J;  1AZS A;  3JYT A;  5KFA A;  3HT0 A;  1F5C A;  2JRS A;  5HVF A;  3V6D B;  1N4L A;  1HKA A;  3I82 A;  3W65 A;  1EAY C;  1WOS A;  3R5B A;  4F4Y A;  2DRA A;  5C42 B;  4CNZ A;  1VGY A;  5A0Y B;  3BR9 A;  3CDB A;  1CS4 B;  3W5X A;  1N5Y A;  3JSY A;  1MRO A;  1D8Y A;  4DCO B;  2VFU A;  3B78 A;  3Q8U A;  2PMH A;  3ISN D;  3AKO B;  1WKL A;  4YR2 A;  1UVK A;  2L9N A;  4A8S A;  2ZJR Q;  1DTQ B;  3MEG A;  3QAE A;  1OS5 A;  5BYR A;  2CQ3 A;  3MM8 A;  1T0T V;  3NGS A;  3CC2 S;  2ZH7 A;  4F4K A;  3MCO A;  5CH7 B;  2L08 A;  3H4B A;  4E0D A;  3QT6 A;  1RT1 A;  3V4M A;  3AT1 B;  4JI5 F;  1TL3 A;  3MGJ A;  2VA2 A;  1T3N A;  3R3T A;  1S6Q B;  3PDN A;  3I9Z A;  4ZVG A;  5KG6 A;  2LFV A;  3BEG B;  5CZX A;  2OO4 A;  2ZM6 F;  3C6T A;  3R2C J;  4MYU A;  4AL6 A;  2XGQ A;  4J9Q A;  2AYE A;  3TUI C;  2LQJ A;  4C2M A;  4OYZ A;  1CJU A;  5DDR C;  1CUL B;  1RWU A;  3OSP A;  3GR1 A;  3VTI A;  1C3G A;  3IWL A;  4DEZ A;  2NYI A;  4JI5 J;  4ZVO B;  4K59 A;  3IR7 B;  5KFW A;  2I8E A;  3TA0 A;  2YKO A;  3KDN A;  4OI6 A;  1SL1 A;  2XG8 A;  2YKN B;  4Q2L A;  2AGQ A;  1RTH B;  5GMD A;  2WBM A;  1DFD A;  2JZ8 A;  2MYF A;  2ZM6 J;  2VU5 A;  2YKQ A;  5M2R A;  2VAS A;  1FHT A;  1ZTT A;  3CD0 A;  2RDD A;  2BZ2 A;  2MKC A;  1HI8 A;  3J7A 1;  3DM2 B;  3BDP A;  3HT3 A;  3GJR B;  1G6B A;  2FGC A;  3TWZ A;  1LV5 A;  1WTF A;  1VBK A;  2GVD B;  3QQC D;  4X4N A;  2EG1 A;  2HKE A;  3DOK B;  3JTO A;  3V4I B;  1V9O A;  4ECY A;  1U0S A;  3MPY A;  3R5C A;  3ZTO A;  3DLE B;  3MPW A;  4LVO P;  1U7L A;  4QOT A;  4UST A;  4WWS A;  4YN3 B;  3MR2 A;  1CPZ A;  1XC9 A;  3A13 A;  5LL6 d;  1U1R A;  4RX6 A;  4ANC A;  2BW7 A;  2HYI B;  2KHD A;  4RW6 B;  3EYZ A;  3WQP A;  4C9D A;  2KVI A;  4V19 X;  2R42 A;  2HHH F;  3PKY A;  1V3R A;  3B82 A;  5IXU A;  2AF6 A;  2V8D A;  4U95 A;  2FHO B;  4M5M A;  2V67 A;  1HBM B;  3MMC B;  4ZVQ B;  4DF4 A;  2MTL A;  5IV3 A;  3NNC A;  3BKU A;  1XNQ F;  3KJQ B;  2YX7 A;  5JVG Q;  1FJ7 A;  1FFW B;  3P45 B;  3OFG A;  3KNA A;  4QYZ K;  2VIC A;  5E3P A;  1WEL A;  2XMK A;  2DIT A;  3PFE A;  4JI3 F;  2HHH J;  4RR5 A;  1KFS A;  3I56 S;  2HLU A;  4PG5 A;  3BQ2 A;  2Y1R I;  1UCN A;  2RS2 A;  2XHC A;  2VG7 B;  1AT1 B;  3AB2 B;  3I4P A;  4DR3 F;  4QPX A;  2GQQ A;  5LXR A;  2BE2 A;  5LSL A;  1XNQ J;  2FLN A;  2GML A;  3H8Y A;  2DGU A;  4HVZ A;  4Q7A A;  2L3M A;  3DLK A;  3R97 A;  4ED5 A;  5IQ6 A;  2WVB A;  1J2V A;  2FC9 A;  3DHW C;  4TYB A;  4M5I A;  1HMV B;  1FRH A;  1NDC A;  2RKI A;  4JI3 J;  2BYC A;  1TK5 A;  5HI7 A;  2OEK A;  4TLR A;  3TA1 A;  3T5L A;  3MZI A;  1U4B A;  3O5T B;  3S1T A;  4DG1 A;  4DR3 J;  4ICL B;  5HBM A;  4NLW A;  5AT1 B;  2DY9 A;  5D15 A;  5KT3 A;  1RU1 A;  2MZJ A;  1TMJ A;  4OYB A;  4HKQ A;  1FEH A;  3LGH A;  2RH3 A;  4X4S A;  3PIO Q;  3EGV A;  4X4V A;  1RHK B;  2CVE A;  1DTT A;  2HIQ A;  1ZA1 B;  5C2G A;  1Z1Z A;  1HPZ B;  2GFF A;  4FNH A;  3J80 Y;  1M1G A;  2FLP A;  4C8Z A;  5GAG I;  4G6V B;  2P2C B;  2EWH A;  2HSE B;  2DCL A;  1XEZ A;  4UQG A;  1KVK A;  1Z2L A;  4WTY A;  1R0B G;  2HQI A;  1CC8 A;  4DL5 A;  1NSP A;  4LSN A;  4WP8 A;  5KFL A;  3NP5 A;  4DLE A;  4HT7 A;  2WSC C;  2DIU A;  1KTQ A;  3T6B A;  5EHH A;  3BZQ A;  4NRT A;  3CC4 S;  3DCA A;  1T05 A;  1KQF B;  2KJW A;  1SKW A;  4QIG A;  2OHD A;  4O4G B;  1K1S A;  1AYE A;  3G96 A;  3CE8 A;  3I96 A;  4BDP A;  4Y3C A;  5D3G B;  4WFX A;  4J9U E;  4KQZ A;  1SI9 A;  4KH0 B;  3JS9 A;  2D41 A;  4X84 A;  2QL5 B;  3MOZ A;  2BQU A;  2E1M C;  4UY8 5;  4K8R A;  2V8G A;  4CLW A;  5I3U B;  1XNR J;  4HHJ A;  4DX8 H;  4OX7 A;  2ZJQ Q;  2HHQ A;  1S1U B;  3EX7 B;  3A8I A;  4ZPA A;  2XS5 A;  1TV6 B;  2U2F A;  3FFI B;  1IQZ A;  4TXS A;  2O3D A;  3DFE A;  1D9A A;  1N8R T;  1NO8 A;  5DRK A;  3UCZ P;  2LVW A;  3J7A N;  1HD0 A;  3EPI A;  3NEK A;  2HLT A;  2X1B A;  4NWB A;  3KJN B;  2BA9 A;  5KT5 A;  4J90 A;  2DD8 S;  4A46 A;  3ZZY A;  2LQ8 A;  3B6B A;  3UD3 P;  1D9F A;  3GMG A;  3LPY A;  1BMQ B;  1LKZ A;  1NM2 A;  4K7Q A;  3IG1 A;  2V4Q A;  4KB7 A;  1B3T A;  2IYG A;  4O3P A;  4Q8E A;  3D0H E;  1CEZ A;  1TL7 B;  1MWZ A;  1QE1 B;  1RU2 A;  3CCL S;  4NOH A;  1ACM B;  2CQD A;  3CIZ A;  3IM9 A;  3CD6 S;  3OUY B;  4F26 A;  2W8K A;  1Q1K A;  3BGR A;  5IQQ A;  3NWR A;  4PQU A;  2LLZ A;  3CDW A;  4IRD A;  4NA1 A;  4PWW A;  4RNF A;  5KT4 A;  1UA1 A;  3AA8 A;  1PJ5 A;  3D7S B;  3D28 A;  3DKD A;  4V19 J;  1HBN A;  4O0N A;  4KYZ A;  3VR1 A;  5D6G A;  2XLJ A;  