3NY0A

Crystal structure of uree from helicobacter pylori (ni2+ bound form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
147
Chain Sequence
b'IIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 37
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3ny0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3ny0A02
3AGYA 3LA0A 3L9ZA 3I38A 3AGZA 2Q2GA 4L3KA 4J80A 2HFVA 3TJ9A 3AGXA 1GMWD 2QLDA 3NXZA 1EB0A 1EARA 1GMVA 1NLTA 2B26A 1GMUA 3TJAA 3LZ8A 1GMWA 1XAOA 1C3GA 3TJ8A 3NY0A
chains in the Genus database with same CATH superfamily
1RT3B 2KRBA 4JBCA 5F9LA 1U8SA 2MY8A 1KSPA 2HBZB 2ZNYA 1E6YB 2A1BA 4DQIA 4M94A 3Q89A 3BDEA 2OAUA 2QA4S 1T05A 4WU2A 1VQ9S 2N4CA 1TVRB 4Y0FA 4CZCA 3JTPA 2PT0A 5LXYA 2RD5C 1T8EA 3FQLA 4DQQA 3CJSA 3H98A 1FA0A 3QWPA 2GA7A 3CDEA 4RPFA 1OPZA 3QLHA 2W9CA 1BQNB 3H7HB 4DQRA 2UP1A 4DR5F 2CJBA 4V19X 2UXDJ 1RTJB 5HLFA 2BMBA 1JK9B 3Q8YA 5MLCV 3CCES 3G6VA 2M88A 1TV6A 2ZDPA 1JLGA 2MJUA 4DUZF 2AYMA 4LFBF 4QR1A 2E29A 5H9EJ 3L7PA 1YBTA 2DITA 3CJ8A 1QLNA 3FMWA 1GMUA 4V19J 4ED2A 5F9NA 4TVAB 3GV5B 2AYEA 2JEIA 4USVA 3KLFA 3RB0A 1XMQF 2APOA 1FX4A 2EBGA 1ZTWA 3D54A 4DSEA 3PYDA 1S4FA 3JYTB 2GHVC 3G87A 2RRBA 1DTQB 4UUXA 5KFPA 4LR9A 4IG0A 2R7RA 3Q2TC 1XTZA 3OBIA 1U8WA 1YRTA 2A18A 2F8EX 3T19A 3IA0A 1CQNA 4WYWA 3K5NA 4DPUA 2HK2A 4IQXA 5F41A 2QRRA 3O44A 3NCPA 2A2CA 4A8WA 5HK4A 2MQ8A 3DU6A 1Y3KA 1N5VA 1L5UA 4X65J 2FY8A 2XCPA 2M52A 1QAXA 5HVFA 2MSTA 3M8QA 3MAAB 1LEOA 4F50A 1HARA 2KRRA 2JFDA 3MM7B 2DGUA 2ZC4A 1NBEB 2HHUA 2XI3A 1V3SA 3PW0A 2W9BA 1KP6A 3OPKA 3BO2A 2WVBA 1RT1A 3R7SB 1X5OA 5BXIA 1S77D 4QQBA 3DM2B 5K20B 1CULB 2FHMA 4A8XA 2ZHAA 3T1AA 3RBEA 4GC7A 3DRRB 4J9MA 3HVTA 3MM6B 5KT4A 4L3NA 2A0FB 2V4RA 3TZXA 1PYSB 4F04B 2R7QA 4QYZJ 1FTRA 4S0MA 2P6SA 3IN5A 2FLPA 5JXSA 2XY6A 5KFYA 2XMWA 2HNDB 2IMWP 4JI3F 1LWFB 4RWWA 4B17A 4JV0A 1HNXF 3DLEB 5U47A 4F4WA 3M9MB 2LXUA 1HPZB 3F0NA 2OPRA 3CCRS 3EX7B 2Y1JA 2IJRA 2JRRA 3CXCR 5A8RA 1UMJA 1URNA 2HS4A 1REGX 3CDUA 2FVPA 1LW0B 4QW9A 2CPDA 4P75A 3WIVA 4CYUA 3PVXA 4OLOA 5E5NA 4RBVA 2QLFB 2YVSA 1F3FA 2NQPA 4PZVA 1WF1A 2F4FA 3EE3A 5F8NA 2RUGA 1GNKA 2R8KA 3ZNUA 2VZ9A 3AGXA 4GKKJ 4NLSA 3GJQB 1HD0A 2AHOB 4DR6F 1SBRA 1GX5A 5HAOA 3AAWB 1LQ9A 1RAOA 4YN3B 3LQVA 1PJ6A 4JI8J 1O0PA 4KH0B 1MU2B 2C2ZB 2HFZA 2LU2A 2ZOFA 2LEPA 2CJQA 3KDOA 1RTIA 2XMJA 4FYXB 1HBUA 2XCAA 4C8KA 2XMKA 5FDLB 1NPRA 2GW8A 4EBEA 2LDYA 1NK4A 2PFFB 1S57A 4B3SF 4JI6J 4NLYA 4FF1A 2JL9A 1Q5YA 5LMNJ 2LMIA 1MROB 5D8HB 4HHUA 1NPKA 1HBMB 3AXMA 1D1UA 4B9MA 1CJUA 1WC0A 4KRWA 2F1FA 1SL1A 2H4WB 1AROP 2MQQA 2OLWA 3N6MA 3D1OA 2DYAA 1UW9A 5A8WA 1G3OA 3IS9A 2ZH2A 2ROEA 2ZOGA 1WHYA 2KJWA 2W2PP 4MK7A 3PW7A 1IR2A 3N0VA 3TO8A 4W4MA 4KYZA 3R5GA 4J9PA 2DNRA 3W65A 3MR5A 4YR0A 3D28A 3R1LA 1EQ0A 2HVDA 5ETTA 1UFWA 2HS3A 5EWEA 2CADA 1VQ6S 4IFVA 2ZJRQ 4M5DB 1RT7B 3IWXA 4ZVRB 4M5LA 2HNZB 1C0TB 2YNIB 4N5SA 3VAJA 2Q79A 3LZ8A 3C2PA 3JQKA 2QYGA 5DDOC 3POTB 2DEIA 2IYIA 2OPPA 4DV4J 1WF2A 1AFIA 4N47A 1FEHA 2RIJA 2VFSA 4L6V3 1QAIA 2UUBJ 1GK8A 2R7SA 4ECTA 5HMYA 1YJVA 1WACA 3RR7A 2VPWB 3DYAA 1K0TA 1YZ6A 2X1GA 1NJIT 4AD6A 5EDWA 2L3MA 2E5GA 1TKTA 2G2YA 2V5HG 1X9WA 1TAUA 4A4JA 5IFMA 2WCXA 1HNIB 1N54B 3TVZA 1PYTA 5K5MA 1R31A 4WKYA 1Q86T 5J2QA 2Z58B 2OPSB 3ZO7A 3NXZA 3R5CA 2UXBF 4D3HA 1VC6A 1P1LA 2VQFJ 2DCUB 1VBYA 4KBIA 1IKXA 1ZOTA 1N5YA 3GILA 1Q81T 2N7CA 2G4BA 4YP3A 2DNOA 1HQUB 2HG4A 1HHTP 2OI2A 2R8HA 3MEGA 3NNCA 1NSKL 4FPRA 1KR4A 4Z2XA 2AU0A 4NA1A 4GVBA 2FVRA 3KHRA 3ZTPA 2NUUG 4F7VA 2WHOA 2W1BA 4Y28C 2KHCA 1CVJA 2RT3A 2UVWA 2C22A 1TP7A 4QBUA 1FNXH 4MIWA 5EX3A 3G6ES 4B9NA 5A6WA 2XNQA 2EFNA 2PA8D 3WX4A 3TA1A 4H4KC 2RU3A 4U7UK 2HMIB 1T9TA 1JNZB 4C3LA 2YNFB 4Y65A 2MHEA 3FEYB 3OR2B 3J7YI 5E3AA 4U8VA 3UVJB 2Z2LA 3KLIB 1HHQA 2IAJA 1SQEA 1PG5B 1WG1A 2ZHOA 4AUKA 4NRUA 1IBLF 2BA9A 4L76A 4DF4A 1X31C 5DETA 3V2UC 4K2JA 3FCWA 5JVHQ 2AZ1A 3TAPA 5CZXA 5ETLA 3L4BC 3T1YF 3O6QA 1PO6A 4TLRA 2E7XA 2KT3A 4RU9A 1RLDA 2FJVA 2KN4A 3W7BA 4KQZA 4MKAA 2LQ9A 2V50A 4P2MA 4J91A 2I2YA 1NRKA 4ES1A 3BN4A 3I5AA 2DNPA 2HVIA 2YKPA 4CWBA 1RWMB 1KVKA 4LR8A 1N8RT 1UJ6A 4X4OA 5DM6Q 4EZ9A 4IRDA 1NHVA 3TQ1A 3ETMA 2EKNA 1VQLS 2XS7A 4KE5A 3DRSA 5J2PA 1FERA 1YBUA 1DQ8A 1S1TA 3NNHA 3NWRA 5FLXY 1K8AT 4IRKA 2BE2A 3CWJA 2XGQA 2FC9A 3LP0B 1DLOA 1QY7A 1N36J 1YJWS 3C3LA 4JYAF 1VFJA 2YKNB 3QMQA 1AW0A 1RSCA 3ZTQA 2JLEA 3SQGB 1WSVA 2W4PA 2CQIA 3I0SB 1HNZJ 3NGRA 3QT8A 4DJBA 1IQTA 1JX4A 2YY3A 2AZ3A 3IP0A 1S9EB 2P9EA 4B08A 1N5SA 1UAWA 2HZAA 5GMEA 3DOKB 2PI5A 2XMAA 1Y5NB 5AE2A 1PKUA 3CSKA 1YJ9S 2DGWA 1NLKL 3UDVA 5IWAJ 1IQZA 4OZNA 5KT5A 3PO4A 4JI0J 2BDPA 3RRGA 1FJGF 1WNEA 5GAGI 2W25A 2V63A 1IJEB 3FSIA 2E5IA 4NASA 1VDHA 1HNVB 3B8HA 2R2TA 4QWCA 2O66A 4EFAC 2O1PA 5IOLA 2OTJS 2QLXA 4OI0A 1SL2A 1JLFA 3LH2S 1RT6B 2LQ5A 5HMXA 2NXEA 1VMBA 2AGQA 2OJ3A 1FJEB 4MKVA 1IR0A 3EXYA 3NS7B 4LFAJ 3V4MA 2BANA 1JLAA 3TUIC 2CQ1A 5GVQA 4UQTA 1XJWB 4LBHA 2DNNA 2WONA 4OX9F 3PW5A 4F36A 2XG8A 2XC9A 3TEHB 1FKOB 5ADZA 2EC0A 5CA5A 4CM0A 4RNHA 3T41A 4JUZA 3EDRB 3JSMA 3QQCD 2CRLA 3IAM9 5LL6d 4CO0A 4RW4A 3NAIA 4UW2A 1J5OB 1GAOA 5DJBA 3D3BJ 5IC4B 1EP4A 4G1IA 2OEKA 3K5OA 3DLGA 4AYBD 2CPJA 2DT9A 2M9KA 4F3QA 3EMTA 4FBUA 4DV0J 1ACMB 3FFIB 5JJBA 3HVRA 1W7WA 3C16A 2C28A 5C25B 4Y00A 5SUHA 3HHNB 2GQQA 1KFDA 4O3RA 3CJRA 3UR3C 3CJ4A 4CLLA 4R5PB 2KU7A 2QLDA 3KXDA 1M5SA 1C0UB 2XY7A 2DXFA 1RZMA 2V69A 3LWMA 4ECXA 5D4LA 4K0KJ 3PIPQ 3E8OA 2E5JA 2CQPA 1K44A 1S6PB 1SH3A 2F8MA 2HYIB 4OYXA 4LBPA 4W98A 3GR1A 2FLOA 4ZCKA 3M32A 1RA7A 1YVFA 2BRKA 2DNKA 2UVVA 2DO0A 2JLFA 4CT8A 2MKIA 2EXUA 5F8GA 2GZOA 2PN6A 3NBPA 3MF5A 3OHBA 1X0FA 1ZTTA 2DKOB 2XQCA 3OUYB 3VHQA 2DD8S 5KAKA 1S76D 3WX8A 5DDRC 1CPZA 4DR1F 3RU0A 2VPZB 1EARA 4WCEQ 1T9XA 2FB0A 2YNGB 3OTCA 4OYBA 2B3TB 3ENAA 2IIHA 4L73A 3A13A 1FRKA 1UL3A 3QFWA 1EB0A 5F8JA 1RTZA 2RS2A 4YR2A 2ZBCA 1YITS 5KG3A 5HL7Q 4G1PA 1N34J 1HWKA 1H7XA 1XNRF 4FF4A 4LQ3A 3M2UA 4ZIWA 3PO5A 2DGOA 2K2PA 2MEWA 1NKCA 3QBCA 4TU7A 4K59A 3OR1A 4NEZA 4CLFA 2JNJA 4ED6A 2OO4A 3Q86A 4AL6A 1TKZA 4KHPF 1X4HA 1EX8A 1HLWA 4Y2IA 3K0JA 1CSJA 1M0SA 4ZVHA 4CP5A 2XYGB 4BC9A 2VKZG 5AT1B 4BWMA 4ETXA 3DRYA 4EUVA 1KOHA 4LVOP 4LBIA 1BC6A 2DHAA 3B54A 4XO0A 1RTHB 2HFSA 1FK9B 1RT4A 3JTNA 1FD2A 3JS9A 1NDLA 4GC6A 1FWKA 2HWTA 1WDTA 2X51A 2ZHBA 1APSA 2PFDA 3O5TB 3ILOA 2V94A 5HMZA 1NKEA 4CLUA 3THVA 4DX8H 3PYEA 3JB9k 4YB5A 1K1QA 1KQSR 2YX4A 1A9NB 3AFGA 4CH7A 4DOZA 4TQSA 2HNYB 4NYPA 1S10A 1CS4A 3QJLA 3D0IE 1HMVA 3OL7A 2W7AA 4CNZA 2R4FA 1QSYA 1S6UA 4DL5A 2CQBA 5IQQA 4K7QA 4ECVA 3I96A 1WG5A 4PUOB 5F3ZA 5ETPA 5HBMA 3VF0B 2E9ZA 4CLYA 2KM8C 3IGVA 2ZZNA 4DPTA 2HPUA 3I32A 3NGDA 5LM7E 5I3UA 2RRNA 1YJUA 4RW9B 2UVRA 3VZIA 1NB2A 3R1HA 1RDRA 5LJ3Y 2JOQA 5L9XA 3PJWA 3RZAA 3UDLA 1X4DA 4KV8A 1REVA 2W8LA 3JQMA 4QIFA 1T05B 2FHKA 3M6UA 4B3OA 3ISNC 2XEXA 1M5VC 1NAQA 1RABB 1QJHA 3PFEA 2KO1A 2WSEC 3M9OB 2RQCA 2J8SA 1WOOA 4HDHA 4NLWA 2KFNA 3BREA 5E7OB 2IVMA 3SXLA 3QLHB 2W9CB 1SKRA 3HVAA 3SSQA 2V0NA 2DR6A 1BMQB 4O4RA 3FK4A 4X66F 3T9NA 5HLFB 1RBLA 4ED8A 2F8HA 2XWYA 2BJ3A 4EK2A 5B0GA 1S7IA 3JQJA 2J9EA 4O3NA 1S4EA 1TV6B 4WXWA 2Y3YA 1JLGB 4QIWD 2M7SA 2ZDOA 2B43A 2YWGA 2FIUA 1QTMA 3A4TA 3BV8A 3MM5A 2V8HA 1YG0A 1N32F 4AQYF 1RCXB 3HFKA 4C9DA 3N01A 3L3CA 2HHXA 2RHQB 2CG8A 2XMVA 1U1NA 3SEOA 3KLFB 2HQFA 4HH1A 3CCSS 3V6DA 2VG5A 4HYKA 3ENQA 2B9YA 5F8MA 3R8YA 3DOMA 4IG0B 3ADAC 2K3KA 2EI5A 2E1RA 1KHWA 5DLFA 2YPZA 2LECA 4WPAA 4ZPTR 1OO0B 1OQ3A 1OPIA 1YHQS 5D0EA 4AT1B 2CNOB 3IWNC 2QN6B 2MLYA 4FXDA 3W66A 4CH1A 1FCAA 5KG4A 4F4ZA 1MMDA 2I8EA 5J2MA 3CNQP 1AZSA 1TL1A 3TAQA 2DRAA 1RT5A 1TL4A 5D78A 3UFCX 1N0UA 2R7WA 3C8YA 3M8QB 1X5PA 3M9NB 3CD7A 3CJQA 2IM3A 1QD1A 4K4ZA 5IT9U 4LRCA 4A8FA 3PW2A 2LKZA 1RBOB 3CJ0A 2W9BB 3QFHA 4ZJLA 1RT1B 3MPDA 4C11A 2C2KB 2HZCA 2AEMA 3T5JA 2J6UA 4RNNA 3SCJE 3TYTA 4I6AA 3G8TA 2GV1A 5DS7A 2FVCA 4ETZA 4CT9A 3T5KA 1EJ7L 3HVTB 4E98A 1NJYA 2ZBQA 5KFMA 3PG9A 3W1YC 3FJ2A 3B82A 5C7PA 3ZZUA 3TA0A 3J81Y 4DV2F 5GAEI 4PWWA 4TY8A 2LFVA 3A3PB 1S7HA 3GFZA 1Q8BA 4HT7A 1YSJA 5BR8F 1IVZA 1YDLA 5DZ7A 1HQEA 4A8OA 1UVIA 2VICA 2NSBA 3NP5A 1S72S 3IM8A 3DLKA 5GAHU 3TEGA 3QAEA 1QUVA 1X4GA 2OPRB 3AHPA 4OHWA 2CDRB 3W8PA 1KKHA 2D7SA 2ZM6J 5A8RB 4L3KA 5IS2A 1DARA 4G6VB 3MUTP 2OD4A 4WP8A 2I6WA 4CYUB 4QU6A 1OS5A 1AXQA 5FLXU 3PZPA 1JKHA 3J7YU 1Y7PA 4LF4F 1NHUA 3BDPA 4CCHA 5DLGA 1VLYA 5DGBA 3AH6A 1MWYA 3TUJC 3HK2A 4OZ2A 3CO9A 4YB6A 1KRPA 4ILMA 2QFJA 3H5UA 1ZZNA 1BQXA 4NEYA 2BW2A 2IM0A 3CT9A 2XS5A 1CJKB 3GG1A 3PFOA 1UEKA 4FKYA 1RTIB 1HBUB 4CTAA 3QAUA 3RW7A 4X4PA 3MM8A 2B9XA 2MJNA 4C3MA 4B9VA 4HTIA 1L3TA 2W24A 1D0EA 4EBDA 1ICEB 5THWA 2XSFA 6FDRA 4WFNQ 3UQSA 3MPVA 4QCLA 1CJUB 2F40A 2ERRA 1X0PA 1HW9A 2OPQA 2UXDF 4KY3A 4I6YA 2Y0BB 2DGTA 2V68A 4YB7A 4IFYA 1RE1B 2EFPA 2CZ9A 1N5QA 3MAQA 3PYFA 1M5HA 5A8WB 4YFUA 3OSNA 2LEAA 1NZAA 3IS9B 1I94J 1H0HB 5B7WA 3CDBA 2EFOA 4IOBA 1D9DA 3JTOA 3VZHA 5CYJA 4B3MJ 3OJUA 1L3KA 4PG5A 4ID8A 2OELA 1DURA 4ZN3A 3VWSA 2FD2A 2CZVC 1IKWA 4PG4A 4ZMMA 2DIVA 2HHHJ 1RI7A 1EQMA 3GU0A 4O0NA 3BF4A 2FDNA 1YJ7A 2YKOA 1B3TA 4IFVB 3ZC4A 1X4CA 2MMYA 4IDKA 3OL6A 1FT8A 2DEJA 4LF5J 5CZVA 4O23A 3HI9A 2FJBB 1WKKA 4NZ0A 4X2BA 2DNYA 2OSQA 4WWSA 4C8NA 3CIMA 3V6JA 2WRMA 3D0GE 3WBZA 2OPPB 4J9UE 2HSEB 2V34A 1HW8A 2YWWA 4M1KA 4DPOA 1FDDA 5A2QU 2MY7A 2VG7A 2ZD1A 5EX0A 2HHSA 2PC6A 1IKVA 2IY5B 3P4UB 1YJTA 2M5YA 2XZTB 1U6ZA 2EWHA 2POKA 3QATA 3DYAB 1WOPA 5CCLA 4OLPA 3LW5C 1IN0A 2GAGC 1S1XB 5L38A 2MKYA 1UWAA 1TKTB 1UKUA 4C0OC 2J5AA 2DCLA 4K4YA 1IWGA 2DHXA 1Y5LB 4Q43A 3MMBA 4F25A 3MUMP 1IM6A 3SMZA 4CIOA 1HWUA 5J2QB 3RBXA 1MWZA 5HQLA 1IKXB 3MPYA 2DXDA 1N5YB 2IDEA 2YKMA 3WC2A 2QMXA 3QT6A 3NG8A 1I1GA 3CVKA 1FVQA 4DL4A 4ZK7M 2QFIA 3MEDA 3HHLA 5KG6A 3MEGB 3P5TL 4JV5J 1RADB 3B78A 4GVBB 4FF2A 1TK0A 3NRBA 3VGTA 2BR0A 1XK8A 4ZVPB 1O8BA 3SCIE 2ATLA 4KJIA 2CNNB 2AF6A 3R2DJ 3D3CJ 1YGYA 3K59A 3QRQA 2KXHA 1X4FA 2JVMA 1Y5IB 1PILA 3PXGa 4P2XA 4Z7YA 1JMTA 3AD7C 2NZ4A 5CH7B 2OKQA 5H1SV 4U8YA 4WF9Q 1F6TA 4UQGA 4O4GA 1S6OA 1SKSA 2IJNA 5KFJA 1S97A 3N5FA 2A3JA 1SH0A 2UUAF 3R5JB 3CD0A 3V6HA 1VQ4S 2IAJB 4DWIA 3CD6S 4WFBQ 3LTOA 4CLZA 1KONA 2DR7A 2YH1A 1DQ9A 2GO9A 3NOCA 3I5CA 3BR8A 