3NY0A

Crystal structure of uree from helicobacter pylori (ni2+ bound form)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
147
structure length
147
Chain Sequence
IIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
total genus 37
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3ny0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3ny0A02
3L9ZA 1XAOA 3TJAA 3NY0A 2Q2GA 4L3KA 2QLDA 1C3GA 3NXZA 4J80A 1GMWD 3AGZA 1GMVA 1GMWA 1NLTA 1EB0A 3TJ8A 2HFVA 3AGXA 3AGYA 1GMUA 3LZ8A 3TJ9A 1EARA 3LA0A 3I38A 2B26A
chains in the Genus database with same CATH superfamily
1RWUA 4NLOA 2XMJA 2ZH4A 4DSKA 2QL7B 1RT7B 2WHOA 1SH2A 3PRBA 1WF1A 4OV6A 4NLUA 5CYJA 1KHVA 3DYAB 2DR6A 4DL3A 1Q53A 2OSRA 3I82A 3RGIA 2KZZA 2B3TB 3AOAA 3DHWC 1RHKB 1TU0B 2H54B 2EWHA 2Y1LB 7FDRA 3M9MB 1N5QA 2H51B 3AJ2A 2Z2YB 3OVBA 2CJKA 4KPYA 1OYEA 5AXLA 1MW7A 1WELA 2HAIA 4X4QA 1NK5A 3J7AN 4LFBF 5D77A 1XQIA 4DPYA 3G6XA 1LWCB 3IN5A 4AL7A 3QT6A 4X64F 4TU9A 2QRRA 3MPVA 3BDEA 1HL6A 2QLJB 1YJUA 4F02A 3AODA 4MAKA 3HKWA 2FQQB 2HFSA 4ID5A 2CZ9A 2IFXA 2VU5A 4QJVA 4DR3J 1XMQJ 2XS2A 4KJIA 2E9TA 3JSBA 3ZZUA 2BOPA 4CO3A 2F3JA 1E6VA 4GRSA 4J9RA 1WKLA 2LQBA 3LPYA 1T7PA 3T1YF 1N6QB 3POTB 1PBUA 1T9UA 1Y0HA 3EUNA 4RW4A 5KFRA 1RP5A 4M5JA 1LFPA 3WHIA 3R3TA 3OL7A 4S0MA 3QJPA 2DO0A 1KLMB 3NWGA 4ZIWA 3QIPA 3A13A 1V3ZA 4UW2A 1Q81T 4JI1J 5EWEA 1QAXA 1ZZFA 5KFTA 2WRMA 3AT1B 5KFBA 4LF9F 3LP0B 5D4LA 3Q86A 4PPDA 2BEFA 2A6MA 4TY8A 4WFAQ 1L3VA 4CLWA 2MHEA 5KFVA 4AUKA 1T03B 2DHGA 3D1HA 3OUYB 2KTQA 4TYBA 4O4GB 1TP7A 2RF2A 3R7NB 2MTLA 2OPQA 4K59A 4L76A 4U96A 3U27A 1XBWA 4RBVA 4DQSA 1CG2A 1XMBA 2AGPA 1N48A 5AJ3J 2W7OA 2E5HA 2AYGA 2UUCF 1FNMA 2B43A 3W64A 2RUSA 2CVIA 3M2VA 4J7CA 4K7QA 3QO9B 2H65B 4IR9A 3I5BA 2QV6A 3FMWA 5JXSA 5DETA 2H5IB 2HGLA 1K1QA 2HFNA 3IP0A 1F1BB 2IYIA 1REGX 2M4MA 4IFVA 1FFWB 4OJHA 5HMWA 1FDAA 3TX8A 4Y2KA 4NA3A 5BR8F 2K8GA 1BWEA 2M70A 1FXDA 1ZM9A 3LALA 2UUBF 4I7FA 3BGRA 1NK4A 4KV8A 5K8PA 3PTWA 1REVA 3NOCA 1Q16B 3HO1A 3NCPA 1S1TA 1TQLA 3PJWA 1IM4A 4U9RA 4LFAJ 2A3JA 3OFFA 5J1NA 5F3ZA 2PFFB 3OQ2A 3V6HA 1U1LA 4A8YA 2VG5A 4LR8A 5B09A 3D3CJ 3OPKA 2DHHA 4NEYA 3ENAA 1PAUB 4FPIA 2W8LA 2OSQA 4G65A 4HDHA 4JV1A 1LWCA 4O3PA 3MR6A 3C6EC 2JVOA 5A8RA 1FA0A 2N7CA 1SV5B 1J5EF 2GAHC 2IRXA 1WJ9A 3NAIA 3KLEA 4J9QA 2C2DA 2DPIA 1VLYA 3CO9A 3OBIA 1VC6A 4Y3CA 3TARA 2P6TA 2R7QA 2BW7A 4J80A 2KYXA 2G4BA 3G8TA 2FJVA 2M3DA 5HLFA 4Z7YA 4ZPBA 1UW9A 1OS5A 4OLOA 4PEOA 4I64A 3BBBA 3M32A 3QLHA 4X65J 2XMAA 1DQ8A 3MPUB 3J80Y 3EPIA 1FXLA 2FVPA 2Y1IA 1NHKL 2LP4A 4K4SA 2C3MA 2XSJA 4LUBA 2POKA 2F4VJ 3VTIA 4FXVA 1JLQB 3RBEA 3PO5A 3FRZA 8AT1B 5AT1B 2BANA 3W2VB 2C2ZB 1SL0A 2BYCA 2H1YA 1HBUA 3X1LB 1YJVA 2CQGA 3ELHA 1UEVA 3QQCD 2R8HA 4ZP6A 5L1IA 2JEJA 4NASA 1N32F 2YPZA 1NAQA 1A0OB 3JS9A 3P8BB 4HVZA 3VVUA 2HQDA 4USKA 3PVXA 3GB0A 3M8QB 1E6YA 3A3NB 1AZSB 2CQPA 1IBLJ 2ACYA 2E7WA 5IXUA 1RK8A 3UD4P 2OPSA 3KNAA 4GKKJ 2Y0BB 2XMVA 3AFGA 4ZOSA 4F4XA 2Z2LA 4I7FB 1S97A 3PX0A 4DXLA 5CD4H 4KHMA 2CQHA 1HNXF 2RS8A 3HKZD 4CTAB 1W26A 3CD5A 1RT6A 4GVBA 1J2VA 3LAMA 2GGPA 2DIUA 4ZVQB 5BR8J 4LSNA 1DQAA 2B9XA 4JUZA 4DS4A 5E41A 1BXNA 2D69A 2XSFA 1U6ZA 3KNGA 4TYAA 1XAOA 2MZ1A 3G6ES 2OJ3A 2XLKA 1FX4A 1X4HA 2VASA 3IAS9 3KG0A 3QFHA 2XYHB 2ZNYA 2GVZB 5CYQA 4F7VA 3G9CA 4MJKA 3R7SB 1BD6A 2BRLA 1T03A 1JLGB 4I69A 3NAHA 1RBLA 1QDUB 2GIFA 2VFUA 5D6GA 4ZN1A 3W9IA 1F3FA 4BC7A 1DTTB 3MECA 2JZ8A 2U1AA 3S6EA 3MM6A 3AQPA 1KLMA 1I51B 3TW0A 1S1VB 2Q43A 3EDQB 4O23A 4ZLJA 2ZJRQ 4DR2J 5L1KA 4J9NA 3TI0A 3L3CA 1YRTA 1N33J 1WHWA 5GADI 4DR7F 3QLHB 3HT3A 1S49A 4MMOA 2E1PA 5DLFA 1YRUA 1UA0A 3MMAB 4OMFG 2OPQB 5A2QU 2XC9A 1IKVB 1B64A 2Q2GA 4JI5J 3D6MB 1RTHB 4MK7A 4RKUC 3T5JA 4J9VA 2BQRA 1FCAA 1T9YA 1X5SA 4RW8A 4FZVA 1IJEB 4F67A 2IM0A 3MM9B 3JTNA 5M2PA 4J9LA 3AKOB 2UV8A 5D8HB 4DU7A 3K8WA 5CXTA 1Q86T 3X3UA 2P5VA 3QWPA 4LBHA 4A8QA 2DISA 3BQ0A 3K59A 4G1QB 4ZHRA 4LVNP 1PC5A 1XN9A 3HT0A 3PJ9A 4O3NA 4HLBA 1SV5A 1AW0A 2LKZA 4ANEA 2QA4G 1R6YA 4NMXA 4PUOB 1BMQB 3MMCA 2FUG9 3VAMA 4DR4F 3PNIA 4QIWD 3MUVP 3KK2A 2KFZA 1SJ3P 1LQ9A 2GJ2A 4DFMA 2HQIA 3M8SA 3QIDA 3OTOJ 4KB7A 4ANCA 2NCKL 1VQ8S 1N34J 1JJCB 3BGRB 5IC4B 1IR0A 2FYXA 4OZ1A 1P8GA 3FFIA 4ECXA 1V6HA 2F8MA 2AZ1A 4LF8J 2MHNA 1PSDA 2EXUA 3I6PA 5HBMB 3ZZPA 1N32J 1WC5A 2CPDA 2LFVA 2OPPB 4WBFA 3ZZ0A 5LXRA 3BO3A 4FF4A 1SQEA 4PABA 4OX6A 4IRDA 3DOKA 1NK7A 4FS1A 2DD8S 1S5ZA 4DI6A 5C2GA 3PEHA 2B9WA 2JRSA 4X62J 3MUMP 4X84A 2JJ4D 3A8IA 5DM7Q 1IKXA 5L9XA 1RHQB 2M5YA 4P72A 4QIFA 4YR3A 3PIOQ 2DCUB 4JOUA 4F4KA 4YMEA 2QC3A 5HLFB 1U47A 4B9VA 2FGOA 3BKUA 4BCAA 2GJIA 3KUHA 5A2QY 5D3GB 1G1XA 1S9GB 2V68A 4RW6A 2ALZA 1U26A 2F9JA 2GMJA 3GLJA 4NZ6A 1HFEL 2QMUB 3UDCA 2AX0A 1TV6B 3ZC4A 4RUHA 5C42A 2ZJPQ 2YNFA 1HWIA 1FJGF 2MEWA 3MD1A 3MEKA 5ETKA 1GTEA 2C22A 2R7SA 4DDFA 2NSBA 2DXFA 1C1CA 2VBXA 4F04B 3LH2S 1X4BA 1Y00A 3HHEA 2NPIA 3I4HX 4EFAC 1GNKA 1NPRA 1RE1B 2IDLA 2B8QA 2DBBA 1WI6A 3CGIA 4OYOA 4OYWA 5KG3A 4PXEA 4QWCA 4FXDA 2VKRA 3FBCA 2QG9B 3ICLA 3TWZA 4DSFA 2CJBA 4M95A 3MGJA 3QGPA 2VUGA 1REVB 4PWUA 4NL5A 1NH7A 2X1AA 1XR7A 3AY0A 5F8HA 2YVSA 5EUHA 4DZDA 1WWHA 3D5MA 3NGUA 2W9BB 4LR7A 3ZXWA 1NU4A 2QE5A 3RBZA 3HFVA 3NS5A 4XDDA 2BW2A 2WVEA 2P6SA 1H72C 2V34A 1H98A 4F0KA 5DZ6A 1CS4B 1X4GA 3NBPB 2IA6A 4P2FA 1NPKA 3QMQA 4V1Ak 4FF2A 3QYYA 3PRVA 3AA8A 2AT1B 2OP5A 4MYUA 1Q4RA 3HFKA 3KLFA 2O5DA 2BZ2A 1Y9OA 3JQKA 3Q2SC 4TVAB 1M1GA 4TY8B 4DN9A 4DV5J 1H38A 4OI3A 3UI3A 1T94A 3UVJA 2BE2B 5E3PA 4O4GA 4XIUA 4USVA 1NUEA 2R2SA 2AU0A 3S7RA 1TK0A 2QLFB 2Y0SD 2QYCA 2HRTA 4WK1A 2ADBA 2OELA 4E98A 2B4PA 1S7IA 2O1PA 4ZPVR 2NXUA 1HBUB 2HBYB 4YR0A 1SH3A 4JP8A 4OI6A 1HNVA 3NCRA 9RUBA 1JLQA 1UFLA 1KVJA 3KHRA 4K0KJ 2O01C 2DXDA 3SDEB 2KT3A 2UXCF 3OJSA 5DS7A 2Q6BA 2QYGA 2RAQA 3VGTA 1C4AA 4FNHA 4ES3A 1YJRA 4HT7A 3MD3A 1SL1A 2A18A 3LAKA 1QAJA 2W7AA 2J9DE 2DGTA 1OY8A 3VGUA 1U48A 4GVBB 5CZVA 4WYWA 4YHHJ 