1T7P A;  1LXN A;  2RUS A;  3CB4 A;  4A4J A;  1ZPV A;  2CXE A;  1TKX A;  2FUG 9;  4IG3 B;  1RTI B;  1D9D A;  4E98 A;  4X65 F;  2F65 A;  4I6Y A;  5HVH A;  2Y1L B;  5E5N A;  2UXC F;  1F9H A;  1HNX F;  1EZZ B;  3K8W A;  4DL0 C;  4X4O A;  2KHC A;  3I0S B;  3VVU A;  4DX7 A;  2J9C A;  3BO4 A;  3TZW A;  3QJJ A;  2IYI A;  1Y3J A;  1L3S A;  1B64 A;  2E5G A;  4QIF A;  3OFE A;  3QFW A;  2HHP A;  3H7H B;  3KUG A;  3MEE A;  3FSI A;  2HND B;  3MHY A;  4X65 J;  5ETP A;  3FBF A;  4ITS A;  4J9M A;  3AY0 A;  5KFP A;  4QW9 A;  1XWL A;  2UXC J;  3J80 U;  3CGI A;  2ROG A;  3M8Z A;  3RGI A;  1HNX J;  4CT9 A;  3P8B B;  4RL1 A;  2IHR 1;  1XN9 A;  4P2X A;  1WF1 A;  1UFL A;  1UEU A;  4IKA A;  5F9N A;  2AW0 A;  3J81 Y;  5K14 B;  3QT5 A;  1YQH A;  2YKM B;  4O23 A;  1REV A;  2ZNZ A;  4TY9 A;  3N79 A;  3LQV A;  3US5 A;  4G1Q A;  2QRR A;  2CDR B;  3M8W A;  2GS8 A;  1KQG B;  2HBZ B;  3MM7 B;  2IMO A;  1RAE B;  1S1X B;  2QLX A;  5L1L A;  5F8N A;  1UEK A;  3SQG A;  3VF0 B;  3SBM A;  1PAU B;  5C5J A;  2AWZ A;  5LT5 A;  3UPF A;  5ADZ A;  2R8K A;  4MJK A;  1GX5 A;  4EZ6 A;  4DJB A;  3VCD A;  2CAD A;  3AOD A;  3B4M A;  2R2S A;  2LU1 A;  2BDP A;  1RCX B;  3DGP A;  3GCX P;  2RQ4 A;  3U7J A;  4ECR A;  3LAN A;  1SJ1 A;  2C3P A;  3HM9 A;  1AB8 A;  1FRM A;  3MPV A;  3L3C A;  1PJ7 A;  1BC6 A;  1S7H A;  1WD6 A;  2KM8 C;  2RNE A;  2PA3 A;  4CZC A;  3IBC B;  1SPB P;  2DXD A;  4CO2 A;  2P5V A;  3CJT A;  1T02 A;  1RT6 B;  1UVI A;  5HLF B;  1YJ7 A;  2C2R A;  2DHA A;  3MMA A;  3HPO A;  3AOA A;  2AYM A;  4G1I A;  3ICL A;  2QLF B;  2LYV A;  1S59 A;  4NPO A;  4CLF A;  3HHN B;  1W2I A;  3W62 A;  3QO9 A;  4ER8 A;  4WBF A;  1I1G A;  3P3D A;  4ZMM A;  2XYG B;  3FEX B;  2E5L F;  4DR1 F;  2B0G A;  4LIW A;  3UVJ A;  5MAO A;  5DZ7 A;  1S9G A;  3FZ2 A;  4TU8 A;  4F25 A;  1S77 D;  3IR6 B;  1Q8I A;  2JJ4 D;  1WNE A;  4ZLL A;  1KOH A;  1UVJ A;  2RDJ A;  4DFM A;  2QL7 B;  3KUE A;  4MIA A;  1LW2 B;  2WSF C;  1FFS B;  2VG6 B;  4CNY A;  1YBT A;  2H9Z A;  1M5O C;  2E5L J;  4DR1 J;  1H0H B;  5A6W A;  5IZH A;  1V3S A;  4P7V A;  3PV8 A;  3G82 B;  4DSE A;  3ZNJ 1;  3MED A;  3QMQ A;  3PRD A;  3N5F A;  2FHK A;  3CCM S;  5IM0 A;  4ZVH A;  4EWT A;  5I42 B;  1IM6 A;  2KVQ E;  1NPK A;  2HVH A;  5B0F A;  3KTQ A;  3G9C A;  2C22 A;  1IKV A;  2ZD1 A;  2AJF E;  2BJ9 A;  3PW0 A;  2EBG A;  2BAB A;  3EJM A;  2ERR A;  2N3O A;  2J0Q D;  2R7R A;  3DRR B;  7FD1 A;  1NLT A;  2FB0 A;  1RAJ A;  4TYA A;  1YDL A;  4BBY A;  4IFY A;  2LP4 A;  4YY3 F;  2QZ8 A;  4FXV A;  4YUD A;  2VBX A;  2IDE A;  3MFH A;  3QWP A;  3MDF A;  4F67 A;  3LGM A;  1GX6 A;  1QVF R;  3DOM B;  2HQF A;  3OTE A;  2WZ1 A;  1CJK B;  2YWF A;  3X1L B;  2FJD B;  3NRB A;  4RW7 B;  4IRC A;  1O6X A;  4RNO A;  2XTJ P;  3QAT A;  2V6A A;  3EVW A;  5KFN A;  2OAU A;  2IVM A;  3G8Q A;  4WCE Q;  2VH7 A;  4D3G A;  5AXM A;  2OPP A;  2M8H A;  2J6T A;  1VRT A;  4FNI A;  4LRA A;  1SXL A;  2CQI A;  4RBT A;  3J81 U;  4NEY A;  4YY3 J;  2CYY A;  4CWB A;  4PUO A;  1Y11 A;  2KFZ A;  3IFE A;  2YNH B;  1SBR A;  2MXY A;  2PE8 A;  4LR7 A;  2DCU B;  4B9T A;  1P6T A;  3IAM 9;  4LR8 A;  2W2M P;  3K7R A;  2OPS A;  3M2V A;  4PYA A;  4O3O A;  1N54 B;  2AKW B;  1VQP S;  2OPQ B;  2OSQ A;  4DUT A;  1N6Q B;  4CM2 A;  4ZVE A;  2HVI A;  2IJN A;  1S76 D;  3AD7 C;  3W9I A;  1QY7 A;  3OXL A;  1ITP A;  2ZHA A;  3TUZ C;  2VJV A;  4LMZ A;  3OT9 A;  4Q8F A;  2RQK A;  2HS3 A;  3DDI A;  5K8N A;  4URG A;  1Q53 A;  2JLF A;  4KGX B;  1F2G A;  2KJV A;  4HHH A;  5J1E A;  3WX8 A;  3DLL Q;  1M1K T;  4TN2 A;  1S6U A;  1FT8 A;  1HHS A;  1S5Z A;  3GLJ A;  5ETN A;  2JRR A;  1S1W A;  1F6T A;  5DG7 A;  1FO1 A;  2LDY A;  3C14 A;  2CPJ A;  3M6X A;  3RUB L;  1T95 A;  3VZH A;  4DR4 F;  3PAC A;  2MST A;  2JX2 A;  1E6V A;  2YNG A;  1B0V A;  4JI2 F;  3K5L A;  3QJL A;  3CCS S;  3R2D J;  2BV3 A;  1RT5 A;  1TKT A;  1NK0 A;  5C24 A;  3OTO F;  1LW0 A;  5M2U A;  1VLY A;  4YHH F;  3KK2 A;  5D4N A;  4DV2 F;  3KYL A;  4PXE A;  2GW8 A;  4EBE A;  1JXE A;  2DRB A;  4LSZ B;  1LQ9 A;  4WE1 B;  4K5R A;  4DR4 J;  3ADA C;  4JUZ A;  1SVD A;  3HDS A;  3GFZ A;  3SFG A;  1FDN A;  4JI2 J;  3GCW P;  1LEO A;  3DOL B;  3GFX A;  2KG1 A;  1LWC B;  4DFJ A;  2CPI A;  1UP1 A;  5LMN F;  3UNG C;  3TUP A;  1TMM A;  5ETL A;  2XWY A;  3JSM A;  4PWD B;  1EB0 A;  2VG5 A;  1K1Q A;  2F5G A;  4RU9 A;  4YHH J;  3A3N B;  2XMV A;  3D0G E;  5DZ6 A;  3K57 A;  1F3V A;  4DV2 J;  3ENA A;  2MHE A;  