5D0RA 4DSJA 3QNWB 2F3JA 1QE1A 4GKKF 2OSRA 3ENVA 2RDJA 2QJ3A 1IBKF 1S9GA 1HIYA 1WELA 5ETVA 2EK6A 4BBYA 1H3DA 1PGZA 4FXVA 2WOMA 2WW8A 2LYVA 2FVQA 1R43A 1HYSA 2Y1RI 1SUQA 4Y34A 3ZTRA 2JHEA 1WC3A 3VV2B 3NGTA 4CM2A 1JJ4A 3R3TA 1RXOB 2P9GA 4EZ6A 4UF4A 4FKXA 3BEGB 2WVDA 5LMNF 1LXJA 4ZVFA 4KGXB 1GEHA 3QIPA 1U2CA 4JV2A 1FE4A 4NLPA 4RUHA 2EG1A 2ABYA 1U47A 4R0EA 2R8JA 4IH7A 2G0JA 1LOUA 3MFHA 2DIUA 3DRSB 5J2PB 1K47A 4CLPA 2VJVA 1S1TB 5IC6B 3IXQA 3IBWA 1TUGB 8RUCA 5BJRA 2BE2B 5HVGA 4YDDB 3D6FB 3HD1A 1DLOB 4J9QA 1GTHA 1K1SA 3C14A 2ZWPA 2OGUA 2UU9J 1FX2A 1F5BA 3BB5A 1H7WA 5IV3A 2M70A 4QIVA 2BQ3A 2F9JA 5SZTA 2YWHA 3PR5B 4FP9A 1RAHB 3AOAA 5K8PA 2RMLA 4IH5A 5AJ3J 3OLAA 2DY9A 3UCZP 2QG9B 3NS5A 3OT9A 4LFCJ 5LMUJ 1XC9A 2VUGA 3W2WA 2IFXA 1T02A 3KLVA 1J5EF 4UUWA 4UOGA 3KJNB 2BZ2A 4USJC 1IBCB 2HFOA 1CLFA 3ILIA 2BRLA 2AV5A 5F8IA 5AXMA 3PNIA 1BE4A 1U7LA 4N8OA 3RAQA 4J7CA 2BW7A 5GMKa 1TL7A 1BY9A 4WZMA 3MMCB 2OH2A 2DO4A 1NSPA 1LWEA 4C0HA 3GZ7A 3W5YA 1XR6A 4X4RA 1JLFB 3EVWA 3N4WA 3ZZYA 4F8RA 1SPBP 3CMQA 1XR7A 4LRBA 1NXIA 3DDNA 1RAGB 4OYPA 2EFVA 4QYZK 2ZBPA 3OJSA 2VQFF 3CCZA 1RAEB 4NE9C 1M1HA 4DR3J 3GJTB 2O5DA 4F2RA 4F26A 2BANB 4GO5X 3HJFA 1JLAB 2D41A 1F2GA 2GIRA 1M90T 1YTYA 3S1TA 2AD9A 3LAMA 3DHWC 3GG0A 2GC8A 2PEHA 3M30A 2UVUA 2HWHA 2PMZD 2Q2GA 3VGSA 4K4VA 4RL1A 2CDQA 2IA6A 3JAMY 3JSMB 1NH8A 2W8KA 3TQEA 4RW4B 2BKOA 3H4BA 4ZVUB 1YLXA 3HFZB 2NPIA 1EP4B 3M8PA 5L1KA 4NXMF 2X7IA 3DLGB 3TVKA 1SL0A 2EG2A 1RYSA 1FHTA 1KFSA 3DRXA 3C16B 4HL9A 2MZSA 4RJVA 2WVFA 3MAHA 1TAQA 2CJYB 4DUYF 4ITSA 3B4DA 2V4JA 2BE9B 3DGPA 1NDKA 3P6YC 4DV1F 1GMVA 1M1GA 4DU8A 4E2FB 3K57A 4DR5J 4ECSA 4ALZA 3P8BB 2FHJA 1JJ2R 1VS3A 1PYOB 3W5XA 1UPMB 4OL8A 3KDNA 4JV1A 4A8YA 1K0VA 2HQGA 2N7YA 4BS2A 4IUFA 3M32B 4PRFA 3ZZOA 2K3IA 4I2QA 3IRXA 5KFXA 3GTYX 4LFBJ 3LPEA 1TFYA 1SJRA 1UZDA 3BGRA 3OSPA 2HLTA 2QO3A 2HLUA 2MHNA 2XYHB 2V2QA 3NBPB 4O44A 4P73A 1KVIA 4FXWA 1XMQJ 3KTQA 3D1QA 1NK0A 3RUBL 2A6OA 4EO8A 3D68A 3C19A 3EWGA 4I67A 2B26A 4PEOA 2OP5A 3E51A 3CGIA 3ISND 1IWAA 2VOOA 2VASA 4TNOA 3KKFA 2J9CA 3TAMA 2GIFA 3BGOP 4XDCA 4P6QA 3AKOB 4ZVEA 4RW6A 1KHVA 2HRTA 1WEZA 3E01A 3SCLE 2O67A 3W9JA 3CCLS 2FQQB 1V6HA 4OHZA 4WP9A 3GLJA 4X62F 3T1HJ 2VD3A 2KG0A 3NWGA 1VQKS 1FFWB 1S1UA 4OYOA 2GHWA 1B64A 5FJ4A 3I0RA 4YR3A 1MLAA 3B6BA 3F41A 3M2UB 1R27B 2KVQE 3ZTSA 4WTOB 1ZYQA 2FJXA 5KFAA 1O51A 3VAHA 2QSWA 3HM9A 3UD4P 2GJ2A 3BM7A 3TJ8A 3OR1B 1VBXA 3QGPA 2OHDA 1TKZB 5E2QA 2A6MA 2B7BB 4OYWA 3ITHA 3K2YA 2NPFA 4ZPWR 4P2FA 2C1EB 4UY85 3AOBA 4IKAA 5A8KA 2RILA 2QC3A 2IBOA 1GMWD 2MGZA 2YBVA 1RT4B 4NA3A 2BKNA 5K9FA 4A8QA 2D1CA 2VFRA 2ASDA 2ASLA 5I3QA 4WZQA 4ELVA 2D9PA 5KFDA 5DGAA 1QVGR 1YK9A 3MMJA 1JB0C 3IC1A 4X64F 2FYXA 4OYIA 3N6LA 4I7FA 1FRMA 1BHNA 3W2VA 3GV8B 3MHYA 1HNXJ 2R7TA 2A2DA 2ZZMA 1F9EB 3IRWP 1NDCA 4O3QA 2AGOA 5GAEU 2PI4A 3GJRB 3R5DA 1CS4B 3CJ2A 1R0BG 4DL2A 3KNAA 2N82B 2GHPA 4YDXA 1HMVB 2UZAA 4ZLJA 3FGVA 1RLCL 5AXNA 4MH8A 3OFGA 3H2LA 1Q1KA 4ANCA 2VU5A 1YJNS 1DJ0A 1VJWA 2QYCA 2X1AA 1H98A 5HBMB 2WSCC 1VI7A 4Y2MA 4Q0BA 4A48A 2DPJA 4PR6A 4OHYA 4DR6J 2DNMA 2IC3A 2GX8A 4UT4A 1P27B 5I3UB 2FHOB 1HWJA 3H90A 4Y2KA 3TWZA 4R25A 2BE7D 2DHGA 2DNLA 4C3KA 1N33F 4LVNP 1IUJA 3HCXA 1RGVA 4DV0F 4KV8B 1REVB 2IRUA 3EM1A 2KXNB 3EYZA 3KG4A 3H4DA 3MCOA 3E3XA 3U1MA 4B3OB 5KG1A 1JLCA 1XERA 1T7PA 2DGVA 4ES2A 1LFPA 1WORA 3M8ZA 3MEEA 4DR4F 4M63A 5CQGA 1QTNB 2CVEA 4F0HA 3TANA 3OL9A 3ILLA 3JSBA 2B8PA 3GYNA 4K0KF 3G6YA 2V9KA 1SCJB 1EIYB 4J37A 4URGA 3OXFA 2CAJA 1Y3JA 1WDDA 1BD6A 1S6QA 3AQOA 1JLEA 2K7KA 4K8RA 3EZUA 3I9V9 2HHVA 1QVFR 3EICA 1MNEA 2VJUA 1VIXA 2HBQB 3OD2A 1WKJA 2MKJA 3HSZA 3MM5B 1FXDA 3LF0A 4I68A 4HDGA 3NMAA 4LIWA 1H38A 3K7RA 4ECYA 2LA6A 4XPEA 4C8YA 1FRLA 2VOPA 3KMSA 4OZLA 1X5SA 1GFWB 4W90B 3V6DB 2VG5B 3CC2S 1F9HA 2HHQA 3BKTA 3D6MB 1QM9A 3DOMB 3W5ZA 2ZBIA 4AXJA 4ECZA 1DZ5A 1P9QC 1FVSA 2AT1B 1QAYA 4EWTA 3HP6A 3U1LA 1Z2LA 3AQPA 3VAKA 1FNOA 5KT3A 1SVDA 5IT0A 3CO0P 4AL5A 5J2MB 1AZSB 2BJ9A 3LALA 1TL1B 1RT5B 2M4MA 3UDCA 1GXUA 2DR9A 4GKJF 1WC1A 4ECRA 4XAKA 4DR2F 4OX6A 3F73A 3RJMB 3DHXA 1Q95G 3PJXA 1WHXA 2MZRA 1U4BA 3ELHA 2MLXA 5BYRA 2XTJP 2VC0A 4C11B 1XNQJ 2ROPA 2HHWA 3I9ZA 3MFIA 2J6SA 2OFGX 2NZCA 5DQGA 2G2ZA 1UETA 2DR5A 1GXLA 1ZA1B 5IV4A 4MFBA 3GE9A 3PIOQ 3HSDA 1F5CA 3PKYA 1KNZA 4FNIA 4TY8B 1YIJS 2YQ3A 1FFGB 3Q8VA 1IKYA 1KN6A 1HQEB 4PAAA 2R2RA 3ZNJ1 1Y11A 5KFCA 4JB8B 8ATCB 1RJJA 3G4SS 3DLKB 2VFUA 3OHAA 1C4AA 1RTDA 5KFQA 1VQOS 1M1KT 1L3UA 1IBLJ 4ELUA 3IR6B 4XDDA 1ZPWX 4ZIVA 4DV6F 2Z57B 4LF1A 1WOSA 2ZUAA 3VVUA 5K8MA 1HBOA 2GMLA 5E3QA 4DSFA 3Q8RB 3KHGA 4PPDA 4R8UA 1JKHB 1KQFB 1H72C 3SQOP 1RA6A 4I69A 2BJ7A 3L95X 5DQIA 2HURA 1FXLA 5HANA 5T7LA 4NX9A 1K73T 1GXTA 4Y6IA 2IRXA 2AYBA 4RR5A 4F0MA 3I56S 2DR8A 4LREA 2MQLA 5HQ8A 4HTJA 4LF6F 4ZJQA 3BS9A 5B0AA 4CTAB 1TL5A 2XMMA 3M6XA 3MM8B 1AA1B 1RACB 5B0DA 1VCTA 3P3DA 1RBAA 2CNLB 1HBNA 3B4MA 4X84A 4P52A 2XO6A 2OPQB 3FUYA 2CQDA 3LANA 1SKWA 4IFYB 4LF9F 4NMXA 3G86A 1ZS6A 2XZDB 4PWDA 3GYXB 3BSNA 1V3RA 2B4UA 4HI1A 4FVMA 3AJDA 4M5HA 3IWLA 4LT6A 4USHA 2RS8A 2WBMA 3Q23A 3QIDA 5L9NA 5CYMA 1KS2A 4NCGA 3GQCA 1WJ9A 1IKWB 2E1CA 2ZOMA 1R3NA 3TA2A 4DZDA 2VBYA 1IBMJ 1R8HA 4IDKB 1GTEA 4OJHA 4FZVA 4X4VA 2ADCA 3L9ZA 1JNRB 1RWXB 2Q1LA 1F9FA 4NLGA 4U7CA 4PQUA 2JEJA 2XNRA 1IR1A 4ANEA 2VG7B 2ZD1B 3BYPA 2J0WA 1NMEB 2W9AA 4M5GA 2J8AA 1IKVB 3J7AN 4M95A 4IQMA 3IG1A 4FF3A 3TZZA 5E33A 3CJTA 3CJ5A 1JJCB 4Z7CA 5CD4H 1U2RA 1XQIA 1KQKA 3H42A 4NLDA 2VIHA 1TL3A 3K5MA 3ZZTA 2BKPA 3QSYB 3NOGA 3MMBB 4ECUA 1VHIA 4ED3A 4BWJA 2XI2A 4K4TA 5D15A 3H0PA 4DSLA 2EK1A 5FD1A 3DMJA 4OX9J 1UVNA 5J2NA 4RW8A 1HI1A 5CAAA 2RF2A 2YKMB 1JLQA 1Y0HA 3NCQA 2B9EA 3MOZA 5DO2A 4QIEA 5HI7A 1S1WA 3MEDB 3G8QA 3HHLB 4DV5F 5AE3A 3W3SA 1F5AA 1QSSA 3D1HA 3A8EA 2I5JA 1H2VZ 1YBAA 4YHHF 1G7CB 1P8GA 1TKXA 2RDIA 2H48B 3THPA 2NSCA 1Q7YT 1WHVA 6FD1A 1N6QA 1MW7A 5M2PA 5F3TA 4L72B 3D7SB 1UJ5A 3CC7S 4NXNF 3CDAA 3H25A 2RDDA 1WI8A 2C2EA 3OW2R 5J1PA 1WEYA 1HA1A 4U6PA 3PX0A 3PM9A 1HHSA 2KJVA 4OYAA 3NGUA 2BXJA 2EFGA 2PDAA 4UOHA 1RQ0A 2P9CA 4KHRA 4O4GB 2ZM6F 2E9TA 4HHJA 5D4OA 4X4SA 4LRFA 3I6PA 1X9SA 4RO0A 2D69A 4P71A 1RP5A 2YX1A 3FKBA 2EPIA 1FRHA 4J9RA 1CEZA 1ZAWA 1VYAA 2H51B 2HAFA 1RHMB 3UCUP 5T14A 3KHLA 1QE1B 3CMAS 2V2KA 4ZCIA 2FJWA 1JQGA 2VF3A 2ILZA 1S9GB 5B0EA 3M4XA 5B08A 4KH1B 1UPPA 3UI3A 2XWXA 4D3GA 2VDHA 1U6BA 2WOMB 2KT5A 4F3MA 1D9AA 3QPIA 4M5IA 3UNGC 1HYSB 2QE5A 4DR1J 1SUQB 5KFGA 2V67A 3DC2A 5IM0A 3WC0A 4NLQA 5KFSA 4NZ6A 3C6TA 3FEXB 3DOLA 4DZ6A 1UFLA 1EKRA 2CWKA 5HSPA 2QL5B 3CEDA 3UNYA 2JSXA 4U96A 1RWNB 3G6XA 3QIPB 1S49A 4J9LA 3SBMA 2QTWA 1XNRJ 3LP1A 1S9FA 4EI2A 3M8WA 2NYHA 4NZ7A 3T6BA 4DR7F 2XB2D 2QA1A 1SV5A 1NNDA 3Q22A 1S0MA 3MZIA 1ULRA 2FLLA 3A8KA 3GIRA 4RX6A 1I94F 1T0TV 3FMBA 5DG7A 3HSJA 2N3LA 3C14B 4B3MF 4CH0S 3CTRA 3LUYA 5GAHI 2W7PA 4HHHA 1ZM3A 1T94A 1ZETA 4DV7F 4J9SA 1FEEA 2HHHF 3DRPA 5GMDA 1FXRA 4FVCA 1EAYC 3T9ZA 5KFOA 1RU2A 3LOUA 3PRVA 3DLLQ 3W2WB 1XMOF 3N28A 3I31A 3ZZ0A 2CQ4A 1T9YA 5CD4A 3HO1A 2V4QA 4U67Q 1Q0NA 2MB0B 5D3GA 4OZ3A 5F8HA 2MPUA 2OEMA 3BH7B 3ZZRA 3M7VA 2IRYA 2RQMA 1YJRA 4LMZA 5EWGA 1TL7B 4HI2A 1F0XA 2LVWA 2CPFA 3TNVA 4OZ5A 4PYDA 1TR0A 1LWEB 4ZP9A 2D3ZA 3DI6A 2RVJA 3UW1A 3V4IA 3LO3A 4NI2A 1B99A 2LA4A 1NK9A 5L1LA 5H9FJ 4U95A 4M5JA 2DGXA 3CB4A 4QPXA 4ILRA 1DRZA 2UXCF 3MECA 4JI5F 1DY3A 4F2SA 1YZ7A 4OFZA 4GMKA 3H5XA 3S6EA 1UVLA 4B9UA 4ZVQB 1Q4RA 3G71S 1VBKA 2JEFA 3W61A 2IM1A 4QR0A 3BR9A 3FBEA 3M30B 2D3UA 2VB6A 1VQ5S 4YB1P 1Z2ZA 1SJ4P 1A6LA 3GONA 3HX9A 1UZHA 5K14A 4M5KA 1X8DA 4LF8F 1YQHA 1UW4A 1SKUB 2RE1A 3X1LB 3RRHA 4NA2A 2RQKA 2QX0A 3DLJA 4DL0C 4CDIA 5K8NA 2CIMA 2DNZA 3GYGA 3M8PB 2RSQA 1B0VA 4ZOSA 3OVAA 2EW9A 4PG8A 2BJDA 1W26A 2V4JB 2HBYB 1AUDA 3DGPB 1TU0B 5CYQA 2BM0A 4DBQA 1UEUA 2CG4A 2JDJA 3GIKA 2FTRA 3LPYA 1Q8LA 2GO8A 2B4VA 3HVWA 3D4JA 3MR3A 1R8AA 2M3DA 2MKCA 4ED4A 5KG7A 1HR0F 1P6TA 1RAIB 2GVDA 1NLTA 2C2NA 1RHKB 1VOMA 2ILYA 1NHKL 2AJ2A 1C1BA 2I0XA 3TP2A 2WBRA 3UN5A 4I2QB 3IRXB 1WUUA 3S8SA 3JSYA 2OUGA 3CULA 2DH9A 3KG0A 4ZHRA 2HRYA 4LR7A 3Q24A 1JXEA 3BGRB 2HS0A 2Z8QA 1N32J 1SI9A 3K89A 4PPZA 2CPXA 4O44B 4G1QA 4USTA 1WC4A 2H1YA 3EXCX 4QJVA 4RUBA 1U1PA 2LXFA 2GGPA 3BZQA 3RBZA 3L7UA 4Q7AA 3TAMB 1L3SA 4RW6B 3E01B 1R6YA 2B5JA 4GVLA 1E6VA 4CQ1A 3GSDA 1Q78A 3FZBA 1R6VA 2C3OA 3NMRA 1S1UB 3US5A 2R9LA 2DH8A 3I0RB 2W7OA 2PA3A 1ROFA 1C3GA 5I3PA 1S1VA 3LA0A 4OI2A 1WG4A 4O0IA 5ETKA 2Z2MA 2YPYA 2KT2A 2BUNA 3ITHB 3WDOA 2ALZA 5D77A 2YQ0A 3QZ8A 4ZPCA 3RR8A 4IH6A 3MEKA 5A8KB 2AYGA 2YXLA 2E44A 1NH7A 2F4VJ 3V81A 5HMWA 2F5GA 1SB6A 4F4AA 4QU7A 2HHTA 2MGZB 2XSJA 4DCPB 3G9CA 4U7UD 3BBCA 2W4CA 4BLGA 4DV2J 2YNHA 3IBFB 5KFIA 1UTAA 3L09A 2CQ2A 1VGYA 4MMOA 5BR8J 3CCJS 1OY9A 3MWBA 2I9SA 2AW0A 1BWVA 2GNKA 2F65A 2V8DA 4I7FB 3HF5A 2CVIA 1D8ZA 3W2VB 4A8SA 3D6TB 2ZBRA 3KUEA 3C15A 2AJQA 2HFNA 1KD1T 4MKYA 4ATNA 1U09A 1NK7A 2Q6CA 1U2FA 4MAKA 5B0FA 5G0RA 2MZQA 1T95A 3SFGA 2CJ9A 4OYMA 2Q6BA 1VQSA 2DXEA 3SV4A 1VLOA 2F7VA 2FJDB 3T3FA 3TOQA 2AJ0A 1RB0A 3RB4A 3BSOA 3NNAA 4ED1A 2DY1A 5LXRA 4LF4J 4Q0BB 2JC0A 4X4TA 6AT1B 3MM9A 3QO9A 4USIA 4ID5A 2JRSA 2IC3B 3VQTA 2RKIA 4TQRA 2RJZA 2OD6A 4DFKA 5E41A 1DHMA 2W2QP 3AB4B 4OI6A 2M2BA 1R8PA 3HZGA 2JX2A 2V8PA 2V9WA 1TMJA 3UO0A 4DV3F 4YY3F 1JLCB 4HR2A 4ZP6A 3FBBA 2KB2A 3VCDA 3K5LA 2NREA 3DXBA 3MEEB 3FSYA 2HKEA 1DQAA 1TFWA 5A0YA 2O3DA 2H9ZA 1B0PA 3FCVA 4N8NA 1XMBA 1RHJB 5IQ6A 1U25A 4ZLLA 2AEJA 2J0QD 1UA1A 1H2UX 2QGFB 2DK2A 1S6QB 4J80A 1JLEB 2E1PA 3PHEA 5AXLA 4DLEA 2M8DB 2AMCB 1U0SA 1H6KX 3RB3A 5DM7Q 3A8JA 2D74B 5EGYA 4K5SA 1BLUA 2HIQA 2G2OA 5K8OA 4USUA 4Q45A 4ED7A 3G2XA 1CC8A 1YX2A 4DL6A 2IVFB 3H20A 4ZKAA 4J9OA 1BXNA 2D9OA 4JI1J 2E1AA 2ZE2A 2NXCA 4WFYA 2QLJB 4K4XA 4QZVB 3TZWA 5KFEA 3HFVA 4LJMA 1N56A 3F56A 5KFTA 3T1HF 1C1CA 5KG0A 2EKYA 2AKWB 1I3OB 2Z30B 4OJ3A 2IMOA 3KJVA 3I4PA 3M6VA 4KGKA 5L39A 3MR2A 2CQHA 3FEZA 3KLEA 3SV3A 2Y9HA 2ZITA 5IZHA 2VG6A 3FBCA 1V3ZA 3TX0A 5LSOA 3P49B 5IT4A 3KK2A 4PG7A 1GQEA 5RUBA 5HROA 3MI7X 4YQWA 2BOAA 5KG2A 3GMGA 1VRUA 1CJVA 2E5LF 4DX5A 4Y2CA 4WTYA 1FRXA 3T5HA 2DHSA 3MMAA 1LWXA 2KI2A 1FD8A 2KXFA 2BACA 1GT8A 1NSAA 4MIBA 3V5RA 5J1EA 1Y4ZB 3V6KA 