2YQ0A 4M5LA 1U0SA 1YVFA 1JNZB 2Q79A 3CJ0A 5I42A 4MTPA 4RU9A 4LF7F 4ERDA 5AXMA 4DBQA 1IWAA 1SKUB 1Y5LB 4DV4J 2OH2A 3MMBB 1ZTWA 3B54A 1OMSA 4QR1A 3QJLA 4NLRA 1EKRA 2CNOB 4HH0A 3T1HF 5J1EB 3J7A1 4X4PA 2PA8D 2QSFA 1WC1A 4OYPA 4IQMA 1RAHB 1V9OA 5HP1B 2MLZA 3I56S 1N5YA 2ODXA 2MLXA 3W8GA 4X4VA 2H48B 5CD4A 1NLKL 2OEMA 2V0NA 1RAJA 1T9TA 4FXWA 4QQBA 1OSCA 4DSIA 4FYYB 2AP6A 1CULA 4H54A 5F8MA 1S10A 5EN1A 3CDWA 1TK8A 1FF2A 3DU5A 2DYAA 1TL7B 4USIA 5H9FK 4LF5J 2QGFB 3K5NA 3P4UB 4QBUA 4GKKF 4DV2F 4G6VB 2DGWA 4Q2LA 5ETMA 3TEHB 4Y65A 1RZMA 1FDDA 2PD1A 1FNOA 3A12A 4CNZA 2YKNB 3OTCA 3P3DA 2KM8B 1YSJA 2I8EA 1HA1A 1RB0A 1SC4B 3I5AA 2HS0A 3HULA 4DPTA 2Z30B 3MWBA 2R2UA 2CNNB 3TUPA 4DS5A 2DNOA 2CQ4A 2J5AA 2B5JA 3GYGA 5IV3A 5I3PA 2PDAA 3R2DJ 4Y2IA 1CBKA 2SXLA 3W2WB 3DDKA 2YWWA 1ZETA 1BGXT 2YWHA 1DQ9A 3GP9A 2J6TA 4PRFA 2CPJA 2X7IA 1HR0F 1RT3B 4URSA 1ZPWX 2DNRA 4R5PA 1XMQF 3C6UA 3HVTA 3TAMB 3MFHA 1M1HA 1KQFB 2ZNZA 5LSLA 1N36J 4I68A 1FVSA 2B26A 2MY8A 2QA1A 4AT1B 2MQQA 2D3OR 1VQ6S 3TOQA 2JEFA 2HFZA 1ZBTA 2ZH2A 4DX7A 3MAHA 4DV0F 5HVFA 3NNAA 1FE0A 1JNRB 2MQMA 2ZBRA 4CO1A 2B7CB 3LW5C 4OX7A 4P7TA 4QOTA 3RB0A 1D8ZA 1R8PA 2VG7B 2EFQA 1UKUA 3C3LA 2XMWA 3IXQA 4OJ1A 4K4TA 2E9RX 3D0GE 3UD3P 1NK8A 1HNZF 3DFEA 1RTHA 3PACA 1FERA 3Q89A 1KN6A 2KU7A 5DDRC 3O6QA 4ES2A 2ILZA 3UFCX 1YX2A 1S4EA 3CCTA 2AEMA 3SYZA 2HS4A 2HHVA 3KMQA 2DNYA 3N5FA 1RT4B 3EPGA 2D9PA 1M5PC 3FCHA 2QL5B 2EKNA 2XGPA 2HIYA 2MKKA 5F8NA 2WAQD 2YNFB 4ZJLA 4DMZA 1FFGB 1N5TA 3OW2R 1MROA 5KG0A 3KLHA 4O44B 1RAOA 3T41A 4DU8A 1RWNB 2RQMA 4NYPA 3FRYA 2BE2A 4RL1A 1BQXA 1HHSA 2KXFA 1EP4A 3BKTA 3P96A 2O3DA 2YNIA 4NPOA 5T41A 3VQTA 1NJXA 3TA1A 1TKZA 4FNIA 1G6BA 4YUDA 4F3OA 1KLNA 4NLTA 5CYMA 2I1RA 5IT9U 3I87A 2WOMA 5LJ3Y 4JI6J 1IKYB 3KLVA 1HD1A 3M8YA 3NGRA 2WVCA 5ETPA 4LSLB 2AWZA 1RDRA 4JI2F 1RA6A 2ATCB 1KOHA 1V5IB 1T3OA 4KV8B 2VH7A 4NE9C 4OQJA 1GFWB 3BGUA 2HNDB 2GHWA 1DARA 1RWXB 1X0PA 3PW7A 1M5VC 4OV1A 1XEZA 2UVVA 1AB8A 3FMBA 2MQLA 3NG8A 3U7JA 1AFIA 5KG7A 3CDBA 3QNWB 3QRRA 4PKDB 4DR4J 4HKQA 3IR5B 5B0FA 1D0EA 3M9NB 3H5SA 2C42A 5A0YA 2DNPA 2X1FA 3KG4A 3I0SA 3EE3A 3H5YA 3ETMA 1S79A 2ZH3A 3TAQA 2F5GA 2RRNA 4K2XA 2EW9A 4KKOA 2MKHA 1RT7A 3BF4A 3EVOA 2MQNA 3F56A 4HHUA 4DUYJ 4KFBA 1W25A 3CMAS 5KFYA 4OYZA 2EBGA 1QLNA 2FGCA 2HHHF 2YY3A 2CQCA 4ATNA 3G8SA 2DRDA 3PR4A 3O2IA 1SIWB 4GO5X 3PW2A 4ZKAA 5C42B 3CJ8A 3Q22A 1SUQA 3QZ7A 2OPRA 3PJXA 4ZIVA 5KFOA 3M6WA 4CLSA 3IR7B 2AEJA 3FDSA 4BBYA 1X9MA 3M8PA 4RW6B 2DVIA 1OSDA 4JBCA 3WIVA 3H4BA 1U0HB 2XWYA 4PZVA 2IJNA 3T9ZA 3NWRA 4ECZA 5D3GA 4QIVA 1Q7YT 1FRXA 3SQGB 3NXZA 1K47A 4ZPTR 1KQKA 2PGCA 3TEGA 3C14B 3M2RB 2KKHA 5LMUJ 3D68A 3PX4A 1W2BR 1G2EA 1RAEB 5IT9Y 1NZAA 1XNRJ 3BYRA 2J7UA 2KRBA 4PR6A 3G6YA 4JI2J 1VQ4S 4WCEQ 2IY5B 1OQ6A 2HWIA 1RTZA 2DR8A 4OHXA 2VBWA 2VG6B 2C2MB 3R6GB 5B7WA 2HFOA 4TY9A 1RT5B 1HBNB 5JJBA 5IM0A 5HO4A 1IBMF 3KOAA 2VG5B 5BXIA 3POTA 1S6QA 1D8YA 1FT8A 2GO9A 3MPDA 4LIWA 4DCPB 1U09A 3TANA 4HT5A 4LSNB 5D78A 5GMDA 3R5DA 2HZCA 4KRWA 4GC6A 1SH0A 4Y6IA 1HLWA 1KVKA 2LYVA 3PHEA 1H6KX 5K9FA 3RAQA 3IO1A 3QJJA 2HVIA 5KAKA 2E1RA 4OYBA 5B0DA 4NLDA 4TU7A 3CCLS 5L8RC 2FPHX 2MKSA 3KLIA 2AF6A 2FJDB 5CYQB 4ETZA 4RNFA 1YZ6A 1X5OA 1FDNA 4RBTA 4ED8A 3K2YA 2EPIA 1D9AA 2RKIB 6FD1A 2ZH6A 1N88A 2W01A 3W1YC 4WWSA 4LBPA 1IBKF 2MZTA 1GAOA 2CIMA 3HDSA 3ILJA 3SCIE 3T3FA 1S9EA 3L7UA 2BR0A 5E3RA 2L9DA 2V9KA 2K2PA 2IAJB 2Z58B 1Q79A 2LMIA 4CLKA 4ECSA 3OXFA 4Y34A 2UU9J 2OKQA 2RIJA 3DMJB 2GQ2A 1U25A 6FDRA 2XLJA 1HARA 2ZJQQ 1LEOA 1HBMA 4MKYA 4YDDB 3DM2B 1SKWA 5J2NB 3M8ZA 1XJWB 5ETNA 3DYAA 3H5XA 5H9EJ 4M1KA 4QIEA 2OD6A 5F0UA 2GS8A 3MCOA 2GFFA 2P8IA 4F25A 2UVWA 4QR0A 2E66A 2CQ0A 3DI6A 1RUSA 4PAAA 4I2PA 2CDRB 2XNQA 4ZITA 1RTJB 5KFLA 3HMJG 2XLIA 1CVJA 5KFZA 2Z2ZA 5DM6Q 1Q7LB 6AT1B 2BMBA 3GYXB 5K14A 2JWNA 2HNYA 2OUGA 3UNGC 4CLFA 2XM3A 2ZHBA 4J9UE 2PEBA 2DTJA 4CDIA 4LREA 3AGXA 5DO2A 4N8NA 2CJ9A 2W2MP 3K5OA 5BYQA 4USJC 2C28A 4NXMJ 1FO1A 3SI8A 1IUJA 2J9EA 4AL6A 1R0AB 1M5SA 3BH6B 2G9OA 3D1QA 5AJ3F 1FX2A 2YPYA 3RJMB 4N77A 2YBVA 4X2BA 3FUYA 3TZXA 1ZZNA 3A8JA 3UR0A 1K0VA 4I6AA 2LEAA 4UF4A 2MPUA 2KDOA 1S7HA 2BACA 1RAAB 1YKWA 3CCSS 1B7FA 5SUHA 3QAUA 4FPRA 4ZVUB 1CC7A 1X31C 3KKFA 1I94F 2F8HA 2UXBJ 3DOLA 2UZAA 1UJ4A 5GMEA 4B02A 3PR5B 4QWAA 1Q8BA 3TJ8A 2W2QP 1NPPA 1UVIA 1JMTA 4U67Q 1B7YB 4X4OA 1MMDA 2JFDA 1PBAA 3GPAA 3RBDA 1E6YB 1IVZA 3HLUA 2E5GA 4BWJA 4ZVPB 1F0XA 2QTWA 5FLXY 2IM1A 5GAHU 2RB7A 2MQPA 4E0DA 2V5HG 1F2HA 4F0HA 1Y11A 1MWZA 2F4FA 4O3QA 2RD5C 5A8KA 3BSNA 1X4CA 2EI5A 2G0IA 5ETVA 2Y1JA 3O5TB 1S12A 3M8PB 3WX4A 5KFHA 1L3TA 3WIUA 3MEDA 3TZYA 3JAMU 4JV2A 1BLUA 1UFWA 4NCAA 1NEEA 2JX2A 5CHCB 5KFUA 3W5ZA 1RTIA 3KLGA 4M5KA 4ECVA 2C2RA 4OZ3A 1FKAF 2KJVA 3BDPA 2R7OA 3E3XA 4KY3A 1VGYA 1BQMB 5E33A 4FYXB 4DL6A 2CG4A 3DRRA 4U7CA 4F4YA 3CDEA 1IBCB 1SC6A 2B9EA 3TZWA 3GR0A 5KT3A 5EWFA 1IKWA 4ELUA 1R8AA 2OFGX 1Q5VA 3E51A 1HWLA 4HTJA 2UXBF 2EBEA 2GQCA 2XMKA 2GGPB 3L95X 3OV7A 3H98A 3A8KA 3OLBA 1WNEA 2EK6A 4CLZA 2HK3A 2X51A 3JSYA 4JV0A 2K1RA 5A8RB 1KVIA 4NYOA 1NO8A 2OMOA 2QX0A 1FRLA 3D28A 5EHHA 4NXNF 3R2CJ 1OJ4A 4X4UA 2XO6A 1VRTB 1TL5A 4B3TF 5KG1A 2W9AA 1N5YB 3H42A 2UVUA 4CH1A 2G1HA 4U95A 2R4FA 5C24B 1YWXA 3CEDA 5HROA 4X4NA 5GAGI 1VYAA 1ZA1B 3ISNC 5DG7A 2BJ7A 2VPWB 3RU0A 1CJKA 1WG4A 2C2KB 5THWA 2HMIB 2WBRA 3ZZTA 2FHJA 3N28A 1FD2A 2MKCA 2XCPA 2LEBA 1D9DA 4M5NA 4K4YA 1MSWD 3IWLA 1RTJA 4ID8A 4LRCA 4OFZA 1RISA 3M8QA 2C2NA 5M2RA 1KOOA 5CYMB 2NLWA 1TFYA 2NSCA 2OPRB 2KZMA 3ILOA 1LK7A 3H5UA 3P5TL 3KLHB 2HHQA 3M2VB 3J7ZT 1DTTA 4F26A 4YQWA 4J90A 4UOFA 2HGNA 3NS6A 3NS7B 2JSXA 3ZTQA 2QT7A 3FEXB 4FKXA 4DPOA 4A8MP 1NKBA 1Q82T 2HWTA 1UW4A 3CJRA 5JVHQ 2HBRB 3AJ1A 4CO5A 4KQZA 1T9WA 5G0RA 2E1AA 3NEKA 4WF9Q 4B3RJ 2I0XA 1SB6A 3N6LA 1PIEA 3B82A 2GHVC 3TA0A 2HQCA 4UOGA 4DCJB 2XZDB 2EEYA 3FZ2A 3R5BA 3HF5A 2IJFA 4PCQA 4UOCA 1NDKA 3LA0A 2Z0GA 3D0HE 4RJVA 4PQUB 