4RW4 B;  4U7U K;  1PJ6 A;  4JI0 F;  2Z4P A;  8AT1 B;  1TVR A;  2RML A;  4ELU A;  4ZPD A;  4AFF A;  5U47 A;  3I9V 9;  1QSL A;  3NBP B;  1Q7L B;  2COL A;  3PR4 A;  1IJE B;  4BCA A;  2VDI A;  3CPW R;  1QTM A;  3DYA A;  1DAR A;  3QT7 A;  2BX6 A;  3C19 A;  4B3M F;  5LMN J;  1TR0 A;  3IBW A;  3FVY A;  4FP9 A;  3R5A A;  3RG6 A;  4KBI A;  4FKY A;  2D3O 1;  3AD9 C;  1JWW A;  2E5J A;  3D6M B;  4H4K C;  4M5N A;  2YKP A;  1N0U A;  3EXC X;  2XYP B;  3Q22 A;  4LUB A;  4JI0 J;  6FD1 A;  3MM9 A;  5DDP C;  2MZ1 A;  4ZIT A;  4NLG A;  2OUG A;  4KV8 B;  1XR5 A;  1NRK A;  2YWH A;  1B99 A;  4DUY J;  3OR1 A;  2G2Y A;  4B3M J;  4C8Y A;  1RQ0 A;  2HQC A;  3T5J A;  4CIO A;  4QR2 A;  5L1I A;  4FS1 A;  2C42 A;  1QUV A;  1ZET A;  3QIP B;  4PQA A;  2UV8 A;  2XM3 A;  4HT5 A;  4J5O A;  4W90 B;  3Q86 A;  1NBE B;  2V68 A;  2BOA A;  1VC6 A;  2HEK A;  3LGN A;  1ELO A;  2V2Q A;  4WP3 A;  5ETS A;  2E29 A;  2V8V A;  3PYE A;  4L72 B;  5L1J A;  1FXD A;  5L39 A;  2XSJ B;  2ZUG A;  4CTA A;  1FD2 A;  3PFO A;  4OZ2 A;  3VQS A;  2HGN A;  2YWE A;  3QLH B;  3R7S B;  3ULH A;  2MGZ B;  4B9M A;  1FKP A;  3T3F A;  3KK3 A;  1G7C B;  3ET6 A;  1VS3 A;  2QA4 G;  1NK7 A;  3SYZ A;  2IA6 A;  1VHF A;  3BSN A;  4IOC Q;  3LP2 A;  1OYD A;  1YKW A;  1SC4 B;  1HQ2 A;  1TAU A;  3D1O A;  4C11 B;  4C8M A;  1CVJ A;  3IN5 A;  1PG5 B;  2R4F A;  1I94 F;  3MM6 A;  3SCJ E;  3HP6 A;  1C0T B;  3CO0 P;  4ZVF A;  1H72 C;  4I2P A;  3CDU A;  4IDK B;  4NLD A;  4OZL A;  2KKH A;  2B43 A;  3M8S A;  1FES A;  1YVF A;  4ZJO A;  4FYY B;  3T9N A;  2V9W A;  1JLA B;  2DGS A;  4B17 A;  4AYB D;  3PNI A;  2CJQ A;  4Z7Y A;  3OFH A;  1FX4 A;  3CMQ A;  3CJ0 A;  3HKZ D;  4PG7 A;  4ZP7 A;  2A0F B;  1N5Q A;  2K3K A;  2VKZ G;  1HBU B;  4NYZ A;  2C2D A;  3IBF B;  4YR3 A;  3BDE A;  2OIH A;  1I94 J;  4OZJ A;  2E1C A;  1GQE A;  4NLO A;  2DHH A;  4F3O A;  2J8S A;  4QIV A;  1Q5Y A;  4DV0 F;  1N88 A;  4RJV A;  1EKS A;  1H2V Z;  2PEB A;  5G0R B;  1ZA2 B;  1LWE A;  4I6W A;  3LOU A;  1U0H B;  5LSR A;  1F60 B;  3ZZ0 A;  3RBD A;  4OV1 A;  3MR7 A;  4A48 A;  3CW2 C;  4CO5 A;  4OI3 A;  4OI1 A;  4I2Q B;  3CJ3 A;  1TKZ B;  4TY8 A;  1R8C A;  3QBC A;  2JVO A;  4WF9 Q;  3RW7 A;  2K1R B;  2OTL S;  1LWF B;  4ZJL A;  2NQP A;  3OTD A;  5DDQ C;  3RRH A;  2BRK A;  2PFF B;  3N6L A;  1S0N A;  1VQ6 S;  1XIQ A;  2UVW A;  2W2N P;  1F9E B;  2N4D A;  2PD1 A;  1H6K X;  4J9O A;  4MKA A;  5L9X A;  4DV0 J;  2JEF A;  1XAO A;  2MSS A;  3M32 A;  4Q0B A;  4YB5 A;  1CSJ A;  1RAD B;  4C8O A;  3TI0 A;  4DL6 A;  1YSJ A;  4U96 A;  2QTW A;  2D69 A;  1RWX B;  1RT7 A;  2RRB A;  4ED3 A;  3G6Y A;  2J7W A;  4GKJ F;  2LXF A;  1KHW A;  3CJK B;  1C4A A;  4K0K F;  1Z4U A;  1GMU A;  2DIV A;  1SKR A;  2BJ8 A;  3V6J A;  3TAR A;  5ETM A;  4PR6 A;  4K4W A;  1UAW A;  4CH7 A;  3EUN A;  2B4U A;  4NZ7 A;  3T9Z A;  1RT4 A;  3M8Q B;  1DJ0 A;  3FRZ A;  4P71 A;  3OTC A;  3CCE S;  2ASD A;  4RWX A;  3T5H A;  5E3C A;  2HWI A;  2IBK A;  2B26 A;  2CJB A;  4CI0 B;  3TZX A;  4CLZ A;  2XLI A;  4UOC A;  2EFQ A;  3C16 B;  5GAG U;  2FY1 A;  4PEO A;  4DOZ A;  5KFC A;  4NXN F;  1Y7P A;  4Z2X A;  2F9D A;  1ZBT A;  3ENQ A;  4K0K J;  4C0O C;  2CRL A;  1Z2Z A;  1NPR A;  4OMF G;  4KFB B;  3MFI A;  4ERD A;  2PI4 A;  1U2F A;  2B4P A;  4TU7 A;  3UR3 C;  1ZTW A;  3RRK A;  1TL1 A;  1YJW S;  3CDE A;  3THT A;  1SQE A;  2UV8 G;  4WTO B;  4NXN J;  1FXR A;  3JSR A;  2FZG B;  1KNZ A;  4J91 A;  1EET A;  2KYZ A;  2Z30 B;  1EP4 A;  3RB6 A;  1I6J A;  1VIO A;  3KK1 A;  2HHV A;  1KDN A;  2X3G A;  3DLG A;  3TVK A;  4EK2 A;  4TVA B;  2PC6 A;  1YHQ S;  2WVD A;  4DSJ A;  1FFG B;  3T1H F;  1YRT A;  2EW9 A;  2J0W A;  3I55 S;  1X5P A;  5F8J A;  2Y9H A;  2A10 A;  1X7V A;  4MK9 A;  2PFD A;  3PYF A;  2CQ1 A;  4F2R A;  1FK9 A;  2GX8 A;  3HFV A;  4A8X A;  5A8W A;  4X2B A;  2HVE A;  4RW8 A;  4KPY A;  3N9U C;  2W9C B;  2ZH3 A;  1RWN B;  1VBX A;  2HNZ A;  2E66 A;  4K4Z A;  1R8P A;  3AJD A;  1KQS R;  2YH1 A;  4ZA1 A;  1A0O B;  2OPR B;  1NJI T;  1RTD B;  3T1H J;  2KXN B;  1RAA B;  5AXL A;  4CLP A;  4FYX B;  1FRK A;  2RJZ A;  5KOX A;  1S1V B;  5E41 A;  4DHV A;  2OLW A;  2XI2 A;  4HLB A;  2R7S A;  1IVZ A;  3MPD A;  4HI1 A;  5CZV A;  3K5O A;  3DMJ B;  4E2F B;  3LW5 C;  3D54 A;  5EGY A;  2P8I A;  3NWG A;  3LP0 A;  2N7Y A;  4FN5 A;  5ETT A;  2W2Q P;  3ETO A;  3ETM A;  5JUM A;  2ZUA A;  3JQJ A;  2W9B A;  3BF4 A;  3KLF B;  1RK8 A;  2XCA A;  5CAA A;  3TEG A;  4JP8 A;  3AFG A;  4GKK