3BKFA 2ZFHA 5EN1A 5ETMA 2HGNA 1NK8A 3CJKA 3HT3A 2O01C 4M5MA 4MFBB 3KMQA 1PAUB 4DX6A 2XLJA 1O6XA 4I0WA 2DB1A 2DH7A 4DX7A 2EEYA 2CKWA 3T6JA 2QZ8A 4LSZB 1PBAA 3M8SA 1PC5A 1IKYB 3PJ9A 4IG3A 2DHHA 4H4MA 1Z1ZA 2ZZTA 4TU9A 4KPCA 1F60B 9ATCB 1Y10A 5LT5A 2QLWA 2PE8A 4HACA 2VODA 4MK8A 2KZZA 2UUAJ 3ZFVA 2NCKL 3MPUB 2G13A 1RTDB 4QYRA 2Y0SD 3ICLA 3K8WA 4AXIA 1WKLA 3Q0AA 2HK3A 2VBZA 2CZ4A 2H5EA 3NAHA 1IBKJ 1HBOB 3MCNA 2QSFA 2CQCA 2R7XA 2CYYA 3PTWA 4IO9Q 4R8UB 1FE0A 4IR9A 3RG6A 4HLBA 1SJQA 5KFNA 4ED0A 1CJKA 3VAGA 1C4CA 4QR2A 1JJHA 2HFUA 2VFVA 1OY6A 5T7LB 3EPIA 4JI7J 3KFWX 3IFEA 3GCXP 3MUVP 4LSLA 2QT7A 5KFWA 1R0AA 4NMLA 3KOAA 3TZYA 1QAJA 2IDLA 1RU1A 1Y9OA 1UWBA 4B9SA 3CW2C 4P72A 1VIOA 3O1LA 5CXTA 3GSIA 1ZM9A 1CJTA 2KFYA 5HATA 2W4DA 3N6NA 3OTOF 3QJJA 3BJYA 1S0NA 1RHUB 1HWIA 1HBNB 1HNWJ 2VQEJ 3D0HE 4UOFA 2KYXA 5KFRA 1A7GE 2AJ1A 3A3NB 4J5OA 2WSFC 3D9BA 3IR5B 4PWDB 3UR0A 4AFFA 4X4UA 1Q7LB 1IM4A 3M05A 3G82A 3O3LA 4F4YA 4N7TA 4F4XA 4DN9A 3IBCB 3VALA 2HVEA 4HT5A 4WE1A 2LCWA 2HQ3A 1FDNA 1MMNA 5CYMB 4NCGB 4MYTA 4ZVGA 3MCMA 2CQGA 3NEKA 3MD1A 1VC5A 1J5EJ 4IOAQ 3TJ9A 4FNHA 4QWEA 3FRYA 3CE8A 3P5BP 3WHIA 3F44A 2CPEA 4G65A 1Q5VA 1JXLA 4RU2A 3FBFA 2WAQD 2W2MP 4I56A 4KKOA 4B3RJ 3GPAA 4PQUB 3RW6A 2EC2A 1S1XA 4F4KA 2AJ4A 3BH6B 2X1BA 1U1MA 4NCBA 4RW7A 4NYOA 3IG1B 5E3RA 1FWPA 1KVJA 2ZH8A 2ZH9A 4JI4J 3NLCA 4P9SA 1QSLA 4KO0A 1WD6A 2VH7A 2XGPA 4ILLA 5DDQC 3HULA 1TL3B 3ZXWA 1DTTA 5KG5A 3K5PA 3HKWA 2J9DA 1QUPA 3DMJB 3CIZA 4ZLPA 5KFKA 4PQAA 4NLUA 5J2NB 4X4QA 4RW8B 3AGYA 1XNQF 2RF2B 1JLQB 4PXDA 2D3OR 4Z37A 2CPYA 5HQMA 3N5BA 3G8SA 2YX7A 2FJEB 4ZA1A 2P5VA 2NYIA 1S1WB 3M2RA 5I42A 2YQ1A 4OZ0A 1VR6A 2NXUA 2VFTA 4NXMJ 1R8CA 2I5JB 2SXLA 4DLGA 3LAKA 3SCKE 1TKXB 3M8RA 1PIEA 1U6FA 4DUYJ 3HZEA 1N6QB 3THTA 5IT9Y 1CQMA 1S5ZA 1YRUA 3H59A 3HHLD 5LOQA 1AT1B 2ACMA 2MXYA 3ZZPA 1RUSA 2N3OA 4DV1J 3FDSA 3NCRA 3VR1A 1XBWA 1ZM2A 1TELA 5KT6A 2VBXA 1IJFB 4H4OA 1U0HA 3GV7B 2RB7A 3EVOA 1ZAVA 1NPPA 4WBFA 3LP2A 3TJAA 2DNGA 3NY0A 2W2OP 5JMNA 3BGLA 5HO4A 5C5JA 3OXGA 4IRCA 5FIIA 1FDAA 4ZVOB 3EGNA 3ENWA 1FI4A 1RWOB 2QMWA 3BSAA 1NK6A 2HEKA 1VRTA 3VGVA 2FC8A 4IOCQ 1V5IB 3EPGA 2MTLA 4X65F 1M5PC 3R97A 3TW0A 4TYAA 5JUMA 4JP8A 4MIAA 1YI2S 5IM0B 1ZM4A 4OYZA 3CMES 1NDPA 1T9VA 3C6TB 4O3SA 5KFVA 4YUDA 3DOLB 2X3GA 5DZ6A 2C2DA 3M1VA 3RBDA 3C6UA 4DL3A 2JFKA 1TKDA 4LF7J 4X62J 3IGNA 5KT2A 2LP4A 4FYDA 1SC3B 1S0OA 2LEBA 3UD3P 2JC1A 3MOJB 4TKTA 3LP1B 1S59A 1X4EA 3SI8A 2WB1D 4JI2J 3IO1A 4CNYA 3QWUA 2Y8YA 3I55S 1XEZA 2DGSA 4ELTA 1SV5B 1KLMA 2J7KA 3R27A 3GFYA 5C42A 2B9WA 3MDFA 3U7JA 4FYWB 2FGCA 2ZH7A 2GMHA 4OV1A 3QZ7A 2U2FA 5CHCB 1T03A 3CF5Q 4ZVSB 1H74A 4C8MA 3DRPB 4G3IA 5F0UA 3PYGA 1MWQA 2H5JB 5E3CA 3EUNA 2ASYA 1IBMF 3Q8QB 4GRSA 4FN5A 4KGMA 3BQ2A 5HP1A 1OY8A 2ODXA 4P2SA 2HZVA 3OL8A 3MMCA 4BCAA 2DPIA 4X64J 1OIAA 1WTBA 4B02A 5D3GB 4ZP8A 3PCOB 2WW4A 1M5KC 3DDIA 3ZZZA 4N41A 2V6AA 3UCGA 3KK3A 2KG1A 4DPYA 3PV8A 1TK5A 2CUYA 4CO1A 4LSNA 2JVRA 2I38A 9RUBA 5ETRA 3H5YA 2DJWA 2X3DA 4BDPA 3DI6B 3V4IB 5L1JA 1XWLA 1YKWA 2X1FA 4JI8F 1OQ6A 4NI2B 3N79A 3PACA 3OV7A 4V1Ak 3CCTA 1XR5A 2UUCJ 4DFPA 2K1RA 2MLZA 2XHWA 3U02A 5DRKA 5AE1A 3MECB 3HKZD 4UTGA 3PKMA 4PXEA 2G0CA 2KDOA 3TARA 1FJCA 4JI6F 2RUSA 1WWHA 5KT7A 3GIMA 2E9RX 2DNQA 5A2QY 1Z4UA 4M8LA 3D5MA 2AQ4A 4MK9A 5KOWA 3QYYA 1N33J 1R8BA 4A46A 4DL7A 2B4PA 5K14B 1L3VA 4FS1A 3CUNA 4NWBA 4C0BA 2VONA 1X4BA 3W63A 3CCUS 3R6LB 4DXLA 5BYQA 1WEXA 2C2OB 1SQFA 4HEA9 2KM8B 7AT1B 2QL9B 2R3VA 4RUAA 2KH9A 1R7IA 3WQPA 4DR4J 3OLBA 4Q8EA 8AT1B 3PHTA 4F0KA 2RNEA 5CYQB 5KFBA 4BC7A 2ZUGA 3OTDA 1MN9A 4PCQA 4RLEA 1Q82T 4B3TJ 3UE2A 2KZMA 4DV4F 2UUBF 2GVDB 1T11A 1A0OB 3MGJA 3ILJA 4ZCMA 1LKZA 1RT2A 1C1BB 2KFZA 2VHGA 2HBRB 1VQ8S 4LIRA 3J80Y 4NL5A 4ZHRB 3AA8A 2FHJD 4F67A 2IVYA 2MKSA 2WTFA 4C4WA 3DCAA 1RWUA 1Q8KA 3J7A1 3FSXA 3KLHA 4G1QB 1NO8A 2J9DE 3H40A 1FTCA 5LSRA 3C5XC 2Z56B 1U26A 2GGPB 1MG7A 2PGCA 1EZZB 3KYLA 3AA9A 5J1NA 4FYYB 4N56A 2UV8A 1VJQA 1FF2A 4ZJOA 3HLUA 1C2PA 2DVIA 2HAIA 2GJFA 4CLTA 4P7TA 4CO5A 2B5JB 2NR0A 3ETOA 2CWXA 2WONB 1B7FA 1D8YA 1E6VB 2P2CB 2J0XA 3GFXA 1WI6A 2GAHC 2KKHA 2FZGB 1R89A 2YH0A 4WFZA 1AYEA 2WB4A 3IMQJ 4A8KA 3CCWA 4OI1A 4EYIB 2ZKTA 2B8QA 4YEAA 4NLXA 1X4AA 2XLKA 3NGSA 5CABA 1W2IA 4GKJJ 4DR2J 4ZS6A 1S1VB 4DCJB 3AGZA 2BM1A 3M2VA 4EEYA 2R8GA 4RZRA 4RNMA 2B6AA 2DRBA 3I4HX 3SSSA 4MYUA 4QWBA 1LWCA 2WZ1A 3PRDA 4IO1A 4CO4A 2BQUA 3IR7B 5C24A 3FVYA 1DAXA 1RWPB 2DRDA 2WVEA 3J81j 4ES3A 3V81B 5F8LA 2V8VA 2B56A 2XHCA 4ERDA 2R42A 1NCLA 4L74A 1P9YA 4N76A 2XSJB 3N9UC 5BYSA 7FD1A 2CFXA 1Q53A 4QWAA 5KTQA 5M2UA 2H54B 2YNHB 3LGMA 2GQCA 2ZVIA 3MTKA 1RKJA 3K17A 4PKDB 2VA3A 4DS4A 2KVIA 3KK1A 4KFBA 3HXMA 3BN7A 1X7VA 1ZA2B 4DUZJ 3WZ0A 2N4DA 4I2PA 1BUXA 3C15B 4CLWA 3EZOA 2QV6A 3EGVA 1LK7A 2L08A 3KUGA 5G0RB 2CA9A 2ZH1A 1NEEA 5D4NA 4NLVA 2ZVSA 4IR1A 2GVZA 4ICLA 1S12A 4K4SA 2HFVA 4DV6J 4KPYA 2C2MB 2QA4G 2Z0GA 2RQ4A 3C66A 3TUZC 1R0CB 3C6EC 4K4WA 3H2UB 3SZ2A 4YS2A 2RAQA 3L7OA 3H5SA 2YWFA 2V2VA 3ISZA 3MM9B 3QO9B 3KJQB 3HD2A 4B9LA 4ID5B 3AB2B 1BQMA 4PG6A 2CJAA 2RKIB 5E3PA 3J81U 1NB7A 1WC6A 4WXOA 4K5RA 4TLQA 4OV6A 4ZP7A 1LW2A 1JLBA 4NLRA 4KSEB 1N36F 1IXKA 4I1TA 4DG1A 3CCQS 4LF6J 2IYGA 4C8ZA 3KLGA 4Y2AA 1HFEL 1T9UA 3RGIA 5GADI 1HNZF 3IAS9 3MR7A 3Q83A 1D9FA 2ZJQQ 1U1QA 3RB6A 2MDAA 4DEZA 2JZ5A 2HIYA 1VBZA 4EGLA 1EETA 5A0YB 1JXVA 3AJ1A 3BPDA 4LF9J 1F1BB 4B9TA 1YRXA 5IWAF 3GJSB 2C3MA 2VA2A 3W62A 3SDEA 4JI0F 1AFJA 2QIFA 2QEXS 4DDFA 1KC8T 1S48A 2FUG9 1VHFA 2JZ8A 3G96A 2P6TA 3SIPB 3TI0A 4TYBA 1ELOA 3QGIA 1VC0A 2V2ZA 4JI3J 1OYEA 4KR0B 3AODA 1QDUB 3DNCA 2PIIA 1VQYA 3OFEA 2AGPA 2B7CB 4W92B 3ZTOA 1FKPA 4WKRA 3NL0A 2QL7B 3X3UA 4FPIA 4LFAF 3ET6A 2EBEA 1F2HA 2FLNA 2ZE2B 3RAXA 1URRA 2G1DA 4NPOA 3CJ3A 2CPIA 4ZPVR 1K9MT 4KTQA 1TUWA 1F3VA 2XBPA 3GWCA 1RT3A 1C1CB 4KAIA 3KG1A 1I51B 2U1AA 3MPWA 4CO3A 1E6YA 2XMTA 3KJVB 1KOOA 5ETQA 3CPWR 5JVGQ 1RKIA 1WSRA 1SIZA 2ADBA 3KLEB 2A10A 1TVRA 1RK8A 2IHR1 2DNHA 3D67A 2VG6B 3I38A 1RAJA 4A8MP 4K4UA 2BJEA 2ALYB 3AOCA 3SSRA 3KK2B 1T3NA 1KBRA 1PAEX 5HROB 3VAMA 3AD9C 4UY8T 2OFHX 4FDFA 4USWA 5MAOA 4B3SJ 2MQOA 4MJKA 1VRUB 2F4VF 3I5BA 2MKHA 2RH3A 2ACYA 1CJVB 4Q5VA 1FRJA 3FCHA 3GIIA 2BVZA 1FRIA 1BQNA 1N52B 2LLZA 5H9FK 5B0CA 3MMAB 5ETOA 4DV5J 2LDIA 1S0VA 5DG9A 1RTJA 3K8VA 3LGNA 4O3OA 4YHHJ 1V9OA 1KTQA 2E66A 1FKAF 5G4DA 3A3OB 5J1EB 1KWMA 1G1XA 4DU7A 2NS1B 4WK1A 1SH2A 3CJKB 2WVCA 2HGMA 1KQGB 3VGUA 1U48A 1AUSL 2ZH5A 2CPZA 1RWWB 4NXNJ 2FPHX 5L46A 4I6WA 4NOHA 2AX1A 1AB8A 3AJ2A 3LGHA 2C3UA 4IG3B 4H4MB 4PXCA 3Q8PB 2LQBA 3QGHA 1NJWA 3JYTA 4HACB 4KT0C 1OWXA 3CC4S 1DTQA 1RWVB 3DN9A 2CJKA 3PEHA 3MXHP 2AP6A 2L9WA 4I4BA 4K2XA 1LFWA 1SC1B 2BABA 1NU4A 4LF2A 1VISA 3BBBA 2G0IA 2FY1A 2FZKB 1N5TA 4OZ1A 2Y1LB 2CNKB 4ANDA 4ED5A 1N34F 3TR5A 2ZKUA 3BO4A 1OJ4A 2P8IA 4JOUA 3VAFA 2KHDA 4ZVTB 3R7NB 1W25A 1MN7A 2IA0A 3MAAA 3LWLA 3MM7A 4EO6A 3PDNA 3PY8A 2E7VA 1LV5A 3DDKA 3E2EA 2HGLA 3RYLA 4LSLB 4PYAA 1S99A 2UXBJ 1R0AB 2JEGA 2DGQA 3S01A 3AD8C 4O3PA 2HW3A 3DM2A 3ULHA 1CULA 2BYCA 3HDSA 3SFUA 4QPTA 4MKBA 1U45A 1UWBB 4CRJA 3DRRA 1T3OA 2IPOB 3MM6A 1TK8A 2NUHA 1VQNS 3HHEA 3ONQA 1CJTB 4DQPA 4RBUA 4DR7J 2F9DA 4I64A 1WTFA 1PJ7A 3JSRA 4CLSA 4C8LA 3DFEA 3WIUA 3DGVA 2OMOA 2E7WA 1RYRA 2XULA 4TU8A 1PSDA 2XM3A 3OFFA 1U1LA 2D3O1 3TX8A 4DV7J 2R8IA 2HNDA 2ZNZA 3G82B 1LWFA 4GO7X 2Q3PA 1NSQA 2OIHA 2PO4A 3DLEA 4EMDA 3BQ1A 1UCNA 4WE1B 1HPZA 4WIQA 4WFXA 3PX4A 4H54A 4OZJA 1XMOJ 2PEBA 2RHSB 2C3YA 1UFKA 2WK4A 3P96A 1LW0A 2PMWA 2W01A 4LQ9A 4JI1F 2UUTA 2ZH6A 2AWZA 5B09A 4HVZA 1B70B 1GH8A 5KOXA 3J7Z5 3R5AA 5CCMA 1UEVA 2Q66A 4XTTA 4NLTA 4J9VA 3BQ0A 3TRGA 5LJ5Y 1B0TA 5E0OA 4DCOB 2LQ8A 4KKOB 2MKKA 1NKBA 2K06A 2C42A 4H4KA 3T1YJ 5GAGU 4NLOA 3PR4A 5EWFA 1D09B 1SJ1A 3KUHA 4EYHB 4DF8A 4RW7B 3R2CJ 1MU2A 1U49A 1X5TA 2J7WA 1VQMS 4KO0B 2ASJA 2UXCJ 1HKAA 3W64A 4JI5J 1X9MA 5FDLA 4YOEA 2PSZA 1DTTB 3CCMS 1UVJA 1WC5A 1J27A 1MROA 1ITPA 3JXOA 4C6AA 3H8YA 3KWMA 2G9OA 1HBMA 4U9RA 1XAOA 3NKYA 4RBTA 1G4CA 2IJFA 4EBCA 2B0GA 4LF8J 1P1TA 4WYLA 2BBEA 1H2TZ 2H4YB 4DMZA 1YWXA 2PMHA 3M2RB 3MCSA 5I42B 3J80U 4WK3A 4JYAJ 4ER8A 3BGUA 1RHRB 4C8OA 3SYZA 3MR6A 2VL1A 4HKQA 1N4LA 3UD5A 3K58A 1KTVA 2PD1A 1CBKA 1Q79A 4M5DA 1RT7A 1GX6A 4MT1A 2HNZA 2J7UA 1C0TA 2GIQA 2YNIA 2UV8G 3HPOA 2MZTA 1ZZFA 3Q2SC 1FFSB 2XMUA 4Q2MA 3AY0A 3S7RA 3POTA 3J7ZT 4H4OB 1RCOB 1U0HB 1HR0J 1OYDA 4LRAA 3EGWB 1FNMA 2GQ2A 3O2IA 1RISA 3LP2B 2HQIA 2F63A 4KB7A 3W60A 1FJGJ 4AE5A 1HL6A 4P10A 1HI0P 3QRPA 4FS2A 1LK5A 4R0JA 5C2GA 1NJZA 2FZCB 3JAMU 2KL8A 4FBTA 4WIIA 4OX8A 4URSA 3EVMA 2FGOA 3OXLA 4OIXA 4JI7F 3D6HB 1RHQB 1VRTB 4UOCA 4DPXA 1D3WA 1HNIA 1TUVA 1U1RA 2OPSA 4C2MA 4PABA 2KTQA 3A12A 1VK3A 1PC4A 4RKUC 5H9EK 3OQ2A 4NYZA 2MQPA 2R7VA 3AT1B 4LRDA 1OSCA 2W2NP 2V8GA 3R9LA 4J9KA 5DDPC 4OQJA 3M1VB 1HQUA 4RUCA 3GP9A 4OMFG 3C6UB 3TUPA 4P74A 3OFHA 4RWXA 3NGKA 3NS6A 4DI6A 2L41A 1HNWF 3IM9A 2VQEF 1J2VA 3DLBA 1PJ5A 1LNQA 4ZN1A 2HRUA 2NXJA 3QJPA 4KHMA 4L75A 4P7VA 1UJ4A 3FZ2A 4TY9A 1KLMB 1TQLA 5C42B 4WP3A 2CQ0A 3VQSA 4HH0A 4QOTA 4DSIA 3O8WA 4UZBA 3HMJG 5C2CA 4FYVB 5HN0A 3BPSP 1U1KA 1T03B 3OVBA 2HMIA 2YNFA 2RU9A 4RNFA 5IXUA 2XLIA 3OR2A 3UVJA 2MYFA 3KLIA 4KIAA 1OSDA 1M5OC 3BO3A 4BHQA 3OVSA 2QLBB 5KFFA 2R7UA 2E1MC 4J9NA 3U27A 1FJ7A 5HP1B 2Y8WA 4E8UA 4CO2A 3PW4A 4MTPA 1HD1A 4ZITA 1VQ7S 4Q8FA 3QT7A 4B3RF 1EHWA 2KYZA 2DBBA 2GCFA 2BX6A 4DQSA 1ZBTA 1SJFA 3HHKA 2JWNA 3QGGA 1OMSA 3KK3B 3CD5A 5LSLA 4NRTA 2DISA 4JI4F 4PXBA 4LSNB 3T5LA 4J90A 1VQPS 3R6GB 4RNOA 2NXNA 4DUTA 2ZH4A 3KNGA 4KC5A 1U1OA 5KFUA 2J6TA 2LQJA 1KLNA 1NZ8A 1TZ0A 2K1RB 2EVZA 4DN0A 1B4SA 4F02A 1XN9A 1CG2A 1FESA 3Q8UA 4OHXA 1Q16B 2K7JA 3KJFB 5L1IA 4Q2LA 3UWTA 3OTEA 2H65B 1RAAB 1MSWD 2IM2A 1HI8A 2VPYB 2Y1IA 3QT5A 1WF0A 3LP0A 1TMMA 2RRAA 1DFDA 5F0WA 1JWWA 3QRRA 2YKNA 1V5VA 4Q44A 3OTBA 2HQDA 1KEKA 3QSIA 4DHVA 3BSCA 5L8RC 3SQGA 4KHPJ 4DV3J 4YY3J 2ZWOA 1SJ3P 2E5HA 3I0SA 3EGZA 5D6GA 4N77A 1NJXA 1SXLA 2CQ3A 3BKUA 3HHDA 2LU1A 1S9EA 3RRKA 1BWEA 1RAFB 4F3OA 5HVHA 3DXSX 3DOKA 2ROGA 4KGVB 2HWIA 3DLHA 4DFJA 1ZH5A 1HQ2A 1PCAA 4LF5F 1SC6A 1JIHA 2QA2A 5D0GA 2CJXB 3UN3A 2QMUB 5ETSA 4X4NA 5GADU 2JVOA 1SIWB 1WHWA 2LXIA 1HNVA 