1FEEA 4USHA 2CG8A 3VHQA 1HQUB 5F3TA 3Q8SB 3KYLA 2W9CA 1NNDA 3KLIB 2A6OA 2B8PA 1Q95G 4YHHF 4LF5F 3UD5A 4DOZA 1UETA 1FI4A 3V6KA 3LANA 1SPBP 5E3QA 1SKSA 4YOEA 3BSAA 3PYEA 4F3MA 2E5LJ 4NCBA 1U24A 3MMBA 5F8LA 3KJVB 2QMWA 2CQIA 5HMXA 2B4OA 2OTLS 4KKOB 4QU6A 1VRUB 3DLKB 3K5PA 3OTEA 2JHEA 5MAOA 3QZ8A 1KS2A 2HGMA 4DL4A 2B56A 2RRBA 2CPIA 2IM3A 3TP2A 1FRJA 4BWMA 1U2FA 4URQU 1GX6A 4W4MA 2HLUA 4I6YA 4Q0BB 3W5YA 2OI2A 3Q8VA 4J5OA 2P9CA 3I0RA 4PG4A 1RWKB 3IRXB 2QEXS 2RF2B 1RCXB 1Q1KA 4CNYA 3AXMA 2Z8QA 3G86A 2FHOB 3TQEA 5DG8A 4OHWA 5D0RA 2E5IA 4QCLA 4ZPWR 1N33F 2ZZMA 3HVAA 2K06A 2WONB 2DNHA 4WFBQ 3VZHA 2JDJA 2AX1A 2IM2A 4Q2MA 5J2NA 4MK9A 4H4OA 3ZTSA 4CP5A 2NPFA 1L5UA 4USUA 3NGDA 4DQPA 1HI1A 2V2ZA 2V69A 3LP2A 5HQMA 2XMUA 5D15A 4I4BA 3VF0B 3HSGA 4O0IA 2YX4A 3RTVA 2BRKA 1EETB 1HKAA 2AW0A 4RNHA 1KKHA 3UNYA 4IFYA 4IG0A 2VBYA 3MM8B 1ZAXA 1C2PA 2YKQA 4M8LA 4PXDA 4I2PB 2CXEA 4X65F 2WVFA 3C16A 4BDPA 3MEDB 3CCWA 3LZ8A 3TJ9A 2XCAA 4DG1B 2OLWA 5KFWA 1VIXA 2CWKA 4TNOA 4R8UA 3U1MA 2LXUA 1AA1B 2VZ9A 4PG6A 4O3OA 5D0GA 1KTQA 3CW2C 2EC2A 2CNKB 3CT9A 1FJ7A 2HNZB 1VC5A 4JI8F 3GSIA 3MUTP 3FSXA 4KGXB 3ONQA 3ZNJ1 4IH7A 4EWTA 2FY1A 3SCLE 1S4FA 1RABB 1JIHA 1T9XA 2HKEA 3GFZA 3BR9A 3LQVA 2V8DA 2K1RB 4ELVA 3B4MA 2VFSA 4UQTA 2C3YA 3JQJA 2LDIA 1FHTA 4WIQA 5KG4A 1GK8A 3R97A 2XGQA 4J37A 3PKYA 4DR1F 1N54B 3GSDA 1ELOA 3AXKA 4C3MA 3VAHA 1GTHA 3M7VA 4YDXA 1CJVB 4ED7A 2XY5A 4QYZJ 2HZAA 4LMZA 4WFYA 3GZ7A 1WC3A 3HHLC 1Q5YA 2CZ4A 2MKYA 3M4XA 4WIIA 4WFXA 2FHJD 4ANDA 1S0NA 4GKJF 1FDBA 3MR3A 4K4UA 4G3IA 1EIYB 2LDYA 1SXLA 3W9JA 5LMNF 4HACB 2K7JA 4OZJA 4X4RA 3SSQA 1WHVA 2ROPA 3MFIA 4C97A 2XQCA 2FC9A 3VVTA 1URNA 2V8VA 4YB5A 5CQGA 1YZ7A 2XHCA 3EWGA 4J91A 5K14B 3TR5A 5HVHA 3KLGB 4DV7F 3U1LA 4WU2A 1T3NA 1F9HA 4KH1B 5AE2A 2W24A 3SDEA 1S9GA 1CPZA 2KN4A 1N5VA 1VS3A 2NYIA 3FQLA 3KJFB 3IS9B 4HR2A 4LQ9A 1OY9A 1AROP 5A8KB 2VA2A 4RZRA 2C3OA 3CJ3A 4NA2A 2VOOA 4H4MB 2HRYA 1HBOB 1HHQA 2KG0A 4ECTA 2RSQA 4ID5B 2PFDA 1HNWF 3MPWA 2RDIA 2ASJA 2CDQA 1EJ7L 3MDFA 2V8HA 1VBKA 1VBXA 1F5BA 2H3EB 3LPEA 4Q45A 2IVMA 3RR7A 4B3MF 5I42B 2ROEA 3NY0A 1VQMS 1TKXA 2DGOA 1CULB 3SCKE 3H8YA 1VLOA 2QJ3A 3PW0A 1JJ4A 2G13A 1I1GA 1WHXA 3I31A 4ZN3A 4RU2A 1QTNB 1LXNA 2HHPA 1K9MT 1RHRB 3DHXA 4H4KC 2VG7A 2YWGA 4NLYA 1Y5IB 4CT8A 2AGOA 1S0MA 1B0TA 3K8VA 4I0WA 4Y2CA 2R8GA 4L74A 4I1TA 4ECQA 4X64J 4ITSA 1I3OB 1SVDA 5C24A 5HROB 4ECYA 2ZBIA 3QT7A 1VC0A 1ZM2A 1RTDA 1VQLS 1CJUB 2DITA 1UTAA 4OX8A 4AFFA 4X4SA 4FF3A 4WXWA 5KFNA 2MZJA 3G8QA 4P74A 5DG9A 3M6XA 2V6AA 3DOMB 5LM7E 2FZCB 1TKDA 5C25A 3H2LA 4IUFA 3N4WA 1UVMA 3VCDA 4L6V3 3VALA 3NNCA 4QW9A 2W2OP 3LUYA 4XO0A 1H2VZ 2H5JB 3MURP 4C9DA 4DPXA 2G0CA 2DR9A 2GZOA 5H9EK 1G3OA 3DU6A 3DRYA 1IKWB 2CJXB 3ET6A 4RWXA 4EMDA 1XMOF 4OX9J 1U0HA 3ILIA 3D6TB 2OIHA 2UUAF 4QR2A 2V4QA 1S6OA 4B3TJ 1AXQA 4L75A 4WP9A 3F73A 2QLXA 3UCZP 3K0JA 2ZH5A 2CQ2A 1X5PA 1UVKA 3T1AA 1VK3A 3CCRS 1YK9A 5KOWA 5GAHI 4KIAA 2J0XA 3T5KA 1C0UB 2VONA 4LR9A 1RHMB 4JI3J 4IOAQ 3CCJS 2WB1D 3AOCA 3W60A 5DQHA 4L72B 4OZ5A 2OEJA 3CJKB 1VDHA 5IT0A 3K57A 4IG3B 2P9GA 3KK3A 4DV1J 4JI0J 3G87A 3H59A 2D74B 3BJYA 2VHGA 2V2VA 4ICLB 3IG1A 5G4DA 2O66A 1DLOB 3ENQA 4A46A 2B51A 5KFFA 1VRUA 3DLKA 1H7WA 3BREA 2CKWA 4NEZA 2RQCA 2VICA 1YDLA 3L4BC 1CJTB 2KJWA 1R31A 1YBAA 2QIFA 4ED0A 2V94A 4I2QB 1EX8A 5IOLA 3HK2A 4K50A 4EBDA 2JL9A 1BY9A 1SL2A 2B9YA 2DCLA 5JUMA 4ETXA 4F50A 3OXLA 3TVZA 2GMHA 4MIWA 5U47A 3T6BA 2RQ4A 1HNWJ 2PEHA 2ZWPA 2NXNA 4C8KA 2X3DA 4ZS6A 3I0SB 3OT9A 4P2XA 1QVFR 3GFXA 1NSQA 4PWDB 1TAUA 2UUBJ 2RQKA 3EZOA 1VQ7S 2CPFA 3V5RA 5GAEI 4UZBA 2ZH1A 4KC5A 1PGZA 1RAIB 3CC4S 4ZCIA 1RTDB 1PJ5A 5KFEA 1VMBA 1NJYA 1RACB 2DB1A 2C1EB 2DR7A 3BM7A 1RWMB 4PG8A 4B9NA 1O8BA 3GJTB 3FVYA 1GXUA 3UWTA 4DF4A 3RAXA 2YNIB 3LP0A 3PDNA 4IFYB 3LWLA 2AJ2A 2VODA 1EQ0A 2M7SA 4C0HA 2ZEJA 4USWA 1FWPA 1TL3A 5B0AA 4ES1A 3AB4B 2VPZB 1NRKA 2WOMB 4LJMA 1ZH5A 5CAAA 3GCXP 2ZVSA 3VAIA 3AGZA 3KDOA 5ETOA 5IQQA 2Q66A 4CLUA 2CPEA 1FRHA 2KHCA 1H2TZ 4IG0B 1SIZA 2F65A 3B8HA 2ZE2A 2MLYA 2ZITA 3D1OA 3DLJA 3NLCA 2EFOA 4NI2B 1Q78A 2IHR1 4F3QA 3CCVS 2RHSB 1JLCB 3VAGA 4WJBA 2FLNA 2AIRB 2EK1A 3WC0A 1RU2A 1WD6A 1KHWA 1EAYC 1S1UA 1UFKA 2FTRA 4Y2AA 5FDLA 1VHFA 4RX6A 2I6WA 2A10A 5CCMA 4YY3J 3OHAA 1U4BA 1JLGA 4C3LA 3TAPA 2W9BA 1J27A 1NB2A 1MNEA 2Q6CA 5T14A 2WK4A 4U6PA 3CJQA 2BDPA 2J0QD 3DOMA 4KR0B 1S1WB 4DQRA 1CS4A 3I5CA 3PX6A 3U1NA 1WOPA 3MZIA 4C8ZA 3ETOA 1U2CA 1NDPA 1UPPA 5F9LA 3AQOA 3FNNA 2IVYA 4WPAA 4J9OA 4GMKA 4OZNA 4KGMA 5LSRA 1SJ4P 5D0EA 2YNGA 4DJBA 3D2WA 1LWFA 4JI7F 1Y3JA 2NXCA 3CB4A 1H2UX 2FHMA 2GVDB 3BO2A 2HVZA 1YTYA 4WE1A 3RAMA 2XZTB 1S1XB 3NOGA 3OL9A 2CADA 3BN4A 1SQFA 4CQ1A 2ZWOA 5HJYA 1T02A 1TELA 2HLTA 1VQPS 4LF2A 4PXCA 3E01B 4LVOP 4U8VA 4EO6A 1YITS 5F8GA 4O0NA 4KBIA 3WC2A 1HIYA 1RT1B 2VL1A 1I5OB 1UJ5A 3EXCX 4ED4A 3TUZC 2MQOA 2PMHA 3TO8A 4OI0A 4FYDA 1XK8A 4FP9A 1IKVA 2CQ3A 4DR1J 1CQNA 4FDFA 4CM0A 1S48A 4PYDA 2W4CA 4ALZA 3M2RA 2FLLA 4NXNJ 2R8IA 3DI6B 4ZCKA 3CJ4A 2AKWB 2D3UA 2JNJA 2KRRA 4QPXA 3IM8A 1RKJA 4DSJA 2JZ5A 2V67A 4NI2A 4P2MA 3MR5A 2BX6A 4ECWA 2MGZB 4XK8C 3JXOA 3GFYA 1PO6A 3V81A 4WXOA 1ACMB 3DGPB 4H4MA 5IT4A 3D6HB 3IGNA 1QAYA 1NZ8A 1XR6A 2XZWA 5HBMA 2FJEB 1U1MA 4FYWB 2VQFF 4JI4J 1LWXA 2GNKA 2QLWA 1H3DA 3CWJA 2E44A 4C8OA 3AD7C 1K0TA 3SQOP 3N01A 4HYKA 4B08A 4ILMA 4P71A 5E3CA 5HK4A 1RWPB 2YX7A 4C11A 3OTOF 3KLEB 2JEGA 1APSA 4DFPA 1P1TA 1WF0A 4KYZA 1WOOA 4ZVOB 3VV2B 1R43A 4IR1A 4IH5A 3M6VA 2YKMB 4OYXA 2LQ9A 1U45A 3M9OB 3DLBA 4LRBA 1KBRA 4UZCA 3GV5B 4DFKA 2V2QA 3C19A 2VC1A 3BR8A 4DL7A 2RHQB 1A9NB 1RAFB 5JVGQ 4DR6F 4P6QA 1V3RA 3OSNA 1LW2B 2YNHA 3O8WA 1VI7A 5JMNA 2BJ8A 4K4VA 3I38A 2BABA 1YGYA 2ZD1A 2KL8A 3FZBA 4V19J 1KTVA 2PIIA 2PI4A 2L9NA 4RW8B 1U8WA 3ZTPA 3V6DA 4M5DB 2Y9HA 2MYFA 4B17A 3BKFA 3F0NA 1WORA 2BM0A 2DY1A 3LO3A 1SJFA 2M52A 3GQCA 2WW8A 2COLA 3JAMY 3D0IE 2YWEA 2LEPA 3I32A 2V9WA 1EHWA 1GT8A 