3NY0A

Crystal structure of uree from helicobacter pylori (ni2+ bound form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
147
Chain Sequence
IIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
total genus 37
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3ny0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3ny0A02
1GMUA 3I38A 3TJAA 1NLTA 1GMWA 3TJ9A 2QLDA 2B26A 3LZ8A 3TJ8A 1GMVA 1XAOA 3AGZA 1C3GA 3AGYA 1EB0A 4L3KA 1GMWD 3LA0A 2Q2GA 1EARA 3NY0A 3AGXA 3L9ZA 3NXZA 4J80A 2HFVA
chains in the Genus database with same CATH superfamily
2BANA 3MECB 2WW8A 4MYTA 2B3TB 3W1YC 2AEFA 1NSQA 2N3LA 3RZAA 4CP5A 4ZVTB 3AXKA 1W26A 3HVTB 2DGQA 4K59A 2ZJQQ 4LF5F 3AD9C 4N41A 3IGNA 3V81B 3TJ9A 4R5PA 4K4VA 1X4EA 2OFHX 2APOA 4B3RJ 4USJC 1VHFA 3DXBA 3BR8A 2BV3A 2DRAA 3KK3B 1RWKB 1N5TA 3TQEA 3F44A 1EKSA 1WACA 2DNGA 2HWIA 2MQLA 4X4QA 2CWKA 2OD4A 2AYGA 4TU8A 4OYXA 5K9FA 2RB7A 1IM6A 1JWWA 4EEYA 4ZVFA 5KFMA 3KUEA 2IA0A 3IO1A 5EHHA 3GFXA 4WE1A 2CJBA 1HD1A 3UCUP 2ZNYA 3UCGA 1Y5LB 3UWTA 3MXHP 1EQMA 3GIKA 1Y4ZB 1FRJA 2BE2A 2DHGA 4KJIA 4WFXA 2C2NA 2KFNA 4QOTA 3PW7A 2H4YB 3UI3A 3CJ8A 1X4GA 1S0MA 1IKXB 3QWPA 3AQOA 1IQZA 1Q8LA 1RT6B 3EGNA 2B4OA 3G8QA 4DL4A 2L9NA 5C5JA 2NYHA 3V6DB 3C46A 1TKTB 1WHYA 2KHDA 1SC4B 3KLIB 4LSLB 1SIWB 3VCDA 5CCLA 4J9PA 2CQCA 5KFKA 2DJWA 4F8RA 1VISA 3LTOA 3M2VB 2K8GA 3I4PA 3R7NB 4RZRA 3OL8A 5DLGA 2W01A 3B6BA 3DLEA 5KG2A 3HVRA 3FZBA 3QIDA 1ELOA 1F5BA 2Q2GA 2R8HA 1VQNS 4G65A 3Q8VA 2LDYA 3QFHA 1Q81T 1PSDA 1FE4A 3BO2A 1NHUA 2HBQB 4M5JA 2MZTA 5A8RA 3T1YJ 4DU7A 2XNQA 4JI6J 2MGZA 1D3WA 1DARA 4G1PA 4OX9J 3K0JA 4V19X 5EN1A 4RW6A 4UQTA 2C1EB 3IXQA 4DR4F 4FN5A 2B7BB 3ZZUA 5GAEU 4Y2CA 1SB6A 1PBAA 3TA2A 3I96A 1TR0A 3A3OB 4ID5B 3DMJA 1UPPA 1T9WA 4OZ3A 2FJXA 1HNIA 2QSWA 1WC3A 4I0WA 2R42A 3OR1B 3TOQA 5GADU 3FKBA 4O3NA 1HNZF 5B0AA 1RT4A 4H54A 2ZH1A 4U8VA 1JLAA 3G71S 2IBKA 1RLCL 2MLYA 2RQ4A 5ETMA 1PBUA 4WKRA 3EZ5A 5A8WA 5LSOA 1PJ6A 4O23A 4USMA 3HP6A 3CC4S 1GAOA 2FHJA 3ADAC 1VDHA 1RUSA 4C2MA 4XDCA 1CQNA 2OAUA 4ZVGA 1KQKA 4O3PA 4ATNA 1F9HA 1MN9A 1QLNA 1YZ7A 1WF2A 5J2NB 2Q6CA 5IT9Y 5AJ3J 3K89A 2ROPA 1CJVA 1VYAA 1VRUA 1C1BA 2KFYA 1Q7YT 4F4AA 5B0CA 3GQCA 3R5AA 5DM7Q 4ERDA 4EMDA 1DBDA 1OMSA 1HBMA 2Z2LA 3GG0A 3KFWX 4PG4A 2VBYA 4PABA 4CLYA 5E3PA 2ZM6J 1T9XA 3CSKA 3QAEA 4ZIVA 1A7GE 2HQGA 2WCXA 4PYDA 2KZMA 4LF1A 2CQBA 3OTOF 4A8MP 4L3KA 2YNIA 2EWHA 4L3NA 3PG9A 2QL9B 2WVBA 2AHOB 4QR1A 5F8MA 2MQOA 4OZ5A 1P6TA 5SUHA 2ZH9A 1T03A 2B56A 3NY0A 1S1UA 4RO0A 4DN0A 3MAQA 1RYSA 2DR8A 3I0RB 3N5BA 4LREA 5B0BA 2XS5A 4M5DA 4C98A 3MR3A 2HQFA 2UV8A 4PYAA 5HK4A 1MWZA 1VFJA 3B4MA 4ZVEA 4L73A 1NK0A 1WKLA 4I67A 3LF0A 2AJ4A 3EVOA 4RU2A 3QGIA 3DOLB 4OX9F 2MQQA 3GIJA 2ASLA 1RT2A 3P4UB 3TYTA 2WOMA 4K7QA 3JSMB 3IWNC 4X4TA 2V8PA 3QRPA 2RQKA 1CPZA 1ZBTA 1FX4A 1HIYA 1R8BA 4ETXA 3AOBA 2DR9A 2QFIA 4P6QA 2XZTB 3G8TA 2IYGA 2JZ5A 2F8EX 3A4TA 3QT6A 1RHRB 4DPYA 1U0SA 2FVPA 2E7WA 3TVYA 4UZBA 3MM6B 3W64A 3VAFA 1Q4RA 4FS2A 3H98A 3MHYA 3LQVA 2PDAA 4NLTA 4L72B 3SFGA 3G6ES 3NOCA 3SSSA 5CZVA 5ETOA 3HZEA 2VQFF 4M5IA 2WVFA 3GWCA 3VAIA 4MAKA 1RABB 2DGVA 5I3UB 4Y2KA 4BCAA 2NUUG 3HHLD 3KLFB 2J6TA 3Q2TC 4KGMA 1M5HA 4CM0A 1N5YB 2VQEJ 1HWJA 4NXMJ 4FKXA 2BJ9A 1TV6B 3LP0A 4F04B 4F3OA 3NRBA 4FZVA 4CO4A 4ECRA 4Z7CA 4KT0C 2I2YA 1XWLA 3PKMA 4QIGA 1IUJA 5HATA 2ZH6A 5D0RA 2EC2A 2XYHB 4HVZA 4HYKA 4DFJA 2DHXA 4OZ1A 2DKOB 4BLGA 4W92B 2WOMB 3C2PA 4NI2A 1FEHA 1DURA 2PMHA 5EWGA 2NCKL 3PKYA 1IQTA 4J9RA 3PR5B 5D4LA 2BACA 3DLJA 3D7SB 3CDAA 1O8BA 2IYIA 2AYBA 3WDOA 1EQ0A 3MMCA 2HFOA 2MKCA 2CQGA 2LXIA 3B4DA 3CD0A 3FEXB 1M5VC 1JJ4A 1IBKF 3Q8PB 4E0DA 2NZ4A 4WZQA 1RBAA 4NE9C 2VICA 3ONQA 2YWHA 4IG0B 1K1QA 2HHPA 4NX9A 5DM6Q 5DLFA 5HQ8A 1REVB 3I9ZA 1W2IA 1VRTA 3UCZP 2J0WA 1YK9A 1FEEA 2RDDA 4OYIA 4X4UA 5DRKA 2JEJA 1SH3A 1LWCB 2BKOA 1LFPA 1YQHA 3PHEA 4J37A 5KG7A 3EXCX 3PV8A 3TANA 2Q66A 2YX4A 1J5OA 4YP3A 5KFNA 1UJ5A 3AA9A 4CYUA 4IR1A 3QO9A 5HQLA 5K8OA 1U1LA 1TL3A 3MM5A 3TARA 2H5IB 3DLBA 1IJFB 2DNLA 2GMJA 4EI2A 1TFWA 2OPPA 3NAHA 4Z7YA 2CJAA 3TZWA 1WTBA 1DLOA 1SJQA 4LR7A 3O3LA 3DLKA 2HGMA 3PFEA 4LF7J 1ZH5A 1T3OA 4PUOB 1UVJA 1SI9A 3IR5B 3D1OA 1RHUB 1F1BB 3PRDA 2ZH8A 2I38A 2NR0A 4OFZA 4KR0B 4OJHA 3MUVP 4DX5A 4WE1B 4N56A 4ZK7M 2W4PA 2KM8C 3I56S 4PQUA 1CJKB 1RDRA 5KT5A 3DGPB 3BR9A 1LK7A 1REGX 2LQJA 2QMXA 2IC3A 5B08A 1R8CA 3QT7A 2XLIA 3V4IA 5HVGA 1A9NB 2VQEF 4RW9B 3HFKA 2GO9A 3IP0A 1NXIA 1UVLA 2CJXB 1HQEB 3DLGA 4U96A 2QA2A 3BF4A 1Y9OA 3BSOA 1NK6A 2DTJA 2BQ3A 1NB7A 4DQIA 2HHWA 1DHMA 1HBOB 2RMLA 3IWXA 3IWLA 3M30A 4M5NA 4ZP8A 3HPOA 4MK7A 4UY85 2JLFA 1UJ4A 5CYMA 1JLQB 4DUYJ 1KLNA 1RCXB 3GFYA 5DGBA 2CZ4A 1Z4UA 4EO8A 5ETSA 2O66A 4HTIA 5K8NA 1KQGB 1HARA 1DLOB 1S1VA 3DGVA 4ZPCA 1RHMB 2ZVSA 4LBHA 3VZHA 4DV7F 3HJVA 1X5SA 3RJMB 1L3VA 1FRXA 1RU2A 1S99A 1FF2A 5AXKA 2ASJA 4ICLA 2GIRA 2M2BA 5KT6A 3PXGa 1BQMB 1SUQB 2AF6A 2GO8A 1VOMA 4PXEA 1Q8BA 2XMAA 4URSA 3F73A 1FT8A 2UVUA 2UVWA 1J5EF 4MIBA 1GMVA 4PXCA 1TL5A 3OBIA 3OPKA 4QW9A 3ZTQA 4P2FA 3OJUA 4CM2A 2JSXA 3AGZA 2FHJD 1B70B 2FHOB 2QRRA 4DSJA 1FRMA 2V8VA 1H7WA 4E2FB 2OUGA 2Y8WA 1DJ0A 2KT2A 4RU9A 2HHXA 1HBUA 1NB2A 4DSLA 1YZ6A 4IOCQ 2JFKA 3MMAB 3D0HE 4KQZA 2G2YA 2X3GA 2BQUA 2R8KA 3ENQA 2E5IA 3W2WB 5I3QA 4QCLA 3O1LA 4DSEA 3SQGA 3MR5A 2CJ9A 4TYAA 3NXZA 2A10A 2BW2A 2MEWA 1UMJA 3GB0A 2EKYA 2F8HA 5A8WB 1Q82T 1OIAA 3QAUA 4X84A 1M5PC 3UNGC 3W62A 1IJEB 4KSEB 2CQDA 3P6YC 4RW8A 1Y3JA 4DV4J 1RWOB 4LVNP 4ENOA 4L74A 2YX7A 3TUJC 3CPWR 4OHVA 2DVIA 4LF6F 4LFBJ 1HLWA 3I0SA 4ZITA 2QO3A 4RW7A 4O3SA 4KFBA 1IBMF 3OVSA 5FLXU 5ETLA 4R5PB 3ZZZA 4LJMA 4TQSA 5KFJA 2F1FA 2GHWA 2E1RA 2ZBIA 5T14A 2JDJA 2QG9B 2G1DA 2VASA 4KGKA 2VA3A 1I3OB 4I2PA 2R7XA 2MKJA 4QWCA 3CB4A 4NZ7A 2IRXA 2WBMA 2D3ZA 2YQ3A 3POTA 4DV1F 3PNIA 3TRGA 4A8WA 1H3DA 1LQ9A 5CH7B 4GRSA 1G1XA 3KLEB 2Y8YA 1Y5NB 3J7A1 3DHXA 3D3BJ 1T8EA 1WI8A 2Y1LB 5KFPA 2V34A 1HNZJ 1QAIA 3W63A 2HQIA 4TY8B 3VF0B 2ZZTA 4IG3B 1LWXA 3S01A 3L4BC 4ILMA 1ZM2A 3UVJB 2WONA 2ZH3A 1NK9A 4P7VA 4D3HA 1XQIA 2QV6A 2Z57B 3MEDA 3ET6A 1U25A 4DQPA 4O0IA 1D9AA 2CVIA 2E29A 2QL5B 5LXRA 4C97A 2IRYA 5J2MB 3V6DA 3R5JB 4JI2J 4DS4A 2W2MP 5CZXA 4LMZA 1HQUA 3CCUS 1HYSA 1WEZA 2BRLA 2HVIA 4DR5F 3KLGA 1M5OC 1UPMB 2UXCJ 2NXCA 4QIVA 4YFUA 3BSNA 3MM7A 3SSRA 2B6AA 4EWTA 1GNKA 2FIUA 4IFVB 4B3MF 1Y5IB 3ITHA 4ECSA 5KT7A 2GX8A 2YNFB 5KFQA 5I3PA 3W9IA 2FD2A 5GAHU 4M95A 3MPVA 4K4ZA 2GJIA 2E66A 2B9XA 4QR0A 3B82A 4KHPF 4JV1A 4HH0A 3O44A 4A8XA 1T94A 3HX9A 2VG7B 1U6BA 2HBYB 3PYFA 1N0UA 4CTAB 4NA2A 1TUGB 2G9OA 2YQ0A 2A2CA 4OYOA 5B0DA 4KY3A 1IKYB 2VDIA 3EE3A 3IRXB 4LSZB 5C24B 4WIIA 4RUCA 1SQGA 2KYZA 3EPGA 3BO3A 2P9EA 4N7TA 3PJ9A 1V5VA 3OR2A 4MTPA 4LR9A 2VFUA 5LT5A 2P9GA 4K4WA 1H2UX 2FLOA 3NGKA 1HNWJ 2UXBJ 1XN9A 5DETA 3MD3A 3MMCB 3QSIA 3GCXP 1CJUA 4O44A 5CYMB 4F0KA 3I5CA 5K20B 3KLGB 5KG0A 3Q83A 3EPIA 2NLWA 4DPXA 2O01C 4R0EA 2BQRA 1BC6A 4IG0A 3NBPA 4RWXA 1E6VA 2NUHA 1NO8A 4HEA9 4XO0A 5J2NA 2FVCA 2DNHA 3U1NA 2CQPA 2AIRB 2IDLA 3PRVA 2RH3A 4DV0J 2F63A 1GXUA 4WU2A 4LR8A 2J8SA 2HBRB 3CCZA 2KVQE 3E01A 3CCRS 2C3YA 4RUHA 5IWAJ 1KVJA 1DY3A 4BS2A 4FVCA 4JV0A 4GC6A 5C24A 3AGXA 2RRBA 3ILIA 1HL6A 2R2SA 2B0GA 2K06A 1J27A 2UUAJ 4RX6A 3IA0A 4PWUA 1TAQA 4KO0A 1CLFA 3AXMA 3IG1A 1JXVA 3FCHA 4MKAA 1GXLA 2MZ1A 1SJ3P 1SC1B 1RISA 3CJ2A 4DCPB 3CXCR 2KKHA 5AE1A 3DRXA 3HT0A 2OD6A 5KG1A 4HTJA 3M7VA 2CQ1A 2CPIA 1Q53A 3AH6A 3PW0A 1UL3A 2UUTA 2YXLA 3D3CJ 2CA9A 3UDLA 4YB7A 3VR1A 2W25A 2VD3A 4NASA 2XULA 3T19A 2DXEA 1UWBA 1EB0A 2WB1D 4DR3F 1UFLA 2EEYA 4GVBB 2ZC4A 5LXYA 4UUXA 1ZM9A 4OLOA 6AT1B 1IR2A 4FDFA 4R8UB 1VBZA 2GVDB 3CO9A 4C7QA 3PW4A 3DRPB 1GT8A 4NLVA 3IMQJ 4Q43A 3PIOQ 3Q89A 4RUBA 5D6GA 2W9CA 1LW0B 3GIRA 2J9DA 1XIQA 4JYAJ 5FIIA 2NSBA 2DT9A 1WSRA 1JJHA 1JJCB 1MNEA 2ZD1A 1KBRA 4ZLLA 4E8UA 1SV5A 1JLEA 4Q44A 5K8PA 2CPFA 1FKPA 1TKZA 1IR1A 2MZJA 4NEYA 4DSKA 4DR7J 4NYPA 3V81A 3VGTA 3DKDA 2EFQA 4KHMA 1XNQJ 2IDEA 3QZ7A 1XMQJ 3LP0B 4CH0S 4C0BA 4ID5A 3VAGA 4NXMF 3EDRB 2YKPA 3D5MA 3QT5A 4KGZB 2HRYA 1BWVA 1VS3A 2XO6A 2YVSA 3F41A 1MU2A 3GE9A 1PYTA 2MJUA 3NKYA 2GJ2A 2AD9A 2NREA 2XG8A 5LJ5Y 1FDNA 2MKHA 1Q1KA 2VC1A 3P5TL 4I7FB 1XK8A 2EI5A 5D0EA 4Z37A 4GKKJ 5FJ4A 1NPKA 1VQ9S 4KHRA 2YPYA 4O4GA 1WG4A 2AX0A 3NCPA 1X5PA 2ZC3A 3NG8A 2ASDA 1RWWB 3SZ2A 4KKOA 2ALZA 4QJVA 3C6TA 5MAOA 4H4KA 5AXNA 5HROA 4YS2A 1X4CA 2CAJA 2G2ZA 1VLOA 4V1Ak 5FLXY 3RW6A 3CJ4A 4BWJA 1PJ5A 3SV3A 2V8GA 2ZZMA 4NLDA 1S4FA 3EDQB 3T5JA 2O3DA 4B9TA 1U1KA 1OS5A 3O8WA 4ER8A 1DTQB 2RE1A 4OI3A 4UOFA 2FJVA 2COLA 2AEJA 2FJDB 3HT3A 2ZH5A 1M90T 1B4SA 1NDCA 3FFIA 3O5TB 5L9XA 3KHHA 3NWGA 5I4MA 5DG8A 3NMAA 2V68A 1UETA 1SQEA 2ZE2B 3FBBA 3PEJA 1ZA2B 4RBUA 4CLUA 1KNZA 2R7VA 2IVYA 2L3MA 4CO2A 1CVJA 2J7KA 2QIFA 2XMUA 4FXWA 4PEOA 1ZPWX 3ZZTA 2X1AA 3RTVA 3KLIA 5HJXA 3CULA 1CJKA 4X4PA 2KRRA 4TY8A 1UJ6A 2V69A 1H2VZ 1FRKA 1TU0B 1BQNA 3D6TB 2ODXA 2B7CB 1H74A 1RAGB 2LA4A 4O4GB 2W2NP 3DOLA 2VJUA 3KK2B 4J9KA 2OHDA 4OIXA 4ED7A 3R1HA 2AGOA 1L3UA 3CIZA 2B5JB 2UXDF 3WBZA 4I2QA 5KG3A 1BXNA 3H5UA 3H59A 4N8OA 3PX4A 1FRIA 1HQEA 3ISND 5HANA 2QLXA 3HDSA 2BE7D 3M30B 3J81Y 5K5MA 3MM6A 2FVSA 2M3DA 1Z2LA 2AMCB 4DR2J 3NNHA 1KOHA 2F4FA 2K1RA 5HLFA 2HVEA 5HP1A 5J2QB 4ZA1A 1FTCA 9ATCB 4NRTA 2IJNA 4J9SA 7FD1A 4UQGA 3IG1B 2BRKA 1UEUA 2W7AA 2E7XA 2M0GB 1SQFA 3CMAS 1T9UA 2FHMA 3QMQA 3RU0A 2BVZA 4KV8A 1ZTTA 1O0PA 3GFZA 2BJDA 5KFHA 3V6JA 2CJKA 4B3TF 2WVDA 1RCOB 4YB6A 1AT1B 1MROB 2DGOA 3MOJB 3HSJA 3VTIA 4BWMA 4DG1A 3JYTA 1NJZA 3N01A 1EJ7L 4DMZA 2KI2A 3FSXA 3B78A 1T02A 2CJYB 2HMIA 3NWRA 3HVTA 1T03B 4O3RA 2OTJS 3CJTA 3E3XA 3EUNA 4CI0B 4FNIA 4ZN3A 4RJVA 2OGUA 1IKVA 4HHJA 1TKXA 1VI7A 1EP4A 3MEKA 4QYRA 5CHCB 3S7RA 5KG4A 5HSPA 4B9SA 4N76A 1HQ2A 2XNRA 3UDEA 1U6FA 2I0XA 1SL2A 2O5DA 4OZJA 4J9UE 3HHEA 1U2RA 1VRTB 3I87A 5J2QA 3BYRA 1ZYQA 1ZM4A 2VB6A 3R5CA 3TA1A 3BPDA 2DB1A 2XS7A 2DY1A 3ISNC 5T7LB 5KFYA 1DQ8A 3KJFB 5GMKa 4LF8F 8RUCA 4ZPDA 3CMQA 4Y00A 4A8KA 2VOOA 4U7CA 4DV2J 3NP5A 3THTA 1G7CB 1YBAA 1X31C 2PN6A 4M5GA 2E1AA 5AT1B 2G13A 4JP8A 3TX0A 3JSBA 2ZHBA 2ADCA 4J80A 4IDKA 2FUG9 2V4QA 4K4TA 4LSNA 1WHWA 4JI0F 3GSIA 1KQFB 2FJWA 1RYRA 2XM3A 1SC6A 3OXLA 1FFGB 2QJ3A 3RUBL 2OPQB 