3VAIA 4C97A 1ZAXA 5A6PA 4ZDNA 1TTHB 4M5NA 2XZWA 1RT2B 3M8YA 1RT6A 4C98A 3TVYA 2BQRA 3MURP 3I87A 3HHLC 4DPWA 1U02A 2FJAB 4XPCA 2EFQA 3KLHB 4ZCLA 2NLWA 4E0DA 1I5OB 2IBKA 3UDEA 2CXEA 4K50A 2L9DA 5KFHA 4LF7F 3GB0A 2ZH3A 3U1NA 2H3EB 2UUWA 3PX6A 4EU0A 2MQMA 1FKOA 2ZJPQ 1I6JA 3EJMA 3RAMA 5EUHA 5HJXA 4OI3A 4DFMA 1SC4B 3EDQB 3KHHA 1N88A 4JI2F 1MMLA 2VKRA 3I82A 1J5OA 2C2RA 2R2UA 2XYPB 2L48A 4AL7A 4JV5F 2YWEA 4LUBA 7FDRA 1O5JA 3UN2A 3MTJA 1NUEA 1VRQC 3FFIA 2ZEJA 2AEFA 3D2WA 5C25A 2M0GB 3CCVS 3HSGA 1FDBA 3HJVA 4OI4A 2XS2A 2J0SD 4TXSA 1UVKA 3GCWP 2COLA 3M2VB 4R5PA 2H5IB 3R7BB 2E5LJ 1C0UA 2B6AB 4ENOA 1LWCB 3M6WA 5B0BA 5C24B 2JH3A 2VDIA 2BEFA 1ZPVA 1S6PA 2R2SA 2VC1A 1T9WA 4QIGA 4QW8A 2XY5A 5T41A 3FC9A 2GJIA 1BGXT 4DS5A 4X66J 3W8GA 3A1YG 4USMA 2MSSA 1S79A 3DU5A 2C3PA 4KGZB 1DBDA 2VBWA 5DQHA 3KK1B 4KFBB 3GFHA 4CLKA 2MZJA 4XIUA 1X60A 5I4MA 3A8IA 1H73A 3OUYA 5EHHA 4I2PB 3D66A 3W9IA 2JLGA 5ETNA 4OJGA 4AQYJ 4PWUA 2Z4PA 2UUCF 2YNGA 4C7QA 5AXKA 4QWDA 3PEJA 3VVTA 4OX7A 5ITHA 5HJYA 2GVZB 4ICLB 4A47A 1UP1A 5KFLA 2Q43A 5KFZA 3P45B 3MD3A 3DKDA 3HT0A 1EKSA 2MZ1A 4USKA 3CDWA 4UZCA 2J76E 3VTIA 2OMLA 2HHPA 4ZLNA 5D0HA 2XO7A 4ZPDA 1BQMB 2AX0A 4ECQA 3BYRA 2MQNA 1NM2A 2VPXB 1GMWA 3FRZA 3RTVA 1UVMA 5M2RA 2CPHA 1UA0A 2DTJA 2ZC3A 1CC7A 4DSKA 1LW2B 1JLBB 2ATCB 4URQU 2M8HA 1W2BR 4DG1B 2UU9F 2BV3A 1NK5A 1G2EA 2G1HA 5A76A 2OTLS 3GR0A 3KLGB 1RTHA 5AJ3F 1FK9A 1B7YB 3OTOJ 4LFCF 4Y3CA 4XK8C 5LMUF 2FVSA 4TN2A 2HVHA 2GS8A 4B3TF 1EETB 4ZPBA 4C48A 2AJFE 3UPFA 1FO1A 2BJ1A 1RWKB 3R5BA 2BJ8A 2YWKA 4CI0B 1FWLA 4OHVA 2Z2ZA 5D4PA 3SDEB 1HWLA 3H2VE 4ECWA 2GMJA 2YTCA 1PBUA 3FNNA 2OEJA 1XIQA 4OJ1A 3EZ5A 2HNYA 2BOPA 2K8GA 4ZPAA 4WFAQ 1Y00A 2I1RA 2GFFA 2B4OA 1VK8A 1G6BA 3Q8SB 4IYQA 2JJ4D 1Q8IA 2VV5A 1N0VC 4YMEA 4WU3A 4NCAA 1U24A 2R7OA 2L9NA 2AIRB 1SQGA 4PUOA 1FKPB 3BBFA 3FQKA 5DG8A 3GIJA 2YKAA 2Z2YB 4DR3F 3PRBA 3AXKA 2HVZA 1KDNA 3ET6B 1N48A 3W9HA 3C46A 2B51A 4RW9A 3BGFA 2YKQA 1LXNA 4WJBA 2HQCA
chains in the Genus database with same CATH topology
3AGYA 3LA0A 3L9ZA 3I38A 3AGZA 2Q2GA 4L3KA 4J80A 2HFVA 3TJ9A 3AGXA 1GMWD 2QLDA 3NXZA 1EB0A 1EARA 1GMVA 1NLTA 2B26A 1GMUA 3TJAA 3LZ8A 1GMWA 1XAOA 1C3GA 3TJ8A 3NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGY A;  3LA0 A;  3L9Z A;  3I38 A;  3AGZ A;  2Q2G A;  4L3K A;  4J80 A;  2HFV A;  3TJ9 A;  3AGX A;  1GMW D;  2QLD A;  3NXZ A;  1EB0 A;  1EAR A;  1GMV A;  1NLT A;  2B26 A;  1GMU A;  3TJA A;  3LZ8 A;  1GMW A;  1XAO A;  1C3G A;  3TJ8 A;  3NY0 A; 
#chains in the Genus database with same CATH topology
 1RT3 B;  2KRB A;  4JBC A;  5F9L A;  1U8S A;  2MY8 A;  1KSP A;  2HBZ B;  2ZNY A;  1E6Y B;  2A1B A;  4DQI A;  4M94 A;  3Q89 A;  3BDE A;  2OAU A;  2QA4 S;  1T05 A;  4WU2 A;  1VQ9 S;  2N4C A;  1TVR B;  4Y0F A;  4CZC A;  3JTP A;  2PT0 A;  5LXY A;  2RD5 C;  1T8E A;  3FQL A;  4DQQ A;  3CJS A;  3H98 A;  1FA0 A;  3QWP A;  2GA7 A;  3CDE A;  4RPF A;  1OPZ A;  3QLH A;  2W9C A;  1BQN B;  3H7H B;  4DQR A;  2UP1 A;  4DR5 F;  2CJB A;  4V19 X;  2UXD J;  1RTJ B;  5HLF A;  2BMB A;  1JK9 B;  3Q8Y A;  5MLC V;  3CCE S;  3G6V A;  2M88 A;  1TV6 A;  2ZDP A;  1JLG A;  2MJU A;  4DUZ F;  2AYM A;  4LFB F;  4QR1 A;  2E29 A;  5H9E J;  3L7P A;  1YBT A;  2DIT A;  3CJ8 A;  1QLN A;  3FMW A;  1GMU A;  4V19 J;  4ED2 A;  5F9N A;  4TVA B;  3GV5 B;  2AYE A;  2JEI A;  4USV A;  3KLF A;  3RB0 A;  1XMQ F;  2APO A;  1FX4 A;  2EBG A;  1ZTW A;  3D54 A;  4DSE A;  3PYD A;  1S4F A;  3JYT B;  2GHV C;  3G87 A;  2RRB A;  1DTQ B;  4UUX A;  5KFP A;  4LR9 A;  4IG0 A;  2R7R A;  3Q2T C;  1XTZ A;  3OBI A;  1U8W A;  1YRT A;  2A18 A;  2F8E X;  3T19 A;  3IA0 A;  1CQN A;  4WYW A;  3K5N A;  4DPU A;  2HK2 A;  4IQX A;  5F41 A;  2QRR A;  3O44 A;  3NCP A;  2A2C A;  4A8W A;  5HK4 A;  2MQ8 A;  3DU6 A;  1Y3K A;  1N5V A;  1L5U A;  4X65 J;  2FY8 A;  2XCP A;  2M52 A;  1QAX A;  5HVF A;  2MST A;  3M8Q A;  3MAA B;  1LEO A;  4F50 A;  1HAR A;  2KRR A;  2JFD A;  3MM7 B;  2DGU A;  2ZC4 A;  1NBE B;  2HHU A;  2XI3 A;  1V3S A;  3PW0 A;  2W9B A;  1KP6 A;  3OPK A;  3BO2 A;  2WVB A;  1RT1 A;  3R7S B;  1X5O A;  5BXI A;  1S77 D;  4QQB A;  3DM2 B;  5K20 B;  1CUL B;  2FHM A;  4A8X A;  2ZHA A;  3T1A A;  3RBE A;  4GC7 A;  3DRR B;  4J9M A;  3HVT A;  3MM6 B;  5KT4 A;  4L3N A;  2A0F B;  2V4R A;  3TZX A;  1PYS B;  4F04 B;  2R7Q A;  4QYZ J;  1FTR A;  4S0M A;  2P6S A;  3IN5 A;  2FLP A;  5JXS A;  2XY6 A;  5KFY A;  2XMW A;  2HND B;  2IMW P;  4JI3 F;  1LWF B;  4RWW A;  4B17 A;  4JV0 A;  1HNX F;  3DLE B;  5U47 A;  4F4W A;  3M9M B;  2LXU A;  1HPZ B;  3F0N A;  2OPR A;  3CCR S;  3EX7 B;  2Y1J A;  2IJR A;  2JRR A;  3CXC R;  5A8R A;  1UMJ A;  1URN A;  2HS4 A;  1REG X;  3CDU A;  2FVP A;  1LW0 B;  4QW9 A;  2CPD A;  4P75 A;  3WIV A;  4CYU A;  3PVX A;  4OLO A;  5E5N A;  4RBV A;  2QLF B;  2YVS A;  1F3F A;  2NQP A;  4PZV A;  1WF1 A;  2F4F A;  3EE3 A;  5F8N A;  2RUG A;  1GNK A;  2R8K A;  3ZNU A;  2VZ9 A;  3AGX A;  4GKK J;  4NLS A;  3GJQ B;  1HD0 A;  2AHO B;  4DR6 F;  1SBR A;  1GX5 A;  5HAO A;  3AAW B;  1LQ9 A;  1RAO A;  4YN3 B;  3LQV A;  1PJ6 A;  4JI8 J;  1O0P A;  4KH0 B;  1MU2 B;  2C2Z B;  2HFZ A;  2LU2 A;  2ZOF A;  2LEP A;  2CJQ A;  3KDO A;  1RTI A;  2XMJ A;  4FYX B;  1HBU A;  2XCA A;  4C8K A;  2XMK A;  5FDL B;  1NPR A;  2GW8 A;  4EBE A;  2LDY A;  1NK4 A;  2PFF B;  1S57 A;  4B3S F;  4JI6 J;  4NLY A;  4FF1 A;  2JL9 A;  1Q5Y A;  5LMN J;  2LMI A;  1MRO B;  5D8H B;  4HHU A;  1NPK A;  1HBM B;  3AXM A;  1D1U A;  4B9M A;  1CJU A;  1WC0 A;  4KRW A;  2F1F A;  1SL1 A;  2H4W B;  1ARO P;  2MQQ A;  2OLW A;  3N6M A;  3D1O A;  2DYA A;  1UW9 A;  5A8W A;  1G3O A;  3IS9 A;  2ZH2 A;  2ROE A;  2ZOG A;  1WHY A;  2KJW A;  2W2P P;  4MK7 A;  3PW7 A;  1IR2 A;  3N0V A;  3TO8 A;  4W4M A;  4KYZ A;  3R5G A;  4J9P A;  2DNR A;  3W65 A;  3MR5 A;  4YR0 A;  3D28 A;  3R1L A;  1EQ0 A;  2HVD A;  5ETT A;  1UFW A;  2HS3 A;  5EWE A;  2CAD A;  1VQ6 S;  4IFV A;  2ZJR Q;  4M5D B;  1RT7 B;  3IWX A;  4ZVR B;  4M5L A;  2HNZ B;  1C0T B;  2YNI B;  4N5S A;  3VAJ A;  2Q79 A;  3LZ8 A;  3C2P A;  3JQK A;  2QYG A;  5DDO C;  3POT B;  2DEI A;  2IYI A;  2OPP A;  4DV4 J;  1WF2 A;  1AFI A;  4N47 A;  1FEH A;  2RIJ A;  2VFS A;  4L6V 3;  1QAI A;  2UUB J;  1GK8 A;  2R7S A;  4ECT A;  5HMY A;  1YJV A;  1WAC A;  3RR7 A;  2VPW B;  3DYA A;  1K0T A;  1YZ6 A;  2X1G A;  1NJI T;  4AD6 A;  5EDW A;  2L3M A;  2E5G A;  1TKT A;  2G2Y A;  2V5H G;  1X9W A;  1TAU A;  4A4J A;  5IFM A;  2WCX A;  1HNI B;  1N54 B;  3TVZ A;  1PYT A;  5K5M A;  1R31 A;  4WKY A;  1Q86 T;  5J2Q A;  2Z58 B;  2OPS B;  3ZO7 A;  3NXZ A;  3R5C A;  2UXB F;  4D3H A;  1VC6 A;  1P1L A;  2VQF J;  2DCU B;  1VBY A;  4KBI A;  1IKX A;  1ZOT A;  1N5Y A;  3GIL A;  1Q81 T;  2N7C A;  2G4B A;  4YP3 A;  2DNO A;  1HQU B;  2HG4 A;  1HHT P;  2OI2 A;  2R8H A;  3MEG A;  3NNC A;  1NSK L;  4FPR A;  1KR4 A;  4Z2X A;  2AU0 A;  4NA1 A;  4GVB A;  2FVR A;  3KHR A;  3ZTP A;  2NUU G;  4F7V A;  2WHO A;  2W1B A;  4Y28 C;  2KHC A;  1CVJ A;  2RT3 A;  2UVW A;  2C22 A;  1TP7 A;  4QBU A;  1FNX H;  4MIW A;  5EX3 A;  3G6E S;  4B9N A;  5A6W A;  2XNQ A;  2EFN A;  2PA8 D;  3WX4 A;  3TA1 A;  4H4K C;  2RU3 A;  4U7U K;  2HMI B;  1T9T A;  1JNZ B;  4C3L A;  2YNF B;  4Y65 A;  2MHE A;  3FEY B;  3OR2 B;  3J7Y I;  5E3A A;  4U8V A;  3UVJ B;  2Z2L A;  3KLI B;  1HHQ A;  2IAJ A;  1SQE A;  1PG5 B;  1WG1 A;  2ZHO A;  4AUK A;  4NRU A;  1IBL F;  2BA9 A;  4L76 A;  4DF4 A;  1X31 C;  5DET A;  3V2U C;  4K2J A;  3FCW A;  5JVH Q;  2AZ1 A;  3TAP A;  5CZX A;  5ETL A;  3L4B C;  3T1Y F;  3O6Q A;  1PO6 A;  4TLR A;  2E7X A;  2KT3 A;  4RU9 A;  1RLD A;  2FJV A;  2KN4 A;  3W7B A;  4KQZ A;  4MKA A;  2LQ9 A;  2V50 A;  4P2M A;  4J91 A;  2I2Y A;  1NRK A;  4ES1 A;  3BN4 A;  3I5A A;  2DNP A;  2HVI A;  2YKP A;  4CWB A;  1RWM B;  1KVK A;  4LR8 A;  1N8R T;  1UJ6 A;  4X4O A;  5DM6 Q;  4EZ9 A;  4IRD A;  1NHV A;  3TQ1 A;  3ETM A;  2EKN A;  1VQL S;  2XS7 A;  4KE5 A;  3DRS A;  5J2P A;  1FER A;  1YBU A;  1DQ8 A;  1S1T A;  3NNH A;  3NWR A;  5FLX Y;  1K8A T;  4IRK A;  2BE2 A;  3CWJ A;  2XGQ A;  2FC9 A;  3LP0 B;  1DLO A;  1QY7 A;  1N36 J;  1YJW S;  3C3L A;  4JYA F;  1VFJ A;  2YKN B;  3QMQ A;  1AW0 A;  1RSC A;  3ZTQ A;  2JLE A;  3SQG B;  1WSV A;  2W4P A;  2CQI A;  3I0S B;  1HNZ J;  3NGR A;  3QT8 A;  4DJB A;  1IQT A;  1JX4 A;  2YY3 A;  2AZ3 A;  3IP0 A;  1S9E B;  2P9E A;  4B08 A;  1N5S A;  1UAW A;  2HZA A;  5GME A;  3DOK B;  2PI5 A;  2XMA A;  1Y5N B;  5AE2 A;  1PKU A;  3CSK A;  1YJ9 S;  2DGW A;  1NLK L;  3UDV A;  5IWA J;  1IQZ A;  4OZN A;  5KT5 A;  3PO4 A;  4JI0 J;  2BDP A;  3RRG A;  1FJG F;  1WNE A;  5GAG I;  2W25 A;  2V63 A;  1IJE B;  3FSI A;  2E5I A;  4NAS A;  1VDH A;  1HNV B;  3B8H A;  2R2T A;  4QWC A;  2O66 A;  4EFA C;  2O1P A;  5IOL A;  2OTJ S;  2QLX A;  4OI0 A;  1SL2 A;  1JLF A;  3LH2 S;  1RT6 B;  2LQ5 A;  5HMX A;  2NXE A;  1VMB A;  2AGQ A;  2OJ3 A;  1FJE B;  4MKV A;  1IR0 A;  3EXY A;  3NS7 B;  4LFA J;  3V4M A;  2BAN A;  1JLA A;  3TUI C;  2CQ1 A;  5GVQ A;  4UQT A;  1XJW B;  4LBH A;  2DNN A;  2WON A;  4OX9 F;  3PW5 A;  4F36 A;  2XG8 A;  2XC9 A;  3TEH B;  1FKO B;  5ADZ A;  2EC0 A;  5CA5 A;  4CM0 A;  4RNH A;  3T41 A;  4JUZ A;  3EDR B;  3JSM A;  3QQC D;  2CRL A;  3IAM 9;  5LL6 d;  4CO0 A;  4RW4 A;  3NAI A;  4UW2 A;  1J5O B;  1GAO A;  5DJB A;  3D3B J;  5IC4 B;  1EP4 A;  4G1I A;  2OEK A;  3K5O A;  3DLG A;  4AYB D;  2CPJ A;  2DT9 A;  2M9K A;  4F3Q A;  3EMT A;  4FBU A;  4DV0 J;  1ACM B;  3FFI B;  5JJB A;  3HVR A;  1W7W A;  3C16 A;  2C28 A;  5C25 B;  4Y00 A;  5SUH A;  3HHN B;  2GQQ A;  1KFD A;  4O3R A;  3CJR A;  3UR3 C;  3CJ4 A;  4CLL A;  4R5P B;  2KU7 A;  2QLD A;  3KXD A;  1M5S A;  1C0U B;  2XY7 A;  2DXF A;  1RZM A;  2V69 A;  3LWM A;  4ECX A;  5D4L A;  4K0K J;  3PIP Q;  3E8O A;  2E5J A;  2CQP A;  1K44 A;  1S6P B;  1SH3 A;  2F8M A;  2HYI B;  4OYX A;  4LBP A;  4W98 A;  3GR1 A;  2FLO A;  4ZCK A;  3M32 A;  1RA7 A;  1YVF A;  2BRK A;  2DNK A;  2UVV A;  2DO0 A;  2JLF A;  4CT8 A;  2MKI A;  2EXU A;  5F8G A;  2GZO A;  2PN6 A;  3NBP A;  3MF5 A;  3OHB A;  1X0F A;  