J;  1SIW B;  3MR3 A;  4HYK A;  1AZS B;  3JYT B;  1HA1 A;  1C1C A;  2GGP B;  1S12 A;  5DG8 A;  2YQ0 A;  1JIH A;  4OIX A;  3ELH A;  4EYH B;  2BJ3 A;  5F8H A;  5KFE A;  2LMI A;  3H20 A;  2VFR A;  2GVZ B;  1RWP B;  2VC1 A;  3Q0A A;  1VQ9 S;  2WOM B;  2OEJ A;  1TL5 A;  2EBE A;  2F40 A;  2NXE A;  1WDT A;  4JI6 F;  3KJF B;  2JWN A;  5KFS A;  4KKO A;  2G1D A;  5IFM A;  1X0P A;  1L5U A;  3VAK A;  3MTJ A;  3I31 A;  3UN2 A;  3BS9 A;  2H1Y A;  3PR5 B;  3QRP A;  2CQ2 A;  2E5H A;  3BSC A;  4QCL A;  3FRY A;  4KPC A;  3IGN A;  3CD7 A;  3MM5 B;  2W24 A;  3CME S;  2YVS A;  4ZCL A;  1A9N B;  1YX2 A;  4JI6 J;  2CPF A;  2HGL A;  2B5J A;  4J7C A;  2C2N A;  4FBU A;  2FQQ B;  3PX0 A;  4HHU A;  3V6D A;  3NGR A;  1SL2 A;  4PWU A;  2FTR A;  1R0A A;  2KN4 A;  3AB4 B;  1RAI B;  3PEH A;  2R8J A;  1G1X A;  5DQG A;  4AXI A;  5A0Y A;  1CS4 A;  4WFZ A;  2NRE A;  2KG0 A;  3MD3 A;  4BC7 A;  3VZI A;  5J2N B;  2GHP A;  3F73 A;  4M1K A;  3LAL A;  4MH8 A;  4Y2C A;  4PRF A;  4DSK A;  1DTQ A;  3KJV B;  3OFF A;  3OLB A;  2NUH A;  1J5O A;  1X4C A;  1QUP A;  1X4A A;  1F5A A;  4IO9 Q;  2P9C A;  1D8Z A;  3H98 A;  5GVQ A;  3HZE A;  2XMT A;  1RWW B;  1NH8 A;  4O44 A;  2K8G A;  3AJ1 A;  4LJM A;  2CUY A;  2O66 A;  2IIH A;  1S6Q A;  2QE5 A;  4KJI A;  3GJQ B;  2ZVS A;  4PZV A;  4ZIW A;  5DQI A;  3D4J A;  2E9Z A;  2RHS B;  3GPA A;  4Y2K A;  3TQ1 A;  3C2P A;  4IR1 A;  2XQC A;  2GO8 A;  2MQQ A;  1U1O A;  1S0O A;  2E5I A;  2EI5 A;  1FNX H;  1VRQ C;  3CF5 Q;  3MD1 A;  3RAQ A;  3DRS B;  1B4S A;  2NXC A;  4KHR A;  1F3F A;  4LF6 F;  2YKN A;  3E2E A;  4P75 A;  1RTH A;  4FKX A;  4USU A;  3AHP A;  2R3V A;  2YKA A;  4U67 Q;  2A3J A;  3CUL A;  1Y9O A;  2B3T B;  2GO9 A;  3R6L B;  3L7O A;  3Q23 A;  4LR9 A;  3DM2 A;  2EG2 A;  2MJU A;  2MQL A;  5KG1 A;  2FGO A;  3CNQ P;  2GZO A;  1KLN A;  1IBC B;  3NOG A;  4DI6 A;  3PVX A;  4OJ1 A;  2GVD A;  3C15 B;  2XC9 A;  5E3Q A;  3H5X A;  4LF9 F;  4RWW A;  1M5P C;  4ZVR B;  2L41 A;  1VLO A;  3V4I A;  2KFN A;  1T94 A;  4X4R A;  1WC5 A;  4QR1 A;  1RT3 A;  4CO4 A;  4QYZ J;  3M7V A;  5L9N A;  4ECS A;  4KY3 A;  2QJ3 A;  2HS0 A;  2XYH B;  3KLE B;  2PGC A;  4LF1 A;  4ENO A;  4LRD A;  3NS7 B;  1U6F A;  4KT0 C;  4YEA A;  1Y0H A;  5KFB A;  3CVK A;  2QL9 B;  4XPC A;  4P52 A;  2ZH4 A;  3RBE A;  3IS9 B;  1W25 A;  3HHL C;  3VVT A;  4LIR A;  2HHU A;  1XK8 A;  1JLC B;  4K4S A;  2B9Y A;  3Q2S C;  4LF9 J;  2NUU G;  1QD1 A;  1RBO B;  1T03 B;  4X4P A;  1HBM A;  4DG1 B;  3MMC A;  5F0W A;  4P74 A;  1X4G A;  2W25 A;  3BH7 B;  2D3O R;  2ILY A;  4KIA A;  4Q44 A;  2MQM A;  5KFT A;  4XAK A;  4CLL A;  4DL4 A;  2Z57 B;  1DUR A;  5B0B A;  1NK4 A;  2B9W A;  2ZJP Q;  3BPD A;  2H4Y B;  2X7I A;  4UUX A;  2HZA A;  1TUV A;  2EFV A;  5M2P A;  5J1P A;  2FC8 A;  1FRI A;  2GNK A;  5K20 B;  3PW5 A;  1YK9 A;  2BKP A;  2VKR A;  3SSQ A;  2ZHO A;  4DXL A;  3QGG A;  2I6W A;  3FBB A;  4UZB A;  4J37 A;  4UW2 A;  2MDA A;  4UF4 A;  1GXL A;  2QX0 A;  2CG8 A;  3WHI A;  3QGI A;  2ZH5 A;  2JZ5 A;  3CJ5 A;  2W1B A;  4U8V A;  6AT1 B;  1NDP A;  4JV5 F;  1HMV A;  1BQX A;  5IT4 A;  4LBP A;  1ARO P;  1JJC B;  4DUZ F;  1EIY B;  4QWE A;  2QYC A;  2UVV A;  2VBW A;  3IXQ A;  4YS2 A;  3BB5 A;  3OVS A;  2KU7 A;  1GH8 A;  2HK3 A;  3T5K A;  4ICL A;  3TOQ A;  4OFZ A;  4HL9 A;  1HNZ F;  2WW8 A;  2HWH A;  4ZPB A;  3FCV A;  3FEZ A;  3P6Y C;  5HK4 A;  5IV4 A;  1FD8 A;  3CT9 A;  1J5E F;  3NS5 A;  3ILL A;  2K06 A;  2QG9 B;  3ONQ A;  1RA7 A;  4JV5 J;  1G2E A;  1P8G A;  1WHX A;  1WC0 A;  3NMA A;  1HHQ A;  3PHT A;  3G6X A;  1RHM B;  2ZDO A;  4DUZ J;  3WC0 A;  3PTW A;  2G2Z A;  3LWL A;  3I5C A;  1HPZ A;  2PI5 A;  2DBB A;  1FVQ A;  2Q6C A;  4DV3 F;  3C8Y A;  3UW1 A;  1NH7 A;  1PC5 A;  4O0I A;  1HNZ J;  5B7W A;  2XZT B;  4Z37 A;  1R6V A;  2B7B B;  3MUT P;  1X5S A;  2J7U A;  3R27 A;  5C7P A;  4PG8 A;  1IBK F;  4YB6 A;  3IG1 B;  2CIM A;  5HJY A;  2FHJ D;  2V34 A;  4ID8 A;  1RAH B;  2E7W A;  4PCQ A;  3JSB A;  1R8B A;  2RT3 A;  4UQT A;  3C46 A;  4USH A;  5D3G A;  4FF4 A;  4DV3 J;  4U7C A;  2H5E A;  1E6Y A;  3U1M A;  4ZHR A;  2DGQ A;  3SIP B;  2I1R A;  2M2B A;  4M63 A;  2CPX A;  3BGR B;  4Y6I A;  1JLE A;  1RT2 B;  1IBK J;  3N0V A;  1K47 A;  3GYN A;  1U25 A;  3FKB A;  3BBB A;  3DDN A;  3QZ7 A;  3BGU A;  1AUD A;  3FFI A;  2MB0 B;  2HNY A;  5FLX Y;  2EKY A;  3EZU A;  4C0B A;  1WHV A;  2R2U A;  3M6W A;  1X9M A;  4ILL A;  2YBV A;  3QNW B;  2L9D A;  3BBF A;  1MSW D;  4ID5 