2UVRA 1IJFB 3MAAB 3R6LB 4TU8A 5L38A 3HSZA 5FDLB 2KFNA 3C14A 1IR1A 2AGQA 4OZ0A 1EETA 2XMMA 3ZTOA 2VA3A 2MKIA 1H0HB 3FSYA 3MMJA 2ZUGA 2KXHA 2VFRA 3MEEA 3UDVA 1AT1B 1HNZJ 1HR0J 3ZZRA 4EI2A 3L7PA 3BH7B 4KGVB 3HCXA 2J0SD 1RWWB 1WG1A 1R0CB 2ZOGA 1RCOB 2VD3A 2E1MC 4ZLLA 4C4WA 2GCFA 3G2XA 2ASDA 1NJIT 2LA6A 3A3OB 3QPIA 4UUWA 4ZPDA 2QN6B 3BQ1A 3KJNB 1B0PA 2BQ3A 3D6FB 2GHPA 2HPUA 2DHXA 3DLGA 3H40A 4LT6A 4BLGA 2JH3A 1F2GA 1XR5A 1YJ9S 2B4VA 7AT1B 1LWFB 2GX8A 1JJHA 1IKXB 5HL7Q 1QSLA 2OFHX 3FSIA 2R7TA 1VRTA 3GR1A 1RKIA 2ROGA 4HDGA 4OHYA 2RE1A 3WX8A 5E0OA 4JI0F 2X3GA 1NHVA 3NNHA 1KFSA 4LRDA 1TVRB 1PKUA 2CFXA 3P6YC 2D3ZA 3HD2A 3FEYB 3V2UC 4CLLA 1Z4UA 1AUDA 2IYGA 2VFTA 4Y2MA 2KI2A 2J7KA 3M2UB 4PPZA 4P73A 3BBCA 4ZP7A 4A8WA 2HYIB 4C8NA 2G2YA 3ZTRA 3KHGA 3SBMA 3ZZOA 3FBEA 3LGHA 3V4IA 3Q8UA 1IR2A 3GJSB 1AFJA 3QSIA 3C15B 3MMAA 3UDEA 1C4CA 4ZVSB 3THVA 2FJBB 2KYZA 5F0WA 5LXYA 1RTIB 3TVKA 2I5JA 3MTKA 5J2PB 4AQYJ 3N79A 1TKTA 2DRAA 2HQGA 1VR6A 3MHYA 1NK6A 2G2ZA 3GV7B 1JX4A 1GEHA 3IG1B 1JXLA 2F4VF 2KVIA 2HURA 2JC0A 3NGTA 1K1SA 3QO9A 1EB0A 3CD7A 3ILLA 2KH9A 2GO8A 5KFXA 3CD6S 3EMTA 3KG1A 1FWKA 4ZCMA 4PG5A 4EZ6A 5E5NA 3ZZYA 2ZZNA 5K8OA 2GW8A 3D4JA 2WTFA 4TKTA 3CSKA 3ZO7A 3J7YU 2MGZA 2E7XA 5A76A 4P2SA 5I4MA 2AZ3A 1U02A 2ZE2B 3CC2S 5KFSA 1BUXA 3RW6A 3G6VA 3GCWP 1M90T 3DXBA 1S77D 5EWGA 1AYEA 1FKOB 1QVGR 2HW3A 5ETSA 2RKIA 4AXJA 1LW2A 4DV7J 1HW9A 1S9FA 2NREA 4C8YA 1ROFA 2ZHOA 3GIRA 3DRPB 1NB7A 3ULHA 4LFCJ 3CCQS 2HSEB 5HANA 4CWBA 2IA0A 3BGFA 1DY3A 4DUZF 1HI0P 2DRBA 5H1SV 5HP1A 4XTTA 1FWLA 1IN0A 2DEIA 1KD1T 4ILLA 2YH1A 4CO4A 3CMES 3CULA 2VOPA 1CJKB 2HBZB 3CCZA 2BM1A 2HWHA 2Z2MA 3D54A 3QT8A 4UTGA 3RUBL 4A48A 1W7WA 2GVDA 3NBPA 3AHPA 3DDNA 1LWEB 4YB6A 5A8WA 3EVMA 3EM1A 3UN5A 1H7XA 2K3IA 3ITHB 3ZZZA 3CDAA 2W2PP 4A47A 4CYUB 3BPDA 3JYTB 4YR2A 2PSZA 1FFSB 5HI7A 2BANB 3W2VA 2LU2A 1MROB 3GG0A 3QBCA 3RZAA 5KFJA 3MCMA 1FK9B 3HHKA 3TQ1A 1VBZA 4DR3F 3K17A 4IRKA 5G0RB 4M5MA 2VFVA 2FZGB 2ZKUA 3FEZA 3KJQB 5KT5A 1Y7PA 4NA1A 2WW4A 1FJEB 4LF9J 4JI4F 2MDAA 2R2RA 1BC6A 3T1HJ 2MJNA 3TYTA 1IKYA 3RR8A 3IGVA 2BBEA 3TZZA 1VJWA 4KAIA 4R0JA 1RT2B 2XYPB 4LF7J 1JQGA 4M5HA 3VAJA 1N8RT 1MN7A 1TAQA 4YEAA 1HYSB 3P49B 3QRPA 3EX7B 1L3SA 5E3AA 5ETLA 4X66J 4B3SF 3H2VE 4MIBA 5J2MB 2VJVA 2MMYA 8RUCA 3QSYB 1ZM3A 4KGKA 1YIJS 3VQSA 2CYYA 2IRYA 4B9TA 2C2OB 1S6PB 3OFHA 1TUGB 2YKPA 3JTPA 5DDQC 4B9MA 2AJQA 2M0GB 2YX1A 1WKKA 3PHTA 5IQ6A 4EBCA 1GXTA 3HZGA 3C66A 4A8SA 5KG2A 4Z37A 1IWGA 2X1BA 5KTQA 1P9YA 3IFEA 3QGIA 3S8SA 3UDLA 2IVFB 3SZ2A 3MXHP 2OEKA 4MYTA 1VJQA 1G4CA 2CPXA 2IIHA 3RW7A 1ZYQA 1GMUA 3DRPA 1SQGA 2Z57B 2ZOFA 4CO2A 2H4YB 2R7XA 3E2EA 4Q0BA 1FKPB 4JYAJ 4IDKA 1JLEA 1TZ0A 2J8SA 3LGNA 2ZVIA 3PCOB 5HAOA 3BPSP 3L9ZA 4OX9F 3RG6A 3MAQA 4MKBA 1O0PA 2W1BA 1T0TV 3Q2TC 3IC1A 1V3SA 3R5CA 4MIAA 4CRJA 2DH7A 1RT6B 2L9WA 1JLBB 2WCXA 2DO4A 1VQ5S 4B9LA 3M1VA 2XNRA 4MFBA 3R9LA 1TKZB 2N82B 3M05A 2V4JB 2HNYB 4CI0B 2F40A 2OPSB 5CZXA 2E1CA 2J76E 3R27A 1KEKA 1YHQS 4CLTA 4E8UA 4J9PA 4J9KA 3QGGA 4DG1A 4Z7CA 4D3HA 5DLGA 3AA9A 1MG7A 2PT0A 4RPFA 4B3RF 1R0BG 3B6BA 1C1BB 4KO0B 3OL6A 1N6QA 1IM6A 1YJ7A 3PYGA 1I94J 1WTBA 2Y8WA 1Y5NB 3HD1A 2DGQA 4DL2A 4DV1F 2PA3A 2W8KA 4UY8T 2E5JA 2K3KA 1XWLA 2QO3A 5EX3A 2ACMA 1M5OC 5KFDA 5IV4A 3LP1A 4Q7AA 2DPJA 5J1EA 1D3WA 1VQYA 4LSZB 5DJBA 4UT4A 1U1RA 5GMKa 2IC3A 1TL4A 2ZC3A 3OFEA 4AYBD 3CCUS 3MEGA 2XY6A 3HSDA 4CT9A 3QIPB 3DLHA 2F63A 2EFGA 3NMRA 1X8DA 1SUQB 2OHDA 4NYZA 1ULRA 2UV8G 4N8OA 4OHZA 3NP5A 5KFCA 2KT5A 1ZTTA 3R8YA 2ZH8A 1OPIA 5B0EA 3I4PA 5CCLA 3N6MA 4K8RA 4B3SJ 4TLQA 4ZP8A 2DH8A 4WE1B 3GIKA 1TUVA 4DPWA 1TL1B 3M8RA 3G71S 4K0KF 2QA4S 2CVEA 1C0TA 2J8AA 1CSJA 3G82B 2KG1A 1QJHA 3GIMA 5L1LA 1FVQA 4OJGA 5B0GA 4NCGB 3M8WA 3D9BA 1KFDA 4OYAA 2IDEA 1WDTA 1NBEB 2HHXA 2UXDF 1C3GA 3OSPA 4CM2A 3IMQJ 3FC9A 3SSSA 2XWXA 3SMZA 1HNIB 4QWDA 4J9SA 4C8LA 1FTRA 4DFJA 4ZP9A 1KNZA 3KHLA 4KTQA 2RVJA 5EX0A 1TKXB 2UP1A 2CPYA 5GADU 1M1KT 2JC1A 1V5VA 2HNDA 2DEJA 3GFHA 5T7LA 2LLZA 3EGVA 4NZ0A 2IRUA 4NMLA 3MM9A 3KHHA 4O4RA 4UQGA 1LXJA 1T05B 2HBQB 3V81B 1VRQC 5ITHA 1XTZA 4KPCA 3KK1A 3T1YJ 5KFMA 3RRHA 3R1HA 4TLRA 5KT2A 3OXGA 3PEJA 3M32B 1HBOA 2KVQE 3GU0A 4ED6A 4EBEA 1IQZA 2BV3A 1WC6A 4KHPF 4RNNA 3C46A 4HHHA 2FC8A 3J7Z5 2WBMA 4LF4J 1SCJB 3OLAA 1U49A 5DDOC 2QSWA 2PN6A 3C5XC 2VIHA 1WKJA 3SFUA 1M5KC 3HZEA 2RNEA 3IM9A 3FGVA 2XBPA 3VGVA 4IH6A 3GJRB 4URGA 2R9LA 3V4IB 2J6SA 2IBKA 2OPPA 4DHVA 1L3UA 5HSPA 3SV3A 1XC9A 4R0EA 1WC0A 4HI1A 4F0MA 3WQPA 3M2UA 4TXSA 3M30A 5D4NA 5A0YB 4N56A 2DGSA 2V2KA 4YS2A 1UZHA 2KXNB 4MFBB 2GA7A 2N4CA 4HACA 3MM5A 2HVEA 3IWXA 4FN5A 4ZVTB 4EK2A 4CIOA 1FNXH 2K7KA 4OYMA 3VZIA 2BE7D 3KXDA 4OZ2A 3US5A 2G0JA 2MZRA 4TQRA 4I67A 5HN0A 1HQEA 3L7OA 5LSOA 2CNLB 5GAGU 2WVBA 4LF8F 1GQEA 2B4UA 3QT5A 2ATLA 1J5EJ 2BJDA 1FKPA 2EKYA 1EKSA 1ZA2B 3HP6A 3BSCA 2DNMA 4U7UK 3OR2A 5DQGA 2OGUA 4W98A 4H4KA 3T5LA 5A6WA 3QAEA 2CA9A 4B3OB 3AGYA 3D7SB 1PG5B 4IG3A 4Q5VA 3KK3B 1U6FA 2NZCA 3ISND 4LSLA 3KDNA 2RS2A 2HVHA 1NJZA 2BJEA 5IWAJ 2UUTA 1MLAA 2W9CB 4RBUA 2XB2D 2RH3A 5BJRA 2RUGA 4CH0S 3H7HB 5DZ7A 3S1TA 4F36A 1UWAA 4KHRA 1KR4A 5KFPA 1U6BA 3EGZA 2RJZA 1S99A 1B3TA 2UXDJ 3DLLQ 1JLAB 3LOUA 2E5LF 4DV3J 2O67A 2A0FB 2FY8A 3DLEA 4ILRA 4ZLNA 3FFIB 2QLDA 5B0BA 3HJFA 2JLGA 3R7BB 2G1DA 2GQQA 1ZOTA 3HHLB 3MCSA 1M5HA 4ZVRB 3NRBA 3WBZA 2NR0A 1IBLF 2XHWA 1HBMB 1QUPA 1IQTA 1XMOJ 1Z2LA 2LVWA 4KFBB 2RDJA 1VQOS 5L1JA 1D9FA 3HXMA 4DV5F 1MU2B 1TL7A 4WP3A 3U02A 4F4WA 5KT7A 2GMLA 4PQAA 1BE4A 4WKRA 3VGSA 5C2CA 5FLXU 4LFCF 5LL6d 3E8OA 3HX9A 3SXLA 4RW7B 1D09B 3Q23A 3H0PA 2N3OA 3M30B 1SBRA 2VC0A 1B70B 1RGVA 2JLFA 3EDRB 4ZJQA 3C15A 1S6UA 2FB0A 2L48A 3G82A 3W63A 2AYBA 2APOA 4ZJOA 4NRTA 1JLBA 3EZUA 1BQMA 1U8SA 3FK4A 1HWJA 3OR1A 3SQGA 2ASYA 4DR5F 4NLQA 2DH9A 3ADAC 2NQPA 1YJWS 5J1PA 1X9SA 4QYZK 3PRDA 2DJWA 2GIRA 5J2MA 2C2EA 4PUOA 3KMSA 2EVZA 2M9KA 5KFGA 3EZ5A 1DLOA 2R8JA 