1ZTT A;  2DKO B;  2XQC A;  3OUY B;  3VHQ A;  2DD8 S;  5KAK A;  1S76 D;  3WX8 A;  5DDR C;  1CPZ A;  4DR1 F;  3RU0 A;  2VPZ B;  1EAR A;  4WCE Q;  1T9X A;  2FB0 A;  2YNG B;  3OTC A;  4OYB A;  2B3T B;  3ENA A;  2IIH A;  4L73 A;  3A13 A;  1FRK A;  1UL3 A;  3QFW A;  1EB0 A;  5F8J A;  1RTZ A;  2RS2 A;  4YR2 A;  2ZBC A;  1YIT S;  5KG3 A;  5HL7 Q;  4G1P A;  1N34 J;  1HWK A;  1H7X A;  1XNR F;  4FF4 A;  4LQ3 A;  3M2U A;  4ZIW A;  3PO5 A;  2DGO A;  2K2P A;  2MEW A;  1NKC A;  3QBC A;  4TU7 A;  4K59 A;  3OR1 A;  4NEZ A;  4CLF A;  2JNJ A;  4ED6 A;  2OO4 A;  3Q86 A;  4AL6 A;  1TKZ A;  4KHP F;  1X4H A;  1EX8 A;  1HLW A;  4Y2I A;  3K0J A;  1CSJ A;  1M0S A;  4ZVH A;  4CP5 A;  2XYG B;  4BC9 A;  2VKZ G;  5AT1 B;  4BWM A;  4ETX A;  3DRY A;  4EUV A;  1KOH A;  4LVO P;  4LBI A;  1BC6 A;  2DHA A;  3B54 A;  4XO0 A;  1RTH B;  2HFS A;  1FK9 B;  1RT4 A;  3JTN A;  1FD2 A;  3JS9 A;  1NDL A;  4GC6 A;  1FWK A;  2HWT A;  1WDT A;  2X51 A;  2ZHB A;  1APS A;  2PFD A;  3O5T B;  3ILO A;  2V94 A;  5HMZ A;  1NKE A;  4CLU A;  3THV A;  4DX8 H;  3PYE A;  3JB9 k;  4YB5 A;  1K1Q A;  1KQS R;  2YX4 A;  1A9N B;  3AFG A;  4CH7 A;  4DOZ A;  4TQS A;  2HNY B;  4NYP A;  1S10 A;  1CS4 A;  3QJL A;  3D0I E;  1HMV A;  3OL7 A;  2W7A A;  4CNZ A;  2R4F A;  1QSY A;  1S6U A;  4DL5 A;  2CQB A;  5IQQ A;  4K7Q A;  4ECV A;  3I96 A;  1WG5 A;  4PUO B;  5F3Z A;  5ETP A;  5HBM A;  3VF0 B;  2E9Z A;  4CLY A;  2KM8 C;  3IGV A;  2ZZN A;  4DPT A;  2HPU A;  3I32 A;  3NGD A;  5LM7 E;  5I3U A;  2RRN A;  1YJU A;  4RW9 B;  2UVR A;  3VZI A;  1NB2 A;  3R1H A;  1RDR A;  5LJ3 Y;  2JOQ A;  5L9X A;  3PJW A;  3RZA A;  3UDL A;  1X4D A;  4KV8 A;  1REV A;  2W8L A;  3JQM A;  4QIF A;  1T05 B;  2FHK A;  3M6U A;  4B3O A;  3ISN C;  2XEX A;  1M5V C;  1NAQ A;  1RAB B;  1QJH A;  3PFE A;  2KO1 A;  2WSE C;  3M9O B;  2RQC A;  2J8S A;  1WOO A;  4HDH A;  4NLW A;  2KFN A;  3BRE A;  5E7O B;  2IVM A;  3SXL A;  3QLH B;  2W9C B;  1SKR A;  3HVA A;  3SSQ A;  2V0N A;  2DR6 A;  1BMQ B;  4O4R A;  3FK4 A;  4X66 F;  3T9N A;  5HLF B;  1RBL A;  4ED8 A;  2F8H A;  2XWY A;  2BJ3 A;  4EK2 A;  5B0G A;  1S7I A;  3JQJ A;  2J9E A;  4O3N A;  1S4E A;  1TV6 B;  4WXW A;  2Y3Y A;  1JLG B;  4QIW D;  2M7S A;  2ZDO A;  2B43 A;  2YWG A;  2FIU A;  1QTM A;  3A4T A;  3BV8 A;  3MM5 A;  2V8H A;  1YG0 A;  1N32 F;  4AQY F;  1RCX B;  3HFK A;  4C9D A;  3N01 A;  3L3C A;  2HHX A;  2RHQ B;  2CG8 A;  2XMV A;  1U1N A;  3SEO A;  3KLF B;  2HQF A;  4HH1 A;  3CCS S;  3V6D A;  2VG5 A;  4HYK A;  3ENQ A;  2B9Y A;  5F8M A;  3R8Y A;  3DOM A;  4IG0 B;  3ADA C;  2K3K A;  2EI5 A;  2E1R A;  1KHW A;  5DLF A;  2YPZ A;  2LEC A;  4WPA A;  4ZPT R;  1OO0 B;  1OQ3 A;  1OPI A;  1YHQ S;  5D0E A;  4AT1 B;  2CNO B;  3IWN C;  2QN6 B;  2MLY A;  4FXD A;  3W66 A;  4CH1 A;  1FCA A;  5KG4 A;  4F4Z A;  1MMD A;  2I8E A;  5J2M A;  3CNQ P;  1AZS A;  1TL1 A;  3TAQ A;  2DRA A;  1RT5 A;  1TL4 A;  5D78 A;  3UFC X;  1N0U A;  2R7W A;  3C8Y A;  3M8Q B;  1X5P A;  3M9N B;  3CD7 A;  3CJQ A;  2IM3 A;  1QD1 A;  4K4Z A;  5IT9 U;  4LRC A;  4A8F A;  3PW2 A;  2LKZ A;  1RBO B;  3CJ0 A;  2W9B B;  3QFH A;  4ZJL A;  1RT1 B;  3MPD A;  4C11 A;  2C2K B;  2HZC A;  2AEM A;  3T5J A;  2J6U A;  4RNN A;  3SCJ E;  3TYT A;  4I6A A;  3G8T A;  2GV1 A;  5DS7 A;  2FVC A;  4ETZ A;  4CT9 A;  3T5K A;  1EJ7 L;  3HVT B;  4E98 A;  1NJY A;  2ZBQ A;  5KFM A;  3PG9 A;  3W1Y C;  3FJ2 A;  3B82 A;  5C7P A;  3ZZU A;  3TA0 A;  3J81 Y;  4DV2 F;  5GAE I;  4PWW A;  4TY8 A;  2LFV A;  3A3P B;  1S7H A;  3GFZ A;  1Q8B A;  4HT7 A;  1YSJ A;  5BR8 F;  1IVZ A;  1YDL A;  5DZ7 A;  1HQE A;  4A8O A;  1UVI A;  2VIC A;  2NSB A;  3NP5 A;  1S72 S;  3IM8 A;  3DLK A;  5GAH U;  3TEG A;  3QAE A;  1QUV A;  1X4G A;  2OPR B;  3AHP A;  4OHW A;  2CDR B;  3W8P A;  1KKH A;  2D7S A;  2ZM6 J;  5A8R B;  4L3K A;  5IS2 A;  1DAR A;  4G6V B;  3MUT P;  2OD4 A;  4WP8 A;  2I6W A;  4CYU B;  4QU6 A;  1OS5 A;  1AXQ A;  5FLX U;  3PZP A;  1JKH A;  3J7Y U;  1Y7P A;  4LF4 F;  1NHU A;  3BDP A;  4CCH A;  5DLG A;  1VLY A;  5DGB A;  3AH6 A;  1MWY A;  3TUJ C;  3HK2 A;  4OZ2 A;  3CO9 A;  4YB6 A;  1KRP A;  4ILM A;  2QFJ A;  3H5U A;  1ZZN A;  1BQX A;  4NEY A;  2BW2 A;  2IM0 A;  3CT9 A;  2XS5 A;  1CJK B;  3GG1 A;  3PFO A;  1UEK A;  4FKY A;  1RTI B;  1HBU B;  4CTA A;  3QAU A;  3RW7 A;  4X4P A;  3MM8 A;  2B9X A;  2MJN A;  4C3M A;  4B9V A;  4HTI A;  1L3T A;  2W24 A;  1D0E A;  4EBD A;  1ICE B;  5THW A;  2XSF A;  6FDR A;  4WFN Q;  3UQS A;  3MPV A;  4QCL A;  1CJU B;  2F40 A;  2ERR A;  1X0P A;  1HW9 A;  2OPQ A;  2UXD F;  4KY3 A;  4I6Y A;  2Y0B B;  2DGT A;  2V68 A;  4YB7 A;  4IFY A;  1RE1 B;  2EFP A;  2CZ9 A;  1N5Q A;  3MAQ A;  3PYF A;  1M5H A;  5A8W B;  4YFU A;  3OSN A;  2LEA A;  1NZA A;  3IS9 B;  1I94 J;  1H0H B;  5B7W A;  3CDB A;  2EFO A;  4IOB A;  1D9D A;  3JTO A;  3VZH A;  5CYJ A;  4B3M J;  3OJU A;  1L3K A;  4PG5 A;  4ID8 A;  2OEL A;  1DUR A;  4ZN3 A;  3VWS A;  2FD2 A;  2CZV C;  1IKW A;  4PG4 A;  4ZMM A;  2DIV A;  2HHH J;  1RI7 A;  1EQM A;  3GU0 A;  4O0N A;  3BF4 A;  2FDN A;  1YJ7 A;  2YKO A;  1B3T A;  4IFV B;  3ZC4 A;  1X4C A;  2MMY A;  4IDK A;  3OL6 A;  1FT8 A;  2DEJ A;  4LF5 J;  5CZV A;  4O23 A;  3HI9 A;  2FJB B;  1WKK A;  4NZ0 A;  4X2B A;  2DNY A;  2OSQ A;  4WWS A;  4C8N A;  3CIM A;  3V6J A;  2WRM A;  3D0G E;  3WBZ A;  2OPP B;  4J9U E;  2HSE B;  2V34 A;  1HW8 A;  2YWW A;  4M1K A;  4DPO A;  1FDD A;  5A2Q U;  2MY7 A;  2VG7 A;  2ZD1 A;  5EX0 A;  2HHS A;  2PC6 A;  1IKV A;  2IY5 B;  3P4U B;  1YJT A;  2M5Y A;  2XZT B;  1U6Z A;  2EWH A;  2POK A;  3QAT A;  3DYA B;  1WOP A;  5CCL A;  4OLP A;  3LW5 C;  1IN0 A;  2GAG C;  1S1X B;  5L38 A;  2MKY A;  1UWA A;  1TKT B;  1UKU A;  4C0O C;  2J5A A;  2DCL A;  4K4Y A;  1IWG A;  2DHX A;  1Y5L B;  4Q43 A;  3MMB A;  4F25 A;  3MUM P;  1IM6 A;  3SMZ A;  4CIO A;  1HWU A;  5J2Q B;  3RBX A;  1MWZ A;  5HQL A;  1IKX B;  3MPY A;  2DXD A;  1N5Y B;  2IDE A;  2YKM A;  3WC2 A;  2QMX A;  3QT6 A;  3NG8 A;  1I1G A;  3CVK A;  1FVQ A;  4DL4 A;  4ZK7 M;  2QFI A;  3MED A;  3HHL A;  5KG6 A;  3MEG B;  3P5T L;  4JV5 J;  1RAD B;  3B78 A;  4GVB B;  4FF2 A;  1TK0 A;  3NRB A;  3VGT A;  2BR0 A;  1XK8 A;  4ZVP B;  1O8B A;  3SCI E;  2ATL A;  4KJI A;  2CNN B;  2AF6 A;  3R2D J;  3D3C J;  1YGY A;  3K59 A;  3QRQ A;  2KXH A;  1X4F A;  2JVM A;  1Y5I B;  1PIL A;  3PXG a;  4P2X A;  4Z7Y A;  1JMT A;  3AD7 C;  2NZ4 A;  5CH7 B;  2OKQ A;  5H1S V;  4U8Y A;  4WF9 Q;  1F6T A;  4UQG A;  4O4G A;  1S6O A;  1SKS A;  2IJN A;  5KFJ A;  1S97 A;  3N5F A;  2A3J A;  1SH0 A;  2UUA F;  3R5J B;  3CD0 A;  3V6H A;  1VQ4 S;  2IAJ B;  4DWI A;  3CD6 S;  4WFB Q;  3LTO A;  4CLZ A;  1KON A;  2DR7 A;  2YH1 A;  1DQ9 A;  2GO9 A;  3NOC A;  3I5C A;  3BR8 A;  5D0R A;  4DSJ A;  3QNW B;  2F3J A;  1QE1 A;  4GKK F;  2OSR A;  3ENV A;  2RDJ A;  2QJ3 A;  1IBK F;  1S9G A;  1HIY A;  1WEL A;  5ETV A;  2EK6 A;  4BBY A;  1H3D A;  1PGZ A;  4FXV A;  2WOM A;  2WW8 A;  2LYV A;  2FVQ A;  1R43 A;  1HYS A;  2Y1R I;  1SUQ A;  4Y34 A;  3ZTR A;  2JHE A;  1WC3 A;  3VV2 B;  3NGT A;  4CM2 A;  1JJ4 A;  3R3T A;  1RXO B;  2P9G A;  4EZ6 A;  4UF4 A;  4FKX A;  3BEG B;  2WVD A;  5LMN F;  1LXJ A;  4ZVF A;  4KGX B;  1GEH A;  3QIP A;  1U2C A;  4JV2 A;  1FE4 A;  4NLP A;  4RUH A;  2EG1 A;  2ABY A;  1U47 A;  4R0E A;  2R8J A;  4IH7 A;  2G0J A;  1LOU A;  3MFH A;  2DIU A;  3DRS B;  5J2P B;  1K47 A;  4CLP A;  2VJV A;  1S1T B;  5IC6 B;  3IXQ A;  3IBW A;  1TUG B;  8RUC A;  5BJR A;  2BE2 B;  5HVG A;  4YDD B;  3D6F B;  3HD1 A;  1DLO B;  4J9Q A;  1GTH A;  1K1S A;  3C14 A;  2ZWP A;  2OGU A;  2UU9 J;  1FX2 A;  1F5B A;  3BB5 A;  1H7W A;  5IV3 A;  2M70 A;  4QIV A;  2BQ3 A;  2F9J A;  5SZT A;  2YWH A;  3PR5 B;  4FP9 A;  1RAH B;  3AOA A;  5K8P A;  2RML A;  4IH5 A;  5AJ3 J;  3OLA A;  2DY9 A;  3UCZ P;  2QG9 B;  3NS5 A;  3OT9 A;  4LFC J;  5LMU J;  1XC9 A;  2VUG A;  3W2W A;  2IFX A;  1T02 A;  3KLV A;  1J5E F;  4UUW A;  4UOG A;  3KJN B;  2BZ2 A;  4USJ C;  1IBC B;  2HFO A;  1CLF A;  3ILI A;  2BRL A;  2AV5 A;  5F8I A;  5AXM A;  3PNI A;  1BE4 A;  1U7L A;  4N8O A;  3RAQ A;  4J7C A;  2BW7 A;  5GMK a;  1TL7 A;  1BY9 A;  4WZM A;  3MMC B;  2OH2 A;  2DO4 A;  1NSP A;  1LWE A;  4C0H A;  3GZ7 A;  3W5Y A;  1XR6 A;  4X4R A;  1JLF B;  3EVW A;  3N4W A;  3ZZY A;  4F8R A;  1SPB P;  3CMQ A;  1XR7 A;  4LRB A;  1NXI A;  3DDN A;  1RAG B;  4OYP A;  2EFV A;  4QYZ K;  2ZBP A;  3OJS A;  2VQF F;  3CCZ A;  1RAE B;  4NE9 C;  1M1H A;  4DR3 J;  3GJT B;  2O5D A;  4F2R A;  4F26 A;  2BAN B;  4GO5 X;  3HJF A;  1JLA B;  2D41 A;  1F2G A;  2GIR A;  1M90 T;  1YTY A;  3S1T A;  2AD9 A;  3LAM A;  3DHW C;  3GG0 A;  2GC8 A;  2PEH A;  3M30 A;  2UVU A;  2HWH A;  2PMZ D;  2Q2G A;  3VGS A;  4K4V A;  4RL1 A;  2CDQ A;  2IA6 A;  3JAM Y;  3JSM B;  1NH8 A;  2W8K A;  3TQE A;  4RW4 B;  2BKO A;  3H4B A;  4ZVU B;  1YLX A;  3HFZ B;  2NPI A;  1EP4 B;  3M8P A;  5L1K A;  4NXM F;  2X7I A;  3DLG B;  3TVK A;  1SL0 A;  2EG2 A;  1RYS A;  1FHT A;  1KFS A;  3DRX A;  3C16 B;  4HL9 A;  2MZS A;  4RJV A;  2WVF A;  3MAH A;  1TAQ A;  2CJY B;  4DUY F;  4ITS A;  3B4D A;  2V4J A;  2BE9 B;  3DGP A;  1NDK A;  3P6Y C;  4DV1 F;  1GMV A;  1M1G A;  4DU8 A;  4E2F B;  3K57 A;  4DR5 J;  4ECS A;  4ALZ A;  3P8B B;  2FHJ A;  1JJ2 R;  1VS3 A;  1PYO B;  3W5X A;  1UPM B;  4OL8 A;  3KDN A;  4JV1 A;  4A8Y A;  1K0V A;  2HQG A;  2N7Y A;  4BS2 A;  4IUF A;  3M32 B;  4PRF A;  3ZZO A;  2K3I A;  4I2Q A;  3IRX A;  5KFX A;  3GTY X;  4LFB J;  3LPE A;  1TFY A;  1SJR A;  1UZD A;  3BGR A;  3OSP A;  2HLT A;  2QO3 A;  2HLU A;  2MHN A;  2XYH B;  2V2Q A;  3NBP B;  4O44 A;  4P73 A;  1KVI A;  4FXW A;  1XMQ J;  3KTQ A;  3D1Q A;  1NK0 A;  3RUB L;  2A6O A;  4EO8 A;  3D68 A;  3C19 A;  3EWG A;  4I67 A;  2B26 A;  4PEO A;  2OP5 A;  3E51 A;  3CGI A;  3ISN D;  1IWA A;  2VOO A;  2VAS A;  4TNO A;  3KKF A;  2J9C A;  3TAM A;  2GIF A;  3BGO P;  4XDC A;  4P6Q A;  3AKO B;  4ZVE A;  4RW6 A;  1KHV A;  2HRT A;  1WEZ A;  3E01 A;  3SCL E;  2O67 A;  3W9J A;  3CCL S;  2FQQ B;  1V6H A;  4OHZ A;  4WP9 A;  3GLJ A;  4X62 F;  3T1H J;  2VD3 