2FHKA 1QE1B 1XR7A 5KFBA 3CMES 3KLFA 2VPZB 1KTQA 3GV5B 2ZHAA 1BE4A 4LQ3A 4OZ0A 3GCWP 4NZ6A 1N5SA 2AV5A 3DU5A 4S0MA 3O6QA 1MMNA 5A0YB 1AXQA 3ZFVA 3CNQP 2HPUA 5JXSA 3DMJB 5L1JA 2VA2A 1G4CA 2I1RA 2E1PA 4NLOA 2VPWB 4I6AA 3GILA 1N36F 3OR1A 2R8GA 1NCLA 3ENAA 1JLCB 1U8SA 4IUFA 2F9JA 3HVAA 1X8DA 3A13A 1MN7A 2VJVA 2FGCA 1DAXA 2V4JA 3KG4A 4DR1J 5L1LA 3OV7A 2CXEA 2WSFC 1HBOA 4N77A 1U1RA 4HT7A 1T95A 2N7CA 3QPIA 4CO3A 3VV2B 5IXUA 2XLKA 2DNRA 3EMTA 4F3MA 2MHEA 3EZOA 2Z58B 3QYYA 4K5RA 1KEKA 2P8IA 2YY3A 3DRYA 5D4NA 4B9LA 2K2PA 4IDKB 5DDRC 3LGNA 4F4YA 1H7XA 2HNDA 1RT4B 4UF4A 3TP2A 3DN9A 5DZ6A 2ZJPQ 4I6WA 1B7YB 4CDIA 3E2EA 1FI4A 3H40A 3K8VA 3OFEA 7FDRA 2W7OA 3D28A 1DRZA 3OVBA 3SDEA 2OEKA 4N47A 4K0KF 2KJWA 2A18A 3PVXA 4NYOA 5CAAA 4EZ9A 5A0YA 3D4JA 4WK1A 4P2MA 1Y10A 2YNGA 3PYEA 3V6KA 4CLPA 2M5YA 3US5A 4X2BA 2LEBA 2E9ZA 3IBWA 4X66J 1TZ0A 2MZRA 5DS7A 5JMNA 1FD2A 2C3OA 1QJHA 3MTJA 1C1BB 3FC9A 3IAM9 5D3GB 4RBVA 2G1HA 4AL7A 1RU1A 3BYPA 2H54B 4JI0J 1RT1A 4RPFA 2UVRA 4WU3A 4LBPA 4RNHA 3FMWA 4NWBA 1UVNA 2PSZA 1FCAA 3D0IE 4OZNA 1VC6A 3ZZRA 2I5JA 5FDLB 3MI7X 1LXJA 1S1TA 3LWMA 1UVKA 2BUNA 1GTHA 2ACMA 3OQ2A 4ZHRA 5F8LA 3OD2A 3KJVB 2DHHA 2WSCC 1N54B 2KXNB 1AUSL 3P49B 3EM1A 3UN5A 3C3LA 2OKQA 2B8PA 1YJUA 2K3IA 5KFEA 3UD4P 5KFZA 2RT3A 1D1UA 4DR4J 4B9MA 4J9OA 4ECYA 2AWZA 2NXEA 2CUYA 2DBBA 2ZEJA 2JRSA 3T6BA 4CH1A 1VQMS 1NRKA 1O6XA 1X5OA 2GIFA 2JH3A 4RLEA 3WHIA 4KAIA 3KYLA 2UVVA 2W24A 2JEGA 4DV6F 3GP9A 4IR9A 3UW1A 2ZOFA 2C2MB 3CJRA 4XDDA 1H0HB 3G82B 3OXFA 3TEGA 2FPHX 2UZAA 1R27B 2CNNB 4A8SA 3H20A 5E41A 4ZS6A 1Y7PA 5DDOC 5B7WA 3H4BA 2V9WA 1VR6A 3OW2R 1UZDA 4USWA 4KO0B 1C1CA 2LYVA 1I1GA 1RWUA 1AZSB 2GJFA 1BMQB 3AAWB 3GJTB 4IG3A 4OV6A 2CQHA 2E5GA 3SCLE 3ULHA 4WTOB 4X65J 1LNQA 3KK1B 3K5LA 3DI6A 4K4SA 2CG4A 4MIWA 1HMVB 2CPYA 2FY1A 1S1TB 2IAJB 5HAOA 3JTNA 4CRJA 9RUBA 4DSIA 3ET6B 2G0IA 4FVMA 2Q43A 3MECA 5KFIA 2Q79A 5T7LA 3A8EA 2A6OA 4DOZA 4CIOA 3MMAA 1HI8A 3L9ZA 4QR2A 1R0AA 4GKJJ 1BWEA 2AU0A 3PX6A 2ZBCA 3ILJA 3NEKA 2F40A 3OFFA 4U9RA 4M5KA 2F3JA 4P9SA 2R8JA 1N33F 1WI6A 2N3OA 2D7SA 3DLLQ 3M1VA 2IM2A 1HBNA 1NLKL 2RUGA 3TA0A 4JV5F 1RE1B 1TQLA 3MCNA 2VQFJ 1WJ9A 3IM8A 2B26A 3LGMA 2GC8A 2HHTA 1S9FA 5JVGQ 3SYZA 3FDSA 3M4XA 1U2FA 5F41A 2BKNA 4HI1A 1FFWB 3FQKA 2CNLB 3JXOA 3LWLA 1KTVA 1F3VA 4ANCA 3WC2A 2HZCA 2NS1B 4EO6A 4IRKA 3R27A 2J8AA 3CJ3A 3SCIE 3U1LA 3W66A 5JUMA 1S6UA 2DCLA 5E7OB 3W60A 2ZKTA 2D1CA 1NHVA 1TVRA 2RS8A 4X64F 1QAJA 2FZCB 2WBRA 2D74B 2IJFA 3H2VE 1RA6A 4ELTA 3BH7B 2HNYA 4Q8FA 2LFVA 5B0EA 3M6VA 2ATLA 2E1MC 5CD4H 2AJQA 1TKTA 2K7KA 2CPEA 1CC7A 1IBKJ 1FKAF 2V8HA 4PQUB 4KE5A 1TKXB 2GGPB 1HKAA 2J5AA 3N0VA 1D09B 3LW5C 3M1VB 1MWYA 4M8LA 3T5HA 3DRSA 3V6HA 5IQQA 4ECQA 2KTQA 2MDAA 4I2PB 1Y00A 1GMWD 3ELHA 4PWDA 3DFEA 3PO4A 2LXFA 3L7UA 2B8QA 3K57A 1QY7A 4JI8F 4C0HA 4AQYJ 5J2MA 2R7UA 1BGXT 2B9WA 2AGPA 1TL7A 2DO4A 2KG1A 1N6QA 1M1KT 2W2OP 2HHQA 5LMUF 1BUXA 1UWAA 3GZ7A 4ZVHA 3HHKA 3ICLA 4PG7A 3RBZA 4EFAC 3UVJA 1K1SA 3IBFB 2D9PA 2LCWA 4WP9A 2PC6A 4Y2IA 1HNIB 1VQPS 1XNQF 3F0NA 1NLTA 4OHYA 2XHWA 1FESA 2AKWB 2G2OA 3PACA 1TTHB 1Y11A 2YBVA 4J91A 3NGUA 3DYAB 3LZ8A 1NHKL 5EUHA 3U7JA 2DPIA 1FKOB 1RQ0A 2DXFA 2HHHJ 3IS9B 3D6HB 1LOUA 1C0TB 1H72C 1IWGA 3H2UB 4WJBA 2R7OA 1PKUA 3PR4A 2YH1A 3J80U 4F2RA 3V2UC 1HNVA 4P10A 1G6BA 5IT4A 1OQ6A 4DL7A 3C6EC 3BSCA 3CDWA 3QWUA 4DR6F 3GU0A 4KH0B 4IOAQ 5KG5A 5E2QA 5IV4A 4CO5A 4DS5A 2PA3A 1KD1T 2DR5A 4DXLA 2OSRA 4DLEA 2B5JA 3Q8QB 4WBFA 1XMOJ 3U02A 3CJSA 5DQHA 2MJNA 3JAMU 4Q0BA 4USIA 1MMDA 2ZH4A 3DOKB 1S5ZA 2VH7A 1U7LA 2J7WA 3CDUA 4ALZA 4GKKF 5F9NA 1FTRA 1HBMB 3CJQA 5EX3A 4ELVA 3KK3A 1R3NA 2YKNB 1LW2A 3HI9A 3MCMA 1X7VA 2XY6A 2ABYA 2GFFA 1PG5B 2HHSA 4I4BA 5LSRA 3VALA 1R8PA 3CCQS 1NK8A 1YG0A 3MR6A 2XS2A 1A0OB 1KLMB 2D69A 3G96A 2WB4A 3TO8A 2OLWA 3R1LA 1APSA 1C4AA 1S6OA 2CQIA 4NZ0A 4AUKA 2DD8S 4DDFA 4RWWA 2HFZA 3CW2C 4GKJF 1WDTA 4DBQA 5J2PB 2ZWOA 4KIAA 1SL0A 1C0UA 1LFWA 5EDWA 1VIOA 1NH7A 3DGPA 3MAHA 1I94F 3NCQA 1B0PA 1JIHA 3VQTA 1NZAA 3TAPA 1E6VB 2M7SA 1X9MA 3RRGA 1CBKA 3BV8A 2XLJA 1UKUA 3MOZA 5E3QA 3JSMA 5L9NA 4B02A 2CPHA 3PJWA 2QC3A 3FMBA 2C42A 1WC0A 2YWKA 1V3RA 5EWFA 2C28A 2HMIB 1Q16B 3KHRA 2V9KA 2UUWA 4K5SA 3MTKA 2ZVIA 1XR5A 2M88A 3BH6B 5KFDA 1Y3KA 5GVQA 3VGVA 3JAMY 2PI5A 2YQ1A 3DOMA 1VJWA 3G87A 3KNAA 1QVGR 5EWEA 4DUZF 3OVAA 2XTJP 3Q0AA 4BDPA 3MZIA 5F0UA 2QYGA 4B08A 2F4VJ 2HHUA 4U95A 2FVRA 1L3SA 4PR6A 4LF6J 4LFBF 2WAQD 3BREA 3MEEB 4YR2A 2FTRA 2KM8B 2JVMA 3KLEA 2ZM6F 2L41A 2NXUA 3QT8A 5F8JA 3ILOA 4I64A 3RBDA 3J80Y 1JLGB 2JWNA 1TV6A 2FQQB 4ZJLA 3TVKA 2VUGA 3ZZOA 5BJRA 2CYYA 3QIPB 3QJPA 1DTQA 3WIUA 2RVJA 5A8KA 2KHCA 1S57A 3AD7C 3IFEA 3M6XA 2XMTA 4USTA 1SC3B 5A76A 3HFZB 1NKEA 1CG2A 2PGCA 3ENVA 4ZCMA 4WFYA 4QW8A 3R5DA 3G6VA 1CJTA 3N4WA 2EFOA 2IM1A 1F5CA 4R0JA 5HO4A 1AUDA 2UUAF 1JLFA 3M05A 3VQSA 5M2RA 1KKHA 2GHPA 2HWTA 5D77A 3GIMA 1T05B 2E5JA 5B09A 1TUVA 5ETTA 4CNYA 4DCJB 2JJ4D 6FDRA 2B4VA 2AX1A 3CTRA 4ZMMA 3OHAA 1BQXA 1TAUA 3NS7B 3UN2A 1F6TA 4OYBA 3MMBA 2E9TA 5DGAA 3A8IA 4U7UK 5F8IA 5L46A 3Q22A 1IKXA 1WC5A 5KFWA 1J5OB 4WTYA 4NLGA 1NNDA 3IM9A 4DEZA 1UA0A 3AOCA 2DNQA 2NQPA 4PXDA 3J81j 2MZSA 2QLBB 2XQCA 2N7YA 2HBZB 1U45A 3PW2A 1IKWB 2RDIA 1S6PB 4NRUA 1N48A 2DK2A 2CNKB 3QJJA 4NLXA 4JI3F 5IWAF 4ED8A 2W2PP 1ZAXA 1RWPB 2R3VA 4UTGA 3SCKE 1YKWA 2AQ4A 2LDIA 4XIUA 4C3LA 3HD2A 2MZQA 2CWXA 3PYDA 2HNDB 4DPOA 3UR3C 1MMLA 5AE3A 1ZOTA 2QMUB 2WTFA 1YJWS 1N32F 4KYZA 3EXYA 4G1QA 1G2EA 2ILYA 4OJGA 3R6GB 3DDNA 2J9EA 2PI4A 4IH7A 3MPWA 2P6SA 3C15A 1VBYA 4PRFA 3VZIA 2QEXS 1X0PA 1S6QB 5IT9U 4EUVA 1L5UA 2R2UA 4P52A 4O3OA 3CD5A 1RT2B 2MKYA 3DM2A 5ETNA 2IC3B 4IO9Q 1X4HA 2DGSA 1NPRA 3FFIB 1U1MA 3ZC4A 3IAS9 1URRA 4B3RF 4ZVSB 5DDQC 1HPZB 3OJSA 2CNOB 3H25A 1U47A 2IMWP 2UXBF 1S9EB 1I6JA 4FKYA 2H4WB 2CPXA 2Z56B 3O2IA 1RTHB 4CLWA 5I42B 3G8SA 1OJ4A 2YH0A 4KGXB 3MEGA 1W7WA 1D8YA 1EKRA 1U0HA 1B64A 2B4UA 4GVLA 1UAWA 5CYQA 1UZHA 1Z2ZA 3PDNA 3KUHA 4OZLA 2CRLA 1X5TA 3VHQA 2N4DA 3I31A 3BO4A 1AA1B 1BLUA 2MY7A 2VU5A 1OYEA 2WRMA 4ZLPA 3KJVA 4ZLNA 4P2SA 4DV0F 3UNYA 3TAQA 2UUCF 5C42B 4JI5J 3KNGA 5C25B 2MPUA 4CLZA 3T5LA 3TVZA 3I32A 2FY8A 5J1EB 1BQMA 1SUQA 3PIPQ 3G4SS 2LKZA 4WWSA 1C0UB 4AL6A 2WHOA 3TZYA 1RLDA 3C14A 3LP2A 1TL1B 3L7PA 4J9VA 2H48B 1FO1A 1Q5VA 3HSGA 4NLRA 4UUWA 4KRWA 5A6WA 4C8NA 3QFWA 4ILRA 4OX8A 4XPCA 1HBUB 4ETZA 4MH8A 3W5YA 2KRBA 3MPDA 4RKUC 1VC0A 2V50A 4N8NA 3MAAB 2OO4A 3N5FA 4WFBQ 1I51B 2R2TA 1S79A 1T9YA 2XZDB 3SI8A 4JI5F 1RT5B 3QGGA 2KT3A 4OYWA 2R7WA 1FVSA 4NMXA 3SEOA 5D0HA 4WF9Q 2A6MA 4L6V3 4YY3J 3PZPA 1IBLF 2J6UA 3H90A 1TL4A 2BOAA 3MMJA 5F8GA 2OFGX 3MEEA 4JOUA 3RYLA 2XMMA 4F7VA 4DV3F 1R0AB 2MHNA 4OLPA 1PIEA 2V8DA 3CCWA 1FHTA 2FLLA 2GV1A 3WX8A 2ASYA 5E3RA 3Q8RB 1VHIA 3MM9A 1RWXB 2V67A 4PPDA 1RGVA 2YKAA 4IFYB 4TU9A 4KPYA 3IR7B 1HA1A 1SH0A 1R43A 4JYAF 5HVFA 3GYXB 1U02A 4DV5J 1HW9A 3DLKB 4DQSA 4JI4F 3GJQB 3POTB 1YIJS 2HZAA 4GMKA 2BDPA 4B3SF 2RQCA 3MUTP 1VRQC 5GAEI 1RP5A 5I3UA 3SSQA 3K58A 3BGRB 4QBUA 5KFSA 1PJ7A 2VF3A 3PY8A 2AGQA 4KB7A 4I56A 5HBMB 2ZBQA 1TMMA 1JK9B 1QTMA 5RUBA 4U8YA 1NJIT 4ECTA 3PW5A 2C3MA 1S49A 1IN0A 3FBFA 2HSEB 1DTTB 4PG6A 2QSFA 5D78A 2IVFB 1WEYA 4F25A 1S1XA 3GIIA 3ILLA 2UXDJ 2AJFE 2DIVA 1SCJB 1NU4A 3KHLA 1ULRA 3C5XC 4QWDA 3LP1A 3CJKA 1HQUB 5ETPA 2OEJA 2XCPA 2FJAB 4UOCA 2XY7A 2HFSA 4LF9J 2R7QA 3I4HX 1WKJA 3CT9A 1M5KC 1GK8A 3DHWC 3NCRA 4P71A 2XGQA 3CC2S 2ERRA 4C8OA 1FWLA 4P74A 3N28A 2VG6B 3VGSA 4NCGB 4DFPA 4H4MB 1T0TV 3OXGA 4QU6A 1IBMJ 2KT5A 1WORA 3D67A 2JEFA 1LWEB 3R7SB 4DF8A 2Y0SD 3E8OA 1NKCA 4HKQA 1RAJA 4X4VA 4UOGA 3BQ1A 4J5OA 3KTQA 1QSYA 4K2XA 2DH8A 4NLPA 2VC0A 5F8HA 3W2VA 1RAHB 1RKJA 2N82B 3EGZA 4QIEA 4IRCA 3BS9A 1XC9A 1NJYA 4C8YA 5HLFB 2JVRA 3HF5A 2KO1A 2GA7A 2Y9HA 5HQMA 1BD6A 1Y0HA 4LRFA 1S9EA 1TP7A 3MD1A 2FJEB 4HI2A 3W3SA 3OL7A 1KHVA 1JKHB 1QUVA 3LA0A 3MCOA 1SPBP 2RD5C 4DJBA 2H51B 4G6VB 1H73A 1M1HA 2DGUA 2L9DA 4KV8B 3K2YA 3UO0A 3W9JA 1EETA 2BJ3A 1YBTA 1CS4B 3M8PB 4N5SA 3KLHB 2CKWA 1O51A 2LP4A 4W98A 1NZ8A 3RRKA 4TQRA 3M2VA 3H5YA 4RBTA 4DR3J 3MMBB 1PC4A 4NCGA 3D1QA 1SKUB 3LANA 2HIQA 2QGFB 4P75A 5GAHI 3J7ZT 1PGZA 1FDDA 1S77D 1GX5A 2FDNA 3P45B 4Y3CA 3I55S 2C2ZB 4DQQA 2CFXA 3VAHA 4Y6IA 4FF3A 3CJ5A 3CJ0A 4JV2A 2E7VA 2GIQA 4ED1A 3OLBA 4FBUA 2DYAA 4C3KA 3BGOP 2F4VF 3RAMA 1R8AA 2H9ZA 2IIHA 2VV5A 4QYZJ 2B4PA 2X51A 4TY9A 2MQPA 2EPIA 2IJRA 5AE2A 3TEHB 3UFCX 3R97A 2JVOA 5HMWA 3VAMA 3OFGA 1JXLA 1I5OB 4G3IA 2KL8A 3AHPA 1M0SA 3M6WA 1F3FA 3AKOB 1YRUA 4H4KC 4L76A 2C3PA 4CH7A 1SKRA 1HNXF 2CVEA 1U2CA 2H5JB 4MT1A 1BY9A 1PC5A 2CDRB 2EVZA 5F3TA 3KUGA 1WDDA 4AE5A 2R2RA 1WF0A 4HHHA 2XEXA 5MLCV 2VODA 2RNEA 2W4DA 1CS4A 1YJ7A 3RAQA 1F60B 1GMUA 3HMJG 3Q23A 3C16B 1S76D 3HKWA 1X4AA 2ZBRA 3GJSB 1NKBA 5CXTA 2X7IA 3A8KA 2BYCA 2AW0A 4UZCA 2RSQA 3M9MB 1Q78A 2UU9F 3SBMA 3QJLA 2ZBPA 2N4CA 2AEMA 1YX2A 2ZKUA 2XY5A 4HH1A 1VLYA 3CIMA 3NGRA 4PPZA 3BGLA 4ZJQA 4KH1B 2XSJB 4A4JA 1HHQA 2AJ2A 3L7OA 4DZ6A 3MM8B 3DRSB 1LK5A 2IM3A 3EYZA 2Q1LA 2DNMA 4DSFA 2K1RB 1WD6A 4G1IA 2RIJA 5KG6A 2JEIA 2MKIA 1K44A 3I82A 1JLBB 4MIAA 4RW8B 4ZP9A 2EK1A 1JLEB 4NLUA 4NLSA 1WHXA 2HZVA 4AXIA 3GR0A 3RG6A 2DIUA 5DG9A 4EYHB 3FQLA 3BBBA 5J1NA 4B9VA 4PCQA 4NXNJ 5LL6d 1FNMA 3BN7A 3W5ZA 1NJXA 1XNRJ 3BN4A 3FBEA 5BYQA 2LECA 2Y0BB 3CD7A 4ZCKA 1QAYA 1N32J 2RF2B 4PZVA 4JB8B 4B17A 5ETVA 3QBCA 4QZVB 1U8WA 2FC8A 1OY6A 1VQ4S 2E5LF 3BKUA 1OO0B 4USHA 1MU2B 4Y0FA 5L8RC 5GAGU 2F7VA 4MJKA 5DDPC 3AOAA 3T41A 4X62J 1X60A 3M2UB 3GLJA 4A48A 2JLGA 2ZH2A 2VZ9A 2IY5B 3UPFA 1CULA 2BEFA 3VWSA 5L1KA 4DFKA 3M2RB 1B0TA 4M5HA 4CLTA 1KSPA 2JLEA 1GFWB 1X9WA 4J9NA 2HEKA 4DV1J 1KFSA 2V63A 3TNVA 2DGXA 2QT7A 3M8ZA 2P6TA 2VG5A 3EWGA 1NDPA 1J5EJ 2XBPA 2YNHA 4FYVB 2ZZNA 1TK0A 5HROB 3D1HA 4PXBA 1OWXA 2MGZB 2AZ3A 2YKOA 1MLAA 3W2VB 4LIRA 3OSNA 3EZUA 3I5BA 3JQJA 1NH8A 4JI7J 2PIIA 1JLQA 1N4LA 3E01B 1IKWA 2OI2A 2I5JB 5FDLA 2XI2A 2XWXA 8ATCB 1D9DA 3NL0A 2QA4S 3N6NA 1Q7LB 3AB2B 3HZGA 2XGPA 5IM0B 5LMUJ 5GMDA 2QL7B 3CCSS 3B8HA 3BSAA 3AY0A 2YNFA 1WTFA 2Z2ZA 2BX6A 1R0CB 3S8SA 4U67Q 2XCAA 3T1HJ 1V3SA 1JKHA 3DC2A 1XEZA 3R6LB 4DR5J 2PEBA 1ZAVA 1IBCB 3TR5A 1FXRA 1RT1B 1K0TA 2KYXA 4NL5A 4Y2AA 4DZDA 