1CLFA 2YWFA 3OL8A 1X60A 1TL3B 3I96A 3AOBA 2YWKA 5DDPC 2NXEA 3K5MA 3VAFA 2MSSA 1Z1ZA 2E29A 4RW9B 2PMZD 1T05A 2V8GA 4B3OA 3CCES 3Q24A 3TJAA 1J5OA 1NSAA 1U1PA 3I55S 3THPA 1VQSA 3TRGA 4OIXA 3J81U 1R27B 4IYQA 4Q44A 1WHYA 1HMVA 4IOCQ 2GVZA 5BYSA 2Y8YA 5KFQA 2V63A 4F4AA 5DGAA 4C3KA 2D9OA 2L3MA 4PYAA 4WFNQ 3BYPA 2A1BA 2GC8A 2LA4A 3BZQA 2CPZA 3MM7A 2FJAB 3AD9C 3K58A 2QFIA 2AMCB 2ZM6J 4D3GA 1GX5A 1E6VB 3FKBA 2D41A 3C2PA 1HQEB 3PM9A 3HPOA 4A8FA 1WEYA 2RMLA 3FJ2A 3SV4A 2RILA 4JI5F 5KG6A 4BHQA 3UVJB 4LRFA 2YNGB 4M63A 3K5LA 1FRMA 1TUWA 2FZKB 2YKMA 2PC6A 1TK5A 2P9EA 3F44A 2GAGC 4C0BA 2W2NP 3QRQA 5A8WB 4AQYF 2QMXA 3OR2B 2OD4A 4QW8A 2HMIA 2IMOA 4N41A 1VOMA 3MOJB 1PCAA 2DT9A 4DX8H 1C0TB 4GKJJ 1LNQA 2JLEA 1S76D 4L3KA 1MWYA 1RT3A 3HM9A 5LOQA 5KOXA 1O51A 4AD6A 3MTJA 3TA2A 4JV5J 4B9SA 3KTQA 2LQ5A 3OTBA 4DV4F 1QUVA 1RJJA 1WSVA 4DWIA 2IMWP 3O44A 4N76A 2BQUA 4O44A 2C3UA 1C0UA 2B5JB 2J9DA 3EICA 3RB3A 2DNGA 4DL5A 4W92B 4YP3A 4MKAA 3W2WA 1UMJA 2X1GA 1QY7A 1S72S 3BB5A 3T5HA 5ETQA 4LF6F 2DK2A 4CH7A 1RHUB 1WF2A 2FIUA 3WDOA 4AL5A 3C16B 4NLSA 5LJ5Y 5IFMA 3SEOA 1DURA 3DCAA 1WDDA 1YBUA 4ZVEA 3HHLD 1IXKA 4DQQA 2HAFA 3W9HA 4R8UB 4TQSA 1NJWA 1S1UB 3W3SA 2R7UA 1ITPA 2B7BB 3A3PB 3QATA 4EEYA 1JK9B 3QFWA 2R42A 3FCVA 2ZH9A 2A2DA 4A8XA 3GE9A 2R8KA 2FVRA 1NCLA 1LK5A 1KP6A 3HHNB 1FRIA 3GWCA 5I3UA 2Y1RI 3BS9A 2KO1A 1SJRA 2Z56B 3MM7B 4L73A 1HI8A 3G96A 1JLFB 2ZM6F 4EU0A 4ZCLA 5EGYA 3PFOA 4P7VA 2OAUA 2HS3A 1UEKA 1UWBA 4R25A 4RW4B 3Q8PB 4LFAF 2UU9F 2NZ4A 3RYLA 1XERA 4IQXA 1JKHB 3EJMA 1BWVA 1S59A 1TMJA 4KE5A 4MK8A 3NL0A 3UN3A 2QZ8A 3CDUA 4DUZJ 4KHPJ 3Q8QB 1IBKJ 2ZD1B 3GJQB 1BHNA 1JLEB 2CZVC 3UR3C 1D1UA 4JI7J 1YLXA 2LQJA 3N5BA 1ICEB 2PI5A 2FVQA 3H2UB 4X62F 4LQ3A 2NYHA 4K2JA 4M5IA 1MU2A 2I5JB 5J2PA 3PKMA 4NLXA 4KSEB 3EYZA 2VQFJ 3A1YG 3GYNA 4USTA 1VK8A 1KRPA 1FE4A 1QE1B 4DLEA 5E2QA 1N4LA 3PW5A 5D0HA 3C6UB 3HVTB 4FBTA 2NUHA 1NH8A 2VPYB 2VKZG 1RADB 4GVLA 2LECA 4WZMA 3DLGB 1R6VA 4O3RA 3P5BP 1NDCA 1UCNA 4EZ9A 2OMLA 4JI3F 1FD8A 3Q0AA 3CJKA 2VF3A 2CQ1A 1OO0B 2FLOA 3B4DA 4NLWA 1JLAA 1HWUA 4WYLA 5B08A 4O3SA 3IS9A 4C48A 1C1BA 4KO0A 1EQMA 2HIQA 2Z4PA 1LFWA 2HK2A 4C11B 3BQ2A 4F8RA 4IRCA 2E7VA 5I3QA 4WFZA 2VG6A 1NDLA 1MMNA 1T11A 2W4PA 4WK3A 3PO4A 1R8CA 5E7OB 3TX0A 2MQ8A 4JI8J 4Q8FA 3KUGA 2F9DA 2XI3A 3PV8A 3C6TA 1HQ2A 3AB2B 3H20A 2V50A 1DTQA 2ZFHA 3CUNA 1X4AA 5DRKA 5J2QA 2AYEA 1AUSL 1PYOB 2DKOB 2XEXA 1GMWA 4QIGA 4JYAF 2BOAA 5F8IA 3RB6A 3KLFB 1UZDA 1UP1A 2BVZA 5RUBA 2DNNA 3ZFVA 1XNQF 4DV3F 4ED3A 4M5DA 4ECRA 4NLPA 1R3NA 1LWEA 1RLCL 3MI7X 4RWWA 2XG8A 3MECB 4NRUA 4RLEA 4FS2A 2J6UA 2GV1A 1Y10A 1NM2A 1S9EB 5SZTA 1DRZA 1TL1A 4K5SA 4CYUA 2VDHA 1RAGB 3MAAA 3A8EA 3CIZA 1Q8IA 4ZPAA 3BO4A 2BXJA 2F8EX 4ZDNA 3IWNC 3JTOA 1DFDA 1O6XA 3ZNUA 4R5PB 2I9SA 4ED1A 1RYSA 2D1CA 1QE1A 2ZBCA 3R1LA 1S6QB 1TTHB 1SC3B 5D4OA 1UJ6A 1MN9A 5LMUF 3A4TA 4DEZA 1RQ0A 2HHUA 2CWXA 1DJ0A 4EGLA 2XS5A 1EP4B 3OJUA 3MOZA 4J9MA 3CTRA 4RNMA 5KG5A 3O1LA 1KQGB 2KT2A 4F4ZA 1RT2A 4A8KA 4CTAA 1N56A 3TUIC 4G1QA 3HHLA 4ZHRB 3SCJE 3R5JB 2R3VA 3AH6A 2HQ3A 3KK1B 1UVNA 2EFVA 1YI2S 4DV2J 1X4DA 2RU9A 3DLEB 1RWVB 3QWUA 3UN2A 1JKHA 2PE8A 4OHVA 2LCWA 2XTJP 4HH1A 4HTIA 1BQNB 2B6AA 4PXBA 4XDCA 4QPTA 1YG0A 3R5AA 3HHDA 4OJ3A 3UE2A 1EZZB 1ZM4A 2XMTA 5HMYA 2FJWA 4K4XA 3C6TB 1N0VC 1XNQJ 4OL8A 3PIPQ 1N52B 1PYSB 5F8JA 2ZBPA 1R7IA 3BV8A 3I0RB 1NKCA 5I3UB 4ZVHA 2LQ8A 5C5JA 1HPZA 3HSJA 4DR7J 3WZ0A 4W90B 3UCGA 9ATCB 5L9NA 1WACA 3J80U 1KDNA 5K8MA 2DR5A 4OYIA 4P52A 3NKYA 2YKAA 4KGZB 3D66A 1UA1A 4RUCA 4K4WA 3CJ5A 3ISZA 4MKVA 3CD0A 1RT4A 4PWWA 1RI7A 3OR1B 3SIPB 3VWSA 1K73T 3HVRA 2JRRA 4RNOA 4UUXA 2HG4A 3DXSX 1WSRA 1Y3KA 2KHDA 2R7VA 1U2RA 3IBWA 1X9WA 2ZBQA 2ZHAA 3Q8YA 1QAIA 1QTMA 1F3VA 1RSCA 2YXLA 4PWDA 4IDKB 3LGMA 3CC7S 1FK9A 2V8PA 4Q8EA 4Q43A 3RB4A 1RT1A 3JSMA 1VCTA 1YJTA 3DRXA 3EGWB 3K89A 2Y3YA 1B0VA 1YQHA 1TV6A 2JFKA 1NMEB 1NSKL 4LBIA 3TNVA 5M2UA 3KK2B 3UCUP 2YH0A 4ER8A 1WOSA 4EYHB 1K44A 2WB4A 3HVWA 3ITHA 5ETTA 1IBMJ 4ZMMA 1F5CA 1A7GE 4B9UA 5IZHA 2MZSA 2QFJA 4JB8B 1HMVB 1N34F 2XS7A 1NHUA 1S57A 1VHIA 1JXVA 1LW0A 2RT3A 1L3KA 1NSPA 3MF5A 4CLPA 4DL0C 5IS2A 2OTJS 4UY85 2AQ4A 1F6TA 5GAEU 3W8PA 3H25A 2LU1A 2M88A 3OD2A 1WTFA 3DRRB 1FTCA 4FKYA 2UUAJ 3GV8B 4IO1A 3GIIA 2JVRA 4DV0J 4DF8A 5IC6B 4ZK7M 2AEFA 3CVKA 1U1QA 1PYTA 4ICLA 1KWMA 2HZVA 4QZVB 1B99A 3CMQA 3KWMA 5CABA 1N36F 4OZLA 2VQEF 3FBFA 1HPZB 2XYGB 1PILA 2H4WB 3SSRA 1HYSA 2BKPA 1N5SA 1R8BA 4G1PA 4Y00A 4N5SA 1WI8A 3CXCR 2L08A 1F5AA 3DMJA 3J81j 2FLPA 1RYRA 1HNXJ 2XSJB 1I6JA 5MLCV 2VBZA 8ATCB 3DM2A 3LF0A 2CQDA 4CO0A 2HHWA 2BJ1A 3V4MA 1NKEA 1WEXA 2DNLA 3R5GA 4ECUA 3EGNA 4C2MA 3DRSA 1RA7A 4MH8A 5F9NA 4RW7A 2F1FA 2ADCA 3DN9A 3FBBA 3AJDA 3THTA 2Q3PA 3V6DB 5DQIA 1HWKA 4NCGA 2ASLA 3PXGa 3MR7A 1CJUA 4F2RA 1NXIA 1VFJA 3JSMB 1TKTB 4AE5A 3C8YA 3CCMS 4EYIB 4DLGA 1VISA 4TN2A 3JSRA 1LKZA 5AE3A 2JVMA 1LV5A 1VQ9S 4FVMA 2V4JA 1RBAA 3ENWA 2QA2A 4KT0C 3GIJA 1DZ5A 1S1XA 3CJ2A 3PY8A 2BUNA 3DC2A 1C1CB 3CF5Q 1UVLA 2IBOA 1HW8A 3OHBA 1VQNS 4DQIA 4NLVA 1R0AA 1P6TA 4NXMF 4NX9A 3DDIA 2HEKA 2XI2A 5A6PA 4JV5F 4Z2XA 2BKOA 1S1TB 1QSYA 4U7UD 1CJTA 4I6WA 5HMZA 2ZKTA 1CEZA 2QLBB 2EC0A 2LXIA 5KT4A 1PAEX 1WC4A 3D3BJ 3MMCB 5H9FJ 4C98A 1TR0A 3MEGB 2VQEJ 3KUEA 2CQBA 2HQFA 3W62A 1HHTP 1S1WA 3CO0P 4WP8A 3DKDA 3V6JA 3F41A 3LP1B 3QGHA 4DPUA 5HQ8A 5EDWA 3IBCB 4LF6J 1OIAA 3CJTA 3J81Y 2DNQA 1M0SA 2ZUAA 2HFUA 1VIOA 3NCQA 3GILA 4L3NA 5LT5A 1SC1B 4NZ7A 1PJ7A 2RU3A 4K4ZA 1GMWD 1Z2ZA 1S0OA 1CQMA 5D4PA 1R89A 2MKJA 2QL9B 4NLGA 3EVWA 2IJRA 2BE9B 2J7WA 1S1VA 5B0CA 5LMNJ 5GVQA 3CNQP 1HNVB 2IAJA 4C7QA 2AHOB 2CAJA 4QU7A 4WZQA 3SFGA 2H9ZA 3W66A 4JI1F 3DOLB 1X4EA 5FIIA 3UW1A 4FBUA 2PMWA 1X7VA 4QYRA 4OLPA 5C25B 1ZPVA 3H4DA 2DNZA 3IAM9 2R7RA 3H90A 2R2TA 3M1VB 1FXRA 2YQ1A 2AJ0A 4XPCA 2FDNA 1VBYA 2M2BA 2RDDA 4ZVFA 3T19A 3N0VA 3BGLA 4ZVGA 4H4OB 5DGBA 2ABYA 3IA0A 2ZH7A 2HHHJ 2M8DB 3BGOP 