A;  2KG0 A;  3NWG A;  1VQK S;  1FFW B;  1S1U A;  4OYO A;  2GHW A;  1B64 A;  5FJ4 A;  3I0R A;  4YR3 A;  1MLA A;  3B6B A;  3F41 A;  3M2U B;  1R27 B;  2KVQ E;  3ZTS A;  4WTO B;  1ZYQ A;  2FJX A;  5KFA A;  1O51 A;  3VAH A;  2QSW A;  3HM9 A;  3UD4 P;  2GJ2 A;  3BM7 A;  3TJ8 A;  3OR1 B;  1VBX A;  3QGP A;  2OHD A;  1TKZ B;  5E2Q A;  2A6M A;  2B7B B;  4OYW A;  3ITH A;  3K2Y A;  2NPF A;  4ZPW R;  4P2F A;  2C1E B;  4UY8 5;  3AOB A;  4IKA A;  5A8K A;  2RIL A;  2QC3 A;  2IBO A;  1GMW D;  2MGZ A;  2YBV A;  1RT4 B;  4NA3 A;  2BKN A;  5K9F A;  4A8Q A;  2D1C A;  2VFR A;  2ASD A;  2ASL A;  5I3Q A;  4WZQ A;  4ELV A;  2D9P A;  5KFD A;  5DGA A;  1QVG R;  1YK9 A;  3MMJ A;  1JB0 C;  3IC1 A;  4X64 F;  2FYX A;  4OYI A;  3N6L A;  4I7F A;  1FRM A;  1BHN A;  3W2V A;  3GV8 B;  3MHY A;  1HNX J;  2R7T A;  2A2D A;  2ZZM A;  1F9E B;  3IRW P;  1NDC A;  4O3Q A;  2AGO A;  5GAE U;  2PI4 A;  3GJR B;  3R5D A;  1CS4 B;  3CJ2 A;  1R0B G;  4DL2 A;  3KNA A;  2N82 B;  2GHP A;  4YDX A;  1HMV B;  2UZA A;  4ZLJ A;  3FGV A;  1RLC L;  5AXN A;  4MH8 A;  3OFG A;  3H2L A;  1Q1K A;  4ANC A;  2VU5 A;  1YJN S;  1DJ0 A;  1VJW A;  2QYC A;  2X1A A;  1H98 A;  5HBM B;  2WSC C;  1VI7 A;  4Y2M A;  4Q0B A;  4A48 A;  2DPJ A;  4PR6 A;  4OHY A;  4DR6 J;  2DNM A;  2IC3 A;  2GX8 A;  4UT4 A;  1P27 B;  5I3U B;  2FHO B;  1HWJ A;  3H90 A;  4Y2K A;  3TWZ A;  4R25 A;  2BE7 D;  2DHG A;  2DNL A;  4C3K A;  1N33 F;  4LVN P;  1IUJ A;  3HCX A;  1RGV A;  4DV0 F;  4KV8 B;  1REV B;  2IRU A;  3EM1 A;  2KXN B;  3EYZ A;  3KG4 A;  3H4D A;  3MCO A;  3E3X A;  3U1M A;  4B3O B;  5KG1 A;  1JLC A;  1XER A;  1T7P A;  2DGV A;  4ES2 A;  1LFP A;  1WOR A;  3M8Z A;  3MEE A;  4DR4 F;  4M63 A;  5CQG A;  1QTN B;  2CVE A;  4F0H A;  3TAN A;  3OL9 A;  3ILL A;  3JSB A;  2B8P A;  3GYN A;  4K0K F;  3G6Y A;  2V9K A;  1SCJ B;  1EIY B;  4J37 A;  4URG A;  3OXF A;  2CAJ A;  1Y3J A;  1WDD A;  1BD6 A;  1S6Q A;  3AQO A;  1JLE A;  2K7K A;  4K8R A;  3EZU A;  3I9V 9;  2HHV A;  1QVF R;  3EIC A;  1MNE A;  2VJU A;  1VIX A;  2HBQ B;  3OD2 A;  1WKJ A;  2MKJ A;  3HSZ A;  3MM5 B;  1FXD A;  3LF0 A;  4I68 A;  4HDG A;  3NMA A;  4LIW A;  1H38 A;  3K7R A;  4ECY A;  2LA6 A;  4XPE A;  4C8Y A;  1FRL A;  2VOP A;  3KMS A;  4OZL A;  1X5S A;  1GFW B;  4W90 B;  3V6D B;  2VG5 B;  3CC2 S;  1F9H A;  2HHQ A;  3BKT A;  3D6M B;  1QM9 A;  3DOM B;  3W5Z A;  2ZBI A;  4AXJ A;  4ECZ A;  1DZ5 A;  1P9Q C;  1FVS A;  2AT1 B;  1QAY A;  4EWT A;  3HP6 A;  3U1L A;  1Z2L A;  3AQP A;  3VAK A;  1FNO A;  5KT3 A;  1SVD A;  5IT0 A;  3CO0 P;  4AL5 A;  5J2M B;  1AZS B;  2BJ9 A;  3LAL A;  1TL1 B;  1RT5 B;  2M4M A;  3UDC A;  1GXU A;  2DR9 A;  4GKJ F;  1WC1 A;  4ECR A;  4XAK A;  4DR2 F;  4OX6 A;  3F73 A;  3RJM B;  3DHX A;  1Q95 G;  3PJX A;  1WHX A;  2MZR A;  1U4B A;  3ELH A;  2MLX A;  5BYR A;  2XTJ P;  2VC0 A;  4C11 B;  1XNQ J;  2ROP A;  2HHW A;  3I9Z A;  3MFI A;  2J6S A;  2OFG X;  2NZC A;  5DQG A;  2G2Z A;  1UET A;  2DR5 A;  1GXL A;  1ZA1 B;  5IV4 A;  4MFB A;  3GE9 A;  3PIO Q;  3HSD A;  1F5C A;  3PKY A;  1KNZ A;  4FNI A;  4TY8 B;  1YIJ S;  2YQ3 A;  1FFG B;  3Q8V A;  1IKY A;  1KN6 A;  1HQE B;  4PAA A;  2R2R A;  3ZNJ 1;  1Y11 A;  5KFC A;  4JB8 B;  8ATC B;  1RJJ A;  3G4S S;  3DLK B;  2VFU A;  3OHA A;  1C4A A;  1RTD A;  5KFQ A;  1VQO S;  1M1K T;  1L3U A;  1IBL J;  4ELU A;  3IR6 B;  4XDD A;  1ZPW X;  4ZIV A;  4DV6 F;  2Z57 B;  4LF1 A;  1WOS A;  2ZUA A;  3VVU A;  5K8M A;  1HBO A;  2GML A;  5E3Q A;  4DSF A;  3Q8R B;  3KHG A;  4PPD A;  4R8U A;  1JKH B;  1KQF B;  1H72 C;  3SQO P;  1RA6 A;  4I69 A;  2BJ7 A;  3L95 X;  5DQI A;  2HUR A;  1FXL A;  5HAN A;  5T7L A;  4NX9 A;  1K73 T;  1GXT A;  4Y6I A;  2IRX A;  2AYB A;  4RR5 A;  4F0M A;  3I56 S;  2DR8 A;  4LRE A;  2MQL A;  5HQ8 A;  4HTJ A;  4LF6 F;  4ZJQ A;  3BS9 A;  5B0A A;  4CTA B;  1TL5 A;  2XMM A;  3M6X A;  3MM8 B;  1AA1 B;  1RAC B;  5B0D A;  1VCT A;  3P3D A;  1RBA A;  2CNL B;  1HBN A;  3B4M A;  4X84 A;  4P52 A;  2XO6 A;  2OPQ B;  3FUY A;  2CQD A;  3LAN A;  1SKW A;  4IFY B;  4LF9 F;  4NMX A;  3G86 A;  1ZS6 A;  2XZD B;  4PWD A;  3GYX B;  3BSN A;  1V3R A;  2B4U A;  4HI1 A;  4FVM A;  3AJD A;  4M5H A;  3IWL A;  4LT6 A;  4USH A;  2RS8 A;  2WBM A;  3Q23 A;  3QID A;  5L9N A;  5CYM A;  1KS2 A;  4NCG A;  3GQC A;  1WJ9 A;  1IKW B;  2E1C A;  2ZOM A;  1R3N A;  3TA2 A;  4DZD A;  2VBY A;  1IBM J;  1R8H A;  4IDK B;  1GTE A;  4OJH A;  4FZV A;  4X4V A;  2ADC A;  3L9Z A;  1JNR B;  1RWX B;  2Q1L A;  1F9F A;  4NLG A;  4U7C A;  4PQU A;  2JEJ A;  2XNR A;  1IR1 A;  4ANE A;  2VG7 B;  2ZD1 B;  3BYP A;  2J0W A;  1NME B;  2W9A A;  4M5G A;  2J8A A;  1IKV B;  3J7A N;  4M95 A;  4IQM A;  3IG1 A;  4FF3 A;  3TZZ A;  5E33 A;  3CJT A;  3CJ5 A;  1JJC B;  4Z7C A;  5CD4 H;  1U2R A;  1XQI A;  1KQK A;  3H42 A;  4NLD A;  2VIH A;  1TL3 A;  3K5M A;  3ZZT A;  2BKP A;  3QSY B;  3NOG A;  3MMB B;  4ECU A;  1VHI A;  4ED3 A;  4BWJ A;  2XI2 A;  4K4T A;  5D15 A;  3H0P A;  4DSL A;  2EK1 A;  5FD1 A;  3DMJ A;  4OX9 J;  1UVN A;  5J2N A;  4RW8 A;  1HI1 A;  5CAA A;  2RF2 A;  2YKM B;  1JLQ A;  1Y0H A;  3NCQ A;  2B9E A;  3MOZ A;  5DO2 A;  4QIE A;  5HI7 A;  1S1W A;  3MED B;  3G8Q A;  3HHL B;  4DV5 F;  5AE3 A;  3W3S A;  1F5A A;  1QSS A;  3D1H A;  3A8E A;  2I5J A;  1H2V Z;  1YBA A;  4YHH F;  1G7C B;  1P8G A;  1TKX A;  2RDI A;  2H48 B;  3THP A;  2NSC A;  1Q7Y T;  1WHV A;  6FD1 A;  1N6Q A;  1MW7 A;  5M2P A;  5F3T A;  4L72 B;  3D7S B;  1UJ5 A;  3CC7 S;  4NXN F;  3CDA A;  3H25 A;  2RDD A;  1WI8 A;  2C2E A;  3OW2 R;  5J1P A;  1WEY A;  1HA1 A;  4U6P A;  3PX0 A;  3PM9 A;  1HHS A;  2KJV A;  4OYA A;  3NGU A;  2BXJ A;  2EFG A;  2PDA A;  4UOH A;  1RQ0 A;  2P9C A;  4KHR A;  4O4G B;  2ZM6 F;  2E9T A;  4HHJ A;  5D4O A;  4X4S A;  4LRF A;  3I6P A;  1X9S A;  4RO0 A;  2D69 A;  4P71 A;  1RP5 A;  2YX1 A;  3FKB A;  2EPI A;  1FRH A;  4J9R A;  1CEZ A;  1ZAW A;  1VYA A;  2H51 B;  2HAF A;  1RHM B;  3UCU P;  5T14 A;  3KHL A;  1QE1 B;  3CMA S;  2V2K A;  4ZCI A;  2FJW A;  1JQG A;  2VF3 A;  2ILZ A;  1S9G B;  5B0E A;  3M4X A;  5B08 A;  4KH1 B;  1UPP A;  3UI3 A;  2XWX A;  4D3G A;  2VDH A;  1U6B A;  2WOM B;  2KT5 A;  4F3M A;  1D9A A;  3QPI A;  4M5I A;  3UNG C;  1HYS B;  2QE5 A;  4DR1 J;  1SUQ B;  5KFG A;  2V67 A;  3DC2 A;  5IM0 A;  3WC0 A;  4NLQ A;  5KFS A;  4NZ6 A;  3C6T A;  3FEX B;  3DOL A;  4DZ6 A;  1UFL A;  1EKR A;  2CWK A;  5HSP A;  2QL5 B;  3CED A;  3UNY A;  2JSX A;  4U96 A;  1RWN B;  3G6X A;  3QIP B;  1S49 A;  4J9L A;  3SBM A;  2QTW A;  1XNR J;  3LP1 A;  1S9F A;  4EI2 A;  3M8W A;  2NYH A;  4NZ7 A;  3T6B A;  4DR7 F;  2XB2 D;  2QA1 A;  1SV5 A;  1NND A;  3Q22 A;  1S0M A;  3MZI A;  1ULR A;  2FLL A;  3A8K A;  3GIR A;  4RX6 A;  1I94 F;  1T0T V;  3FMB A;  5DG7 A;  3HSJ A;  2N3L A;  3C14 B;  4B3M F;  4CH0 S;  3CTR A;  3LUY A;  5GAH I;  2W7P A;  4HHH A;  1ZM3 A;  1T94 A;  1ZET A;  4DV7 F;  4J9S A;  1FEE A;  2HHH F;  3DRP A;  5GMD A;  1FXR A;  4FVC A;  1EAY C;  3T9Z A;  5KFO A;  1RU2 A;  3LOU A;  3PRV A;  3DLL Q;  3W2W B;  1XMO F;  3N28 A;  3I31 A;  3ZZ0 A;  2CQ4 A;  1T9Y A;  5CD4 A;  3HO1 A;  2V4Q A;  4U67 Q;  1Q0N A;  2MB0 B;  5D3G A;  4OZ3 A;  5F8H A;  2MPU A;  2OEM A;  3BH7 B;  3ZZR A;  3M7V A;  2IRY A;  2RQM A;  1YJR A;  4LMZ A;  5EWG A;  1TL7 B;  4HI2 A;  1F0X A;  2LVW A;  2CPF A;  3TNV A;  4OZ5 A;  4PYD A;  1TR0 A;  1LWE B;  4ZP9 A;  2D3Z A;  3DI6 A;  2RVJ A;  3UW1 A;  3V4I A;  3LO3 A;  4NI2 A;  1B99 A;  2LA4 A;  1NK9 A;  5L1L A;  5H9F J;  4U95 A;  4M5J A;  2DGX A;  3CB4 A;  4QPX A;  4ILR A;  1DRZ A;  2UXC F;  3MEC A;  4JI5 F;  1DY3 A;  4F2S A;  1YZ7 A;  4OFZ A;  4GMK A;  3H5X A;  3S6E A;  1UVL A;  4B9U A;  4ZVQ B;  1Q4R A;  3G71 S;  1VBK A;  2JEF A;  3W61 A;  2IM1 A;  4QR0 A;  3BR9 A;  3FBE A;  3M30 B;  2D3U A;  2VB6 A;  1VQ5 S;  4YB1 P;  1Z2Z A;  1SJ4 P;  1A6L A;  3GON A;  3HX9 A;  1UZH A;  5K14 A;  4M5K A;  1X8D A;  4LF8 F;  1YQH A;  1UW4 A;  1SKU B;  2RE1 A;  3X1L B;  3RRH A;  4NA2 A;  2RQK A;  2QX0 A;  3DLJ A;  4DL0 C;  4CDI A;  5K8N A;  2CIM A;  2DNZ A;  3GYG A;  3M8P B;  2RSQ A;  1B0V A;  4ZOS A;  3OVA A;  2EW9 A;  4PG8 A;  2BJD A;  1W26 A;  2V4J B;  2HBY B;  1AUD A;  3DGP B;  1TU0 B;  5CYQ A;  2BM0 A;  4DBQ A;  1UEU A;  2CG4 A;  2JDJ A;  3GIK A;  2FTR A;  3LPY A;  1Q8L A;  2GO8 A;  2B4V A;  3HVW A;  3D4J A;  3MR3 A;  1R8A A;  2M3D A;  2MKC A;  4ED4 A;  5KG7 A;  1HR0 F;  1P6T A;  1RAI B;  2GVD A;  1NLT A;  2C2N A;  1RHK B;  1VOM A;  2ILY A;  1NHK L;  2AJ2 A;  1C1B A;  2I0X A;  3TP2 A;  2WBR A;  3UN5 A;  4I2Q B;  3IRX B;  1WUU A;  3S8S A;  3JSY A;  2OUG A;  3CUL A;  2DH9 A;  3KG0 A;  4ZHR A;  2HRY A;  4LR7 A;  3Q24 A;  1JXE A;  3BGR B;  2HS0 A;  2Z8Q A;  1N32 J;  1SI9 A;  3K89 A;  4PPZ A;  2CPX A;  4O44 B;  4G1Q A;  4UST A;  1WC4 A;  2H1Y A;  3EXC X;  4QJV A;  4RUB A;  1U1P A;  2LXF A;  2GGP A;  3BZQ A;  3RBZ A;  3L7U A;  4Q7A A;  3TAM B;  1L3S A;  4RW6 B;  3E01 B;  1R6Y A;  2B5J A;  4GVL A;  1E6V A;  4CQ1 A;  3GSD A;  1Q78 A;  3FZB A;  1R6V A;  2C3O A;  3NMR A;  1S1U B;  3US5 A;  2R9L A;  2DH8 A;  3I0R B;  2W7O A;  2PA3 A;  1ROF A;  1C3G A;  5I3P A;  1S1V A;  3LA0 A;  4OI2 A;  1WG4 A;  4O0I A;  5ETK A;  2Z2M A;  2YPY A;  2KT2 A;  2BUN A;  3ITH B;  3WDO A;  2ALZ A;  5D77 A;  2YQ0 A;  3QZ8 A;  4ZPC A;  3RR8 A;  4IH6 A;  3MEK A;  5A8K B;  2AYG A;  2YXL A;  2E44 A;  1NH7 A;  2F4V J;  3V81 A;  5HMW A;  2F5G A;  1SB6 A;  4F4A A;  4QU7 A;  2HHT A;  2MGZ B;  2XSJ A;  4DCP B;  3G9C A;  4U7U D;  3BBC A;  2W4C A;  4BLG A;  4DV2 J;  2YNH A;  3IBF B;  5KFI A;  1UTA A;  3L09 A;  2CQ2 A;  1VGY A;  4MMO A;  5BR8 J;  3CCJ S;  1OY9 A;  3MWB A;  2I9S A;  2AW0 A;  1BWV A;  2GNK A;  2F65 A;  2V8D A;  4I7F B;  3HF5 A;  2CVI A;  1D8Z A;  3W2V B;  4A8S A;  3D6T B;  2ZBR A;  3KUE A;  3C15 A;  2AJQ A;  2HFN A;  1KD1 T;  4MKY A;  4ATN A;  1U09 A;  1NK7 A;  2Q6C A;  1U2F A;  4MAK A;  5B0F A;  5G0R A;  2MZQ A;  1T95 A;  3SFG A;  2CJ9 A;  4OYM A;  2Q6B A;  1VQS A;  2DXE A;  3SV4 A;  1VLO A;  2F7V A;  2FJD B;  3T3F A;  3TOQ A;  2AJ0 A;  1RB0 A;  3RB4 A;  