3KLHA 1U1OA 3MGJA 4F4KA 1WF1A 4HACB 2ZHOA 4ED4A 3D2WA 2HS0A 3GFHA 4GO5X 3M2RA 1SJ4P 4FPIA 1VQSA 1S9GB 3CCJS 3R3TA 1UEVA 2VBXA 4H4OB 4C8ZA 3M6UA 4DR6J 2ZITA 1REVA 3HVWA 3PJXA 1IR0A 2YX1A 3A3PB 3OTOJ 3FSIA 2H1YA 3M8QB 3OR2B 3DDKA 4MKVA 2J6SA 1RAAB 1WC6A 2X1BA 5I42A 3LPYA 3LUYA 1AZSA 2HLTA 2BOPA 2UUBJ 4CYUB 2HGNA 1OY8A 3T5KA 3DOMB 4TLRA 3BPSP 2U2FA 3IR6B 2VG6A 3MDFA 3DLEB 4A46A 2F5GA 3IC1A 5KFAA 3OTBA 1U1NA 3IN5A 1F5AA 1S0OA 1F2GA 1YRXA 4FNHA 4X4OA 3SV4A 2J76E 2DGWA 4UOHA 5D15A 4F67A 2IVMA 1R6YA 1C0TA 4F4XA 4A8OA 3TJ8A 3HLUA 4B9NA 1HBNB 3BM7A 3UR0A 4DPUA 4IQMA 2QA1A 4LF4J 1JXEA 3E51A 1NSAA 2DGTA 3QNWB 4ITSA 5GADI 2V2VA 4FS1A 1S0VA 3CCES 1B7FA 1FDAA 1EX8A 3K5OA 2DNYA 3NGTA 2GAHC 1C2PA 4WIQA 4ZVOB 1YJ9S 5BR8J 1KLMA 3FSYA 4DL2A 4CLKA 5CABA 4O0NA 3FUYA 1U24A 3FVYA 1FNOA 2MMYA 3RB0A 4IQXA 3MAAA 2LVWA 2VFSA 4OV1A 3ZTSA 4CWBA 5M2UA 4OYMA 1HWIA 3M8PA 4NXNF 2M9KA 4ZVRB 2RU3A 1S0NA 2YKNA 1KONA 1OQ3A 1TVRB 4RNNA 4Q8EA 1XMBA 3I38A 4LF9F 4DWIA 1LWFA 2JHEA 4TNOA 4F26A 5DJBA 1LXNA 3FBCA 3LAMA 4TXSA 2I6WA 4M63A 2YWWA 3VGUA 4LF2A 4FYWB 8AT1B 4OI6A 4OHZA 3FJ2A 1XMOF 4EZ6A 3MFHA 2W9AA 5BXIA 3IBCB 3W61A 1U48A 4C8KA 1FRHA 3T3FA 2I9SA 4AFFA 2E5HA 3MM9B 3K5PA 5IZHA 2FLPA 1IXKA 4Y34A 2ALYB 3G9CA 4FXVA 5CQGA 3NS5A 3CGIA 3M32A 2XYPB 1RAEB 3I5AA 1F2HA 2YNIB 3AD8C 4LQ9A 2A0FB 4ZJOA 3DRRA 3X3UA 4YR3A 1TELA 4GO7X 2ZE2A 3M2UA 3P8BB 2DH7A 3PTWA 2JC0A 2WW4A 1O5JA 4WP8A 3UE2A 4MMOA 3GMGA 4A47A 4EGLA 4RNOA 1QE1A 3ZXWA 4ZPAA 4AXJA 3TZXA 4UT4A 1ITPA 1RHJB 5BYSA 1T11A 2LQBA 4NCAA 2CIMA 3K5NA 4YMEA 3QATA 1IKYA 3IRXA 3EVWA 1PAUB 1Q8IA 3EGVA 4WYWA 1FRLA 1KS2A 2Z2MA 4ZP7A 4Q45A 2YNHB 2HURA 2ZUAA 1XTZA 1CJTB 2W9BA 4DFMA 4PWDB 2B51A 2J9DE 1CSJA 1NPPA 1RT6A 1HHTP 4HL9A 4LSLA 4ECXA 3FRZA 4W90B 3V4MA 1CEZA 3QRRA 5IT0A 1SXLA 1TL3B 2BW7A 1JX4A 4DV3J 5CCMA 4FF1A 3ETOA 1SBRA 3GJRB 2EFGA 2YWGA 4YHHJ 5DQGA 5A8KB 4YQWA 1M1GA 2BABA 2XMVA 2MSSA 2CG8A 2Q6BA 2YKQA 5F0WA 1N5QA 5G4DA 4CLSA 5H9EK 1YITS 1YGYA 3QQCD 4C0OC 2B9EA 1S7HA 3AJ2A 4DV2F 3NNAA 5KT3A 2ZWPA 4Q2MA 3H5XA 1DQAA 1GMWA 1RKIA 3M8WA 1ZA1B 5HL7Q 4DLGA 2QA4G 2NXNA 3NAIA 3BDEA 5A6PA 3M8SA 1LW2B 4USVA 3D66A 2RF2A 4NPOA 1BHNA 2EG1A 4F2SA 1TL1A 3D0GE 1I94J 2WONB 5K8MA 2ROEA 4BBYA 2BXJA 3FK4A 4ZCIA 4YHHF 3IGVA 1V9OA 3FCVA 4TU7A 3U1MA 3EGWB 2ZNZA 3DOKA 3KMQA 4CLLA 2KDOA 1KVKA 1U1QA 2E9RX 1FJCA 2HFVA 4WKYA 4I68A 1KC8T 4MKBA 5KFOA 1HWUA 5DG7A 2DCUB 3NOGA 2ROGA 4ZHRB 1AROP 2B6AB 4ZVPB 2VL1A 1JB0C 3A1YG 3W9HA 4YN3B 4USKA 3CEDA 1QDUB 2EFPA 1CJVB 2PE8A 3OT9A 2DY9A 3S6EA 3HM9A 2GQCA 2GW8A 5KOXA 2FGOA 3C66A 4X62F 3HHNB 2J9CA 1NJWA 2FB0A 5KFRA 2ZJRQ 1OY9A 1TL7B 4HDHA 7AT1B 3UD5A 3H2LA 1N6QB 3J7Z5 2CDQA 2KB2A 4KC5A 3CF5Q 4JI2F 2OPPB 2HAIA 1T3NA 3G2XA 3TX8A 1YJRA 1FXDA 4HLBA 1K9MT 2BM0A 3BBFA 5DO2A 1WKKA 1RTJA 3I6PA 2HK2A 3HXMA 1DQ9A 2HQCA 3BKFA 2FVQA 2HIYA 1YJNS 4NLYA 3BQ0A 2QZ8A 2E5LJ 2R7TA 3HHLC 4DHVA 2NPIA 4ANDA 4C11A 1HHSA 1RT7B 2GCFA 2MYFA 1U1PA 1SL1A 3HJFA 2O67A 4LVOP 4DI6A 2K3KA 2QLDA 3MEGB 2PFFB 1RA7A 3QLHA 2O1PA 4X66F 1QSLA 3H8YA 5ETQA 2BJ1A 3TAMA 2CQ2A 5CYQB 1V6HA 2OMOA 1JLCA 1S7IA 4AL5A 1LEOA 1C3GA 2NPFA 1R0BG 1VC5A 1FK9A 1FJGJ 5D8HB 2MQMA 2EFVA 3TQ1A 3I0SB 2RKIA 2OELA 3T1HF 5G0RA 3ISZA 2AJ1A 5E0OA 1UEKA 5L1IA 3BDPA 2V5HG 2G4BA 5AJ3F 2CADA 4FXDA 1NK5A 5L38A 2KN4A 2CQ3A 4TVAB 4DN9A 1NK4A 4NYZA 3W5XA 2DPJA 2K7JA 3F56A 4FPRA 3KJNB 5IS2A 3LALA 4EYIB 3RR7A 4BC9A 1JJ2R 3R5BA 1VQYA 4JI7F 4TYBA 2RRAA 1SVDA 2OPSA 2Z4PA 2GQQA 4CT9A 3TJAA 2QYCA 3PHTA 2BANB 4Q2LA 4JI4J 1FJ7A 2LMIA 4U6PA 3H5SA 3PFOA 3LO3A 2BE9B 4C11B 1XAOA 1EIYB 2YKMA 4JI1F 1S6PA 4J7CA 1K47A 1N88A 5SZTA 2VKRA 1B0VA 5J2PA 4MFBB 3ZTRA 1RTIA 5H9FK 1W25A 4CCHA 1MW7A 1U6ZA 4YDDB 1R6VA 3MUMP 2LU1A 1FWKA 1MSWD 2HNYB 2JL9A 3NS6A 4DR2F 5ETRA 2L9WA 1KWMA 2D3OR 3GPAA 4OYZA 3VVUA 5JJBA 1WWHA 3R9LA 3SXLA 3CCVS 1DZ5A 5D4PA 4EU0A 4URGA 5HJYA 2W1BA 1S6QA 4OZ2A 4Y65A 1YTYA 1ICEB 3TWZA 4ZP6A 1X4FA 2AZ1A 5IC4B 3KLVA 1K0VA 1RTZA 1B99A 2F8MA 1ZETA 3DXSX 2V0NA 5DZ7A 1HR0F 4I2QB 4ES3A 4AD6A 1XMQF 1U09A 1HPZA 4OX6A 3R2DJ 1VK3A 2F9DA 2GMHA 2GVZB 2OPSB 1NDKA 4DUYF 3ZZPA 5DQIA 4LF5J 2BZ2A 3P3DA 3CCMS 2VHGA 5E33A 1AFJA 1YHQS 1RK8A 3C6UA 4NMLA 4LFCF 1NBEB 1HWKA 1OYDA 5LJ3Y 4O4RA 3QO9B 3U27A 5HBMA 1UA1A 2LLZA 3Q8SB 5M2PA 3RAXA 4EK2A 1NSPA 2I8EA 2XWYA 3PM9A 2HRTA 2Y3YA 4TLQA 1YJVA 4OQJA 1KP6A 2XSFA 3TZZA 5F9LA 2HS4A 5LMNF 4ILLA 3DYAA 3AT1B 1T9TA 3THPA 1HWLA 2YTCA 5IV3A 4TN2A 3IS9A 5A8RB 2X1FA 1FNXH 4K50A 1N0VC 1FKOA 3WX4A 3LGHA 3FGVA 3SDEB 3RGIA 4LRDA 2POKA 3KK1A 2DRBA 2GHVC 2RHSB 4ZOSA 1MROA 2MB0B 2D41A 2YPZA 4FBTA 2ZUGA 1P8GA 2GNKA 4H4MA 4LRBA 4RW9A 3QSYB 5A2QU 4OHWA 5J1PA 4PWWA 1UP1A 2P5VA 5H9EJ 1GX6A 4P72A 4NOHA 3DNCA 4WCEQ 3VAKA 2XMWA 2P2CB 1WEXA 4DV4F 3C8YA 1QAXA 1R89A 2WVCA 4MK9A 4DX8H 4J9LA 4NCBA 4ZLJA 2DNOA 2OMLA 3P5BP 3P96A 1T9VA 2IRUA 4XTTA 2KG0A 2HVHA 4WK3A 1H6KX 4IFVA 3H0PA 2ACYA 4Y2MA 3CO0P 5E3CA 4BC7A 4J9MA 5HMZA 1HI0P 4YEAA 3GV8B 3QZ8A 3X1LB 2ADBA 3UQSA 2Z2YB 3NMRA 2A2DA 2DNPA 4ICLB 1RXOB 1YJTA 1NAQA 3HHLA 4WFAQ 2IHR1 4OYPA 2Y1JA 1AB8A 4KBIA 1GTEA 2YWEA 5D0GA 1H2TZ 4LIWA 1NUEA 3HKZD 5EX0A 2DITA 2UXCF 3BGFA 3ZZ0A 4CZCA 1FK9B 1H98A 3ETMA 4DX6A 4IH6A 4L75A 3GONA 3RR8A 1S1WB 3LAKA 1MG7A 2LQ9A 2QN6B 2RKIB 3TW0A 2OPRA 1DFDA 4QU7A 2PMZD 1IM4A 1D9FA 3T6JA 2AT1B 3W2WA 5CA5A 4ED3A 4K4UA 1SIZA 1WG1A 2V6AA 4F0HA 4LFAF 2DHSA 2RILA 1N5VA 2W9CB 3PYGA 4CNZA 1HD0A 2HHVA 3JB9k 4B3OB 4LRCA 3Q86A 2WSEC 1LWFB 4DL3A 1S1XB 4IH5A 4WFNQ 1YSJA 3OTEA 4O3QA 1P27B 2HKEA 4C48A 2HHHF 2FYXA 3SCJE 2B9YA 3VAJA 4V19J 3R5GA 2G0JA 2V94A 1S48A 3ZTOA 3FZ2A 5JVHQ 2IA6A 1RI7A 4FF2A 3HFVA 5J1EA 3KG0A 3EX7B 2EC0A 3IRWP 2W8LA 3I9V9 4ECVA 3ZZYA 4WP3A 4QPXA 2GAGC 1X9SA 2KJVA 2BJEA 2DEJA 2HAFA 4QIWD 4RNFA 2E1CA 4F4WA 3LP2B 4NEZA 2VDHA 2KVIA 2C2KB 3QGHA 1TMJA 2C2OB 1PCAA 2MKSA 3PRBA 1WHVA 4RUAA 4ES1A 5A2QY 3MWBA 1JLFB 3GTYX 2KH9A 1JNRB 2DHAA 4I6YA 3W8GA 1N34J 4PUOA 1WOOA 1FJEB 2KZZA 3M8YA 2C22A 1T05A 2FC9A 3Q8YA 5ITHA 2U1AA 4A8FA 4QWAA 2V2QA 4C3MA 4OI4A 1IKVB 3N6LA 1JQGA 5BR8F 2C2RA 5CD4A 2H5EA 5EGYA 1VQ7S 4UY8T 1M5SA 1LV5A 3CCTA 3V4IB 3NGDA 4B3OA 1Q79A 2NXJA 3MEDB 2OH2A 5IOLA 1KDNA 1X4BA 1LWEA 2EBGA 2HGLA 1W2BR 3THVA 4B3TJ 3S1TA 1JNZB 2W9BB 3JTOA 2EXUA 3PEHA 5LMNJ 4F02A 2VPYB 1FXLA 2A1BA 4DV6J 4QQBA 1NDLA 4DUZJ 1K8AT 1HW8A 3RRHA 1FDBA 1RHKB 3KKFA 1Q0NA 1YBUA 1HYSB 2HVDA 3BBCA 2LQ5A 3DDIA 1WC4A 2QX0A 1YLXA 1EHWA 2JNJA 2Z30B 4R8UA 3CVKA 1QTNB 1S12A 4ECWA 4WFZA 4ZPWR 4DF4A 2KU7A 2J0QD 3T1YF 2Y1RI 4ID8A 1FWPA 2VG5B 4E98A 3BGUA 1QVFR 4QIFA 4USUA 4FYDA 1ZPVA 2Z8QA 2HYIB 3AB4B 1WG5A 1RT3B 2X3DA 5KFTA 1WSVA 2DEIA 3OL6A 2EG2A 2XO7A 4DX7A 4LF7F 1XNRF 4G1QB 4KGVB 5L39A 4K4XA 5LSLA 3A12A 4CLFA 1GXTA 2DNKA 4OX7A 3BKTA 5HVHA 4LRAA 2J0SD 3JSYA 4YB1P 1QM9A 3KWMA 1DTTA 5IM0A 5KFCA 1VCTA 3MR7A 4NA3A 1FVQA 4WXOA 1E6YB 5D4OA 2WZ1A 4WPAA 3UDCA 1UTAA 2ILZA 2LA6A 4OYAA 3SFUA 2VKZG 4HDGA 3SQGB 1RTHA 3H42A 1OSDA 2MLXA 4IKAA 2XMJA 3W7BA 2XC9A 4A8QA 3NLCA 2UP1A 4ZPBA 2JFDA 1HMVA 1TFYA 3K7RA 5C2GA 3HD1A 4ELUA 4IOBA 3D9BA 2QMWA 3C6TB 2ZDPA 4TKTA 3ZO7A 3GYGA 1VBXA 1PO6A 4YDXA 1XERA 4M5MA 5C42A 1KFDA 2HFUA 4D3GA 3AJ1A 1PYOB 1S1UB 4X4RA 4DV7J 4HT5A 4AT1B 2PMWA 4PG8A 1QSSA 3HHLB 1YDLA 4X64J 1EARA 1NMEB 2GZOA 4C9DA 1HI1A 2XSJA 3FCWA 3JQKA 3D68A 3WZ0A 1QD1A 1RB0A 3MM8A 5ETKA 2MTLA 1KQSR 1J2VA 1YWXA 2CPDA 3M32B 5F3ZA 1GH8A 2YNGB 1NK7A 4I69A 4LF4F 4JI1J 3KOAA 1S1VB 1RAFB 2M52A 1S1WA 5KFLA 1UFWA 4PG5A 4OI1A 2OSQA 3HCXA 2MKKA 3B54A 3HHDA 2IBOA 2CPZA 5K14B 4OMFG 3V5RA 1RT7A 1CC8A 1QUPA 2R7RA 4EBEA 3J7AN 2P9CA 5ADZA 1ROFA 2DR7A 4AQYF 2PT0A 4JI8J 4C6AA 3M9OB 2IM0A 1TUWA 1XR6A 1LKZA 4OJ1A 4ZIWA 2KXFA 4ECUA 5IQ6A 4P7TA 2QLWA 2C3UA 3T9ZA 2HWHA 3CE8A 4ZCLA 4MK8A 3ZTPA 3PX0A 4URQU 3CDBA 1VK8A 4MYUA 1RAIB 4GVBA 1XBWA 1AW0A 5GMEA 2QE5A 4M94A 1RJJA 2M4MA 1A6LA 2RJZA 3J7YU 3G6XA 1P1TA 2DXDA 3MM7B 2J7UA 1F9FA 1RAOA 1WOPA 2R9LA 4FYXB 2H65B 4LFCJ 1S97A 2VFRA 4JI6F 1PYSB 1K73T 1N36J 1VQ6S 2EKNA 2R4FA 1UVIA 4DPWA 3HULA 1C4CA 1RBLA 6FD1A 4CO0A 3D54A 2V2ZA 1KOOA 2RAQA 1KVIA 1CULB 1TKZB 2Z0GA 3MPYA 3BGRA 4YUDA 1JLGA 1VJQA 3BJYA 2HS3A 2V4RA 4ED0A 2RU9A 2LU2A 4M5DB 4ANEA 4DL6A 4CTAA 1HNXJ 3RBEA 4KTQA 4OI0A 3RB3A 4QWEA 1N33J 2UV8G 2C2DA 1R31A 2FZKB 1FERA 2XZWA 3JSRA 4P2XA 3MURP 2IAJA 2D9OA 3JYTB 4BHQA 2UUCJ 5HMXA 3FEYB 5KFUA 2D3O1 3QRQA 1S10A 4K0KJ 3MCSA 2ZOGA 3CCLS 1FJGF 3LP1B 3CJKB 3L3CA 1RHQB 5T41A 4HACA 1D8ZA 4KFBB 3T9NA 1RZMA 3H4DA 1Q86T 3GYNA 3KDNA 5KT2A 1D0EA 1S9GA 3FEZA 1KR4A 2EK6A 4FF4A 1JMTA 4FYYB 4YOEA 5LM7E 3Q2SC 4EBCA 1VBKA 1KN6A 2KXHA 1PILA 2V2KA 1ZTWA 1RTDA 1S72S 2YWFA 2BBEA 2RHQB 3DCAA 5KT4A 2GVZA 3NGSA 4X4NA 4X65F 5IC6B 2F65A 1KHWA 1XJWB 2X1GA 1ZM3A 2IMOA 2VFVA 3KHGA 1VQ8S 5B0GA 3K8WA 5C7PA 1Q5YA 1N5YA 3N9UC 1UW4A 3C19A 3EVMA 3KMSA 2XB2D 2DNNA 4B3SJ 4DR7F 3C14B 4YY3F 1IBLJ 5F8NA 2EW9A 4I1TA 4C8LA 4ZPTR 5KFFA 4XPEA 2DRDA 4DQRA 4NLWA 5HMYA 1X0FA 4DL0C 3OHBA 2GQ2A 2ZH7A 3GR1A 1JLAB 2VBZA 3DLGB 1ACMB 3H7HB 3CWJA 1VMBA 2RUSA 3OTCA 4XAKA 5GAGI 2FJBB 3MFIA 4C8MA 3K17A 1HNWF 3W8PA 2CZ9A 5E3AA 2LEAA 5KTQA 3R2CJ 3C15B 1BQNB 1RT5A 2M8DB 4JUZA 3ZNUA 1RWNB 2AJ0A 2DISA 2JOQA 2AP6A 4ZN1A 1GEHA 2FZGB 4GC7A 1WC1A 1ZZFA 5BYRA 1SH2A 2AYMA 5HN0A 2HFNA 4PKDB 4K4YA 2BMBA 1TK8A 2VPXB 3RBXA 5KFXA 1LWCA 3LH2S 1YVFA 1HR0J 1YRTA 2CJQA 2D3UA 3R7BB 4ED6A 4JBCA 4Q7AA 1CJUB 2M70A 4B9UA 1U4BA 5H1SV 1X4DA 4C4WA 3KG1A 1U49A 5HP1B 1RWVB 3N6MA 5E5NA 1RBOB 1B3TA 2PEHA 4PQAA 4ES2A 2QLFB 3RW7A 3ENWA 3DU6A 2EBEA 2W4CA 2XI3A 2PA8D 5K14A 5C25A 3GG1A 5H9FJ 4UW2A 2W8KA 3EICA 3I0RA 2CQ4A 2HVZA 3QIPA 2JZ8A 3WIVA 2DH9A 4F4ZA 2KFZA 1RTIB 2NZCA 3J81U 3M8RA 2RDJA 5KFVA 4RNMA 3K5MA 4QYZK 1TKDA 2HLUA 5HI7A 3UD3P 4H4OA 4JV5J 2PO4A 4YR0A 1YI2S 1UFKA 1RTJB 4CO1A 1GQEA 4WZMA 2L48A 5LOQA 3Q24A 1ZZNA 4JI3J 4OI2A 2ZOMA 1PAEX 1UCNA 2OPRB 4RW7B 3OUYB 2EFNA 1SJFA 1Q95G 4Q0BB 2BJ7A 3FNNA 2MY8A 1FFSB 2VFTA 4OHXA 4W4MA 1EP4B 4DR1F 4DCOB 1KRPA 3BQ2A 2CPJA 2ATCB 1T7PA 2C2EA 2VIHA 4KKOB 3G86A 1WNEA 4EBDA 5AXLA 3AJDA 4B3MJ 3G6YA 3RB4A 2NSCA 1VIXA 5FD1A 1UVMA 4K8RA 1JLBA 4PAAA 1WUUA 1FD8A 2BR0A 5U47A 5THWA 5G0RB 3WC0A 2QFJA 3JS9A 4K2JA 4QWBA 4DL5A 