B;  4LFA F;  1I5O B;  5HN0 A;  3BKT A;  4ZLN A;  4JV2 A;  1WC1 A;  2BUN A;  3FEY B;  2CPE A;  4OHY A;  4DCJ B;  1Q8L A;  3H25 A;  2MZT A;  1ZM2 A;  4JV0 A;  2W8L A;  1KEK A;  2ZWP A;  1NJX A;  1DQA A;  2FZC B;  1S97 A;  2IC3 B;  4Y2A A;  3GSD A;  2HBQ B;  3IO1 A;  4DPO A;  1PYS B;  3ZXW A;  1UW4 A;  2PSZ A;  4O3S A;  4WZQ A;  1FVS A;  1TL7 A;  3HD1 A;  1X0F A;  2J5A A;  1QE1 A;  4QIE A;  1NME B;  3CCZ A;  5H9E K;  4LFA J;  3CCT A;  3OUY A;  1PCA A;  2HAF A;  4KGZ B;  1UJ4 A;  3HX9 A;  2AJQ A;  2EPI A;  3EGZ A;  2J9D E;  4DR6 J;  1S10 A;  4ECW A;  3CXC R;  1S1T B;  4FYD A;  3A12 A;  5B08 A;  1YRU A;  1OPI A;  4ECT A;  2VZ9 A;  2U1A A;  2XEX A;  5C25 B;  1F5B A;  3EDQ B;  4OZ3 A;  2WON B;  3TR5 A;  5CYQ A;  5F8L A;  3LZ8 A;  3NMR A;  5D8H B;  5ETV A;  5FDL A;  3K8V A;  3W2W B;  3D6F B;  4IG3 A;  3M4X A;  3DRX A;  3CJ8 A;  1RTI A;  3H42 A;  3B4D A;  2BBE A;  8ATC B;  1GTE A;  1FJG F;  2DNR A;  1EKR A;  4DSI A;  2QLB B;  3SQG B;  3C6U A;  4KGK A;  3PHE A;  4RZR A;  1R0C B;  2XMU A;  1SKS A;  1HBO A;  2MQN A;  4AT1 B;  3I0S A;  2D3Z A;  2EK6 A;  1VQ5 S;  2Q6B A;  1G3O A;  2C3Y A;  3LAK A;  3M1V A;  4OYP A;  1DLO B;  4PKD B;  2FJB B;  3ZZZ A;  5EUH A;  2O5D A;  2R7W A;  2DNP A;  3PCO B;  3D1H A;  1FJG J;  1HWK A;  1M0S A;  1U2R A;  1T9V A;  1ULR A;  3KDO A;  5I3P A;  2ZE2 B;  1Q82 T;  1BQN A;  1HI0 P;  1U6B A;  4GMK A;  3OXF A;  2UXD F;  4USJ C;  2LA4 A;  1U8S A;  2DGW A;  2MKK A;  2KXH A;  2Z8Q A;  5K14 A;  4M5H A;  2XY7 A;  4I56 A;  4KC5 A;  4QYR A;  1YIJ S;  1ROF A;  2IM3 A;  3QO9 B;  3JQM A;  1TZ0 A;  3MM7 A;  3TJ8 A;  1S1X A;  5GAD I;  3RR8 A;  3VAM A;  1NSK L;  2GHW A;  3MI7 X;  4I1T A;  1WAC A;  5FD1 A;  2V8H A;  3HFK A;  1HNI B;  3NNH A;  3TZZ A;  1S48 A;  2KZZ A;  2UXD J;  1MW7 A;  4P73 A;  4C97 A;  3VAJ A;  1XR6 A;  1DQ8 A;  1UWA A;  3RZA A;  2OGU A;  2IVF B;  3GSI A;  3M2R B;  4ZCK A;  3D0I E;  1FER A;  4UOF A;  4CLU A;  3DXB A;  3LF0 A;  4A8Q A;  5FLX U;  5KG5 A;  3KKF A;  4DPU A;  4L74 A;  4QIW D;  2A6M A;  2MQP A;  2EFN A;  3DGV A;  1WEZ A;  4W4M A;  3TVZ A;  1Q8K A;  1CBK A;  3U02 A;  3W9J A;  1NU4 A;  2XY6 A;  2ASL A;  5DJB A;  1SUQ B;  1BQM A;  5IC4 B;  2Q2G A;  1RT6 A;  1WHW A;  3MED B;  5HLF A;  4X4T A;  4Z7C A;  2XMJ A;  1R8H A;  1RLC L;  1NSA A;  3M8P A;  3T1Y F;  1LK5 A;  4N5S A;  4MIB A;  2ZD1 B;  4ZN3 A;  2VBZ A;  3QGP A;  2ZNY A;  4KGV B;  4MK7 A;  4WII A;  2AJ4 A;  5F8M A;  1FWL A;  2XHW A;  2ZC4 A;  4DQP A;  3K5M A;  3OBI A;  3H4D A;  1Q78 A;  1DBD A;  3KLH B;  5KAK A;  5AXK A;  3GYG A;  2KXF A;  1GMW A;  3P4U B;  1JLB A;  4EU0 A;  3T1Y J;  4IO1 A;  4ELV A;  4LQ9 A;  4X62 F;  3NGD A;  3HF5 A;  1KD1 T;  2WAQ D;  1QM9 A;  4TKT A;  4WU3 A;  1JLG B;  4OI2 A;  3OR2 B;  1N5V A;  3CJQ A;  1LW2 A;  3IWN C;  3ZZP A;  5GAE U;  4ED1 A;  3FSX A;  1HAR A;  2OPP B;  3KMS A;  1VRU B;  1VRT B;  5I3Q A;  2AZ3 A;  2CPH A;  1FF2 A;  2P6T A;  3OPK A;  3I32 A;  2MQ8 A;  1TKD A;  3G82 A;  2ZH8 A;  1FE0 A;  4CM0 A;  2OFH X;  1KHV A;  2Z58 B;  4M5K A;  4X62 J;  1H74 A;  2BAC A;  4OX8 A;  3RYL A;  4ED0 A;  4K5S A;  2BE9 B;  2OPS B;  3P49 B;  3GJS B;  2F7V A;  1C2P A;  3MCN A;  4F2S A;  3DRR A;  3CCJ S;  4DR2 F;  3H2V E;  2ZZM A;  2ZVI A;  3HVT A;  2QA4 S;  1QLN A;  3PG9 A;  2AJ2 A;  4R8U A;  3DOM A;  1PIE A;  3ITH B;  1L3U A;  1CJK A;  2C1E B;  1CLF A;  7AT1 B;  1W7W A;  5ETO A;  2ZH6 A;  4DR2 J;  1XMO F;  1S1W B;  3F41 A;  2V2K A;  1M5S A;  2DNQ A;  3JXO A;  5DO2 A;  3NGT A;  2OKQ A;  4ECQ A;  4DZ6 A;  4UUW A;  2YNH A;  5AE1 A;  5KT7 A;  2DO4 A;  5D77 A;  2H65 B;  3PRB A;  2L48 A;  3NOC A;  2MKH A;  3J81 j;  2UUA F;  3A1Y G;  1DRZ A;  3MMB A;  2JLG A;  4IRK A;  5C24 B;  2A2C A;  1LW0 B;  3TAQ A;  2Y0S D;  2FHM A;  1MLA A;  2C3M A;  1SC6 A;  4XO0 A;  1JLQ B;  5F3Z A;  3IWX A;  1N6Q A;  1XMO J;  2VON A;  5HP1 B;  4JI8 F;  1N5T A;  1IKY A;  3EVM A;  5KFO A;  2F3J A;  2OP5 A;  4ZVP B;  2IRU A;  1UJ5 A;  4DMZ A;  2RSQ A;  1VQO S;  4CCH A;  2BAN A;  1YLX A;  3FBE A;  1X9W A;  2Y0B B;  1N52 B;  3OL7 A;  3BYR A;  1H38 A;  3JAM Y;  2B8P A;  5HQM A;  4DQQ A;  2XBP A;  2UUA J;  2M70 A;  2FHJ A;  2DNY A;  2IMW P;  1EHW A;  2DR8 A;  1JQG A;  1KRP A;  2ZBP A;  2C2O B;  4JI8 J;  3QJP A;  3HHL D;  4RW9 A;  3G4S S;  3MEC B;  4DU8 A;  1YI2 S;  1NHV A;  4N7T A;  5HRO B;  1TEL A;  2AYB A;  5D4L A;  3PYG A;  2V5H G;  3KG1 A;  2B9E A;  3EMT A;  2M0G B;  3W5Y A;  1SJF A;  4DPY A;  