2EFPA 5HJXA 1GH8A 1LW0B 1UAWA 3ET6B 2XULA 1WG5A 2G2OA 3O3LA 2BJ3A 2ZC4A 2MJUA 1S0VA 1KSPA 4DR2F 2CJQA 1PC4A 1DBDA 2MZQA 1X4FA 4IFVB 5K5MA 1P27B 1NLTA 1UEUA 2CUYA 4HHJA 3IRWP 1GXLA 1FRKA 3CPWR 2V4RA 2D3O1 2KFYA 4NOHA 1WUUA 4ENOA 1EARA 3MCNA 4B3MJ 3DGPA 4Y28C 2XO7A 3VAKA 3BSOA 1QSSA 3OVAA 1HBNA 3BN7A 2J0WA 1P9QC 2FHKA 2KM8C 2FVSA 4DX5A 1JXEA 3I9ZA 3VR1A 2AJ4A 4AXIA 4RUAA 1RWOB 1Y4ZB 1JWWA 1DHMA 1T9VA 2A2CA 1FEHA 2U2FA 4WU3A 1J5OB 2MSTA 5AE1A 5T7LB 4DSEA 4HI2A 1DTQB 5J2QB 2OO4A 2VPXB 2DHAA 4Y0FA 1U1NA 1JLCA 3PFEA 3DOKB 5ADZA 4PQUA 4DR5J 4DUTA 2HRUA 2NUUG 4DV6J 5F41A 3MR2A 4M5GA 2CPHA 5CA5A 2PO4A 2Q1LA 4V19X 1Q8LA 2NS1B 4ED5A 1SI9A 1G7CB 2I38A 1U7LA 4EUVA 1FJCA 1SJ1A 1FJGJ 2CJAA 2ZZTA 3AD8C 2DY9A 1KQSR 2MB0B 2VV5A 4USMA 1NK9A 5AXKA 3T9NA 4A8OA 3IBFB 4DR6J 3DNCA 1YBTA 2D7SA 1HNIA 3JYTA 3NGSA 3W61A 2JOQA 4XPEA 2YNHB 2AJ1A 3GG1A 3IR6B 2N7YA 3HI9A 4LIRA 3N6NA 3FQKA 3KFWX 4WKYA 3P45B 1KC8T 2WZ1A 3FCWA 3IRXA 3RBXA 4BS2A 3MM5B 2ILYA 1ZAWA 4XAKA 3CIMA 4P10A 1CC8A 1OQ3A 3DRSB 5HATA 4E2FB 5HVGA 1MWQA 2ZDOA 3PG9A 4LF1A 4GO7X 3TVYA 3PYDA 1YRXA 2DIVA 1MMLA 2YTCA 2WVDA 1OY6A 2HFVA 2MY7A 2ZOMA 4QWEA 1YJNS 3NGKA 5CH7B 7FD1A 3UPFA 4RR5A 3W65A 3CE8A 4BC9A 1OWXA 2H5EA 4RUBA 5ETRA 4WTYA 5FJ4A 2AD9A 1F9FA 4YFUA 4GC7A 3PZPA 5K8NA 2W25A 4LF4F 1CJVA 5K20B 1U1OA 1WEZA 4X4TA 3MM8A 4N47A 1PJ6A 4DN0A 5KFAA 3W7BA 1S6PA 2IC3B 1HD0A 1TVRA 3BEGB 1HQUA 1QM9A 2EG2A 1P1LA 2DGVA 4K5RA 1ZS6A 4EO8A 4CZCA 3W5XA 4CCHA 1F9EB 4DV6F 1K8AT 2AJFE 4LRAA 2WSCC 4C8MA 2JEIA 1DAXA 3Q83A 4DCOB 3OVSA 2F7VA 2EG1A 2W7PA 1URRA 3HJVA 4OI4A 3M6UA 4A4JA 2N3LA 4ZA1A 4P9SA 2W4DA 2CJYB 5KFKA 4UOHA 1SKRA 4JI6F 2B0GA 2GIQA 2ALYB 2YKNA 2AV5A 5KFIA 5KT6A 2NXJA 1VQKS 2DXEA 4NWBA 2FD2A 3S01A 5C7PA 3E01A 1SJQA 1T95A 3I9V9 2YKOA 4FVCA 2WSEC 1KONA 1B4SA 1UL3A 2DGXA 2BKNA 3UO0A 4X66F 1Q8KA 4DSLA 1RXOB 3T6JA 3DGVA 2MXYA 2FVCA 4OI2A 2AYMA 2UXCJ 4I56A 3Q8RB 3MEEB 2J9CA 3MM6B 3OTDA 4DX6A 3LTOA 4P75A 4DUYF 1QD1A 4WTOB 2CRLA 2HHTA 3G4SS 2N4DA 5FD1A 3PW4A 2RRAA 3JQMA 3GONA 1Q0NA 4MT1A 5BYRA 1X5TA 2HVDA 3L09A 1TFWA 3EXYA 3N9UC 3GMGA 4IKAA 1H74A 2WSFC 2M8HA 4IOBA 4RO0A 4C6AA 5IWAF 1F60B 3B78A 1A6LA 3HFZB 4U8YA 4YN3B 1AZSA 2EFNA 4FF1A 2UUWA 3BBFA 3K7RA 3UQSA 1RU1A 1H73A 3TUJC 1ZAVA 2C3PA 3KJVA 4LFBJ 3JB9k 4OI1A 2L41A 2BA9A 2VB6A 4YY3F 2XY7A 1U1KA 1XNRF 4HL9A 2VDIA 4M94A 3GTYX 1FESA 3TAMA 5HQLA 4YB1P 1FKOA 2DHSA 2ZDPA 4ZLPA 3CJSA 4QWBA 2HNZA 1X0FA 1UVJA 2GJFA 1RBOB 4KH0B 2ERRA 1RT5A 5IM0B 2R7WA 1TMMA 1N0UA 2KB2A 3LWMA 2I2YA 2LXFA 1BQNA 2B6AB 4I2QA 4HEA9 4C0OC 2VJUA 2IPOB 4N7TA 3RRKA 1JJ2R 1T8EA 1JLFA 4FYVB 4YB7A 5L39A 3PYFA 1UPMB 1LOUA 4IO9Q 4RW9A 1UWBB 3RRGA 3OFGA 2FJXA 1GMVA 2YQ3A 2DGUA 3OUYA 2E9ZA 1W2IA 2HHSA 5AXNA 4CLYA 5L46A 1JB0C 4F2SA 1OYDA 3NMAA 1RLDA 3MPYA 4ELTA 1XIQA 2BJ9A 4ED2A 2UUCJ 3LP2B 1RHJB 4DZ6A 3AAWB 3J7YI 3D67A 1OPZA 1O5JA 1R8HA 2P2CB 3ENVA 4PG7A 1NK0A 4ZPCA 4G1IA 2DNKA 2WONA
chains in the Genus database with same CATH topology
3L9ZA 1XAOA 3TJAA 3NY0A 2Q2GA 4L3KA 2QLDA 1C3GA 3NXZA 4J80A 1GMWD 3AGZA 1GMVA 1GMWA 1NLTA 1EB0A 3TJ8A 2HFVA 3AGXA 3AGYA 1GMUA 3LZ8A 3TJ9A 1EARA 3LA0A 3I38A 2B26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9Z A;  1XAO A;  3TJA A;  3NY0 A;  2Q2G A;  4L3K A;  2QLD A;  1C3G A;  3NXZ A;  4J80 A;  1GMW D;  3AGZ A;  1GMV A;  1GMW A;  1NLT A;  1EB0 A;  3TJ8 A;  2HFV A;  3AGX A;  3AGY A;  1GMU A;  3LZ8 A;  3TJ9 A;  1EAR A;  3LA0 A;  3I38 A;  2B26 A; 
#chains in the Genus database with same CATH topology
 1RWU A;  4NLO A;  2XMJ A;  2ZH4 A;  4DSK A;  2QL7 B;  1RT7 B;  2WHO A;  1SH2 A;  3PRB A;  1WF1 A;  4OV6 A;  4NLU A;  5CYJ A;  1KHV A;  3DYA B;  2DR6 A;  4DL3 A;  1Q53 A;  2OSR A;  3I82 A;  3RGI A;  2KZZ A;  2B3T B;  3AOA A;  3DHW C;  1RHK B;  1TU0 B;  2H54 B;  2EWH A;  2Y1L B;  7FDR A;  3M9M B;  1N5Q A;  2H51 B;  3AJ2 A;  2Z2Y B;  3OVB A;  2CJK A;  4KPY A;  1OYE A;  5AXL A;  1MW7 A;  1WEL A;  2HAI A;  4X4Q A;  1NK5 A;  3J7A N;  4LFB F;  5D77 A;  1XQI A;  4DPY A;  3G6X A;  1LWC B;  3IN5 A;  4AL7 A;  3QT6 A;  4X64 F;  4TU9 A;  2QRR A;  3MPV A;  3BDE A;  1HL6 A;  2QLJ B;  1YJU A;  4F02 A;  3AOD A;  4MAK A;  3HKW A;  2FQQ B;  2HFS A;  4ID5 A;  2CZ9 A;  2IFX A;  2VU5 A;  4QJV A;  4DR3 J;  1XMQ J;  2XS2 A;  4KJI A;  2E9T A;  3JSB A;  3ZZU A;  2BOP A;  4CO3 A;  2F3J A;  1E6V A;  4GRS A;  4J9R A;  1WKL A;  2LQB A;  3LPY A;  1T7P A;  3T1Y F;  1N6Q B;  3POT B;  1PBU A;  1T9U A;  1Y0H A;  3EUN A;  4RW4 A;  5KFR A;  1RP5 A;  4M5J A;  1LFP A;  3WHI A;  3R3T A;  3OL7 A;  4S0M A;  3QJP A;  2DO0 A;  1KLM B;  3NWG A;  4ZIW A;  3QIP A;  3A13 A;  1V3Z A;  4UW2 A;  1Q81 T;  4JI1 J;  5EWE A;  1QAX A;  1ZZF A;  5KFT A;  2WRM A;  3AT1 B;  5KFB A;  4LF9 F;  3LP0 B;  5D4L A;  3Q86 A;  4PPD A;  2BEF A;  2A6M A;  4TY8 A;  4WFA Q;  1L3V A;  4CLW A;  2MHE A;  5KFV A;  4AUK A;  1T03 B;  2DHG A;  3D1H A;  3OUY B;  2KTQ A;  4TYB A;  4O4G B;  1TP7 A;  2RF2 A;  3R7N B;  2MTL A;  2OPQ A;  4K59 A;  4L76 A;  4U96 A;  3U27 A;  1XBW A;  4RBV A;  4DQS A;  1CG2 A;  1XMB A;  2AGP A;  1N48 A;  5AJ3 J;  2W7O A;  2E5H A;  2AYG A;  2UUC F;  1FNM A;  2B43 A;  3W64 A;  2RUS A;  2CVI A;  3M2V A;  4J7C A;  4K7Q A;  3QO9 B;  2H65 B;  4IR9 A;  3I5B A;  2QV6 A;  3FMW A;  5JXS A;  5DET A;  2H5I B;  2HGL A;  1K1Q A;  2HFN A;  3IP0 A;  1F1B B;  2IYI A;  1REG X;  2M4M A;  4IFV A;  1FFW B;  4OJH A;  5HMW A;  1FDA A;  3TX8 A;  4Y2K A;  4NA3 A;  5BR8 F;  2K8G A;  1BWE A;  2M70 A;  1FXD A;  1ZM9 A;  3LAL A;  2UUB F;  4I7F A;  3BGR A;  1NK4 A;  4KV8 A;  5K8P A;  3PTW A;  1REV A;  3NOC A;  1Q16 B;  3HO1 A;  3NCP A;  1S1T A;  1TQL A;  3PJW A;  1IM4 A;  4U9R A;  4LFA J;  2A3J A;  3OFF A;  5J1N A;  5F3Z A;  2PFF B;  3OQ2 A;  3V6H A;  1U1L A;  4A8Y A;  2VG5 A;  4LR8 A;  5B09 A;  3D3C J;  3OPK A;  2DHH A;  4NEY A;  3ENA A;  1PAU B;  4FPI A;  2W8L A;  2OSQ A;  4G65 A;  4HDH A;  4JV1 A;  1LWC A;  4O3P A;  3MR6 A;  3C6E C;  2JVO A;  5A8R A;  1FA0 A;  2N7C A;  1SV5 B;  1J5E F;  2GAH C;  2IRX A;  1WJ9 A;  3NAI A;  3KLE A;  4J9Q A;  2C2D A;  2DPI A;  1VLY A;  3CO9 A;  3OBI A;  1VC6 A;  4Y3C A;  3TAR A;  2P6T A;  2R7Q A;  2BW7 A;  4J80 A;  2KYX A;  2G4B A;  3G8T A;  2FJV A;  2M3D A;  5HLF A;  4Z7Y A;  4ZPB A;  1UW9 A;  1OS5 A;  4OLO A;  4PEO A;  4I64 A;  3BBB A;  3M32 A;  3QLH A;  4X65 J;  2XMA A;  1DQ8 A;  3MPU B;  3J80 Y;  3EPI A;  1FXL A;  2FVP A;  2Y1I A;  1NHK L;  2LP4 A;  4K4S A;  2C3M A;  2XSJ A;  4LUB A;  2POK A;  2F4V J;  3VTI A;  4FXV A;  1JLQ B;  3RBE A;  3PO5 A;  3FRZ A;  8AT1 B;  5AT1 B;  2BAN A;  3W2V B;  2C2Z B;  1SL0 A;  2BYC A;  2H1Y A;  1HBU A;  3X1L B;  1YJV A;  2CQG A;  3ELH A;  1UEV A;  3QQC D;  2R8H A;  4ZP6 A;  5L1I A;  2JEJ A;  4NAS A;  1N32 F;  2YPZ A;  1NAQ A;  1A0O B;  3JS9 A;  3P8B B;  4HVZ A;  3VVU A;  2HQD A;  4USK A;  3PVX A;  3GB0 A;  3M8Q B;  1E6Y A;  3A3N B;  1AZS B;  2CQP A;  1IBL J;  2ACY A;  2E7W A;  5IXU A;  1RK8 A;  3UD4 P;  2OPS A;  3KNA A;  4GKK J;  2Y0B B;  2XMV A;  3AFG A;  4ZOS A;  4F4X A;  2Z2L A;  4I7F B;  1S97 A;  3PX0 A;  4DXL A;  5CD4 H;  4KHM A;  2CQH A;  1HNX F;  2RS8 A;  3HKZ D;  4CTA B;  1W26 A;  3CD5 A;  1RT6 A;  4GVB A;  1J2V A;  3LAM A;  2GGP A;  2DIU A;  4ZVQ B;  5BR8 J;  4LSN A;  1DQA A;  2B9X A;  4JUZ A;  4DS4 A;  5E41 A;  1BXN A;  2D69 A;  2XSF A;  1U6Z A;  3KNG A;  4TYA A;  1XAO A;  2MZ1 A;  3G6E S;  2OJ3 A;  2XLK A;  1FX4 A;  1X4H A;  2VAS A;  3IAS 9;  3KG0 A;  3QFH A;  2XYH B;  2ZNY A;  2GVZ B;  5CYQ A;  4F7V A;  3G9C A;  4MJK A;  3R7S B;  1BD6 A;  2BRL A;  1T03 A;  1JLG B;  4I69 A;  3NAH A;  1RBL A;  1QDU B;  2GIF A;  2VFU A;  5D6G A;  4ZN1 A;  3W9I A;  1F3F A;  4BC7 A;  1DTT B;  3MEC A;  2JZ8 A;  2U1A A;  3S6E A;  3MM6 A;  3AQP A;  1KLM A;  1I51 B;  3TW0 A;  1S1V B;  2Q43 A;  3EDQ B;  4O23 A;  4ZLJ A;  2ZJR Q;  4DR2 J;  5L1K A;  4J9N A;  3TI0 A;  3L3C A;  1YRT A;  1N33 J;  1WHW A;  5GAD I;  4DR7 F;  3QLH B;  3HT3 A;  1S49 A;  4MMO A;  2E1P A;  5DLF A;  1YRU A;  1UA0 A;  3MMA B;  4OMF G;  2OPQ B;  5A2Q U;  2XC9 A;  1IKV B;  1B64 A;  2Q2G A;  4JI5 J;  3D6M B;  1RTH B;  4MK7 A;  4RKU C;  3T5J A;  4J9V A;  2BQR A;  1FCA A;  1T9Y A;  1X5S A;  4RW8 A;  4FZV A;  1IJE B;  4F67 A;  2IM0 A;  3MM9 B;  3JTN A;  5M2P A;  4J9L A;  3AKO B;  2UV8 A;  5D8H B;  4DU7 A;  3K8W A;  5CXT A;  1Q86 T;  3X3U A;  2P5V A;  3QWP A;  4LBH A;  4A8Q A;  2DIS A;  3BQ0 A;  3K59 A;  4G1Q B;  4ZHR A;  4LVN P;  1PC5 A;  1XN9 A;  3HT0 A;  3PJ9 A;  4O3N A;  4HLB A;  1SV5 A;  1AW0 A;  2LKZ A;  4ANE A;  2QA4 G;  1R6Y A;  4NMX A;  4PUO B;  1BMQ B;  3MMC A;  2FUG 9;  3VAM A;  4DR4 F;  3PNI A;  4QIW D;  3MUV P;  3KK2 A;  2KFZ A;  1SJ3 P;  1LQ9 A;  2GJ2 A;  4DFM A;  2HQI A;  3M8S A;  3QID A;  3OTO J;  4KB7 A;  4ANC A;  2NCK L;  1VQ8 S;  1N34 J;  1JJC B;  3BGR B;  5IC4 B;  1IR0 A;  2FYX A;  4OZ1 A;  1P8G A;  3FFI A;  4ECX A;  1V6H A;  2F8M A;  2AZ1 A;  4LF8 J;  2MHN A;  1PSD A;  2EXU A;  3I6P A;  5HBM B;  3ZZP A;  1N32 J;  1WC5 A;  2CPD A;  2LFV A;  2OPP B;  4WBF A;  3ZZ0 A;  5LXR A;  3BO3 A;  4FF4 A;  1SQE A;  4PAB A;  4OX6 A;  4IRD A;  3DOK A;  1NK7 A;  4FS1 A;  2DD8 S;  1S5Z A;  4DI6 A;  5C2G A;  3PEH A;  2B9W A;  2JRS A;  4X62 J;  3MUM P;  4X84 A;  2JJ4 D;  3A8I A;  5DM7 Q;  1IKX A;  5L9X A;  1RHQ B;  2M5Y A;  4P72 A;  4QIF A;  4YR3 A;  3PIO Q;  2DCU B;  4JOU A;  4F4K A;  4YME A;  2QC3 A;  5HLF B;  1U47 A;  4B9V A;  2FGO A;  3BKU A;  4BCA A;  2GJI A;  3KUH A;  5A2Q Y;  5D3G B;  1G1X A;  1S9G B;  2V68 A;  4RW6 A;  2ALZ A;  1U26 A;  2F9J A;  2GMJ A;  3GLJ A;  4NZ6 A;  1HFE L;  2QMU B;  3UDC A;  2AX0 A;  1TV6 B;  3ZC4 A;  4RUH A;  5C42 A;  2ZJP Q;  2YNF A;  1HWI A;  1FJG F;  2MEW A;  3MD1 A;  3MEK A;  5ETK A;  1GTE A;  2C22 A;  2R7S A;  4DDF A;  2NSB A;  2DXF A;  1C1C A;  2VBX A;  4F04 B;  3LH2 S;  1X4B A;  1Y00 A;  3HHE A;  2NPI A;  3I4H X;  4EFA C;  1GNK A;  1NPR A;  1RE1 B;  2IDL A;  2B8Q A;  2DBB A;  1WI6 A;  3CGI A;  4OYO A;  4OYW A;  5KG3 A;  4PXE A;  4QWC A;  4FXD A;  2VKR A;  3FBC A;  2QG9 B;  3ICL A;  3TWZ A;  4DSF A;  2CJB A;  4M95 A;  3MGJ A;  3QGP A;  2VUG A;  1REV B;  4PWU A;  4NL5 A;  1NH7 A;  2X1A A;  1XR7 A;  3AY0 A;  5F8H A;  2YVS A;  5EUH A;  4DZD A;  1WWH A;  3D5M A;  3NGU A;  2W9B B;  4LR7 A;  3ZXW A;  1NU4 A;  2QE5 A;  3RBZ A;  3HFV A;  3NS5 A;  4XDD A;  2BW2 A;  2WVE A;  2P6S A;  1H72 C;  2V34 A;  1H98 A;  4F0K A;  5DZ6 A;  1CS4 B;  1X4G A;  3NBP B;  2IA6 A;  4P2F A;  1NPK A;  3QMQ A;  4V1A k;  4FF2 A;  3QYY A;  3PRV A;  3AA8 A;  2AT1 B;  2OP5 A;  4MYU A;  1Q4R A;  3HFK A;  3KLF A;  2O5D A;  2BZ2 A;  1Y9O A;  3JQK A;  3Q2S C;  4TVA B;  1M1G A;  4TY8 B;  4DN9 A;  4DV5 J;  1H38 A;  4OI3 A;  3UI3 A;  1T94 A;  3UVJ A;  2BE2 B;  5E3P A;  4O4G A;  4XIU A;  4USV A;  1NUE A;  2R2S A;  2AU0 A;  3S7R A;  1TK0 A;  2QLF B;  2Y0S D;  2QYC A;  2HRT A;  4WK1 A;  2ADB A;  2OEL A;  4E98 A;  2B4P A;  1S7I A;  2O1P A;  4ZPV R;  2NXU A;  1HBU B;  2HBY B;  4YR0 A;  1SH3 A;  4JP8 A;  4OI6 A;  1HNV A;  3NCR A;  9RUB A;  1JLQ A;  1UFL A;  1KVJ A;  3KHR A;  4K0K J;  2O01 C;  2DXD A;  3SDE B;  2KT3 A;  2UXC F;  3OJS A;  5DS7 A;  2Q6B A;  2QYG A;  2RAQ A;  3VGT A;  1C4A A;  4FNH A;  4ES3 A;  1YJR A;  4HT7 A;  3MD3 A;  1SL1 A;  2A18 A;  3LAK A;  1QAJ A;  2W7A A;  2J9D E;  2DGT A;  1OY8 A;  3VGU A;  1U48 A;  4GVB B;  5CZV A;  4WYW A;  4YHH J;  2YQ0 A;  4M5L A;  1U0S A;  1YVF A;  1JNZ B;  2Q79 A;  3CJ0 A;  5I42 A;  4MTP A;  4RU9 A;  4LF7 F;  4ERD A;  5AXM A;  4DBQ A;  1IWA A;  1SKU B;  1Y5L B;  4DV4 J;  2OH2 A;  3MMB B;  1ZTW A;  3B54 A;  1OMS A;  4QR1 A;  3QJL A;  4NLR A;  1EKR A;  2CNO B;  4HH0 A;  3T1H F;  5J1E B;  3J7A 1;  4X4P A;  2PA8 D;  