3SQOP 4KHPJ 4X4SA 3L95X 1ZS6A 3HSZA 4ZPVR 4QPTA 3QLHB 4NA1A 2L08A 4IRDA 3D6FB 3BZQA 1VGYA 2CQ0A 4MKYA 2JRRA 1L3TA 4DU8A 1EAYC 1R7IA 2OPQA 4NI2B 4RW4A 1NM2A 2G0CA 1NSKL 1FX2A 1SV5B 4P73A 4ZVUB 1U26A 4F0MA 5AXMA 1FKPB 2RQMA 2VG7A 4RR5A 3AGYA 1EETB 2XHCA 4FP9A 2YKMB 2OEMA 2JC1A 1OSCA 1P9YA 2MLZA 1SJ1A 4CT8A 3OL9A 2PFDA 3KXDA 1V5IB 2MSTA 3DI6B 4IO1A 2W7PA 2HQ3A 1LW0A 2DNZA 4DPTA 3TUZC 1G3OA 3D6MB 3N79A 3OTDA 1RADB 3AQPA 1N8RT 3DLHA 2BJ8A 3LPEA 2XMKA 3AODA 3UN3A 2V4JB 2RS2A 2ZFHA 4KPCA 3A3NB 4Y28C 3T1AA 1SKSA 1P1LA 3BEGB 3MPUB 2FLNA 4I7FA 3CDEA 2HNZB 3VVTA 3FRYA 3W65A 2IFXA 2QLJB 1MWQA 3MM5B 3TUIC 3NBPB 4XK8C 1UW9A 4F50A 3KJQB 3CD6S 3M9NB 2UU9J 2AYEA 2VOPA 1L3KA 2LXUA 2H3EB 3DRRB 2GS8A 1EZZB 2A3JA 1RT3A 4RW4B 1H38A 1Q8KA 3LOUA 2SXLA 4ECZA 2B43A 2WK4A 5KOWA 3C6UB 1N34F 4OL8A 1HNVB 4RW6B 1N52B 4LBIA 4WYLA 4CQ1A 1FA0A 4LT6A 3C16A 3EJMA 3JQMA 3Q8UA 3OFHA 4ZDNA 3MF5A 2HG4A 3SMZA 3UDVA 4RL1A 1WOSA 1Z1ZA 3AFGA 4A8YA 3TI0A 1RTDB 1IWAA 1AYEA 3A8JA 1HFEL 4F36A 4DUTA 5CYJA 2OJ3A 3NNCA 1S4EA 2OTLS 2QTWA 2NYIA 3PO5A 3M8QA 1RSCA 2BA9A 4LUBA 5D3GA 1E6YA 1VQLS 1NEEA 1R8HA 4J90A 1N56A 3JTPA 4Z2XA 3K59A 4DV5F 3BB5A 2HNZA 4NLQA 2GGPA 3HO1A 2CZVC 3TAMB 2IPOB 2DR6A 4WXWA 3RB6A 1AFIA 4HHUA 2E44A 3GV7B 3PCOB 4Q5VA 2J0XA 3HSDA 3ITHB 2ZDOA 4ED2A 1OPIA 2MXYA 2JX2A 4IYQA 3OSPA 3HK2A 4F3QA 2M8HA 2OP5A 3R8YA 5KAKA 1S59A 1F9EB 4LF8J 1F0XA 1VRUB 2LQ8A 3AA8A 3SIPB 4AYBD 1VQ5S 4M5LA 1WELA 4YB5A 2PD1A 3DRPA 3CC7S 3GSDA 4IFYA 2HRUA 2OIHA 5IFMA 2HW3A 2GMLA 3G82A 1TK5A 4LSNB 3CUNA 1ZAWA 1RWMB 2BM1A 2HK3A 2XYGB 3KK2A 3DM2B 3OLAA 4U7UD 1SJRA 2ZD1B 3KDOA 1UWBB 2MQNA 2W2QP 1VQOS 3L09A 3J7YI 2LEPA 2RRNA 1VQKS 2MQ8A 2Y1IA 3TUPA 3QGPA 3OUYA 3WQPA 5C2CA 1CQMA 2R7SA 1C1CB 1SKWA 1IVZA 1OPZA 1P9QC 1V3ZA 3ZNJ1 4HR2A 2GVDA 4O44B 4MFBA 5B0FA 4LFAJ 2R8IA 1U0HB 2BE2B 2WVEA 4OJ3A 5KFGA 2VBWA 2DO0A 4ZKAA 3MR2A 1URNA 2HQDA 4M1KA 4ZVQB 2BKPA 2VONA 2Q3PA 4DG1B 4ED5A 4J9QA 2UUBF 1RACB 4R25A 1FE0A
chains in the Genus database with same CATH topology
1GMUA 3I38A 3TJAA 1NLTA 1GMWA 3TJ9A 2QLDA 2B26A 3LZ8A 3TJ8A 1GMVA 1XAOA 3AGZA 1C3GA 3AGYA 1EB0A 4L3KA 1GMWD 3LA0A 2Q2GA 1EARA 3NY0A 3AGXA 3L9ZA 3NXZA 4J80A 2HFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMU A;  3I38 A;  3TJA A;  1NLT A;  1GMW A;  3TJ9 A;  2QLD A;  2B26 A;  3LZ8 A;  3TJ8 A;  1GMV A;  1XAO A;  3AGZ A;  1C3G A;  3AGY A;  1EB0 A;  4L3K A;  1GMW D;  3LA0 A;  2Q2G A;  1EAR A;  3NY0 A;  3AGX A;  3L9Z A;  3NXZ A;  4J80 A;  2HFV A; 
#chains in the Genus database with same CATH topology
 2BAN A;  3MEC B;  2WW8 A;  4MYT A;  2B3T B;  3W1Y C;  2AEF A;  1NSQ A;  2N3L A;  3RZA A;  4CP5 A;  4ZVT B;  3AXK A;  1W26 A;  3HVT B;  2DGQ A;  4K59 A;  2ZJQ Q;  4LF5 F;  3AD9 C;  4N41 A;  3IGN A;  3V81 B;  3TJ9 A;  4R5P A;  4K4V A;  1X4E A;  2OFH X;  2APO A;  4B3R J;  4USJ C;  1VHF A;  3DXB A;  3BR8 A;  2BV3 A;  2DRA A;  3KK3 B;  1RWK B;  1N5T A;  3TQE A;  3F44 A;  1EKS A;  1WAC A;  2DNG A;  2HWI A;  2MQL A;  4X4Q A;  2CWK A;  2OD4 A;  2AYG A;  4TU8 A;  4OYX A;  5K9F A;  2RB7 A;  1IM6 A;  1JWW A;  4EEY A;  4ZVF A;  5KFM A;  3KUE A;  2IA0 A;  3IO1 A;  5EHH A;  3GFX A;  4WE1 A;  2CJB A;  1HD1 A;  3UCU P;  2ZNY A;  3UCG A;  1Y5L B;  3UWT A;  3MXH P;  1EQM A;  3GIK A;  1Y4Z B;  1FRJ A;  2BE2 A;  2DHG A;  4KJI A;  4WFX A;  2C2N A;  2KFN A;  4QOT A;  3PW7 A;  2H4Y B;  3UI3 A;  3CJ8 A;  1X4G A;  1S0M A;  1IKX B;  3QWP A;  3AQO A;  1IQZ A;  1Q8L A;  1RT6 B;  3EGN A;  2B4O A;  3G8Q A;  4DL4 A;  2L9N A;  5C5J A;  2NYH A;  3V6D B;  3C46 A;  1TKT B;  1WHY A;  2KHD A;  1SC4 B;  3KLI B;  4LSL B;  1SIW B;  3VCD A;  5CCL A;  4J9P A;  2CQC A;  5KFK A;  2DJW A;  4F8R A;  1VIS A;  3LTO A;  3M2V B;  2K8G A;  3I4P A;  3R7N B;  4RZR A;  3OL8 A;  5DLG A;  2W01 A;  3B6B A;  3DLE A;  5KG2 A;  3HVR A;  3FZB A;  3QID A;  1ELO A;  1F5B A;  2Q2G A;  2R8H A;  1VQN S;  4G65 A;  3Q8V A;  2LDY A;  3QFH A;  1Q81 T;  1PSD A;  1FE4 A;  3BO2 A;  1NHU A;  2HBQ B;  4M5J A;  2MZT A;  5A8R A;  3T1Y J;  4DU7 A;  2XNQ A;  4JI6 J;  2MGZ A;  1D3W A;  1DAR A;  4G1P A;  4OX9 J;  3K0J A;  4V19 X;  5EN1 A;  4RW6 A;  4UQT A;  2C1E B;  3IXQ A;  4DR4 F;  4FN5 A;  2B7B B;  3ZZU A;  5GAE U;  4Y2C A;  1SB6 A;  1PBA A;  3TA2 A;  3I96 A;  1TR0 A;  3A3O B;  4ID5 B;  3DMJ A;  1UPP A;  1T9W A;  4OZ3 A;  2FJX A;  1HNI A;  2QSW A;  1WC3 A;  4I0W A;  2R42 A;  3OR1 B;  3TOQ A;  5GAD U;  3FKB A;  4O3N A;  1HNZ F;  5B0A A;  1RT4 A;  4H54 A;  2ZH1 A;  4U8V A;  1JLA A;  3G71 S;  2IBK A;  1RLC L;  2MLY A;  2RQ4 A;  5ETM A;  1PBU A;  4WKR A;  3EZ5 A;  5A8W A;  5LSO A;  1PJ6 A;  4O23 A;  4USM A;  3HP6 A;  3CC4 S;  1GAO A;  2FHJ A;  3ADA C;  1VDH A;  1RUS A;  4C2M A;  4XDC A;  1CQN A;  2OAU A;  4ZVG A;  1KQK A;  4O3P A;  4ATN A;  1F9H A;  1MN9 A;  1QLN A;  1YZ7 A;  1WF2 A;  5J2N B;  2Q6C A;  5IT9 Y;  5AJ3 J;  3K89 A;  2ROP A;  1CJV A;  1VYA A;  1VRU A;  1C1B A;  2KFY A;  1Q7Y T;  4F4A A;  5B0C A;  3GQC A;  3R5A A;  5DM7 Q;  4ERD A;  4EMD A;  1DBD A;  1OMS A;  1HBM A;  2Z2L A;  3GG0 A;  3KFW X;  4PG4 A;  2VBY A;  4PAB A;  4CLY A;  5E3P A;  2ZM6 J;  1T9X A;  3CSK A;  3QAE A;  4ZIV A;  1A7G E;  2HQG A;  2WCX A;  4PYD A;  2KZM A;  4LF1 A;  2CQB A;  3OTO F;  4A8M P;  4L3K A;  2YNI A;  2EWH A;  4L3N A;  3PG9 A;  2QL9 B;  2WVB A;  2AHO B;  4QR1 A;  5F8M A;  2MQO A;  4OZ5 A;  1P6T A;  5SUH A;  2ZH9 A;  1T03 A;  2B56 A;  3NY0 A;  1S1U A;  4RO0 A;  4DN0 A;  3MAQ A;  1RYS A;  2DR8 A;  3I0R B;  3N5B A;  4LRE A;  5B0B A;  2XS5 A;  4M5D A;  4C98 A;  3MR3 A;  2HQF A;  2UV8 A;  4PYA A;  5HK4 A;  1MWZ A;  1VFJ A;  3B4M A;  4ZVE A;  4L73 A;  1NK0 A;  1WKL A;  4I67 A;  3LF0 A;  2AJ4 A;  3EVO A;  4RU2 A;  3QGI A;  3DOL B;  4OX9 F;  2MQQ A;  3GIJ A;  2ASL A;  1RT2 A;  3P4U B;  3TYT A;  2WOM A;  4K7Q A;  3JSM B;  3IWN C;  4X4T A;  2V8P A;  3QRP A;  2RQK A;  1CPZ A;  1ZBT A;  1FX4 A;  1HIY A;  1R8B A;  4ETX A;  3AOB A;  2DR9 A;  2QFI A;  4P6Q A;  2XZT B;  3G8T A;  2IYG A;  2JZ5 A;  2F8E X;  3A4T A;  3QT6 A;  1RHR B;  4DPY A;  1U0S A;  2FVP A;  2E7W A;  3TVY A;  4UZB A;  3MM6 B;  3W64 A;  3VAF A;  1Q4R A;  4FS2 A;  3H98 A;  3MHY A;  3LQV A;  2PDA A;  4NLT A;  4L72 B;  3SFG A;  3G6E S;  3NOC A;  3SSS A;  5CZV A;  5ETO A;  3HZE A;  2VQF F;  4M5I A;  2WVF A;  3GWC A;  3VAI A;  4MAK A;  1RAB B;  2DGV A;  5I3U B;  4Y2K A;  4BCA A;  2NUU G;  3HHL D;  3KLF B;  2J6T A;  3Q2T C;  4KGM A;  1M5H A;  4CM0 A;  1N5Y B;  2VQE J;  1HWJ A;  4NXM J;  4FKX A;  2BJ9 A;  1TV6 B;  3LP0 A;  4F04 B;  4F3O A;  3NRB A;  4FZV A;  4CO4 A;  4ECR A;  4Z7C A;  4KT0 C;  2I2Y A;  1XWL A;  3PKM A;  4QIG A;  1IUJ A;  5HAT A;  2ZH6 A;  5D0R A;  2EC2 A;  2XYH B;  4HVZ A;  4HYK A;  4DFJ A;  2DHX A;  4OZ1 A;  2DKO B;  4BLG A;  4W92 B;  2WOM B;  3C2P A;  4NI2 A;  1FEH A;  1DUR A;  2PMH A;  5EWG A;  2NCK L;  3PKY A;  1IQT A;  4J9R A;  3PR5 B;  5D4L A;  2BAC A;  3DLJ A;  3D7S B;  3CDA A;  1O8B A;  2IYI A;  2AYB A;  3WDO A;  1EQ0 A;  3MMC A;  2HFO A;  2MKC A;  2CQG A;  2LXI A;  3B4D A;  3CD0 A;  3FEX B;  1M5V C;  1JJ4 A;  1IBK F;  3Q8P B;  4E0D A;  2NZ4 A;  4WZQ A;  1RBA A;  4NE9 C;  2VIC A;  3ONQ A;  2YWH A;  4IG0 B;  1K1Q A;  2HHP A;  4NX9 A;  5DM6 Q;  5DLF A;  5HQ8 A;  1REV B;  3I9Z A;  1W2I A;  1VRT A;  3UCZ P;  2J0W A;  1YK9 A;  1FEE A;  2RDD A;  4OYI A;  4X4U A;  5DRK A;  2JEJ A;  1SH3 A;  1LWC B;  2BKO A;  1LFP A;  1YQH A;  3PHE A;  4J37 A;  5KG7 A;  3EXC X;  3PV8 A;  3TAN A;  2Q66 A;  2YX4 A;  1J5O A;  4YP3 A;  5KFN A;  1UJ5 A;  3AA9 A;  4CYU A;  4IR1 A;  3QO9 A;  5HQL A;  5K8O A;  1U1L A;  1TL3 A;  3MM5 A;  3TAR A;  2H5I B;  3DLB A;  1IJF B;  2DNL A;  2GMJ A;  4EI2 A;  1TFW A;  2OPP A;  3NAH A;  4Z7Y A;  2CJA A;  3TZW A;  1WTB A;  1DLO A;  1SJQ A;  4LR7 A;  3O3L A;  3DLK A;  2HGM A;  3PFE A;  4LF7 J;  1ZH5 A;  1T3O A;  4PUO B;  1UVJ A;  1SI9 A;  3IR5 B;  3D1O A;  1RHU B;  1F1B B;  3PRD A;  2ZH8 A;  2I38 A;  2NR0 A;  4OFZ A;  4KR0 B;  4OJH A;  3MUV P;  4DX5 A;  4WE1 B;  4N56 A;  4ZK7 M;  2W4P A;  2KM8 C;  3I56 S;  4PQU A;  1CJK B;  1RDR A;  5KT5 A;  3DGP B;  3BR9 A;  1LK7 A;  1REG X;  2LQJ A;  2QMX A;  2IC3 A;  5B08 A;  1R8C A;  3QT7 A;  2XLI A;  3V4I A;  5HVG A;  1A9N B;  2VQE F;  4RW9 B;  3HFK A;  2GO9 A;  3IP0 A;  1NXI A;  1UVL A;  2CJX B;  1HQE B;  3DLG A;  4U96 A;  2QA2 A;  3BF4 A;  1Y9O A;  3BSO A;  1NK6 A;  2DTJ A;  2BQ3 A;  1NB7 A;  4DQI A;  2HHW A;  1DHM A;  1HBO B;  2RML A;  3IWX A;  3IWL A;  3M30 A;  4M5N A;  4ZP8 A;  3HPO A;  4MK7 A;  4UY8 5;  2JLF A;  1UJ4 A;  5CYM A;  1JLQ B;  4DUY J;  1KLN A;  1RCX B;  3GFY A;  5DGB A;  2CZ4 A;  1Z4U A;  4EO8 A;  5ETS A;  2O66 A;  4HTI A;  5K8N A;  1KQG B;  1HAR A;  1DLO B;  1S1V A;  3DGV A;  4ZPC A;  1RHM B;  2ZVS A;  4LBH A;  3VZH A;  4DV7 F;  3HJV A;  1X5S A;  3RJM B;  1L3V A;  1FRX A;  1RU2 A;  1S99 A;  1FF2 A;  5AXK A;  2ASJ A;  4ICL A;  2GIR A;  2M2B A;  5KT6 A;  3PXG a;  1BQM B;  1SUQ B;  2AF6 A;  2GO8 A;  1VOM A;  4PXE A;  1Q8B A;  2XMA A;  4URS A;  3F73 A;  1FT8 A;  2UVU A;  2UVW A;  1J5E F;  4MIB A;  1GMV A;  4PXC A;  1TL5 A;  3OBI A;  3OPK A;  4QW9 A;  3ZTQ A;  4P2F A;  3OJU A;  4CM2 A;  2JSX A;  3AGZ A;  2FHJ D;  1B70 B;  2FHO B;  2QRR A;  4DSJ A;  1FRM A;  2V8V A;  1H7W A;  4E2F B;  2OUG A;  2Y8W A;  1DJ0 A;  2KT2 A;  4RU9 A;  2HHX A;  1HBU A;  1NB2 A;  4DSL A;  1YZ6 A;  4IOC Q;  2JFK A;  3MMA B;  3D0H E;  4KQZ A;  2G2Y A;  2X3G A;  2BQU A;  2R8K A;  3ENQ A;  2E5I A;  3W2W B;  5I3Q A;  4QCL A;  3O1L A;  4DSE A;  3SQG A;  3MR5 A;  2CJ9 A;  4TYA A;  3NXZ A;  2A10 A;  2BW2 A;  2MEW A;  1UMJ A;  3GB0 A;  2EKY A;  2F8H A;  5A8W B;  1Q82 T;  1OIA A;  3QAU A;  4X84 A;  1M5P C;  3UNG C;  3W62 A;  1IJE B;  4KSE B;  2CQD A;  3P6Y C;  4RW8 A;  1Y3J A;  4DV4 J;  1RWO B;  4LVN P;  4ENO A;  4L74 A;  2YX7 A;  3TUJ C;  3CPW R;  4OHV A;  2DVI A;  4LF6 F;  4LFB J;  1HLW A;  3I0S A;  4ZIT A;  2QO3 A;  4RW7 A;  4O3S A;  4KFB A;  1IBM F;  3OVS A;  5FLX U;  5ETL A;  4R5P B;  3ZZZ A;  4LJM A;  4TQS A;  5KFJ A;  2F1F A;  2GHW