4NX9 A;  1UPM B;  4H4M A;  1QSY A;  3A8E A;  3RBX A;  3G8S A;  3L95 X;  4FXW A;  1B7F A;  1N5S A;  2CZV C;  1R6Y A;  3GIJ A;  1F2H A;  2IM0 A;  3PJ9 A;  3T1A A;  2CPD A;  5E2Q A;  3D66 A;  2KM8 B;  1OYE A;  2VFS A;  3RRG A;  1GTH A;  3HJV A;  2P6S A;  5C2C A;  1DAX A;  4F36 A;  4XIU A;  2VPZ B;  5BR8 F;  3EIC A;  5KFK A;  3OR1 B;  3DRY A;  1NJW A;  3DOL A;  1LWC A;  4AE5 A;  5BYS A;  1RTZ A;  2C28 A;  2PT0 A;  4PWD A;  2LEA A;  1X31 C;  2WCX A;  3M30 A;  1UVL A;  3GV7 B;  4O3Q A;  2SXL A;  1F1B B;  2W7P A;  3QT8 A;  4RW4 A;  3I87 A;  3QFH A;  3SSR A;  4EFA C;  5CQG A;  3BR8 A;  2MKY A;  3CUN A;  1SJR A;  2DR7 A;  3NBP A;  3NAI A;  3FSY A;  2FJA B;  5BR8 J;  3L09 A;  3A3P B;  4S0M A;  2RIL A;  1FWK A;  2HWT A;  1WJ9 A;  1ZAV A;  3EGN A;  5CCL A;  3KK3 B;  3TEH B;  3GP9 A;  4NA3 A;  3RW6 A;  3RTV A;  4ECU A;  3UCG A;  1X4D A;  4GVB B;  3A8J A;  2CNL B;  3DU5 A;  3I0R B;  5KG0 A;  5H1S V;  1PGZ A;  2D7S A;  3E51 A;  4DSL A;  1NND A;  2JNJ A;  1ZS6 A;  1SL0 A;  1OJ4 A;  4KV8 A;  5KFD A;  4JI7 F;  4I2P B;  2XWX A;  2CA9 A;  1HW8 A;  1NK9 A;  2RE1 A;  2ACM A;  1WOP A;  1ZAX A;  5HVG A;  5HQL A;  2DH8 A;  4ES3 A;  4DV1 F;  5CYJ A;  1U2C A;  4L75 A;  4N8O A;  1JXL A;  1ZH5 A;  4ED8 A;  3QIP A;  3TA2 A;  3E3X A;  1PIL A;  2ZH2 A;  2LEB A;  1HQE B;  2DEI A;  1APS A;  2HBR B;  3J7Y U;  1QSS A;  2UUB F;  1D0E A;  2RB7 A;  2XSJ A;  1UWB A;  3TW0 A;  2QMX A;  1VI7 A;  4JI7 J;  1BWE A;  5A8R B;  4HDG A;  3OVA A;  3QLH A;  5GAH U;  2DR9 A;  2MGZ A;  1N0V C;  3G8T A;  3GWC A;  4DV1 J;  2VFV A;  4QR0 A;  1N36 F;  2YXL A;  3EZO A;  5F8I A;  1RI7 A;  3JAM U;  4C11 A;  3BH6 B;  4QQB A;  3N28 A;  1HNV B;  4C48 A;  4IH6 A;  1H2U X;  2UUB J;  1WKJ A;  2RS8 A;  2V50 A;  1VK3 A;  1TUG B;  1T9X A;  3OXG A;  3UWT A;  1LFW A;  3AGX A;  5IS2 A;  3UFC X;  4P2F A;  2NSB A;  2ROP A;  2KT3 A;  3CMA S;  1WG4 A;  1QTN B;  4OZ0 A;  5BXI A;  5SZT A;  3PO5 A;  3BQ1 A;  3DRP B;  2JEG A;  1X5T A;  3HUL A;  1N36 J;  4ZS6 A;  3MR6 A;  1JLA A;  1O5J A;  4XTT A;  4NI2 A;  1XMQ F;  1OQ3 A;  2NLW A;  2KB2 A;  2LKZ A;  3DLB A;  4GVL A;  1CG2 A;  1S72 S;  2QFI A;  5DQH A;  5DLF A;  2YWG A;  1EQ0 A;  2XLK A;  2XUL A;  2W9A A;  4RNM A;  3WX4 A;  3UR0 A;  2MQO A;  2PII A;  2CNO B;  3E01 B;  2MLY A;  4UOH A;  1FKO A;  1TK0 A;  2QIF A;  3UE2 A;  2B56 A;  1X9S A;  1KKH A;  4ILR A;  3RAX A;  4IOA Q;  1WSR A;  4PYD A;  4PPZ A;  1YGY A;  3MUV P;  5CD4 H;  5G0R A;  3PEJ A;  1P9Y A;  1HWL A;  2V8P A;  2HQG A;  3R1H A;  4ZPW R;  4DL7 A;  1U0H A;  2MLZ A;  4YDX A;  3ILO A;  4OQJ A;  2G9O A;  1T9W A;  2NR0 A;  3H5U A;  1JJ2 R;  1TKZ A;  1BLU A;  1MG7 A;  2RUG A;  2K1R A;  3SCK E;  5JJB A;  1LWF A;  3M2U B;  3MUM P;  2H5J B;  3UN5 A;  2X51 A;  2V2Z A;  4ED4 A;  9RUB A;  3OHB A;  4Q5V A;  1GEH A;  3QRR A;  5KG2 A;  3BRE A;  2Y1J A;  2DNZ A;  4DN0 A;  3IGV A;  1Q0N A;  1JLF A;  3HVR A;  1CJT A;  3CO9 A;  3PZP A;  1K0V A;  2LQB A;  4WFA Q;  1IM4 A;  2OH2 A;  2BR0 A;  2H3E B;  2DNN A;  5HQ8 A;  4AL7 A;  4WP9 A;  1TL1 B;  1PSD A;  3VAF A;  5KFR A;  3QGH A;  2RDI A;  3G87 A;  4N41 A;  1NAQ A;  1IN0 A;  2L9W A;  3CJK A;  1NJZ A;  3PW7 A;  3T19 A;  3POT B;  4M5G A;  3UI3 A;  1EP4 B;  3KHR A;  2DK2 A;  4LRE A;  2FLL A;  3KG4 A;  1OY6 A;  2DH9 A;  4DFP A;  4ZLP A;  3M8Q A;  5LJ3 Y;  4FZV A;  3FCH A;  4USI A;  3EXY A;  1JKH B;  5J2Q B;  1NKB A;  3TRG A;  4WKY A;  1YJN S;  3R7N B;  2VOD A;  4LF5 F;  4RUC A;  2HW3 A;  5IT0 A;  1FTR A;  5A6P A;  5K8P A;  2X1A A;  2E1R A;  4XDD A;  2H51 B;  4U8Y A;  4ZPV R;  3B54 A;  3C16 A;  1S49 A;  5H9F K;  5KG4 A;  2DRD A;  2HFS A;  2HNZ B;  5MLC V;  1VDH A;  3VGU A;  2WK4 A;  1JJ4 A;  3EM1 A;  2DY1 A;  2CQP A;  2HFU A;  2VL1 A;  4KFB A;  3CTR A;  2GIQ A;  3K17 A;  1BD6 A;  2YNF A;  2WSE C;  2YQ1 A;  1PC4 A;  5IC6 B;  4LF5 J;  4JI1 F;  1LFP A;  4OZ1 A;  2C2Z B;  4HH0 A;  3QZ8 A;  3W64 A;  2YTC A;  4C98 A;  4MK8 A;  2I5J B;  4ED2 A;  2JSX A;  1HI1 A;  4ECX A;  1WG5 A;  4DF8 A;  1HQU B;  2YQ3 A;  3LAM A;  2EC2 A;  3LP0 B;  5KG7 A;  3C5X C;  3HHK A;  1EJ7 L;  1UZD A;  3AGZ A;  2K7J A;  3CED A;  3I5A A;  3RR7 A;  3KLI B;  2FVR A;  3BJY A;  4NLR A;  3HCX A;  2JC1 A;  4JI1 J;  3HZG A;  2DNM A;  3O3L A;  3AA9 A;  1RHR B;  1OSD A;  3DI6 B;  2ZH9 A;  2AEM A;  3M9M B;  1S6P B;  2HVZ A;  3P5B P;  2D3U A;  1KN6 A;  1C1C B;  1MN9 A;  1W26 A;  2D9P A;  2OPR A;  3NKY A;  1TAQ A;  2NXJ A;  2W7A A;  4H4O A;  