3BSO A;  3NNA A;  4ED1 A;  2DY1 A;  5LXR A;  4LF4 J;  4Q0B B;  2JC0 A;  4X4T A;  6AT1 B;  3MM9 A;  3QO9 A;  4USI A;  4ID5 A;  2JRS A;  2IC3 B;  3VQT A;  2RKI A;  4TQR A;  2RJZ A;  2OD6 A;  4DFK A;  5E41 A;  1DHM A;  2W2Q P;  3AB4 B;  4OI6 A;  2M2B A;  1R8P A;  3HZG A;  2JX2 A;  2V8P A;  2V9W A;  1TMJ A;  3UO0 A;  4DV3 F;  4YY3 F;  1JLC B;  4HR2 A;  4ZP6 A;  3FBB A;  2KB2 A;  3VCD A;  3K5L A;  2NRE A;  3DXB A;  3MEE B;  3FSY A;  2HKE A;  1DQA A;  1TFW A;  5A0Y A;  2O3D A;  2H9Z A;  1B0P A;  3FCV A;  4N8N A;  1XMB A;  1RHJ B;  5IQ6 A;  1U25 A;  4ZLL A;  2AEJ A;  2J0Q D;  1UA1 A;  1H2U X;  2QGF B;  2DK2 A;  1S6Q B;  4J80 A;  1JLE B;  2E1P A;  3PHE A;  5AXL A;  4DLE A;  2M8D B;  2AMC B;  1U0S A;  1H6K X;  3RB3 A;  5DM7 Q;  3A8J A;  2D74 B;  5EGY A;  4K5S A;  1BLU A;  2HIQ A;  2G2O A;  5K8O A;  4USU A;  4Q45 A;  4ED7 A;  3G2X A;  1CC8 A;  1YX2 A;  4DL6 A;  2IVF B;  3H20 A;  4ZKA A;  4J9O A;  1BXN A;  2D9O A;  4JI1 J;  2E1A A;  2ZE2 A;  2NXC A;  4WFY A;  2QLJ B;  4K4X A;  4QZV B;  3TZW A;  5KFE A;  3HFV A;  4LJM A;  1N56 A;  3F56 A;  5KFT A;  3T1H F;  1C1C A;  5KG0 A;  2EKY A;  2AKW B;  1I3O B;  2Z30 B;  4OJ3 A;  2IMO A;  3KJV A;  3I4P A;  3M6V A;  4KGK A;  5L39 A;  3MR2 A;  2CQH A;  3FEZ A;  3KLE A;  3SV3 A;  2Y9H A;  2ZIT A;  5IZH A;  2VG6 A;  3FBC A;  1V3Z A;  3TX0 A;  5LSO A;  3P49 B;  5IT4 A;  3KK2 A;  4PG7 A;  1GQE A;  5RUB A;  5HRO A;  3MI7 X;  4YQW A;  2BOA A;  5KG2 A;  3GMG A;  1VRU A;  1CJV A;  2E5L F;  4DX5 A;  4Y2C A;  4WTY A;  1FRX A;  3T5H A;  2DHS A;  3MMA A;  1LWX A;  2KI2 A;  1FD8 A;  2KXF A;  2BAC A;  1GT8 A;  1NSA A;  4MIB A;  3V5R A;  5J1E A;  1Y4Z B;  3V6K A;  3BKF A;  2ZFH A;  5EN1 A;  5ETM A;  2HGN A;  1NK8 A;  3CJK A;  3HT3 A;  2O01 C;  4M5M A;  4MFB B;  3KMQ A;  1PAU B;  4DX6 A;  2XLJ A;  1O6X A;  4I0W A;  2DB1 A;  2DH7 A;  4DX7 A;  2EEY A;  2CKW A;  3T6J A;  2QZ8 A;  4LSZ B;  1PBA A;  3M8S A;  1PC5 A;  1IKY B;  3PJ9 A;  4IG3 A;  2DHH A;  4H4M A;  1Z1Z A;  2ZZT A;  4TU9 A;  4KPC A;  1F60 B;  9ATC B;  1Y10 A;  5LT5 A;  2QLW A;  2PE8 A;  4HAC A;  2VOD A;  4MK8 A;  2KZZ A;  2UUA J;  3ZFV A;  2NCK L;  3MPU B;  2G13 A;  1RTD B;  4QYR A;  2Y0S D;  3ICL A;  3K8W A;  4AXI A;  1WKL A;  3Q0A A;  2HK3 A;  2VBZ A;  2CZ4 A;  2H5E A;  3NAH A;  1IBK J;  1HBO B;  3MCN A;  2QSF A;  2CQC A;  2R7X A;  2CYY A;  3PTW A;  4IO9 Q;  4R8U B;  1FE0 A;  4IR9 A;  3RG6 A;  4HLB A;  1SJQ A;  5KFN A;  4ED0 A;  1CJK A;  3VAG A;  1C4C A;  4QR2 A;  1JJH A;  2HFU A;  2VFV A;  1OY6 A;  5T7L B;  3EPI A;  4JI7 J;  3KFW X;  3IFE A;  3GCX P;  3MUV P;  4LSL A;  2QT7 A;  5KFW A;  1R0A A;  4NML A;  3KOA A;  3TZY A;  1QAJ A;  2IDL A;  1RU1 A;  1Y9O A;  1UWB A;  4B9S A;  3CW2 C;  4P72 A;  1VIO A;  3O1L A;  5CXT A;  3GSI A;  1ZM9 A;  1CJT A;  2KFY A;  5HAT A;  2W4D A;  3N6N A;  3OTO F;  3QJJ A;  3BJY A;  1S0N A;  1RHU B;  1HWI A;  1HBN B;  1HNW J;  2VQE J;  3D0H E;  4UOF A;  2KYX A;  5KFR A;  1A7G E;  2AJ1 A;  3A3N B;  4J5O A;  2WSF C;  3D9B A;  3IR5 B;  4PWD B;  3UR0 A;  4AFF A;  4X4U A;  1Q7L B;  1IM4 A;  3M05 A;  3G82 A;  3O3L A;  4F4Y A;  4N7T A;  4F4X A;  4DN9 A;  3IBC B;  3VAL A;  2HVE A;  4HT5 A;  4WE1 A;  2LCW A;  2HQ3 A;  1FDN A;  1MMN A;  5CYM B;  4NCG B;  4MYT A;  4ZVG A;  3MCM A;  2CQG A;  3NEK A;  3MD1 A;  1VC5 A;  1J5E J;  4IOA Q;  3TJ9 A;  4FNH A;  4QWE A;  3FRY A;  3CE8 A;  3P5B P;  3WHI A;  3F44 A;  2CPE A;  4G65 A;  1Q5V A;  1JXL A;  4RU2 A;  3FBF A;  2WAQ D;  2W2M P;  4I56 A;  4KKO A;  4B3R J;  3GPA A;  4PQU B;  3RW6 A;  2EC2 A;  1S1X A;  4F4K A;  2AJ4 A;  3BH6 B;  2X1B A;  1U1M A;  4NCB A;  4RW7 A;  4NYO A;  3IG1 B;  5E3R A;  1FWP A;  1KVJ A;  2ZH8 A;  2ZH9 A;  4JI4 J;  3NLC A;  4P9S A;  1QSL A;  4KO0 A;  1WD6 A;  2VH7 A;  2XGP A;  4ILL A;  5DDQ C;  3HUL A;  1TL3 B;  3ZXW A;  1DTT A;  5KG5 A;  3K5P A;  3HKW A;  2J9D A;  1QUP A;  3DMJ B;  3CIZ A;  4ZLP A;  5KFK A;  4PQA A;  4NLU A;  5J2N B;  4X4Q A;  4RW8 B;  3AGY A;  1XNQ F;  2RF2 B;  1JLQ B;  4PXD A;  2D3O R;  4Z37 A;  2CPY A;  5HQM A;  3N5B A;  3G8S A;  2YX7 A;  2FJE B;  4ZA1 A;  2P5V A;  2NYI A;  1S1W B;  3M2R A;  5I42 A;  2YQ1 A;  4OZ0 A;  1VR6 A;  2NXU A;  2VFT A;  4NXM J;  1R8C A;  2I5J B;  2SXL A;  4DLG A;  3LAK A;  3SCK E;  1TKX B;  3M8R A;  1PIE A;  1U6F A;  4DUY J;  3HZE A;  1N6Q B;  3THT A;  5IT9 Y;  1CQM A;  1S5Z A;  1YRU A;  3H59 A;  3HHL D;  5LOQ A;  1AT1 B;  2ACM A;  2MXY A;  3ZZP A;  1RUS A;  2N3O A;  4DV1 J;  3FDS A;  3NCR A;  3VR1 A;  1XBW A;  1ZM2 A;  1TEL A;  5KT6 A;  2VBX A;  1IJF B;  4H4O A;  1U0H A;  3GV7 B;  2RB7 A;  3EVO A;  1ZAV A;  1NPP A;  4WBF A;  3LP2 A;  3TJA A;  2DNG A;  3NY0 A;  2W2O P;  5JMN A;  3BGL A;  5HO4 A;  5C5J A;  3OXG A;  4IRC A;  5FII A;  1FDA A;  4ZVO B;  3EGN A;  3ENW A;  1FI4 A;  1RWO B;  2QMW A;  3BSA A;  1NK6 A;  2HEK A;  1VRT A;  3VGV A;  2FC8 A;  4IOC Q;  1V5I B;  3EPG A;  2MTL A;  4X65 F;  1M5P C;  3R97 A;  3TW0 A;  4TYA A;  5JUM A;  4JP8 A;  4MIA A;  1YI2 S;  5IM0 B;  1ZM4 A;  4OYZ A;  3CME S;  1NDP A;  1T9V A;  3C6T B;  4O3S A;  5KFV A;  4YUD A;  3DOL B;  2X3G A;  5DZ6 A;  2C2D A;  3M1V A;  3RBD A;  3C6U A;  4DL3 A;  2JFK A;  1TKD A;  4LF7 J;  4X62 J;  3IGN A;  5KT2 A;  2LP4 A;  4FYD A;  1SC3 B;  1S0O A;  2LEB A;  3UD3 P;  2JC1 A;  3MOJ B;  4TKT A;  3LP1 B;  1S59 A;  1X4E A;  3SI8 A;  2WB1 D;  4JI2 J;  3IO1 A;  4CNY A;  3QWU A;  2Y8Y A;  3I55 S;  1XEZ A;  2DGS A;  4ELT A;  1SV5 B;  1KLM A;  2J7K A;  3R27 A;  3GFY A;  5C42 A;  2B9W A;  3MDF A;  3U7J A;  4FYW B;  2FGC A;  2ZH7 A;  2GMH A;  4OV1 A;  3QZ7 A;  2U2F A;  5CHC B;  1T03 A;  3CF5 Q;  4ZVS B;  1H74 A;  4C8M A;  3DRP B;  4G3I A;  5F0U A;  3PYG A;  1MWQ A;  2H5J B;  5E3C A;  3EUN A;  2ASY A;  1IBM F;  3Q8Q B;  4GRS A;  4FN5 A;  4KGM A;  3BQ2 A;  5HP1 A;  1OY8 A;  2ODX A;  4P2S A;  2HZV A;  3OL8 A;  3MMC A;  4BCA A;  2DPI A;  4X64 J;  1OIA A;  1WTB A;  4B02 A;  5D3G B;  4ZP8 A;  3PCO B;  2WW4 A;  1M5K C;  3DDI A;  3ZZZ A;  4N41 A;  2V6A A;  3UCG A;  3KK3 A;  2KG1 A;  4DPY A;  3PV8 A;  1TK5 A;  2CUY A;  4CO1 A;  4LSN A;  2JVR A;  2I38 A;  9RUB A;  5ETR A;  3H5Y A;  2DJW A;  2X3D A;  4BDP A;  3DI6 B;  3V4I B;  5L1J A;  1XWL A;  1YKW A;  2X1F A;  4JI8 F;  1OQ6 A;  4NI2 B;  3N79 A;  3PAC A;  3OV7 A;  4V1A k;  3CCT A;  1XR5 A;  2UUC J;  4DFP A;  2K1R A;  2MLZ A;  2XHW A;  3U02 A;  5DRK A;  5AE1 A;  3MEC B;  3HKZ D;  4UTG A;  3PKM A;  4PXE A;  2G0C A;  2KDO A;  3TAR A;  1FJC A;  4JI6 F;  2RUS A;  1WWH A;  5KT7 A;  3GIM A;  2E9R X;  2DNQ A;  5A2Q Y;  1Z4U A;  4M8L A;  3D5M A;  2AQ4 A;  4MK9 A;  5KOW A;  3QYY A;  1N33 J;  1R8B A;  4A46 A;  4DL7 A;  2B4P A;  5K14 B;  1L3V A;  4FS1 A;  3CUN A;  4NWB A;  4C0B A;  2VON A;  1X4B A;  3W63 A;  3CCU S;  3R6L B;  4DXL A;  5BYQ A;  1WEX A;  2C2O B;  1SQF A;  4HEA 9;  2KM8 B;  7AT1 B;  2QL9 B;  2R3V A;  4RUA A;  2KH9 A;  1R7I A;  3WQP A;  4DR4 J;  3OLB A;  4Q8E A;  8AT1 B;  3PHT A;  4F0K A;  2RNE A;  5CYQ B;  5KFB A;  4BC7 A;  2ZUG A;  3OTD A;  1MN9 A;  4PCQ A;  4RLE A;  1Q82 T;  4B3T J;  3UE2 A;  2KZM A;  4DV4 F;  2UUB F;  2GVD B;  1T11 A;  1A0O B;  3MGJ A;  3ILJ A;  4ZCM A;  1LKZ A;  1RT2 A;  1C1B B;  2KFZ A;  2VHG A;  2HBR B;  1VQ8 S;  4LIR A;  3J80 Y;  4NL5 A;  4ZHR B;  3AA8 A;  2FHJ D;  4F67 A;  2IVY A;  2MKS A;  2WTF A;  4C4W A;  3DCA A;  1RWU A;  1Q8K A;  3J7A 1;  3FSX A;  3KLH A;  4G1Q B;  1NO8 A;  2J9D E;  3H40 A;  1FTC A;  5LSR A;  3C5X C;  2Z56 B;  1U26 A;  2GGP B;  1MG7 A;  2PGC A;  1EZZ B;  3KYL A;  3AA9 A;  5J1N A;  4FYY B;  4N56 A;  2UV8 A;  1VJQ A;  1FF2 A;  4ZJO A;  3HLU A;  1C2P A;  2DVI A;  2HAI A;  2GJF A;  4CLT A;  4P7T A;  4CO5 A;  2B5J B;  2NR0 A;  3ETO A;  2CWX A;  2WON B;  1B7F A;  1D8Y A;  1E6V B;  2P2C B;  2J0X A;  3GFX A;  1WI6 A;  2GAH C;  2KKH A;  2FZG B;  1R89 A;  2YH0 A;  4WFZ A;  1AYE A;  2WB4 A;  3IMQ J;  4A8K A;  3CCW A;  4OI1 A;  4EYI B;  2ZKT A;  2B8Q A;  4YEA A;  4NLX A;  1X4A A;  2XLK A;  3NGS A;  5CAB A;  1W2I A;  4GKJ J;  4DR2 J;  4ZS6 A;  1S1V B;  4DCJ B;  3AGZ A;  2BM1 A;  3M2V A;  4EEY A;  2R8G A;  4RZR A;  4RNM A;  2B6A A;  2DRB A;  3I4H X;  3SSS A;  4MYU A;  4QWB A;  1LWC A;  2WZ1 A;  3PRD A;  4IO1 A;  4CO4 A;  2BQU A;  3IR7 B;  5C24 A;  3FVY A;  1DAX A;  1RWP B;  2DRD A;  2WVE A;  3J81 j;  4ES3 A;  3V81 B;  5F8L A;  2V8V A;  2B56 A;  2XHC A;  4ERD A;  2R42 A;  1NCL A;  4L74 A;  1P9Y A;  4N76 A;  2XSJ B;  3N9U C;  5BYS A;  7FD1 A;  2CFX A;  1Q53 A;  4QWA A;  5KTQ A;  5M2U A;  2H54 B;  2YNH B;  3LGM A;  2GQC A;  2ZVI A;  3MTK A;  1RKJ A;  3K17 A;  4PKD B;  2VA3 A;  4DS4 A;  2KVI A;  3KK1 A;  4KFB A;  3HXM A;  3BN7 A;  1X7V A;  1ZA2 B;  4DUZ J;  3WZ0 A;  2N4D A;  4I2P A;  1BUX A;  3C15 B;  4CLW A;  3EZO A;  2QV6 A;  3EGV A;  1LK7 A;  2L08 A;  3KUG A;  5G0R B;  2CA9 A;  2ZH1 A;  1NEE A;  5D4N A;  4NLV A;  2ZVS A;  4IR1 A;  2GVZ A;  4ICL A;  1S12 A;  4K4S A;  2HFV A;  4DV6 J;  4KPY A;  2C2M B;  2QA4 G;  2Z0G A;  2RQ4 A;  3C66 A;  3TUZ C;  1R0C B;  3C6E C;  4K4W A;  3H2U B;  3SZ2 A;  4YS2 A;  2RAQ A;  3L7O A;  3H5S A;  2YWF A;  2V2V A;  3ISZ A;  3MM9 B;  3QO9 B;  3KJQ B;  3HD2 A;  4B9L A;  4ID5 B;  3AB2 B;  1BQM A;  4PG6 A;  2CJA A;  2RKI B;  5E3P A;  3J81 U;  1NB7 A;  1WC6 A;  4WXO A;  4K5R A;  4TLQ A;  4OV6 A;  4ZP7 A;  1LW2 A;  1JLB A;  4NLR A;  4KSE B;  1N36 F;  1IXK A;  4I1T A;  4DG1 A;  3CCQ S;  4LF6 J;  2IYG A;  4C8Z A;  3KLG A;  4Y2A A;  1HFE L;  1T9U A;  3RGI A;  5GAD I;  1HNZ F;  3IAS 9;  3MR7 A;  3Q83 A;  1D9F A;  2ZJQ Q;  1U1Q A;  3RB6 A;  2MDA A;  4DEZ A;  2JZ5 A;  2HIY A;  1VBZ A;  4EGL A;  1EET A;  5A0Y B;  1JXV A;  3AJ1 A;  3BPD A;  4LF9 J;  1F1B B;  4B9T A;  1YRX A;  5IWA F;  3GJS B;  2C3M A;  2VA2 A;  3W62 A;  3SDE A;  4JI0 F;  1AFJ A;  2QIF A;  2QEX S;  4DDF A;  1KC8 T;  1S48 A;  2FUG 9;  1VHF A;  2JZ8 A;  3G96 A;  2P6T A;  3SIP B;  3TI0 A;  4TYB A;  1ELO A;  3QGI A;  1VC0 A;  2V2Z A;  4JI3 J;  1OYE A;  4KR0 B;  3AOD A;  1QDU B;  3DNC A;  2PII A;  1VQY A;  3OFE A;  2AGP A;  