A;  2E1R A;  2ZBI A;  5T14 A;  2JDJ A;  2QG9 B;  2G1D A;  2VAS A;  4KGK A;  2VA3 A;  1I3O B;  4I2P A;  2R7X A;  2MKJ A;  4QWC A;  3CB4 A;  4NZ7 A;  2IRX A;  2WBM A;  2D3Z A;  2YQ3 A;  3POT A;  4DV1 F;  3PNI A;  3TRG A;  4A8W A;  1H3D A;  1LQ9 A;  5CH7 B;  4GRS A;  1G1X A;  3KLE B;  2Y8Y A;  1Y5N B;  3J7A 1;  3DHX A;  3D3B J;  1T8E A;  1WI8 A;  2Y1L B;  5KFP A;  2V34 A;  1HNZ J;  1QAI A;  3W63 A;  2HQI A;  4TY8 B;  3VF0 B;  2ZZT A;  4IG3 B;  1LWX A;  3S01 A;  3L4B C;  4ILM A;  1ZM2 A;  3UVJ B;  2WON A;  2ZH3 A;  1NK9 A;  4P7V A;  4D3H A;  1XQI A;  2QV6 A;  2Z57 B;  3MED A;  3ET6 A;  1U25 A;  4DQP A;  4O0I A;  1D9A A;  2CVI A;  2E29 A;  2QL5 B;  5LXR A;  4C97 A;  2IRY A;  5J2M B;  3V6D A;  3R5J B;  4JI2 J;  4DS4 A;  2W2M P;  5CZX A;  4LMZ A;  1HQU A;  3CCU S;  1HYS A;  1WEZ A;  2BRL A;  2HVI A;  4DR5 F;  3KLG A;  1M5O C;  1UPM B;  2UXC J;  2NXC A;  4QIV A;  4YFU A;  3BSN A;  3MM7 A;  3SSR A;  2B6A A;  4EWT A;  1GNK A;  2FIU A;  4IFV B;  4B3M F;  1Y5I B;  3ITH A;  4ECS A;  5KT7 A;  2GX8 A;  2YNF B;  5KFQ A;  5I3P A;  3W9I A;  2FD2 A;  5GAH U;  4M95 A;  3MPV A;  4K4Z A;  2GJI A;  2E66 A;  2B9X A;  4QR0 A;  3B82 A;  4KHP F;  4JV1 A;  4HH0 A;  3O44 A;  4A8X A;  1T94 A;  3HX9 A;  2VG7 B;  1U6B A;  2HBY B;  3PYF A;  1N0U A;  4CTA B;  4NA2 A;  1TUG B;  2G9O A;  2YQ0 A;  2A2C A;  4OYO A;  5B0D A;  4KY3 A;  1IKY B;  2VDI A;  3EE3 A;  3IRX B;  4LSZ B;  5C24 B;  4WII A;  4RUC A;  1SQG A;  2KYZ A;  3EPG A;  3BO3 A;  2P9E A;  4N7T A;  3PJ9 A;  1V5V A;  3OR2 A;  4MTP A;  4LR9 A;  2VFU A;  5LT5 A;  2P9G A;  4K4W A;  1H2U X;  2FLO A;  3NGK A;  1HNW J;  2UXB J;  1XN9 A;  5DET A;  3MD3 A;  3MMC B;  3QSI A;  3GCX P;  1CJU A;  4O44 A;  5CYM B;  4F0K A;  3I5C A;  5K20 B;  3KLG B;  5KG0 A;  3Q83 A;  3EPI A;  2NLW A;  4DPX A;  2O01 C;  4R0E A;  2BQR A;  1BC6 A;  4IG0 A;  3NBP A;  4RWX A;  1E6V A;  2NUH A;  1NO8 A;  4HEA 9;  4XO0 A;  5J2N A;  2FVC A;  2DNH A;  3U1N A;  2CQP A;  2AIR B;  2IDL A;  3PRV A;  2RH3 A;  4DV0 J;  2F63 A;  1GXU A;  4WU2 A;  4LR8 A;  2J8S A;  2HBR B;  3CCZ A;  2KVQ E;  3E01 A;  3CCR S;  2C3Y A;  4RUH A;  5IWA J;  1KVJ A;  1DY3 A;  4BS2 A;  4FVC A;  4JV0 A;  4GC6 A;  5C24 A;  3AGX A;  2RRB A;  3ILI A;  1HL6 A;  2R2S A;  2B0G A;  2K06 A;  1J27 A;  2UUA J;  4RX6 A;  3IA0 A;  4PWU A;  1TAQ A;  4KO0 A;  1CLF A;  3AXM A;  3IG1 A;  1JXV A;  3FCH A;  4MKA A;  1GXL A;  2MZ1 A;  1SJ3 P;  1SC1 B;  1RIS A;  3CJ2 A;  4DCP B;  3CXC R;  2KKH A;  5AE1 A;  3DRX A;  3HT0 A;  2OD6 A;  5KG1 A;  4HTJ A;  3M7V A;  2CQ1 A;  2CPI A;  1Q53 A;  3AH6 A;  3PW0 A;  1UL3 A;  2UUT A;  2YXL A;  3D3C J;  2CA9 A;  3UDL A;  4YB7 A;  3VR1 A;  2W25 A;  2VD3 A;  4NAS A;  2XUL A;  3T19 A;  2DXE A;  1UWB A;  1EB0 A;  2WB1 D;  4DR3 F;  1UFL A;  2EEY A;  4GVB B;  2ZC4 A;  5LXY A;  4UUX A;  1ZM9 A;  4OLO A;  6AT1 B;  1IR2 A;  4FDF A;  4R8U B;  1VBZ A;  2GVD B;  3CO9 A;  4C7Q A;  3PW4 A;  3DRP B;  1GT8 A;  4NLV A;  3IMQ J;  4Q43 A;  3PIO Q;  3Q89 A;  4RUB A;  5D6G A;  2W9C A;  1LW0 B;  3GIR A;  2J9D A;  1XIQ A;  4JYA J;  5FII A;  2NSB A;  2DT9 A;  1WSR A;  1JJH A;  1JJC B;  1MNE A;  2ZD1 A;  1KBR A;  4ZLL A;  4E8U A;  1SV5 A;  1JLE A;  4Q44 A;  5K8P A;  2CPF A;  1FKP A;  1TKZ A;  1IR1 A;  2MZJ A;  4NEY A;  4DSK A;  4DR7 J;  4NYP A;  3V81 A;  3VGT A;  3DKD A;  2EFQ A;  4KHM A;  1XNQ J;  2IDE A;  3QZ7 A;  1XMQ J;  3LP0 B;  4CH0 S;  4C0B A;  4ID5 A;  3VAG A;  4NXM F;  3EDR B;  2YKP A;  3D5M A;  3QT5 A;  4KGZ B;  2HRY A;  1BWV A;  1VS3 A;  2XO6 A;  2YVS A;  3F41 A;  1MU2 A;  3GE9 A;  1PYT A;  2MJU A;  3NKY A;  2GJ2 A;  2AD9 A;  2NRE A;  2XG8 A;  5LJ5 Y;  1FDN A;  2MKH A;  1Q1K A;  2VC1 A;  3P5T L;  4I7F B;  1XK8 A;  2EI5 A;  5D0E A;  4Z37 A;  4GKK J;  5FJ4 A;  1NPK A;  1VQ9 S;  4KHR A;  2YPY A;  4O4G A;  1WG4 A;  2AX0 A;  3NCP A;  1X5P A;  2ZC3 A;  3NG8 A;  2ASD A;  1RWW B;  3SZ2 A;  4KKO A;  2ALZ A;  4QJV A;  3C6T A;  5MAO A;  4H4K A;  5AXN A;  5HRO A;  4YS2 A;  1X4C A;  2CAJ A;  2G2Z A;  1VLO A;  4V1A k;  5FLX Y;  3RW6 A;  3CJ4 A;  4BWJ A;  1PJ5 A;  3SV3 A;  2V8G A;  2ZZM A;  4NLD A;  1S4F A;  3EDQ B;  3T5J A;  2O3D A;  4B9T A;  1U1K A;  1OS5 A;  3O8W A;  4ER8 A;  1DTQ B;  2RE1 A;  4OI3 A;  4UOF A;  2FJV A;  2COL A;  2AEJ A;  2FJD B;  3HT3 A;  2ZH5 A;  1M90 T;  1B4S A;  1NDC A;  3FFI A;  3O5T B;  5L9X A;  3KHH A;  3NWG A;  5I4M A;  5DG8 A;  3NMA A;  2V68 A;  1UET A;  1SQE A;  2ZE2 B;  3FBB A;  3PEJ A;  1ZA2 B;  4RBU A;  4CLU A;  1KNZ A;  2R7V A;  2IVY A;  2L3M A;  4CO2 A;  1CVJ A;  2J7K A;  2QIF A;  2XMU A;  4FXW A;  4PEO A;  1ZPW X;  3ZZT A;  2X1A A;  3RTV A;  3KLI A;  5HJX A;  3CUL A;  1CJK A;  4X4P A;  2KRR A;  4TY8 A;  1UJ6 A;  2V69 A;  1H2V Z;  1FRK A;  1TU0 B;  1BQN A;  3D6T B;  2ODX A;  2B7C B;  1H74 A;  1RAG B;  2LA4 A;  4O4G B;  2W2N P;  3DOL A;  2VJU A;  3KK2 B;  4J9K A;  2OHD A;  4OIX A;  4ED7 A;  3R1H A;  2AGO A;  1L3U A;  3CIZ A;  2B5J B;  2UXD F;  3WBZ A;  4I2Q A;  5KG3 A;  1BXN A;  3H5U A;  3H59 A;  4N8O A;  3PX4 A;  1FRI A;  1HQE A;  3ISN D;  5HAN A;  2QLX A;  3HDS A;  2BE7 D;  3M30 B;  3J81 Y;  5K5M A;  3MM6 A;  2FVS A;  2M3D A;  1Z2L A;  2AMC B;  4DR2 J;  3NNH A;  1KOH A;  2F4F A;  2K1R A;  5HLF A;  2HVE A;  5HP1 A;  5J2Q B;  4ZA1 A;  1FTC A;  9ATC B;  4NRT A;  2IJN A;  4J9S A;  7FD1 A;  4UQG A;  3IG1 B;  2BRK A;  1UEU A;  2W7A A;  2E7X A;  2M0G B;  1SQF A;  3CMA S;  1T9U A;  2FHM A;  3QMQ A;  3RU0 A;  2BVZ A;  4KV8 A;  1ZTT A;  1O0P A;  3GFZ A;  2BJD A;  5KFH A;  3V6J A;  2CJK A;  4B3T F;  2WVD A;  1RCO B;  4YB6 A;  1AT1 B;  1MRO B;  2DGO A;  3MOJ B;  3HSJ A;  3VTI A;  4BWM A;  4DG1 A;  3JYT A;  1NJZ A;  3N01 A;  1EJ7 L;  4DMZ A;  2KI2 A;  3FSX A;  3B78 A;  1T02 A;  2CJY B;  2HMI A;  3NWR A;  3HVT A;  1T03 B;  4O3R A;  2OTJ S;  3CJT A;  3E3X A;  3EUN A;  4CI0 B;  4FNI A;  4ZN3 A;  4RJV A;  2OGU A;  1IKV A;  4HHJ A;  1TKX A;  1VI7 A;  1EP4 A;  3MEK A;  4QYR A;  5CHC B;  3S7R A;  5KG4 A;  5HSP A;  4B9S A;  4N76 A;  1HQ2 A;  2XNR A;  3UDE A;  1U6F A;  2I0X A;  1SL2 A;  2O5D A;  4OZJ A;  4J9U E;  3HHE A;  1U2R A;  1VRT B;  3I87 A;  5J2Q A;  3BYR A;  1ZYQ A;  1ZM4 A;  2VB6 A;  3R5C A;  3TA1 A;  3BPD A;  2DB1 A;  2XS7 A;  2DY1 A;  3ISN C;  5T7L B;  5KFY A;  1DQ8 A;  3KJF B;  5GMK a;  4LF8 F;  8RUC A;  4ZPD A;  3CMQ A;  4Y00 A;  4A8K A;  2VOO A;  4U7C A;  4DV2 J;  3NP5 A;  3THT A;  1G7C B;  1YBA A;  1X31 C;  2PN6 A;  4M5G A;  2E1A A;  5AT1 B;  2G13 A;  4JP8 A;  3TX0 A;  3JSB A;  2ZHB A;  2ADC A;  4J80 A;  4IDK A;  2FUG 9;  2V4Q A;  4K4T A;  4LSN A;  1WHW A;  4JI0 F;  3GSI A;  1KQF B;  2FJW A;  1RYR A;  2XM3 A;  1SC6 A;  3OXL A;  1FFG B;  2QJ3 A;  3RUB L;  2OPQ B;  2FHK A;  1QE1 B;  1XR7 A;  5KFB A;  3CME S;  3KLF A;  2VPZ B;  1KTQ A;  3GV5 B;  2ZHA A;  1BE4 A;  4LQ3 A;  4OZ0 A;  3GCW P;  4NZ6 A;  1N5S A;  2AV5 A;  3DU5 A;  4S0M A;  3O6Q A;  1MMN A;  5A0Y B;  1AXQ A;  3ZFV A;  3CNQ P;  2HPU A;  5JXS A;  3DMJ B;  5L1J A;  2VA2 A;  1G4C A;  2I1R A;  2E1P A;  4NLO A;  2VPW B;  4I6A A;  3GIL A;  1N36 F;  3OR1 A;  2R8G A;  1NCL A;  3ENA A;  1JLC B;  1U8S A;  4IUF A;  2F9J A;  3HVA A;  1X8D A;  3A13 A;  1MN7 A;  2VJV A;  2FGC A;  1DAX A;  2V4J A;  3KG4 A;  4DR1 J;  5L1L A;  3OV7 A;  2CXE A;  2WSF C;  1HBO A;  4N77 A;  1U1R A;  4HT7 A;  1T95 A;  2N7C A;  3QPI A;  4CO3 A;  3VV2 B;  5IXU A;  2XLK A;  2DNR A;  3EMT A;  4F3M A;  2MHE A;  3EZO A;  2Z58 B;  3QYY A;  4K5R A;  1KEK A;  2P8I A;  2YY3 A;  3DRY A;  5D4N A;  4B9L A;  2K2P A;  4IDK B;  5DDR C;  3LGN A;  4F4Y A;  1H7X A;  2HND A;  1RT4 B;  4UF4 A;  3TP2 A;  3DN9 A;  5DZ6 A;  2ZJP Q;  4I6W A;  1B7Y B;  4CDI A;  3E2E A;  1FI4 A;  3H40 A;  3K8V A;  3OFE A;  7FDR A;  2W7O A;  3D28 A;  1DRZ A;  3OVB A;  3SDE A;  2OEK A;  4N47 A;  4K0K F;  2KJW A;  2A18 A;  3PVX A;  4NYO A;  5CAA A;  4EZ9 A;  5A0Y A;  3D4J A;  4WK1 A;  4P2M A;  1Y10 A;  2YNG A;  3PYE A;  3V6K A;  4CLP A;  2M5Y A;  3US5 A;  4X2B A;  2LEB A;  2E9Z A;  3IBW A;  4X66 J;  1TZ0 A;  2MZR A;  5DS7 A;  5JMN A;  1FD2 A;  2C3O A;  1QJH A;  3MTJ A;  1C1B B;  3FC9 A;  3IAM 9;  5D3G B;  4RBV A;  2G1H A;  4AL7 A;  1RU1 A;  3BYP A;  2H54 B;  4JI0 J;  1RT1 A;  4RPF A;  2UVR A;  4WU3 A;  4LBP A;  4RNH A;  3FMW A;  4NWB A;  1UVN A;  2PSZ A;  1FCA A;  3D0I E;  4OZN A;  1VC6 A;  3ZZR A;  2I5J A;  5FDL B;  3MI7 X;  1LXJ A;  1S1T A;  3LWM A;  1UVK A;  2BUN A;  1GTH A;  2ACM A;  3OQ2 A;  4ZHR A;  5F8L A;  3OD2 A;  3KJV B;  2DHH A;  2WSC C;  1N54 B;  2KXN B;  1AUS L;  3P49 B;  3EM1 A;  3UN5 A;  3C3L A;  2OKQ A;  2B8P A;  1YJU A;  2K3I A;  5KFE A;  3UD4 P;  5KFZ A;  2RT3 A;  1D1U A;  4DR4 J;  4B9M A;  4J9O A;  4ECY A;  2AWZ A;  2NXE A;  2CUY A;  2DBB A;  2ZEJ A;  2JRS A;  3T6B A;  4CH1 A;  1VQM S;  1NRK A;  1O6X A;  1X5O A;  2GIF A;  2JH3 A;  4RLE A;  3WHI A;  4KAI A;  3KYL A;  2UVV A;  2W24 A;  2JEG A;  4DV6 F;  3GP9 A;  4IR9 A;  3UW1 A;  2ZOF A;  2C2M B;  3CJR A;  4XDD A;  1H0H B;  3G82 B;  3OXF A;  3TEG A;  2FPH X;  2UZA A;  1R27 B;  2CNN B;  4A8S A;  3H20 A;  5E41 A;  4ZS6 A;  1Y7P A;  5DDO C;  5B7W A;  3H4B A;  2V9W A;  1VR6 A;  3OW2 R;  1UZD A;  4USW A;  4KO0 B;  1C1C A;  2LYV A;  1I1G A;  1RWU A;  1AZS B;  2GJF A;  1BMQ B;  3AAW B;  3GJT B;  4IG3 A;  4OV6 A;  2CQH A;  2E5G A;  3SCL E;  3ULH A;  4WTO B;  4X65 J;  1LNQ A;  3KK1 B;  3K5L A;  3DI6 A;  4K4S A;  2CG4 A;  4MIW A;  1HMV B;  2CPY A;  2FY1 A;  1S1T B;  2IAJ B;  5HAO A;  3JTN A;  4CRJ A;  9RUB A;  4DSI A;  3ET6 B;  2G0I A;  4FVM A;  2Q43 A;  3MEC A;  5KFI A;  2Q79 A;  5T7L A;  3A8E A;  2A6O A;  4DOZ A;  4CIO A;  3MMA A;  1HI8 A;  3L9Z A;  4QR2 A;  1R0A A;  4GKJ J;  1BWE A;  2AU0 A;  3PX6 A;  2ZBC A;  3ILJ A;  3NEK A;  2F40 A;  3OFF A;  4U9R A;  4M5K A;  2F3J A;  4P9S A;  2R8J A;  1N33 F;  1WI6 A;  2N3O A;  2D7S A;  3DLL Q;  3M1V A;  2IM2 A;  1HBN A;  1NLK L;  2RUG A;  3TA0 A;  4JV5 F;  1RE1 B;  1TQL A;  3MCN A;  2VQF J;  1WJ9 A;  3IM8 A;  2B26 A;  3LGM A;  2GC8 A;  2HHT A;  1S9F A;  5JVG Q;  3SYZ A;  3FDS A;  