2AQ4 A;  2DXE A;  4C3K A;  2VD3 A;  1RTD A;  1JNR B;  5IT9 Y;  2KZM A;  1ZZN A;  2D74 B;  1MML A;  3G6E S;  3V81 B;  4N56 A;  1B0P A;  1WEY A;  3M6U A;  1UFK A;  4K4U A;  2MJN A;  2BJE A;  4OL8 A;  3BSA A;  5CYM A;  2XNR A;  5D0G A;  4PXB A;  1O8B A;  4OX6 A;  2WHO A;  3KNG A;  4ES2 A;  4NLU A;  5T7L B;  3NAH A;  4WZM A;  2RIJ A;  1OO0 B;  2F1F A;  4ECV A;  3ZFV A;  2YPY A;  2R7T A;  3WC2 A;  2UUT A;  4NZ6 A;  2DGT A;  2Z2Y B;  5D4P A;  1F0X A;  1CC7 A;  2B7C B;  4TQS A;  3CJS A;  3GTY X;  4O3R A;  1VJW A;  5K9F A;  4A8W A;  4IG0 B;  1V5I B;  2HMI B;  1PBA A;  4LRB A;  1ZOT A;  3SDE B;  2AHO B;  2B5J B;  5HAO A;  3FQK A;  3KLG B;  3Q8V A;  2GGP A;  3UDL A;  2DT9 A;  1RTJ B;  4OI4 A;  2DEJ A;  5A76 A;  7FDR A;  4K4Y A;  2POK A;  1GXT A;  3L7U A;  1R0A B;  2GVZ A;  2WOM A;  5JMN A;  2HFV A;  3FNN A;  4RUA A;  1RHJ B;  4KSE B;  3P96 A;  1RB0 A;  1FTC A;  2IFX A;  1RYR A;  2DPI A;  1S4F A;  1Q81 T;  1NB2 A;  1OSC A;  2DHG A;  2ABY A;  5LXY A;  2ZOF A;  4HDH A;  2KTQ A;  4IFV B;  3IMQ J;  2ZBR A;  4XK8 C;  1SV5 A;  1HWJ A;  3AOC A;  1KTV A;  2BVZ A;  2DXF A;  4OI0 A;  2HHW A;  4JV1 A;  1J5O B;  4R5P B;  2DNL A;  4KHP F;  3QSI A;  5RUB A;  1FKA F;  1FNM A;  3ENW A;  1J27 A;  2Z2M A;  3HKW A;  3S01 A;  5DET A;  1D09 B;  4O44 B;  4Y2M A;  3BYP A;  4XDC A;  4K4T A;  4L6V 3;  3K5N A;  4DR7 F;  2OMO A;  3MM5 A;  1WC4 A;  1RGV A;  1YBU A;  2LDI A;  2ASY A;  2GJ2 A;  1K73 T;  4WK1 A;  1IR0 A;  8RUC A;  4M95 A;  5GAD U;  1KVJ A;  3JTP A;  4CYU A;  5DGA A;  2W2O P;  3H40 A;  1FDB A;  3G86 A;  4KHP J;  1DQ9 A;  3G6V A;  4NYP A;  1QAI A;  4RBV A;  1ICE B;  4MFB B;  4UTG A;  4GC7 A;  3N5B A;  2GJF A;  4RBU A;  1MU2 A;  1SH2 A;  2XSF A;  1KS2 A;  4OLP A;  4DV4 F;  4DR7 J;  4P72 A;  3OTO J;  2W4P A;  5DLG A;  5J2N A;  2DB1 A;  5THW A;  1NKE A;  3AD8 C;  2GQC A;  3H2L A;  4X66 F;  3HD2 A;  3KJV A;  2IRX A;  3BQ0 A;  3GIR A;  4I4B A;  2GV1 A;  5K8O A;  5T41 A;  2W7O A;  3VAL A;  4KO0 B;  1YJR A;  1BY9 A;  3BN4 A;  4L3N A;  1WUU A;  4YP3 A;  2DR5 A;  4HAC B;  4DFK A;  1NK8 A;  4DV4 J;  4QU6 A;  1RT3 B;  4NLX A;  3DHX A;  5IT9 U;  4EO6 A;  2CDQ A;  4YME A;  3VWS A;  4Q2M A;  3SXL A;  2N4C A;  1JXV A;  4OJG A;  4X66 J;  1VHI A;  3GZ7 A;  4I7F A;  4WXO A;  4MT1 A;  1RKI A;  2KH9 A;  1RWV B;  4W92 B;  4RLE A;  3CJ4 A;  3LA0 A;  4C8K A;  1S9E B;  1GXU A;  3I5B A;  3DRS A;  5GME A;  3G2X A;  4RKU C;  4BS2 A;  2J8A A;  3I4H X;  4NMX A;  4Y0F A;  5BJR A;  1V5V A;  4OYA A;  2QMW A;  1C4C A;  2WW4 A;  4WXW A;  3QYY A;  3HSD A;  5E3A A;  4EYI B;  3RJM B;  3FGV A;  3CC7 S;  1REG X;  2R8I A;  1AFI A;  2PN6 A;  4L3K A;  2AJ1 A;  3WBZ A;  2CQC A;  3W2V B;  1VBZ A;  5F9L A;  1RYS A;  1IKX B;  1WC6 A;  4RPF A;  3VHQ A;  4DV6 F;  1X8D A;  3C15 A;  4IOB A;  1WKK A;  3IP0 A;  2IJF A;  3FC9 A;  4ZCM A;  3S8S A;  1YJV A;  2HVD A;  3PXG a;  1WSV A;  3KLE A;  3HO1 A;  5J2P B;  2BOP A;  1VFJ A;  3HMJ G;  1GT8 A;  1BGX T;  2KT5 A;  3M9O B;  1FCA A;  4LF2 A;  4DS4 A;  1T9T A;  3IS9 A;  3HK2 A;  3NS6 A;  4DV6 J;  3GIK A;  4M5L A;  3LH2 S;  4NZ0 A;  4MTP A;  1JLC A;  2ROE A;  4N47 A;  1NB7 A;  5KFZ A;  2BW2 A;  1T03 A;  5A8K B;  3Q83 A;  5J2M B;  4KRW A;  2B6A B;  4NA2 A;  4E8U A;  2HS4 A;  1FE4 A;  1WDD A;  4DPT A;  3FMW A;  2K7K A;  3FDS A;  5DDO C;  1Q95 G;  3NCP A;  4C8N A;  1DHM A;  1C1B B;  3OL8 A;  1IKW A;  1UZH A;  1VQN S;  2AZ1 A;  2F8H A;  3V6H A;  4LSL B;  1TUW A;  4OHZ A;  4M5D A;  1QAJ A;  2ATL A;  2M52 A;  1VQ7 S;  2B4O A;  2ZZN A;  1WF2 A;  2J9D A;  4YOE A;  3BO2 A;  3NY0 A;  2WTF A;  2C2K B;  2CJX B;  5AE3 A;  1HIY A;  4FS2 A;  4FYV B;  4MYT A;  3MR5 A;  1PYO B;  1XNR F;  3HHE A;  2ATC B;  1RKJ A;  1IXK A;  4FPI A;  2ZEJ A;  2YNI B;  3CCU S;  3HSZ A;  5IWA F;  2IBO A;  1VQL S;  1RA6 A;  3CWJ A;  5CAB A;  2RF2 B;  4UOG A;  5L38 A;  5KFY A;  2XO7 A;  4QU7 A;  1YIT S;  2ZWO A;  4DSF A;  3EGW B;  4ZP8 A;  4RNN A;  5F0U A;  1E6Y B;  4AUK A;  4ZHR B;  3MAA A;  2OML A;  4XPE A;  4AD6 A;  3K0J A;  2K3I A;  4HEA 9;  2J6S A;  1RLD A;  1Y00 A;  2D1C A;  1P9Q C;  1JLE B;  4F4Z A;  4WFB Q;  3PY8 A;  4N8N A;  5BYQ A;  2IM2 A;  1OQ6 A;  9ATC B;  5HSP A;  3MCM A;  4B08 A;  2MKS A;  2A6O A;  4F3M A;  2HNY B;  1QVG R;  5KFX A;  5IWA J;  1C0U A;  2WVE A;  2G0I A;  1UTA A;  4NLY A;  5CCM A;  3Q8P B;  1UKU A;  3NXZ A;  2HIY A;  1NK5 A;  4WFY A;  2NXN A;  2J76 E;  3BV8 A;  3W61 A;  1NHU A;  2ZBC A;  5ETK A;  1VQK