2B7C B;  4W92 B;  3ZTO A;  1FKP A;  4WKR A;  3NL0 A;  2QL7 B;  3X3U A;  4FPI A;  4LFA F;  3ET6 A;  2EBE A;  1F2H A;  2FLN A;  2ZE2 B;  3RAX A;  1URR A;  2G1D A;  4NPO A;  3CJ3 A;  2CPI A;  4ZPV R;  1K9M T;  4KTQ A;  1TUW A;  1F3V A;  2XBP A;  3GWC A;  1RT3 A;  1C1C B;  4KAI A;  3KG1 A;  1I51 B;  2U1A A;  3MPW A;  4CO3 A;  1E6Y A;  2XMT A;  3KJV B;  1KOO A;  5ETQ A;  3CPW R;  5JVG Q;  1RKI A;  1WSR A;  1SIZ A;  2ADB A;  3KLE B;  2A10 A;  1TVR A;  1RK8 A;  2IHR 1;  2DNH A;  3D67 A;  2VG6 B;  3I38 A;  1RAJ A;  4A8M P;  4K4U A;  2BJE A;  2ALY B;  3AOC A;  3SSR A;  3KK2 B;  1T3N A;  1KBR A;  1PAE X;  5HRO B;  3VAM A;  3AD9 C;  4UY8 T;  2OFH X;  4FDF A;  4USW A;  5MAO A;  4B3S J;  2MQO A;  4MJK A;  1VRU B;  2F4V F;  3I5B A;  2MKH A;  2RH3 A;  2ACY A;  1CJV B;  4Q5V A;  1FRJ A;  3FCH A;  3GII A;  2BVZ A;  1FRI A;  1BQN A;  1N52 B;  2LLZ A;  5H9F K;  5B0C A;  3MMA B;  5ETO A;  4DV5 J;  2LDI A;  1S0V A;  5DG9 A;  1RTJ A;  3K8V A;  3LGN A;  4O3O A;  4YHH J;  1V9O A;  1KTQ A;  2E66 A;  1FKA F;  5G4D A;  3A3O B;  5J1E B;  1KWM A;  1G1X A;  4DU7 A;  2NS1 B;  4WK1 A;  1SH2 A;  3CJK B;  2WVC A;  2HGM A;  1KQG B;  3VGU A;  1U48 A;  1AUS L;  2ZH5 A;  2CPZ A;  1RWW B;  4NXN J;  2FPH X;  5L46 A;  4I6W A;  4NOH A;  2AX1 A;  1AB8 A;  3AJ2 A;  3LGH A;  2C3U A;  4IG3 B;  4H4M B;  4PXC A;  3Q8P B;  2LQB A;  3QGH A;  1NJW A;  3JYT A;  4HAC B;  4KT0 C;  1OWX A;  3CC4 S;  1DTQ A;  1RWV B;  3DN9 A;  2CJK A;  3PEH A;  3MXH P;  2AP6 A;  2L9W A;  4I4B A;  4K2X A;  1LFW A;  1SC1 B;  2BAB A;  1NU4 A;  4LF2 A;  1VIS A;  3BBB A;  2G0I A;  2FY1 A;  2FZK B;  1N5T A;  4OZ1 A;  2Y1L B;  2CNK B;  4AND A;  4ED5 A;  1N34 F;  3TR5 A;  2ZKU A;  3BO4 A;  1OJ4 A;  2P8I A;  4JOU A;  3VAF A;  2KHD A;  4ZVT B;  3R7N B;  1W25 A;  1MN7 A;  2IA0 A;  3MAA A;  3LWL A;  3MM7 A;  4EO6 A;  3PDN A;  3PY8 A;  2E7V A;  1LV5 A;  3DDK A;  3E2E A;  2HGL A;  3RYL A;  4LSL B;  4PYA A;  1S99 A;  2UXB J;  1R0A B;  2JEG A;  2DGQ A;  3S01 A;  3AD8 C;  4O3P A;  2HW3 A;  3DM2 A;  3ULH A;  1CUL A;  2BYC A;  3HDS A;  3SFU A;  4QPT A;  4MKB A;  1U45 A;  1UWB B;  4CRJ A;  3DRR A;  1T3O A;  2IPO B;  3MM6 A;  1TK8 A;  2NUH A;  1VQN S;  3HHE A;  3ONQ A;  1CJT B;  4DQP A;  4RBU A;  4DR7 J;  2F9D A;  4I64 A;  1WTF A;  1PJ7 A;  3JSR A;  4CLS A;  4C8L A;  3DFE A;  3WIU A;  3DGV A;  2OMO A;  2E7W A;  1RYR A;  2XUL A;  4TU8 A;  1PSD A;  2XM3 A;  3OFF A;  1U1L A;  2D3O 1;  3TX8 A;  4DV7 J;  2R8I A;  2HND A;  2ZNZ A;  3G82 B;  1LWF A;  4GO7 X;  2Q3P A;  1NSQ A;  2OIH A;  2PO4 A;  3DLE A;  4EMD A;  3BQ1 A;  1UCN A;  4WE1 B;  1HPZ A;  4WIQ A;  4WFX A;  3PX4 A;  4H54 A;  4OZJ A;  1XMO J;  2PEB A;  2RHS B;  2C3Y A;  1UFK A;  2WK4 A;  3P96 A;  1LW0 A;  2PMW A;  2W01 A;  4LQ9 A;  4JI1 F;  2UUT A;  2ZH6 A;  2AWZ A;  5B09 A;  4HVZ A;  1B70 B;  1GH8 A;  5KOX A;  3J7Z 5;  3R5A A;  5CCM A;  1UEV A;  2Q66 A;  4XTT A;  4NLT A;  4J9V A;  3BQ0 A;  3TRG A;  5LJ5 Y;  1B0T A;  5E0O A;  4DCO B;  2LQ8 A;  4KKO B;  2MKK A;  1NKB A;  2K06 A;  2C42 A;  4H4K A;  3T1Y J;  5GAG U;  4NLO A;  3PR4 A;  5EWF A;  1D09 B;  1SJ1 A;  3KUH A;  4EYH B;  4DF8 A;  4RW7 B;  3R2C J;  1MU2 A;  1U49 A;  1X5T A;  2J7W A;  1VQM S;  4KO0 B;  2ASJ A;  2UXC J;  1HKA A;  3W64 A;  4JI5 J;  1X9M A;  5FDL A;  4YOE A;  2PSZ A;  1DTT B;  3CCM S;  1UVJ A;  1WC5 A;  1J27 A;  1MRO A;  1ITP A;  3JXO A;  4C6A A;  3H8Y A;  3KWM A;  2G9O A;  1HBM A;  4U9R A;  1XAO A;  3NKY A;  4RBT A;  1G4C A;  2IJF A;  4EBC A;  2B0G A;  4LF8 J;  1P1T A;  4WYL A;  2BBE A;  1H2T Z;  2H4Y B;  4DMZ A;  1YWX A;  2PMH A;  3M2R B;  3MCS A;  5I42 B;  3J80 U;  4WK3 A;  4JYA J;  4ER8 A;  3BGU A;  1RHR B;  4C8O A;  3SYZ A;  3MR6 A;  2VL1 A;  4HKQ A;  1N4L A;  3UD5 A;  3K58 A;  1KTV A;  2PD1 A;  1CBK A;  1Q79 A;  4M5D A;  1RT7 A;  1GX6 A;  4MT1 A;  2HNZ A;  2J7U A;  1C0T A;  2GIQ A;  2YNI A;  2UV8 G;  3HPO A;  2MZT A;  1ZZF A;  3Q2S C;  1FFS B;  2XMU A;  4Q2M A;  3AY0 A;  3S7R A;  3POT A;  3J7Z T;  4H4O B;  1RCO B;  1U0H B;  1HR0 J;  1OYD A;  4LRA A;  3EGW B;  1FNM A;  2GQ2 A;  3O2I A;  1RIS A;  3LP2 B;  2HQI A;  2F63 A;  4KB7 A;  3W60 A;  1FJG J;  4AE5 A;  1HL6 A;  4P10 A;  1HI0 P;  3QRP A;  4FS2 A;  1LK5 A;  4R0J A;  5C2G A;  1NJZ A;  2FZC B;  3JAM U;  2KL8 A;  4FBT A;  4WII A;  4OX8 A;  4URS A;  3EVM A;  2FGO A;  3OXL A;  4OIX A;  4JI7 F;  3D6H B;  1RHQ B;  1VRT B;  4UOC A;  4DPX A;  1D3W A;  1HNI A;  1TUV A;  1U1R A;  2OPS A;  4C2M A;  4PAB A;  2KTQ A;  3A12 A;  1VK3 A;  1PC4 A;  4RKU C;  5H9E K;  3OQ2 A;  4NYZ A;  2MQP A;  2R7V A;  3AT1 B;  4LRD A;  1OSC A;  2W2N P;  2V8G A;  3R9L A;  4J9K A;  5DDP C;  4OQJ A;  3M1V B;  1HQU A;  4RUC A;  3GP9 A;  4OMF G;  3C6U B;  3TUP A;  4P74 A;  3OFH A;  4RWX A;  3NGK A;  3NS6 A;  4DI6 A;  2L41 A;  1HNW F;  3IM9 A;  2VQE F;  1J2V A;  3DLB A;  1PJ5 A;  1LNQ A;  4ZN1 A;  2HRU A;  2NXJ A;  3QJP A;  4KHM A;  4L75 A;  4P7V A;  1UJ4 A;  3FZ2 A;  4TY9 A;  1KLM B;  1TQL A;  5C42 B;  4WP3 A;  2CQ0 A;  3VQS A;  4HH0 A;  4QOT A;  4DSI A;  3O8W A;  4UZB A;  3HMJ G;  5C2C A;  4FYV B;  5HN0 A;  3BPS P;  1U1K A;  1T03 B;  3OVB A;  2HMI A;  2YNF A;  2RU9 A;  4RNF A;  5IXU A;  2XLI A;  3OR2 A;  3UVJ A;  2MYF A;  3KLI A;  4KIA A;  1OSD A;  1M5O C;  3BO3 A;  4BHQ A;  3OVS A;  2QLB B;  5KFF A;  2R7U A;  2E1M C;  4J9N A;  3U27 A;  1FJ7 A;  5HP1 B;  2Y8W A;  4E8U A;  4CO2 A;  3PW4 A;  4MTP A;  1HD1 A;  4ZIT A;  1VQ7 S;  4Q8F A;  3QT7 A;  4B3R F;  1EHW A;  2KYZ A;  2DBB A;  2GCF A;  2BX6 A;  4DQS A;  1ZBT A;  1SJF A;  3HHK A;  2JWN A;  3QGG A;  1OMS A;  3KK3 B;  3CD5 A;  5LSL A;  4NRT A;  2DIS A;  4JI4 F;  4PXB A;  4LSN B;  3T5L A;  4J90 A;  1VQP S;  3R6G B;  4RNO A;  2NXN A;  4DUT A;  2ZH4 A;  3KNG A;  4KC5 A;  1U1O A;  5KFU A;  2J6T A;  2LQJ A;  1KLN A;  1NZ8 A;  1TZ0 A;  2K1R B;  2EVZ A;  4DN0 A;  1B4S A;  4F02 A;  1XN9 A;  1CG2 A;  1FES A;  3Q8U A;  4OHX A;  1Q16 B;  2K7J A;  3KJF B;  5L1I A;  4Q2L A;  3UWT A;  3OTE A;  2H65 B;  1RAA B;  1MSW D;  2IM2 A;  1HI8 A;  2VPY B;  2Y1I A;  3QT5 A;  1WF0 A;  3LP0 A;  1TMM A;  2RRA A;  1DFD A;  5F0W A;  1JWW A;  3QRR A;  2YKN A;  1V5V A;  4Q44 A;  3OTB A;  2HQD A;  1KEK A;  3QSI A;  4DHV A;  3BSC A;  5L8R C;  3SQG A;  4KHP J;  4DV3 J;  4YY3 J;  2ZWO A;  1SJ3 P;  2E5H A;  3I0S A;  3EGZ A;  5D6G A;  4N77 A;  1NJX A;  1SXL A;  2CQ3 A;  3BKU A;  3HHD A;  2LU1 A;  1S9E A;  3RRK A;  1BWE A;  1RAF B;  4F3O A;  5HVH A;  3DXS X;  3DOK A;  2ROG A;  4KGV B;  2HWI A;  3DLH A;  4DFJ A;  1ZH5 A;  1HQ2 A;  1PCA A;  4LF5 F;  1SC6 A;  1JIH A;  2QA2 A;  5D0G A;  2CJX B;  3UN3 A;  2QMU B;  5ETS A;  4X4N A;  5GAD U;  2JVO A;  1SIW B;  1WHW A;  2LXI A;  1HNV A;  3VAI A;  4C97 A;  1ZAX A;  5A6P A;  4ZDN A;  1TTH B;  4M5N A;  2XZW A;  1RT2 B;  3M8Y A;  1RT6 A;  4C98 A;  3TVY A;  2BQR A;  3MUR P;  3I87 A;  3HHL C;  4DPW A;  1U02 A;  2FJA B;  4XPC A;  2EFQ A;  3KLH B;  4ZCL A;  2NLW A;  4E0D A;  1I5O B;  2IBK A;  3UDE A;  2CXE A;  4K50 A;  2L9D A;  5KFH A;  4LF7 F;  3GB0 A;  2ZH3 A;  3U1N A;  2H3E B;  2UUW A;  3PX6 A;  4EU0 A;  2MQM A;  1FKO A;  2ZJP Q;  1I6J A;  3EJM A;  3RAM A;  5EUH A;  5HJX A;  4OI3 A;  4DFM A;  1SC4 B;  3EDQ B;  3KHH A;  1N88 A;  4JI2 F;  1MML A;  2VKR A;  3I82 A;  1J5O A;  2C2R A;  2R2U A;  2XYP B;  2L48 A;  4AL7 A;  4JV5 F;  2YWE A;  4LUB A;  7FDR A;  1O5J A;  3UN2 A;  3MTJ A;  1NUE A;  1VRQ C;  3FFI A;  2ZEJ A;  2AEF A;  3D2W A;  5C25 A;  2M0G B;  3CCV S;  3HSG A;  1FDB A;  3HJV A;  4OI4 A;  2XS2 A;  2J0S D;  4TXS A;  1UVK A;  3GCW P;  2COL A;  3M2V B;  4R5P A;  2H5I B;  3R7B B;  2E5L J;  1C0U A;  2B6A B;  4ENO A;  1LWC B;  3M6W A;  5B0B A;  5C24 B;  2JH3 A;  2VDI A;  2BEF A;  1ZPV A;  1S6P A;  2R2S A;  2VC1 A;  1T9W A;  4QIG A;  4QW8 A;  2XY5 A;  5T41 A;  3FC9 A;  2GJI A;  1BGX T;  4DS5 A;  4X66 J;  3W8G A;  3A1Y G;  4USM A;  2MSS A;  1S79 A;  3DU5 A;  2C3P A;  4KGZ B;  1DBD A;  2VBW A;  5DQH A;  3KK1 B;  4KFB B;  3GFH A;  4CLK A;  2MZJ A;  4XIU A;  1X60 A;  5I4M A;  3A8I A;  1H73 A;  3OUY A;  5EHH A;  4I2P B;  3D66 A;  3W9I A;  2JLG A;  5ETN A;  4OJG A;  4AQY J;  4PWU A;  2Z4P A;  2UUC F;  2YNG A;  4C7Q A;  5AXK A;  4QWD A;  3PEJ A;  3VVT A;  4OX7 A;  5ITH A;  5HJY A;  2GVZ B;  4ICL B;  4A47 A;  1UP1 A;  5KFL A;  2Q43 A;  5KFZ A;  3P45 B;  3MD3 A;  3DKD A;  3HT0 A;  1EKS A;  2MZ1 A;  4USK A;  3CDW A;  4UZC A;  2J76 E;  3VTI A;  2OML A;  2HHP A;  4ZLN A;  5D0H A;  2XO7 A;  4ZPD A;  1BQM B;  2AX0 A;  4ECQ A;  3BYR A;  2MQN A;  1NM2 A;  2VPX B;  1GMW A;  3FRZ A;  3RTV A;  1UVM A;  5M2R A;  2CPH A;  1UA0 A;  2DTJ A;  2ZC3 A;  1CC7 A;  4DSK A;  1LW2 B;  1JLB B;  2ATC B;  4URQ U;  2M8H A;  1W2B R;  4DG1 B;  2UU9 F;  2BV3 A;  1NK5 A;  1G2E A;  2G1H A;  5A76 A;  2OTL S;  3GR0 A;  3KLG B;  1RTH A;  5AJ3 F;  1FK9 A;  1B7Y B;  3OTO J;  4LFC F;  4Y3C A;  4XK8 C;  5LMU F;  2FVS A;  4TN2 A;  2HVH A;  2GS8 A;  4B3T F;  1EET B;  4ZPB A;  4C48 A;  2AJF E;  3UPF A;  1FO1 A;  2BJ1 A;  1RWK B;  3R5B A;  2BJ8 A;  2YWK A;  4CI0 B;  1FWL A;  4OHV A;  2Z2Z A;  5D4P A;  3SDE B;  1HWL A;  3H2V E;  4ECW A;  2GMJ A;  2YTC A;  1PBU A;  3FNN A;  2OEJ A;  1XIQ A;  4OJ1 A;  3EZ5 A;  2HNY A;  2BOP A;  2K8G A;  4ZPA A;  4WFA Q;  1Y00 A;  2I1R A;  2GFF A;  2B4O A;  1VK8 A;  1G6B A;  3Q8S B;  4IYQ A;  2JJ4 D;  1Q8I A;  2VV5 A;  1N0V C;  4YME A;  4WU3 A;  4NCA A;  1U24 A;  2R7O A;  2L9N A;  2AIR B;  1SQG A;  4PUO A;  1FKP B;  3BBF A;  3FQK A;  5DG8 A;  3GIJ A;  2YKA A;  2Z2Y B;  4DR3 F;  3PRB A;  3AXK A;  2HVZ A;  1KDN A;  3ET6 B;  1N48 A;  3W9H A;  3C46 A;  2B51 A;  4RW9 A;  3BGF A;  2YKQ A;  1LXN A;  4WJB A;  2HQC A; 
#chains in the Genus database with same CATH homology
 3AGY A;  3LA0 A;  3L9Z A;  3I38 A;  3AGZ A;  2Q2G A;  4L3K A;  4J80 A;  2HFV A;  3TJ9 A;  3AGX A;  1GMW D;  2QLD A;  3NXZ A;  1EB0 A;  1EAR A;  1GMV A;  1NLT A;  2B26 A;  1GMU A;  3TJA A;  3LZ8 A;  1GMW A;  1XAO A;  1C3G A;  3TJ8 A;  3NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...