3M4X A;  1U2F A;  5F41 A;  2BKN A;  4HI1 A;  1FFW B;  3FQK A;  2CNL B;  3JXO A;  3LWL A;  1KTV A;  1F3V A;  4ANC A;  3WC2 A;  2HZC A;  2NS1 B;  4EO6 A;  4IRK A;  3R27 A;  2J8A A;  3CJ3 A;  3SCI E;  3U1L A;  3W66 A;  5JUM A;  1S6U A;  2DCL A;  5E7O B;  3W60 A;  2ZKT A;  2D1C A;  1NHV A;  1TVR A;  2RS8 A;  4X64 F;  1QAJ A;  2FZC B;  2WBR A;  2D74 B;  2IJF A;  3H2V E;  1RA6 A;  4ELT A;  3BH7 B;  2HNY A;  4Q8F A;  2LFV A;  5B0E A;  3M6V A;  2ATL A;  2E1M C;  5CD4 H;  2AJQ A;  1TKT A;  2K7K A;  2CPE A;  1CC7 A;  1IBK J;  1FKA F;  2V8H A;  4PQU B;  4KE5 A;  1TKX B;  2GGP B;  1HKA A;  2J5A A;  3N0V A;  1D09 B;  3LW5 C;  3M1V B;  1MWY A;  4M8L A;  3T5H A;  3DRS A;  3V6H A;  5IQQ A;  4ECQ A;  2KTQ A;  2MDA A;  4I2P B;  1Y00 A;  1GMW D;  3ELH A;  4PWD A;  3DFE A;  3PO4 A;  2LXF A;  3L7U A;  2B8Q A;  3K57 A;  1QY7 A;  4JI8 F;  4C0H A;  4AQY J;  5J2M A;  2R7U A;  1BGX T;  2B9W A;  2AGP A;  1TL7 A;  2DO4 A;  2KG1 A;  1N6Q A;  1M1K T;  2W2O P;  2HHQ A;  5LMU F;  1BUX A;  1UWA A;  3GZ7 A;  4ZVH A;  3HHK A;  3ICL A;  4PG7 A;  3RBZ A;  4EFA C;  3UVJ A;  1K1S A;  3IBF B;  2D9P A;  2LCW A;  4WP9 A;  2PC6 A;  4Y2I A;  1HNI B;  1VQP S;  1XNQ F;  3F0N A;  1NLT A;  4OHY A;  2XHW A;  1FES A;  2AKW B;  2G2O A;  3PAC A;  1TTH B;  1Y11 A;  2YBV A;  4J91 A;  3NGU A;  3DYA B;  3LZ8 A;  1NHK L;  5EUH A;  3U7J A;  2DPI A;  1FKO B;  1RQ0 A;  2DXF A;  2HHH J;  3IS9 B;  3D6H B;  1LOU A;  1C0T B;  1H72 C;  1IWG A;  3H2U B;  4WJB A;  2R7O A;  1PKU A;  3PR4 A;  2YH1 A;  3J80 U;  4F2R A;  3V2U C;  1HNV A;  4P10 A;  1G6B A;  5IT4 A;  1OQ6 A;  4DL7 A;  3C6E C;  3BSC A;  3CDW A;  3QWU A;  4DR6 F;  3GU0 A;  4KH0 B;  4IOA Q;  5KG5 A;  5E2Q A;  5IV4 A;  4CO5 A;  4DS5 A;  2PA3 A;  1KD1 T;  2DR5 A;  4DXL A;  2OSR A;  4DLE A;  2B5J A;  3Q8Q B;  4WBF A;  1XMO J;  3U02 A;  3CJS A;  5DQH A;  2MJN A;  3JAM U;  4Q0B A;  4USI A;  1MMD A;  2ZH4 A;  3DOK B;  1S5Z A;  2VH7 A;  1U7L A;  2J7W A;  3CDU A;  4ALZ A;  4GKK F;  5F9N A;  1FTR A;  1HBM B;  3CJQ A;  5EX3 A;  4ELV A;  3KK3 A;  1R3N A;  2YKN B;  1LW2 A;  3HI9 A;  3MCM A;  1X7V A;  2XY6 A;  2ABY A;  2GFF A;  1PG5 B;  2HHS A;  4I4B A;  5LSR A;  3VAL A;  1R8P A;  3CCQ S;  1NK8 A;  1YG0 A;  3MR6 A;  2XS2 A;  1A0O B;  1KLM B;  2D69 A;  3G96 A;  2WB4 A;  3TO8 A;  2OLW A;  3R1L A;  1APS A;  1C4A A;  1S6O A;  2CQI A;  4NZ0 A;  4AUK A;  2DD8 S;  4DDF A;  4RWW A;  2HFZ A;  3CW2 C;  4GKJ F;  1WDT A;  4DBQ A;  5J2P B;  2ZWO A;  4KIA A;  1SL0 A;  1C0U A;  1LFW A;  5EDW A;  1VIO A;  1NH7 A;  3DGP A;  3MAH A;  1I94 F;  3NCQ A;  1B0P A;  1JIH A;  3VQT A;  1NZA A;  3TAP A;  1E6V B;  2M7S A;  1X9M A;  3RRG A;  1CBK A;  3BV8 A;  2XLJ A;  1UKU A;  3MOZ A;  5E3Q A;  3JSM A;  5L9N A;  4B02 A;  2CPH A;  3PJW A;  2QC3 A;  3FMB A;  2C42 A;  1WC0 A;  2YWK A;  1V3R A;  5EWF A;  2C28 A;  2HMI B;  1Q16 B;  3KHR A;  2V9K A;  2UUW A;  4K5S A;  3MTK A;  2ZVI A;  1XR5 A;  2M88 A;  3BH6 B;  5KFD A;  1Y3K A;  5GVQ A;  3VGV A;  3JAM Y;  2PI5 A;  2YQ1 A;  3DOM A;  1VJW A;  3G87 A;  3KNA A;  1QVG R;  5EWE A;  4DUZ F;  3OVA A;  2XTJ P;  3Q0A A;  4BDP A;  3MZI A;  5F0U A;  2QYG A;  4B08 A;  2F4V J;  2HHU A;  4U95 A;  2FVR A;  1L3S A;  4PR6 A;  4LF6 J;  4LFB F;  2WAQ D;  3BRE A;  3MEE B;  4YR2 A;  2FTR A;  2KM8 B;  2JVM A;  3KLE A;  2ZM6 F;  2L41 A;  2NXU A;  3QT8 A;  5F8J A;  3ILO A;  4I64 A;  3RBD A;  3J80 Y;  1JLG B;  2JWN A;  1TV6 A;  2FQQ B;  4ZJL A;  3TVK A;  2VUG A;  3ZZO A;  5BJR A;  2CYY A;  3QIP B;  3QJP A;  1DTQ A;  3WIU A;  2RVJ A;  5A8K A;  2KHC A;  1S57 A;  3AD7 C;  3IFE A;  3M6X A;  2XMT A;  4UST A;  1SC3 B;  5A76 A;  3HFZ B;  1NKE A;  1CG2 A;  2PGC A;  3ENV A;  4ZCM A;  4WFY A;  4QW8 A;  3R5D A;  3G6V A;  1CJT A;  3N4W A;  2EFO A;  2IM1 A;  1F5C A;  4R0J A;  5HO4 A;  1AUD A;  2UUA F;  1JLF A;  3M05 A;  3VQS A;  5M2R A;  1KKH A;  2GHP A;  2HWT A;  5D77 A;  3GIM A;  1T05 B;  2E5J A;  5B09 A;  1TUV A;  5ETT A;  4CNY A;  4DCJ B;  2JJ4 D;  6FDR A;  2B4V A;  2AX1 A;  3CTR A;  4ZMM A;  3OHA A;  1BQX A;  1TAU A;  3NS7 B;  3UN2 A;  1F6T A;  4OYB A;  3MMB A;  2E9T A;  5DGA A;  3A8I A;  4U7U K;  5F8I A;  5L46 A;  3Q22 A;  1IKX A;  1WC5 A;  5KFW A;  1J5O B;  4WTY A;  4NLG A;  1NND A;  3IM9 A;  4DEZ A;  1UA0 A;  3AOC A;  2DNQ A;  2NQP A;  4PXD A;  3J81 j;  2MZS A;  2QLB B;  2XQC A;  2N7Y A;  2HBZ B;  1U45 A;  3PW2 A;  1IKW B;  2RDI A;  1S6P B;  4NRU A;  1N48 A;  2DK2 A;  2CNK B;  3QJJ A;  4NLX A;  4JI3 F;  5IWA F;  4ED8 A;  2W2P P;  1ZAX A;  1RWP B;  2R3V A;  4UTG A;  3SCK E;  1YKW A;  2AQ4 A;  2LDI A;  4XIU A;  4C3L A;  3HD2 A;  2MZQ A;  2CWX A;  3PYD A;  2HND B;  4DPO A;  3UR3 C;  1MML A;  5AE3 A;  1ZOT A;  2QMU B;  2WTF A;  1YJW S;  1N32 F;  4KYZ A;  3EXY A;  4G1Q A;  1G2E A;  2ILY A;  4OJG A;  3R6G B;  3DDN A;  2J9E A;  2PI4 A;  4IH7 A;  3MPW A;  2P6S A;  3C15 A;  1VBY A;  4PRF A;  3VZI A;  2QEX S;  1X0P A;  1S6Q B;  5IT9 U;  4EUV A;  1L5U A;  2R2U A;  4P52 A;  4O3O A;  3CD5 A;  1RT2 B;  2MKY A;  3DM2 A;  5ETN A;  2IC3 B;  4IO9 Q;  1X4H A;  2DGS A;  1NPR A;  3FFI B;  1U1M A;  3ZC4 A;  3IAS 9;  1URR A;  4B3R F;  4ZVS B;  5DDQ C;  1HPZ B;  3OJS A;  2CNO B;  3H25 A;  1U47 A;  2IMW P;  2UXB F;  1S9E B;  1I6J A;  4FKY A;  2H4W B;  2CPX A;  2Z56 B;  3O2I A;  1RTH B;  4CLW A;  5I42 B;  3G8S A;  1OJ4 A;  2YH0 A;  4KGX B;  3MEG A;  1W7W A;  1D8Y A;  1EKR A;  1U0H A;  1B64 A;  2B4U A;  4GVL A;  1UAW A;  5CYQ A;  1UZH A;  1Z2Z A;  3PDN A;  3KUH A;  4OZL A;  2CRL A;  1X5T A;  3VHQ A;  2N4D A;  3I31 A;  3BO4 A;  1AA1 B;  1BLU A;  2MY7 A;  2VU5 A;  1OYE A;  2WRM A;  4ZLP A;  3KJV A;  4ZLN A;  4P2S A;  4DV0 F;  3UNY A;  3TAQ A;  2UUC F;  5C42 B;  4JI5 J;  3KNG A;  5C25 B;  2MPU A;  4CLZ A;  3T5L A;  3TVZ A;  3I32 A;  2FY8 A;  5J1E B;  1BQM A;  1SUQ A;  3PIP Q;  3G4S S;  2LKZ A;  4WWS A;  1C0U B;  4AL6 A;  2WHO A;  3TZY A;  1RLD A;  3C14 A;  3LP2 A;  1TL1 B;  3L7P A;  4J9V A;  2H48 B;  1FO1 A;  1Q5V A;  3HSG A;  4NLR A;  4UUW A;  4KRW A;  5A6W A;  4C8N A;  3QFW A;  4ILR A;  4OX8 A;  4XPC A;  1HBU B;  4ETZ A;  4MH8 A;  3W5Y A;  2KRB A;  3MPD A;  4RKU C;  1VC0 A;  2V50 A;  4N8N A;  3MAA B;  2OO4 A;  3N5F A;  4WFB Q;  1I51 B;  2R2T A;  1S79 A;  1T9Y A;  2XZD B;  3SI8 A;  4JI5 F;  1RT5 B;  3QGG A;  2KT3 A;  4OYW A;  2R7W A;  1FVS A;  4NMX A;  3SEO A;  5D0H A;  4WF9 Q;  2A6M A;  4L6V 3;  4YY3 J;  3PZP A;  1IBL F;  2J6U A;  3H90 A;  1TL4 A;  2BOA A;  3MMJ A;  5F8G A;  2OFG X;  3MEE A;  4JOU A;  3RYL A;  2XMM A;  4F7V A;  4DV3 F;  1R0A B;  2MHN A;  4OLP A;  1PIE A;  2V8D A;  3CCW A;  1FHT A;  2FLL A;  2GV1 A;  3WX8 A;  2ASY A;  5E3R A;  3Q8R B;  1VHI A;  3MM9 A;  1RWX B;  2V67 A;  4PPD A;  1RGV A;  2YKA A;  4IFY B;  4TU9 A;  4KPY A;  3IR7 B;  1HA1 A;  1SH0 A;  1R43 A;  4JYA F;  5HVF A;  3GYX B;  1U02 A;  4DV5 J;  1HW9 A;  3DLK B;  4DQS A;  4JI4 F;  3GJQ B;  3POT B;  1YIJ S;  2HZA A;  4GMK A;  2BDP A;  4B3S F;  2RQC A;  3MUT P;  1VRQ C;  5GAE I;  1RP5 A;  5I3U A;  3SSQ A;  3K58 A;  3BGR B;  4QBU A;  5KFS A;  1PJ7 A;  2VF3 A;  3PY8 A;  2AGQ A;  4KB7 A;  4I56 A;  5HBM B;  2ZBQ A;  1TMM A;  1JK9 B;  1QTM A;  5RUB A;  4U8Y A;  1NJI T;  4ECT A;  3PW5 A;  2C3M A;  1S49 A;  1IN0 A;  3FBF A;  2HSE B;  1DTT B;  4PG6 A;  2QSF A;  5D78 A;  2IVF B;  1WEY A;  4F25 A;  1S1X A;  3GII A;  3ILL A;  2UXD J;  2AJF E;  2DIV A;  1SCJ B;  1NU4 A;  3KHL A;  1ULR A;  3C5X C;  4QWD A;  3LP1 A;  3CJK A;  1HQU B;  5ETP A;  2OEJ A;  2XCP A;  2FJA B;  4UOC A;  2XY7 A;  2HFS A;  4LF9 J;  2R7Q A;  3I4H X;  1WKJ A;  3CT9 A;  1M5K C;  1GK8 A;  3DHW C;  3NCR A;  4P71 A;  2XGQ A;  3CC2 S;  2ERR A;  4C8O A;  1FWL A;  4P74 A;  3N28 A;  2VG6 B;  3VGS A;  4NCG B;  4DFP A;  4H4M B;  1T0T V;  3OXG A;  4QU6 A;  1IBM J;  2KT5 A;  1WOR A;  3D67 A;  2JEF A;  1LWE B;  3R7S B;  4DF8 A;  2Y0S D;  3E8O A;  1NKC A;  4HKQ A;  1RAJ A;  4X4V A;  4UOG A;  3BQ1 A;  4J5O A;  3KTQ A;  1QSY A;  4K2X A;  2DH8 A;  4NLP A;  2VC0 A;  5F8H A;  3W2V A;  1RAH B;  1RKJ A;  2N82 B;  3EGZ A;  4QIE A;  4IRC A;  3BS9 A;  1XC9 A;  1NJY A;  4C8Y A;  5HLF B;  2JVR A;  3HF5 A;  2KO1 A;  2GA7 A;  2Y9H A;  5HQM A;  1BD6 A;  1Y0H A;  4LRF A;  1S9E A;  1TP7 A;  3MD1 A;  2FJE B;  4HI2 A;  3W3S A;  3OL7 A;  1KHV A;  1JKH B;  1QUV A;  3LA0 A;  3MCO A;  1SPB P;  2RD5 C;  4DJB A;  2H51 B;  4G6V B;  1H73 A;  1M1H A;  2DGU A;  2L9D A;  4KV8 B;  3K2Y A;  3UO0 A;  3W9J A;  1EET A;  2BJ3 A;  1YBT A;  1CS4 B;  3M8P B;  4N5S A;  3KLH B;  2CKW A;  1O51 A;  2LP4 A;  4W98 A;  1NZ8 A;  3RRK A;  4TQR A;  3M2V A;  3H5Y A;  4RBT A;  4DR3 J;  3MMB B;  1PC4 A;  4NCG A;  3D1Q A;  1SKU B;  3LAN A;  2HIQ A;  2QGF B;  4P75 A;  5GAH I;  3J7Z T;  1PGZ A;  1FDD A;  1S77 D;  1GX5 A;  2FDN A;  3P45 B;  4Y3C A;  3I55 S;  2C2Z B;  4DQQ A;  2CFX A;  3VAH A;  4Y6I A;  4FF3 A;  3CJ5 A;  3CJ0 A;  4JV2 A;  2E7V A;  2GIQ A;  4ED1 A;  3OLB A;  4FBU A;  2DYA A;  4C3K A;  3BGO P;  2F4V F;  3RAM A;  1R8A A;  2H9Z A;  2IIH A;  2VV5 A;  4QYZ J;  2B4P A;  2X51 A;  4TY9 A;  2MQP A;  2EPI A;  2IJR A;  5AE2 A;  3TEH B;  3UFC X;  3R97 A;  2JVO A;  5HMW A;  3VAM A;  3OFG A;  1JXL A;  1I5O B;  4G3I A;  2KL8 A;  3AHP A;  1M0S A;  3M6W A;  1F3F A;  3AKO B;  1YRU A;  4H4K C;  4L76 A;  2C3P A;  4CH7 A;  1SKR A;  1HNX F;  2CVE A;  1U2C A;  2H5J B;  4MT1 A;  1BY9 A;  1PC5 A;  2CDR B;  2EVZ A;  5F3T A;  3KUG A;  1WDD A;  4AE5 A;  2R2R A;  1WF0 A;  4HHH A;  2XEX A;  5MLC V;  2VOD A;  2RNE A;  2W4D A;  1CS4 A;  1YJ7 A;  3RAQ A;  1F60 B;  1GMU A;  3HMJ G;  3Q23 A;  3C16 B;  1S76 D;  3HKW A;  1X4A A;  2ZBR A;  3GJS B;  1NKB A;  5CXT A;  2X7I A;  3A8K A;  2BYC A;  2AW0 A;  4UZC A;  2RSQ A;  3M9M B;  1Q78 A;  2UU9 F;  3SBM A;  3QJL A;  2ZBP A;  2N4C A;  2AEM A;  1YX2 A;  2ZKU A;  2XY5 A;  4HH1 A;  1VLY A;  3CIM A;  3NGR A;  4PPZ A;  3BGL A;  4ZJQ A;  4KH1 B;  2XSJ B;  4A4J A;  1HHQ A;  2AJ2 A;  3L7O A;  4DZ6 A;  3MM8 B;  3DRS B;  1LK5 A;  2IM3 A;  3EYZ A;  2Q1L A;  2DNM A;  4DSF A;  2K1R B;  1WD6 A;  4G1I A;  2RIJ A;  5KG6 A;  2JEI A;  2MKI A;  1K44 A;  3I82 A;  1JLB B;  4MIA A;  4RW8 B;  4ZP9 A;  2EK1 A;  1JLE B;  4NLU A;  4NLS A;  1WHX A;  2HZV A;  4AXI A;  3GR0 A;  3RG6 A;  2DIU A;  5DG9 A;  4EYH B;  3FQL A;  3BBB A;  5J1N A;  4B9V A;  4PCQ A;  4NXN J;  5LL6 d;  1FNM A;  3BN7 A;  3W5Z A;  1NJX A;  1XNR J;  3BN4 A;  3FBE A;  5BYQ A;  2LEC A;  2Y0B B;  3CD7 A;  4ZCK A;  1QAY A;  1N32 J;  2RF2 B;  4PZV A;  4JB8 B;  4B17 A;  5ETV A;  3QBC A;  4QZV B;  1U8W A;  2FC8 A;  1OY6 A;  1VQ4 S;  2E5L F;  3BKU A;  1OO0 B;  4USH A;  1MU2 B;  4Y0F A;  5L8R C;  5GAG U;  2F7V A;  4MJK A;  5DDP C;  3AOA A;  3T41 A;  4X62 J;  1X60 A;  3M2U B;  3GLJ A;  4A48 A;  2JLG A;  2ZH2 A;  2VZ9 A;  2IY5 B;  3UPF A;  1CUL A;  2BEF A;  3VWS A;  5L1K A;  4DFK A;  3M2R B;  1B0T A;  4M5H A;  4CLT A;  1KSP A;  2JLE A;  1GFW B;  1X9W A;  4J9N A;  2HEK A;  4DV1 J;  1KFS A;  2V63 A;  3TNV A;  2DGX A;  2QT7 A;  3M8Z A;  2P6T A;  2VG5 A;  3EWG A;  1NDP A;  1J5E J;  2XBP A;  2YNH A;  4FYV B;  2ZZN A;  1TK0 A;  5HRO B;  3D1H A;  4PXB A;  1OWX A;  2MGZ B;  2AZ3 A;  2YKO A;  1MLA A;  3W2V B;  4LIR A;  3OSN A;  3EZU A;  3I5B A;  3JQJ A;  1NH8 A;  4JI7 J;  2PII A;  1JLQ A;  1N4L A;  3E01 B;  1IKW A;  2OI2 A;  2I5J B;  5FDL A;  2XI2 A;  2XWX A;  8ATC B;  1D9D A;  3NL0 A;  2QA4 S;  3N6N A;  1Q7L B;  3AB2 B;  3HZG A;  2XGP A;  5IM0 B;  5LMU J;  5GMD A;  2QL7 B;  3CCS S;  3B8H A;  3BSA A;  3AY0 A;  2YNF A;  1WTF A;  2Z2Z A;  2BX6 A;  1R0C B;  3S8S A;  4U67 Q;  2XCA A;  3T1H J;  1V3S A;  1JKH A;  3DC2 A;  1XEZ A;  3R6L B;  4DR5 J;  2PEB A;  1ZAV A;  1IBC B;  3TR5 A;  1FXR A;  1RT1 B;  1K0T A;  2KYX A;  4NL5 A;  4Y2A A;  4DZD A;  3KLH A;  1U1O A;  3MGJ A;  4F4K A;  1WF1 A;  4HAC B;  2ZHO A;  4ED4 A;  3D2W A;  2HS0 A;  3GFH A;  4GO5 X;  3M2R A;  1SJ4 P;  4FPI A;  1VQS A;  1S9G B;  3CCJ S;  3R3T A;  1UEV A;  2VBX A;  4H4O B;  4C8Z A;  3M6U A;  4DR6 J;  2ZIT A;  1REV A;  3HVW A;  3PJX A;  1IR0 A;  2YX1 A;  3A3P B;  3OTO J;  3FSI A;  2H1Y A;  3M8Q B;  3OR2 B;  3DDK A;  4MKV A;  2J6S A;  1RAA B;  1WC6 A;  2X1B A;  5I42 A;  3LPY A;  3LUY A;  1AZS A;  2HLT A;  2BOP A;  2UUB J;  4CYU B;  2HGN A;  1OY8 A;  3T5K A;  3DOM B;  4TLR A;  3BPS P;  2U2F A;  3IR6 B;  2VG6 A;  3MDF A;  3DLE B;  4A46 A;  2F5G A;  3IC1 A;  5KFA A;  3OTB A;  1U1N A;  3IN5 A;  1F5A A;  1S0O A;  1F2G A;  1YRX A;  4FNH A;  4X4O A;  3SV4 A;  2J76 E;  2DGW A;  4UOH A;  5D15 A;  4F67 A;  2IVM A;  1R6Y A;  1C0T A;  4F4X A;  4A8O A;  3TJ8 A;  3HLU A;  4B9N A;  1HBN B;  3BM7 A;  3UR0 A;  4DPU A;  4IQM A;  2QA1 A;  4LF4 J;  1JXE A;  3E51 A;  1NSA A;  2DGT A;  3QNW B;  4ITS A;  5GAD I;  2V2V A;  4FS1 A;  1S0V A;  3CCE S;  1B7F A;  1FDA A;  1EX8 A;  3K5O A;  2DNY A;  3NGT A;  2GAH C;  1C2P A;  4WIQ A;  4ZVO B;  1YJ9 S;  5BR8 J;  1KLM A;  3FSY A;  4DL2 A;  4CLK A;  5CAB A;  4O0N A;  3FUY A;  1U24 A;  3FVY A;  1FNO A;  2MMY A;  3RB0 A;  4IQX A;  3MAA A;  2LVW A;  2VFS A;  4OV1 A;  3ZTS A;  4CWB A;  5M2U A;  4OYM A;  1HWI A;  3M8P A;  4NXN F;  2M9K A;  4ZVR B;  2RU3 A;  1S0N A;  2YKN A;  1KON A;  1OQ3 A;  1TVR B;  4RNN A;  4Q8E A;  1XMB A;  3I38 A;  4LF9 F;  4DWI A;  1LWF A;  2JHE A;  4TNO A;  4F26 A;  5DJB A;  1LXN A;  3FBC A;  3LAM A;  4TXS A;  2I6W A;  4M63 A;  2YWW A;  3VGU A;  4LF2 A;  4FYW B;  8AT1 B;  4OI6 A;  4OHZ A;  3FJ2 A;  1XMO F;  4EZ6 A;  3MFH A;  2W9A A;  5BXI A;  3IBC B;  3W61 A;  1U48 A;  4C8K A;  1FRH A;  3T3F A;  2I9S A;  4AFF A;  2E5H A;  3MM9 B;  3K5P A;  5IZH A;  2FLP A;  1IXK A;  4Y34 A;  2ALY B;  3G9C A;  4FXV A;  5CQG A;  3NS5 A;  3CGI A;  3M32 A;  2XYP B;  1RAE B;  3I5A A;  1F2H A;  2YNI B;  3AD8 C;  4LQ9 A;  2A0F B;  4ZJO A;  3DRR A;  3X3U A;  4YR3 A;  1TEL A;  4GO7 X;  2ZE2 A;  3M2U A;  3P8B B;  2DH7 A;  3PTW A;  2JC0 A;  2WW4 A;  1O5J A;  4WP8 A;  3UE2 A;  4MMO A;  3GMG A;  4A47 A;  4EGL A;  4RNO A;  1QE1 A;  3ZXW A;  4ZPA A;  4AXJ A;  3TZX A;  4UT4 A;  1ITP A;  1RHJ B;  5BYS A;  1T11 A;  2LQB A;  4NCA A;  2CIM A;  3K5N A;  4YME A;  3QAT A;  1IKY A;  3IRX A;  3EVW A;  1PAU B;  1Q8I A;  3EGV A;  4WYW A;  1FRL A;  1KS2 A;  2Z2M A;  4ZP7 A;  4Q45 A;  2YNH B;  2HUR A;  2ZUA A;  1XTZ A;  1CJT B;  2W9B A;  4DFM A;  4PWD B;  2B51 A;  2J9D E;  1CSJ A;  1NPP A;  1RT6 A;  1HHT P;  4HL9 A;  4LSL A;  4ECX A;  3FRZ A;  4W90 B;  3V4M A;  1CEZ A;  3QRR A;  5IT0 A;  1SXL A;  1TL3 B;  2BW7 A;  1JX4 A;  4DV3 J;  5CCM A;  4FF1 A;  3ETO A;  1SBR A;  3GJR B;  2EFG A;  2YWG A;  4YHH J;  5DQG A;  5A8K B;  4YQW A;  1M1G A;  2BAB A;  2XMV A;  2MSS A;  2CG8 A;  2Q6B A;  2YKQ A;  5F0W A;  1N5Q A;  5G4D A;  4CLS A;  5H9E K;  1YIT S;  1YGY A;  3QQC D;  4C0O C;  2B9E A;  1S7H A;  3AJ2 A;  4DV2 F;  3NNA A;  5KT3 A;  2ZWP A;  4Q2M A;  3H5X A;  1DQA A;  1GMW A;  1RKI A;  3M8W A;  1ZA1 B;  5HL7 Q;  4DLG A;  2QA4 G;  2NXN A;  3NAI A;  3BDE A;  5A6P A;  3M8S A;  1LW2 B;  4USV A;  3D66 A;  2RF2 A;  4NPO A;  1BHN A;  2EG1 A;  4F2S A;  1TL1 A;  3D0G E;  1I94 J;  2WON B;  5K8M A;  2ROE A;  4BBY A;  2BXJ A;  3FK4 A;  4ZCI A;  4YHH F;  3IGV A;  1V9O A;  3FCV A;  4TU7 A;  3U1M A;  3EGW B;  2ZNZ A;  3DOK A;  3KMQ A;  4CLL A;  2KDO A;  1KVK A;  1U1Q A;  2E9R X;  1FJC A;  2HFV A;  4WKY A;  4I68 A;  1KC8 T;  4MKB A;  5KFO A;  1HWU A;  5DG7 A;  2DCU B;  3NOG A;  2ROG A;  4ZHR B;  1ARO P;  2B6A B;  4ZVP B;  2VL1 A;  1JB0 C;  3A1Y G;  3W9H A;  4YN3 B;  4USK A;  3CED A;  1QDU B;  2EFP A;  1CJV B;  2PE8 A;  3OT9 A;  2DY9 A;  3S6E A;  3HM9 A;  2GQC A;  2GW8 A;  5KOX A;  2FGO A;  3C66 A;  4X62 F;  3HHN B;  2J9C A;  1NJW A;  2FB0 A;  5KFR A;  2ZJR Q;  1OY9 A;  1TL7 B;  4HDH A;  7AT1 B;  3UD5 A;  3H2L A;  1N6Q B;  3J7Z 5;  2CDQ A;  2KB2 A;  4KC5 A;  3CF5 Q;  4JI2 F;  2OPP B;  2HAI A;  1T3N A;  3G2X A;  3TX8 A;  1YJR A;  1FXD A;  4HLB A;  1K9M T;  2BM0 A;  3BBF A;  5DO2 A;  1WKK A;  1RTJ A;  3I6P A;  2HK2 A;  3HXM A;  1DQ9 A;  2HQC A;  3BKF A;  2FVQ A;  2HIY A;  1YJN S;  4NLY A;  3BQ0 A;  2QZ8 A;  2E5L J;  2R7T A;  3HHL C;  4DHV A;  2NPI A;  4AND A;  4C11 A;  1HHS A;  1RT7 B;  2GCF A;  2MYF A;  1U1P A;  1SL1 A;  3HJF A;  2O67 A;  4LVO P;  4DI6 A;  2K3K A;  2QLD A;  3MEG B;  2PFF B;  1RA7 A;  3QLH A;  2O1P A;  4X66 F;  1QSL A;  3H8Y A;  5ETQ A;  2BJ1 A;  3TAM A;  2CQ2 A;  5CYQ B;  1V6H A;  2OMO A;  1JLC A;  1S7I A;  4AL5 A;  1LEO A;  1C3G A;  2NPF A;  1R0B G;  1VC5 A;  1FK9 A;  1FJG J;  5D8H B;  2MQM A;  2EFV A;  3TQ1 A;  3I0S B;  2RKI A;  2OEL A;  3T1H F;  5G0R A;  3ISZ A;  2AJ1 A;  5E0O A;  1UEK A;  5L1I A;  3BDP A;  2V5H G;  2G4B A;  5AJ3 F;  2CAD A;  4FXD A;  1NK5 A;  5L38 A;  2KN4 A;  2CQ3 A;  4TVA B;  4DN9 A;  1NK4 A;  4NYZ A;  3W5X A;  2DPJ A;  2K7J A;  3F56 A;  4FPR A;  3KJN B;  5IS2 A;  3LAL A;  4EYI B;  3RR7 A;  4BC9 A;  1JJ2 R;  3R5B A;  1VQY A;  4JI7 F;  4TYB A;  2RRA A;  1SVD A;  2OPS A;  2Z4P A;  2GQQ A;  4CT9 A;  3TJA A;  2QYC A;  3PHT A;  2BAN B;  4Q2L A;  4JI4 J;  1FJ7 A;  2LMI A;  4U6P A;  3H5S A;  3PFO A;  3LO3 A;  2BE9 B;  4C11 B;  1XAO A;  1EIY B;  2YKM A;  4JI1 F;  1S6P A;  4J7C A;  1K47 A;  1N88 A;  5SZT A;  2VKR A;  1B0V A;  5J2P A;  4MFB B;  3ZTR A;  1RTI A;  5H9F K;  1W25 A;  4CCH A;  1MW7 A;  1U6Z A;  4YDD B;  1R6V A;  3MUM P;  2LU1 A;  1FWK A;  1MSW D;  2HNY B;  2JL9 A;  3NS6 A;  4DR2 F;  5ETR A;  2L9W A;  1KWM A;  2D3O R;  3GPA A;  4OYZ A;  3VVU A;  5JJB A;  1WWH A;  3R9L A;  3SXL A;  3CCV S;  1DZ5 A;  5D4P A;  4EU0 A;  4URG A;  5HJY A;  2W1B A;  1S6Q A;  4OZ2 A;  4Y65 A;  1YTY A;  1ICE B;  3TWZ A;  4ZP6 A;  1X4F A;  2AZ1 A;  5IC4 B;  3KLV A;  1K0V A;  1RTZ A;  1B99 A;  2F8M A;  1ZET A;  3DXS X;  2V0N A;  5DZ7 A;  1HR0 F;  4I2Q B;  4ES3 A;  4AD6 A;  1XMQ F;  1U09 A;  1HPZ A;  4OX6 A;  3R2D J;  1VK3 A;  2F9D A;  2GMH A;  2GVZ B;  2OPS B;  1NDK A;  4DUY F;  3ZZP A;  5DQI A;  4LF5 J;  2BZ2 A;  3P3D A;  3CCM S;  2VHG A;  5E33 A;  1AFJ A;  1YHQ S;  1RK8 A;  3C6U A;  4NML A;  4LFC F;  1NBE B;  1HWK A;  1OYD A;  5LJ3 Y;  4O4R A;  3QO9 B;  3U27 A;  5HBM A;  1UA1 A;  2LLZ A;  3Q8S B;  5M2P A;  3RAX A;  4EK2 A;  1NSP A;  2I8E A;  2XWY A;  3PM9 A;  2HRT A;  2Y3Y A;  4TLQ A;  1YJV A;  4OQJ A;  1KP6 A;  2XSF A;  3TZZ A;  5F9L A;  2HS4 A;  5LMN F;  4ILL A;  3DYA A;  3AT1 B;  1T9T A;  3THP A;  1HWL A;  2YTC A;  5IV3 A;  4TN2 A;  3IS9 A;  5A8R B;  2X1F A;  1FNX H;  4K50 A;  1N0V C;  1FKO A;  3WX4 A;  3LGH A;  3FGV A;  3SDE B;  3RGI A;  4LRD A;  2POK A;  3KK1 A;  2DRB A;  2GHV C;  2RHS B;  4ZOS A;  1MRO A;  2MB0 B;  2D41 A;  2YPZ A;  4FBT A;  2ZUG A;  1P8G A;  2GNK A;  4H4M A;  4LRB A;  4RW9 A;  3QSY B;  5A2Q U;  4OHW A;  5J1P A;  4PWW A;  1UP1 A;  2P5V A;  5H9E J;  1GX6 A;  4P72 A;  4NOH A;  3DNC A;  4WCE Q;  3VAK A;  2XMW A;  2P2C B;  1WEX A;  4DV4 F;  3C8Y A;  1QAX A;  1R89 A;  2WVC A;  4MK9 A;  4DX8 H;  4J9L A;  4NCB A;  4ZLJ A;  2DNO A;  2OML A;  3P5B P;  3P96 A;  1T9V A;  2IRU A;  4XTT A;  2KG0 A;  2HVH A;  4WK3 A;  1H6K X;  4IFV A;  3H0P A;  2ACY A;  4Y2M A;  3CO0 P;  5E3C A;  4BC7 A;  4J9M A;  5HMZ A;  1HI0 P;  4YEA A;  3GV8 B;  3QZ8 A;  3X1L B;  2ADB A;  3UQS A;  2Z2Y B;  3NMR A;  2A2D A;  2DNP A;  4ICL B;  1RXO B;  1YJT A;  1NAQ A;  3HHL A;  4WFA Q;  2IHR 1;  4OYP A;  2Y1J A;  1AB8 A;  4KBI A;  1GTE A;  2YWE A;  5D0G A;  1H2T Z;  4LIW A;  1NUE A;  3HKZ D;  5EX0 A;  2DIT A;  2UXC F;  3BGF A;  3ZZ0 A;  4CZC A;  1FK9 B;  1H98 A;  3ETM A;  4DX6 A;  4IH6 A;  4L75 A;  3GON A;  3RR8 A;  1S1W B;  3LAK A;  1MG7 A;  2LQ9 A;  2QN6 B;  2RKI B;  3TW0 A;  2OPR A;  1DFD A;  4QU7 A;  2PMZ D;  1IM4 A;  1D9F A;  3T6J A;  2AT1 B;  3W2W A;  5CA5 A;  4ED3 A;  4K4U A;  1SIZ A;  1WG1 A;  2V6A A;  4F0H A;  4LFA F;  2DHS A;  2RIL A;  1N5V A;  2W9C B;  3PYG A;  4CNZ A;  1HD0 A;  2HHV A;  3JB9 k;  4B3O B;  4LRC A;  3Q86 A;  2WSE C;  1LWF B;  4DL3 A;  1S1X B;  4IH5 A;  4WFN Q;  1YSJ A;  3OTE A;  4O3Q A;  1P27 B;  2HKE A;  4C48 A;  2HHH F;  2FYX A;  3SCJ E;  2B9Y A;  3VAJ A;  4V19 J;  3R5G A;  2G0J A;  2V94 A;  1S48 A;  3ZTO A;  3FZ2 A;  5JVH Q;  2IA6 A;  1RI7 A;  