S;  3VGS A;  1R89 A;  3CCQ S;  4TQR A;  1O0P A;  4DQS A;  2HBY B;  2YH0 A;  1VYA A;  4GKJ J;  1ZPW X;  4EBC A;  4CO1 A;  3F56 A;  4NCG B;  2G0C A;  1JB0 C;  2NPF A;  3RB4 A;  3LP1 B;  3GFY A;  3BKF A;  4U9R A;  4LFC F;  3H59 A;  3K58 A;  4B3O A;  2K2P A;  4ETX A;  2GQ2 A;  2MZS A;  1AXQ A;  3PRV A;  4HTJ A;  1H2T Z;  3HI9 A;  1UVN A;  1VIX A;  1Q86 T;  3HSG A;  4C4W A;  3D67 A;  4DBQ A;  1RT2 A;  4OYO A;  2QC3 A;  2NZ4 A;  3GYX B;  1YJT A;  5H9E J;  1FEE A;  4JBC A;  3KG0 A;  1NJY A;  4Y2I A;  4NXM F;  4OX9 F;  4O3N A;  3R9L A;  4LFC J;  3HFZ B;  5CYQ B;  1GAO A;  4LVN P;  3W60 A;  2PO4 A;  5EDW A;  2Z2Z A;  2LQ5 A;  1EX8 A;  3UDC A;  1QDU B;  2CZ4 A;  5FDL B;  2OD6 A;  3GV8 B;  4ETZ A;  2GMJ A;  1VR6 A;  2HFZ A;  4ID5 A;  4DWI A;  3HVA A;  2E7V A;  1XJW B;  2AGO A;  1U1N A;  3V5R A;  2BQR A;  2QV6 A;  1NCL A;  1YJ9 S;  3C6U B;  2V0N A;  4LBH A;  2WBR A;  1WF0 A;  2W01 A;  3C3L A;  3U1L A;  4OHV A;  1HW9 A;  1NZ8 A;  1T9U A;  2IC3 A;  3THP A;  2XGP A;  2M8D B;  1HBO B;  1UMJ A;  4NXM J;  4OX9 J;  2JVR A;  4ECZ A;  3TP2 A;  1YZ7 A;  2GC8 A;  4I0W A;  1FA0 A;  2E1A A;  4HR2 A;  2MY8 A;  2CQB A;  3TAM B;  2KYX A;  3M1V B;  3J7Z T;  4R25 A;  1NKC A;  1SB6 A;  3W9H A;  4H54 A;  2B8Q A;  3FQL A;  3K89 A;  1MMD A;  2DYA A;  2DJW A;  3VAH A;  2WB1 D;  2ZBQ A;  2IAJ B;  4F0K A;  2GAH C;  3IA0 A;  3B8H A;  1RCO B;  2A2D A;  1S1T A;  4QZV B;  1BQN B;  2MPU A;  2R2R A;  3BBC A;  3MCS A;  3HHL B;  3CJ2 A;  2DH7 A;  4NYO A;  3SFU A;  5C25 A;  2VBY A;  1JNZ B;  3IR5 B;  2WON A;  1TP7 A;  5E7O B;  3R8Y A;  4OZN A;  2VOO A;  1HLW A;  3GJT B;  1Q16 B;  3Q89 A;  4OYI A;  5KFF A;  1NSQ A;  3MPU B;  3GFH A;  1CJV A;  4A8F A;  3W2W A;  4DL2 A;  1AFJ A;  2CWX A;  4DN9 A;  2VUG A;  3AXK A;  5T14 A;  2ADB A;  1D3W A;  2Y1I A;  3H0P A;  1JMT A;  4ZPT R;  4B9N A;  4CT8 A;  2AX1 A;  2QGF B;  2AU0 A;  1N48 A;  3D9B A;  4X4U A;  2V4J B;  2Q3P A;  1KLM A;  1RWM B;  4UT4 A;  4ZVS B;  3DC2 A;  5KFJ A;  3L4B C;  1WC3 A;  2WB4 A;  1S0V A;  4F4W A;  1IJF B;  3C6E C;  1TFY A;  4U7U D;  3O2I A;  4NLT A;  1VBY A;  1DLO A;  3W63 A;  4TLQ A;  4V1A k;  4ANE A;  1N56 A;  2B4V A;  2Q79 A;  1N5Y B;  2JC0 A;  1TQL A;  1MRO B;  2Q1L A;  1T9Y A;  3W1Y C;  2FDN A;  5KFV A;  4TU9 A;  1BQM B;  2ZE2 A;  1VJQ A;  3V6K A;  3IRX A;  4JB8 B;  1HYS A;  1FX2 A;  4J9P A;  2YX4 A;  2AD9 A;  3MEG B;  3M8P B;  3MM8 B;  2FJV A;  4OJ3 A;  5HMW A;  3RAM A;  3PW4 A;  4I6A A;  3TUJ C;  2RVJ A;  4DDF A;  3AH6 A;  3L9Z A;  4NCB A;  4DX5 A;  2MZQ A;  1RT1 B;  3V2U C;  2M9K A;  2QT7 A;  1TL3 B;  1U09 A;  4AL5 A;  2ADC A;  2OSR A;  3SCI E;  2NXU A;  2ASJ A;  1WI8 A;  1HNI A;  3ZTS A;  3C6T B;  4OYX A;  2PMZ D;  3UN3 A;  4UZC A;  1JLB B;  3RB3 A;  1T11 A;  2UUC F;  3RU0 A;  2FLO A;  3M2R A;  2ZDP A;  4AXJ A;  4K4V A;  1CJU B;  2BRL A;  4Y34 A;  5KFI A;  5C42 A;  3BGF A;  1OMS A;  2CJY B;  2APO A;  1WOR A;  2F4F A;  2CG4 A;  1KWM A;  3M8R A;  1SUQ A;  1O51 A;  2P9G A;  3WDO A;  3KHG A;  4A8M P;  5JXS A;  3KOA A;  3R5G A;  4CO0 A;  2XY5 A;  4DQR A;  1QJH A;  2VPW B;  2UUC J;  3CIM A;  5K5M A;  4DZD A;  4X64 F;  5AE2 A;  5EN1 A;  1IBM F;  4NL5 A;  1SJ3 P;  3HVT B;  4L73 A;  1Q4R A;  4K2J A;  1VOM A;  2FJW A;  1NUE A;  3KLH A;  1Y4Z B;  2JDJ A;  4R8U B;  2ALY B;  3EDR B;  3TAN A;  1IUJ A;  1RDR A;  1S79 A;  4DR5 F;  1M5K C;  1AW0 A;  4G65 A;  4X64 J;  1QAX A;  1PYT A;  2MKJ A;  2QO3 A;  1IBM J;  4YB7 A;  1JLG A;  2OEM A;  3OR2 A;  1CUL A;  3MAH A;  4ZPC A;  2G4B A;  2LEP A;  2J6U A;  1VRU A;  1U6Z A;  3MMJ A;  2JHE A;  3DLH A;  1BHN A;  4QWA A;  2OTJ S;  2JL9 A;  2YWW A;  4CDI A;  3FJ2 A;  4DR5 J;  1YTY A;  4CH1 A;  3MMB B;  4N77 A;  3OQ2 A;  1MN7 A;  3PM9 A;  1VQ8 S;  2DNG A;  1KP6 A;  1S6O A;  2HGM A;  2UU9 F;  3DOK A;  2AP6 A;  1IKY B;  4CLY A;  4LF6 J;  1P1T A;  1UL3 A;  2BE2 B;  2BAN B;  3DLE A;  1KC8 T;  1LOU A;  2Z2L A;  3JQK A;  5ETQ A;  2HAI A;  2GIR A;  1U1L A;  3DLK B;  3ITH A;  2V4R A;  3ILI A;  3UD5 A;  3A4T A;  1GK8 A;  2RKI B;  4RW6 A;  5HL7 Q;  1FNO A;  1VQM S;  1URN A; 
#chains in the Genus database with same CATH homology
 1NLT A;  1EAR A;  2Q2G A;  3TJ9 A;  1GMU A;  4L3K A;  1EB0 A;  3TJ8 A;  3LZ8 A;  3NXZ A;  1XAO A;  2B26 A;  2HFV A;  3AGX A;  1GMW A;  3I38 A;  3L9Z A;  3TJA A;  1C3G A;  3LA0 A;  3NY0 A;  1GMW D;  3AGY A;  3AGZ A;  4J80 A;  1GMV A;  2QLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...