4FF2 A;  3HFV A;  5J1E A;  3KG0 A;  3EX7 B;  2EC0 A;  3IRW P;  2W8L A;  3I9V 9;  4ECV A;  3ZZY A;  4WP3 A;  4QPX A;  2GAG C;  1X9S A;  2KJV A;  2BJE A;  2DEJ A;  2HAF A;  4QIW D;  4RNF A;  2E1C A;  4F4W A;  3LP2 B;  4NEZ A;  2VDH A;  2KVI A;  2C2K B;  3QGH A;  1TMJ A;  2C2O B;  1PCA A;  2MKS A;  3PRB A;  1WHV A;  4RUA A;  4ES1 A;  5A2Q Y;  3MWB A;  1JLF B;  3GTY X;  2KH9 A;  1JNR B;  2DHA A;  4I6Y A;  3W8G A;  1N34 J;  4PUO A;  1WOO A;  1FJE B;  2KZZ A;  3M8Y A;  2C22 A;  1T05 A;  2FC9 A;  3Q8Y A;  5ITH A;  2U1A A;  4A8F A;  4QWA A;  2V2Q A;  4C3M A;  4OI4 A;  1IKV B;  3N6L A;  1JQG A;  5BR8 F;  2C2R A;  5CD4 A;  2H5E A;  5EGY A;  1VQ7 S;  4UY8 T;  1M5S A;  1LV5 A;  3CCT A;  3V4I B;  3NGD A;  4B3O A;  1Q79 A;  2NXJ A;  3MED B;  2OH2 A;  5IOL A;  1KDN A;  1X4B A;  1LWE A;  2EBG A;  2HGL A;  1W2B R;  3THV A;  4B3T J;  3S1T A;  1JNZ B;  2W9B B;  3JTO A;  2EXU A;  3PEH A;  5LMN J;  4F02 A;  2VPY B;  1FXL A;  2A1B A;  4DV6 J;  4QQB A;  1NDL A;  4DUZ J;  1K8A T;  1HW8 A;  3RRH A;  1FDB A;  1RHK B;  3KKF A;  1Q0N A;  1YBU A;  1HYS B;  2HVD A;  3BBC A;  2LQ5 A;  3DDI A;  1WC4 A;  2QX0 A;  1YLX A;  1EHW A;  2JNJ A;  2Z30 B;  4R8U A;  3CVK A;  1QTN B;  1S12 A;  4ECW A;  4WFZ A;  4ZPW R;  4DF4 A;  2KU7 A;  2J0Q D;  3T1Y F;  2Y1R I;  4ID8 A;  1FWP A;  2VG5 B;  4E98 A;  3BGU A;  1QVF R;  4QIF A;  4USU A;  4FYD A;  1ZPV A;  2Z8Q A;  2HYI B;  3AB4 B;  1WG5 A;  1RT3 B;  2X3D A;  5KFT A;  1WSV A;  2DEI A;  3OL6 A;  2EG2 A;  2XO7 A;  4DX7 A;  4LF7 F;  1XNR F;  4G1Q B;  4KGV B;  5L39 A;  4K4X A;  5LSL A;  3A12 A;  4CLF A;  1GXT A;  2DNK A;  4OX7 A;  3BKT A;  5HVH A;  4LRA A;  2J0S D;  3JSY A;  4YB1 P;  1QM9 A;  3KWM A;  1DTT A;  5IM0 A;  5KFC A;  1VCT A;  3MR7 A;  4NA3 A;  1FVQ A;  4WXO A;  1E6Y B;  5D4O A;  2WZ1 A;  4WPA A;  3UDC A;  1UTA A;  2ILZ A;  2LA6 A;  4OYA A;  3SFU A;  2VKZ G;  4HDG A;  3SQG B;  1RTH A;  3H42 A;  1OSD A;  2MLX A;  4IKA A;  2XMJ A;  3W7B A;  2XC9 A;  4A8Q A;  3NLC A;  2UP1 A;  4ZPB A;  2JFD A;  1HMV A;  1TFY A;  3K7R A;  5C2G A;  3HD1 A;  4ELU A;  4IOB A;  3D9B A;  2QMW A;  3C6T B;  2ZDP A;  4TKT A;  3ZO7 A;  3GYG A;  1VBX A;  1PO6 A;  4YDX A;  1XER A;  4M5M A;  5C42 A;  1KFD A;  2HFU A;  4D3G A;  3AJ1 A;  1PYO B;  1S1U B;  4X4R A;  4DV7 J;  4HT5 A;  4AT1 B;  2PMW A;  4PG8 A;  1QSS A;  3HHL B;  1YDL A;  4X64 J;  1EAR A;  1NME B;  2GZO A;  4C9D A;  1HI1 A;  2XSJ A;  3FCW A;  3JQK A;  3D68 A;  3WZ0 A;  1QD1 A;  1RB0 A;  3MM8 A;  5ETK A;  2MTL A;  1KQS R;  1J2V A;  1YWX A;  2CPD A;  3M32 B;  5F3Z A;  1GH8 A;  2YNG B;  1NK7 A;  4I69 A;  4LF4 F;  4JI1 J;  3KOA A;  1S1V B;  1RAF B;  2M52 A;  1S1W A;  5KFL A;  1UFW A;  4PG5 A;  4OI1 A;  2OSQ A;  3HCX A;  2MKK A;  3B54 A;  3HHD A;  2IBO A;  2CPZ A;  5K14 B;  4OMF G;  3V5R A;  1RT7 A;  1CC8 A;  1QUP A;  2R7R A;  4EBE A;  3J7A N;  2P9C A;  5ADZ A;  1ROF A;  2DR7 A;  4AQY F;  2PT0 A;  4JI8 J;  4C6A A;  3M9O B;  2IM0 A;  1TUW A;  1XR6 A;  1LKZ A;  4OJ1 A;  4ZIW A;  2KXF A;  4ECU A;  5IQ6 A;  4P7T A;  2QLW A;  2C3U A;  3T9Z A;  2HWH A;  3CE8 A;  4ZCL A;  4MK8 A;  3ZTP A;  3PX0 A;  4URQ U;  3CDB A;  1VK8 A;  4MYU A;  1RAI B;  4GVB A;  1XBW A;  1AW0 A;  5GME A;  2QE5 A;  4M94 A;  1RJJ A;  2M4M A;  1A6L A;  2RJZ A;  3J7Y U;  3G6X A;  1P1T A;  2DXD A;  3MM7 B;  2J7U A;  1F9F A;  1RAO A;  1WOP A;  2R9L A;  4FYX B;  2H65 B;  4LFC J;  1S97 A;  2VFR A;  4JI6 F;  1PYS B;  1K73 T;  1N36 J;  1VQ6 S;  2EKN A;  2R4F A;  1UVI A;  4DPW A;  3HUL A;  1C4C A;  1RBL A;  6FD1 A;  4CO0 A;  3D54 A;  2V2Z A;  1KOO A;  2RAQ A;  1KVI A;  1CUL B;  1TKZ B;  2Z0G A;  3MPY A;  3BGR A;  4YUD A;  1JLG A;  1VJQ A;  3BJY A;  2HS3 A;  2V4R A;  4ED0 A;  2RU9 A;  2LU2 A;  4M5D B;  4ANE A;  4DL6 A;  4CTA A;  1HNX J;  3RBE A;  4KTQ A;  4OI0 A;  3RB3 A;  4QWE A;  1N33 J;  2UV8 G;  2C2D A;  1R31 A;  2FZK B;  1FER A;  2XZW A;  3JSR A;  4P2X A;  3MUR P;  2IAJ A;  2D9O A;  3JYT B;  4BHQ A;  2UUC J;  5HMX A;  3FEY B;  5KFU A;  2D3O 1;  3QRQ A;  1S10 A;  4K0K J;  3MCS A;  2ZOG A;  3CCL S;  1FJG F;  3LP1 B;  3CJK B;  3L3C A;  1RHQ B;  5T41 A;  4HAC A;  1D8Z A;  4KFB B;  3T9N A;  1RZM A;  3H4D A;  1Q86 T;  3GYN A;  3KDN A;  5KT2 A;  1D0E A;  1S9G A;  3FEZ A;  1KR4 A;  2EK6 A;  4FF4 A;  1JMT A;  4FYY B;  4YOE A;  5LM7 E;  3Q2S C;  4EBC A;  1VBK A;  1KN6 A;  2KXH A;  1PIL A;  2V2K A;  1ZTW A;  1RTD A;  1S72 S;  2YWF A;  2BBE A;  2RHQ B;  3DCA A;  5KT4 A;  2GVZ A;  3NGS A;  4X4N A;  4X65 F;  5IC6 B;  2F65 A;  1KHW A;  1XJW B;  2X1G A;  1ZM3 A;  2IMO A;  2VFV A;  3KHG A;  1VQ8 S;  5B0G A;  3K8W A;  5C7P A;  1Q5Y A;  1N5Y A;  3N9U C;  1UW4 A;  3C19 A;  3EVM A;  3KMS A;  2XB2 D;  2DNN A;  4B3S J;  4DR7 F;  3C14 B;  4YY3 F;  1IBL J;  5F8N A;  2EW9 A;  4I1T A;  4C8L A;  4ZPT R;  5KFF A;  4XPE A;  2DRD A;  4DQR A;  4NLW A;  5HMY A;  1X0F A;  4DL0 C;  3OHB A;  2GQ2 A;  2ZH7 A;  3GR1 A;  1JLA B;  2VBZ A;  3DLG B;  1ACM B;  3H7H B;  3CWJ A;  1VMB A;  2RUS A;  3OTC A;  4XAK A;  5GAG I;  2FJB B;  3MFI A;  4C8M A;  3K17 A;  1HNW F;  3W8P A;  2CZ9 A;  5E3A A;  2LEA A;  5KTQ A;  3R2C J;  3C15 B;  1BQN B;  1RT5 A;  2M8D B;  4JUZ A;  3ZNU A;  1RWN B;  2AJ0 A;  2DIS A;  2JOQ A;  2AP6 A;  4ZN1 A;  1GEH A;  2FZG B;  4GC7 A;  1WC1 A;  1ZZF A;  5BYR A;  1SH2 A;  2AYM A;  5HN0 A;  2HFN A;  4PKD B;  4K4Y A;  2BMB A;  1TK8 A;  2VPX B;  3RBX A;  5KFX A;  1LWC A;  3LH2 S;  1YVF A;  1HR0 J;  1YRT A;  2CJQ A;  2D3U A;  3R7B B;  4ED6 A;  4JBC A;  4Q7A A;  1CJU B;  2M70 A;  4B9U A;  1U4B A;  5H1S V;  1X4D A;  4C4W A;  3KG1 A;  1U49 A;  5HP1 B;  1RWV B;  3N6M A;  5E5N A;  1RBO B;  1B3T A;  2PEH A;  4PQA A;  4ES2 A;  2QLF B;  3RW7 A;  3ENW A;  3DU6 A;  2EBE A;  2W4C A;  2XI3 A;  2PA8 D;  5K14 A;  5C25 A;  3GG1 A;  5H9F J;  4UW2 A;  2W8K A;  3EIC A;  3I0R A;  2CQ4 A;  2HVZ A;  3QIP A;  2JZ8 A;  3WIV A;  2DH9 A;  4F4Z A;  2KFZ A;  1RTI B;  2NZC A;  3J81 U;  3M8R A;  2RDJ A;  5KFV A;  4RNM A;  3K5M A;  4QYZ K;  1TKD A;  2HLU A;  5HI7 A;  3UD3 P;  4H4O A;  4JV5 J;  2PO4 A;  4YR0 A;  1YI2 S;  1UFK A;  1RTJ B;  4CO1 A;  1GQE A;  4WZM A;  2L48 A;  5LOQ A;  3Q24 A;  1ZZN A;  4JI3 J;  4OI2 A;  2ZOM A;  1PAE X;  1UCN A;  2OPR B;  4RW7 B;  3OUY B;  2EFN A;  1SJF A;  1Q95 G;  4Q0B B;  2BJ7 A;  3FNN A;  2MY8 A;  1FFS B;  2VFT A;  4OHX A;  4W4M A;  1EP4 B;  4DR1 F;  4DCO B;  1KRP A;  3BQ2 A;  2CPJ A;  2ATC B;  1T7P A;  2C2E A;  2VIH A;  4KKO B;  3G86 A;  1WNE A;  4EBD A;  5AXL A;  3AJD A;  4B3M J;  3G6Y A;  3RB4 A;  2NSC A;  1VIX A;  5FD1 A;  1UVM A;  4K8R A;  1JLB A;  4PAA A;  1WUU A;  1FD8 A;  2BR0 A;  5U47 A;  5THW A;  5G0R B;  3WC0 A;  2QFJ A;  3JS9 A;  4K2J A;  4QWB A;  4DL5 A;  3SQO P;  4KHP J;  4X4S A;  3L95 X;  1ZS6 A;  3HSZ A;  4ZPV R;  4QPT A;  3QLH B;  4NA1 A;  2L08 A;  4IRD A;  3D6F B;  3BZQ A;  1VGY A;  2CQ0 A;  4MKY A;  2JRR A;  1L3T A;  4DU8 A;  1EAY C;  1R7I A;  2OPQ A;  4NI2 B;  4RW4 A;  1NM2 A;  2G0C A;  1NSK L;  1FX2 A;  1SV5 B;  4P73 A;  4ZVU B;  1U26 A;  4F0M A;  5AXM A;  1FKP B;  2RQM A;  2VG7 A;  4RR5 A;  3AGY A;  1EET B;  2XHC A;  4FP9 A;  2YKM B;  2OEM A;  2JC1 A;  1OSC A;  1P9Y A;  2MLZ A;  1SJ1 A;  4CT8 A;  3OL9 A;  2PFD A;  3KXD A;  1V5I B;  2MST A;  3DI6 B;  4IO1 A;  2W7P A;  2HQ3 A;  1LW0 A;  2DNZ A;  4DPT A;  3TUZ C;  1G3O A;  3D6M B;  3N79 A;  3OTD A;  1RAD B;  3AQP A;  1N8R T;  3DLH A;  2BJ8 A;  3LPE A;  2XMK A;  3AOD A;  3UN3 A;  2V4J B;  2RS2 A;  2ZFH A;  4KPC A;  3A3N B;  4Y28 C;  3T1A A;  1SKS A;  1P1L A;  3BEG B;  3MPU B;  2FLN A;  4I7F A;  3CDE A;  2HNZ B;  3VVT A;  3FRY A;  3W65 A;  2IFX A;  2QLJ B;  1MWQ A;  3MM5 B;  3TUI C;  3NBP B;  4XK8 C;  1UW9 A;  4F50 A;  3KJQ B;  3CD6 S;  3M9N B;  2UU9 J;  2AYE A;  2VOP A;  1L3K A;  2LXU A;  2H3E B;  3DRR B;  2GS8 A;  1EZZ B;  2A3J A;  1RT3 A;  4RW4 B;  1H38 A;  1Q8K A;  3LOU A;  2SXL A;  4ECZ A;  2B43 A;  2WK4 A;  5KOW A;  3C6U B;  1N34 F;  4OL8 A;  1HNV B;  4RW6 B;  1N52 B;  4LBI A;  4WYL A;  4CQ1 A;  1FA0 A;  4LT6 A;  3C16 A;  3EJM A;  3JQM A;  3Q8U A;  3OFH A;  4ZDN A;  3MF5 A;  2HG4 A;  3SMZ A;  3UDV A;  4RL1 A;  1WOS A;  1Z1Z A;  3AFG A;  4A8Y A;  3TI0 A;  1RTD B;  1IWA A;  1AYE A;  3A8J A;  1HFE L;  4F36 A;  4DUT A;  5CYJ A;  2OJ3 A;  3NNC A;  1S4E A;  2OTL S;  2QTW A;  2NYI A;  3PO5 A;  3M8Q A;  1RSC A;  2BA9 A;  4LUB A;  5D3G A;  1E6Y A;  1VQL S;  1NEE A;  1R8H A;  4J90 A;  1N56 A;  3JTP A;  4Z2X A;  3K59 A;  4DV5 F;  3BB5 A;  2HNZ A;  4NLQ A;  2GGP A;  3HO1 A;  2CZV C;  3TAM B;  2IPO B;  2DR6 A;  4WXW A;  3RB6 A;  1AFI A;  4HHU A;  2E44 A;  3GV7 B;  3PCO B;  4Q5V A;  2J0X A;  3HSD A;  3ITH B;  2ZDO A;  4ED2 A;  1OPI A;  2MXY A;  2JX2 A;  4IYQ A;  3OSP A;  3HK2 A;  4F3Q A;  2M8H A;  2OP5 A;  3R8Y A;  5KAK A;  1S59 A;  1F9E B;  4LF8 J;  1F0X A;  1VRU B;  2LQ8 A;  3AA8 A;  3SIP B;  4AYB D;  1VQ5 S;  4M5L A;  1WEL A;  4YB5 A;  2PD1 A;  3DRP A;  3CC7 S;  3GSD A;  4IFY A;  2HRU A;  2OIH A;  5IFM A;  2HW3 A;  2GML A;  3G82 A;  1TK5 A;  4LSN B;  3CUN A;  1ZAW A;  1RWM B;  2BM1 A;  2HK3 A;  2XYG B;  3KK2 A;  3DM2 B;  3OLA A;  4U7U D;  1SJR A;  2ZD1 B;  3KDO A;  1UWB B;  2MQN A;  2W2Q P;  1VQO S;  3L09 A;  3J7Y I;  2LEP A;  2RRN A;  1VQK S;  2MQ8 A;  2Y1I A;  3TUP A;  3QGP A;  3OUY A;  3WQP A;  5C2C A;  1CQM A;  2R7S A;  1C1C B;  1SKW A;  1IVZ A;  1OPZ A;  1P9Q C;  1V3Z A;  3ZNJ 1;  4HR2 A;  2GVD A;  4O44 B;  4MFB A;  5B0F A;  4LFA J;  2R8I A;  1U0H B;  2BE2 B;  2WVE A;  4OJ3 A;  5KFG A;  2VBW A;  2DO0 A;  4ZKA A;  3MR2 A;  1URN A;  2HQD A;  4M1K A;  4ZVQ B;  2BKP A;  2VON A;  2Q3P A;  4DG1 B;  4ED5 A;  4J9Q A;  2UUB F;  1RAC B;  4R25 A;  1FE0 A; 
#chains in the Genus database with same CATH homology
 1GMU A;  3I38 A;  3TJA A;  1NLT A;  1GMW A;  3TJ9 A;  2QLD A;  2B26 A;  3LZ8 A;  3TJ8 A;  1GMV A;  1XAO A;  3AGZ A;  1C3G A;  3AGY A;  1EB0 A;  4L3K A;  1GMW D;  3LA0 A;  2Q2G A;  1EAR A;  3NY0 A;  3AGX A;  3L9Z A;  3NXZ A;  4J80 A;  2HFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...