2QSF A;  1WC1 A;  4OYP A;  4IQM A;  1RAH B;  1V9O A;  5HP1 B;  2MLZ A;  3I56 S;  1N5Y A;  2ODX A;  2MLX A;  3W8G A;  4X4V A;  2H48 B;  5CD4 A;  1NLK L;  2OEM A;  2V0N A;  1RAJ A;  1T9T A;  4FXW A;  4QQB A;  1OSC A;  4DSI A;  4FYY B;  2AP6 A;  1CUL A;  4H54 A;  5F8M A;  1S10 A;  5EN1 A;  3CDW A;  1TK8 A;  1FF2 A;  3DU5 A;  2DYA A;  1TL7 B;  4USI A;  5H9F K;  4LF5 J;  2QGF B;  3K5N A;  3P4U B;  4QBU A;  4GKK F;  4DV2 F;  4G6V B;  2DGW A;  4Q2L A;  5ETM A;  3TEH B;  4Y65 A;  1RZM A;  1FDD A;  2PD1 A;  1FNO A;  3A12 A;  4CNZ A;  2YKN B;  3OTC A;  3P3D A;  2KM8 B;  1YSJ A;  2I8E A;  1HA1 A;  1RB0 A;  1SC4 B;  3I5A A;  2HS0 A;  3HUL A;  4DPT A;  2Z30 B;  3MWB A;  2R2U A;  2CNN B;  3TUP A;  4DS5 A;  2DNO A;  2CQ4 A;  2J5A A;  2B5J A;  3GYG A;  5IV3 A;  5I3P A;  2PDA A;  3R2D J;  4Y2I A;  1CBK A;  2SXL A;  3W2W B;  3DDK A;  2YWW A;  1ZET A;  1BGX T;  2YWH A;  1DQ9 A;  3GP9 A;  2J6T A;  4PRF A;  2CPJ A;  2X7I A;  1HR0 F;  1RT3 B;  4URS A;  1ZPW X;  2DNR A;  4R5P A;  1XMQ F;  3C6U A;  3HVT A;  3TAM B;  3MFH A;  1M1H A;  1KQF B;  2ZNZ A;  5LSL A;  1N36 J;  4I68 A;  1FVS A;  2B26 A;  2MY8 A;  2QA1 A;  4AT1 B;  2MQQ A;  2D3O R;  1VQ6 S;  3TOQ A;  2JEF A;  2HFZ A;  1ZBT A;  2ZH2 A;  4DX7 A;  3MAH A;  4DV0 F;  5HVF A;  3NNA A;  1FE0 A;  1JNR B;  2MQM A;  2ZBR A;  4CO1 A;  2B7C B;  3LW5 C;  4OX7 A;  4P7T A;  4QOT A;  3RB0 A;  1D8Z A;  1R8P A;  2VG7 B;  2EFQ A;  1UKU A;  3C3L A;  2XMW A;  3IXQ A;  4OJ1 A;  4K4T A;  2E9R X;  3D0G E;  3UD3 P;  1NK8 A;  1HNZ F;  3DFE A;  1RTH A;  3PAC A;  1FER A;  3Q89 A;  1KN6 A;  2KU7 A;  5DDR C;  3O6Q A;  4ES2 A;  2ILZ A;  3UFC X;  1YX2 A;  1S4E A;  3CCT A;  2AEM A;  3SYZ A;  2HS4 A;  2HHV A;  3KMQ A;  2DNY A;  3N5F A;  1RT4 B;  3EPG A;  2D9P A;  1M5P C;  3FCH A;  2QL5 B;  2EKN A;  2XGP A;  2HIY A;  2MKK A;  5F8N A;  2WAQ D;  2YNF B;  4ZJL A;  4DMZ A;  1FFG B;  1N5T A;  3OW2 R;  1MRO A;  5KG0 A;  3KLH A;  4O44 B;  1RAO A;  3T41 A;  4DU8 A;  1RWN B;  2RQM A;  4NYP A;  3FRY A;  2BE2 A;  4RL1 A;  1BQX A;  1HHS A;  2KXF A;  1EP4 A;  3BKT A;  3P96 A;  2O3D A;  2YNI A;  4NPO A;  5T41 A;  3VQT A;  1NJX A;  3TA1 A;  1TKZ A;  4FNI A;  1G6B A;  4YUD A;  4F3O A;  1KLN A;  4NLT A;  5CYM A;  2I1R A;  5IT9 U;  3I87 A;  2WOM A;  5LJ3 Y;  4JI6 J;  1IKY B;  3KLV A;  1HD1 A;  3M8Y A;  3NGR A;  2WVC A;  5ETP A;  4LSL B;  2AWZ A;  1RDR A;  4JI2 F;  1RA6 A;  2ATC B;  1KOH A;  1V5I B;  1T3O A;  4KV8 B;  2VH7 A;  4NE9 C;  4OQJ A;  1GFW B;  3BGU A;  2HND B;  2GHW A;  1DAR A;  1RWX B;  1X0P A;  3PW7 A;  1M5V C;  4OV1 A;  1XEZ A;  2UVV A;  1AB8 A;  3FMB A;  2MQL A;  3NG8 A;  3U7J A;  1AFI A;  5KG7 A;  3CDB A;  3QNW B;  3QRR A;  4PKD B;  4DR4 J;  4HKQ A;  3IR5 B;  5B0F A;  1D0E A;  3M9N B;  3H5S A;  2C42 A;  5A0Y A;  2DNP A;  2X1F A;  3KG4 A;  3I0S A;  3EE3 A;  3H5Y A;  3ETM A;  1S79 A;  2ZH3 A;  3TAQ A;  2F5G A;  2RRN A;  4K2X A;  2EW9 A;  4KKO A;  2MKH A;  1RT7 A;  3BF4 A;  3EVO A;  2MQN A;  3F56 A;  4HHU A;  4DUY J;  4KFB A;  1W25 A;  3CMA S;  5KFY A;  4OYZ A;  2EBG A;  1QLN A;  2FGC A;  2HHH F;  2YY3 A;  2CQC A;  4ATN A;  3G8S A;  2DRD A;  3PR4 A;  3O2I A;  1SIW B;  4GO5 X;  3PW2 A;  4ZKA A;  5C42 B;  3CJ8 A;  3Q22 A;  1SUQ A;  3QZ7 A;  2OPR A;  3PJX A;  4ZIV A;  5KFO A;  3M6W A;  4CLS A;  3IR7 B;  2AEJ A;  3FDS A;  4BBY A;  1X9M A;  3M8P A;  4RW6 B;  2DVI A;  1OSD A;  4JBC A;  3WIV A;  3H4B A;  1U0H B;  2XWY A;  4PZV A;  2IJN A;  3T9Z A;  3NWR A;  4ECZ A;  5D3G A;  4QIV A;  1Q7Y T;  1FRX A;  3SQG B;  3NXZ A;  1K47 A;  4ZPT R;  1KQK A;  2PGC A;  3TEG A;  3C14 B;  3M2R B;  2KKH A;  5LMU J;  3D68 A;  3PX4 A;  1W2B R;  1G2E A;  1RAE B;  5IT9 Y;  1NZA A;  1XNR J;  3BYR A;  2J7U A;  2KRB A;  4PR6 A;  3G6Y A;  4JI2 J;  1VQ4 S;  4WCE Q;  2IY5 B;  1OQ6 A;  2HWI A;  1RTZ A;  2DR8 A;  4OHX A;  2VBW A;  2VG6 B;  2C2M B;  3R6G B;  5B7W A;  2HFO A;  4TY9 A;  1RT5 B;  1HBN B;  5JJB A;  5IM0 A;  5HO4 A;  1IBM F;  3KOA A;  2VG5 B;  5BXI A;  3POT A;  1S6Q A;  1D8Y A;  1FT8 A;  2GO9 A;  3MPD A;  4LIW A;  4DCP B;  1U09 A;  3TAN A;  4HT5 A;  4LSN B;  5D78 A;  5GMD A;  3R5D A;  2HZC A;  4KRW A;  4GC6 A;  1SH0 A;  4Y6I A;  1HLW A;  1KVK A;  2LYV A;  3PHE A;  1H6K X;  5K9F A;  3RAQ A;  3IO1 A;  3QJJ A;  2HVI A;  5KAK A;  2E1R A;  4OYB A;  5B0D A;  4NLD A;  4TU7 A;  3CCL S;  5L8R C;  2FPH X;  2MKS A;  3KLI A;  2AF6 A;  2FJD B;  5CYQ B;  4ETZ A;  4RNF A;  1YZ6 A;  1X5O A;  1FDN A;  4RBT A;  4ED8 A;  3K2Y A;  2EPI A;  1D9A A;  2RKI B;  6FD1 A;  2ZH6 A;  1N88 A;  2W01 A;  3W1Y C;  4WWS A;  4LBP A;  1IBK F;  2MZT A;  1GAO A;  2CIM A;  3HDS A;  3ILJ A;  3SCI E;  3T3F A;  1S9E A;  3L7U A;  2BR0 A;  5E3R A;  2L9D A;  2V9K A;  2K2P A;  2IAJ B;  2Z58 B;  1Q79 A;  2LMI A;  4CLK A;  4ECS A;  3OXF A;  4Y34 A;  2UU9 J;  2OKQ A;  2RIJ A;  3DMJ B;  2GQ2 A;  1U25 A;  6FDR A;  2XLJ A;  1HAR A;  2ZJQ Q;  1LEO A;  1HBM A;  4MKY A;  4YDD B;  3DM2 B;  1SKW A;  5J2N B;  3M8Z A;  1XJW B;  5ETN A;  3DYA A;  3H5X A;  5H9E J;  4M1K A;  4QIE A;  2OD6 A;  5F0U A;  2GS8 A;  3MCO A;  2GFF A;  2P8I A;  4F25 A;  2UVW A;  4QR0 A;  2E66 A;  2CQ0 A;  3DI6 A;  1RUS A;  4PAA A;  4I2P A;  2CDR B;  2XNQ A;  4ZIT A;  1RTJ B;  5KFL A;  3HMJ G;  2XLI A;  1CVJ A;  5KFZ A;  2Z2Z A;  5DM6 Q;  1Q7L B;  6AT1 B;  2BMB A;  3GYX B;  5K14 A;  2JWN A;  2HNY A;  2OUG A;  3UNG C;  4CLF A;  2XM3 A;  2ZHB A;  4J9U E;  2PEB A;  2DTJ A;  4CDI A;  4LRE A;  3AGX A;  5DO2 A;  4N8N A;  2CJ9 A;  2W2M P;  3K5O A;  5BYQ A;  4USJ C;  2C28 A;  4NXM J;  1FO1 A;  3SI8 A;  1IUJ A;  2J9E A;  4AL6 A;  1R0A B;  1M5S A;  3BH6 B;  2G9O A;  3D1Q A;  5AJ3 F;  1FX2 A;  2YPY A;  3RJM B;  4N77 A;  2YBV A;  4X2B A;  3FUY A;  3TZX A;  1ZZN A;  3A8J A;  3UR0 A;  1K0V A;  4I6A A;  2LEA A;  4UF4 A;  2MPU A;  2KDO A;  1S7H A;  2BAC A;  1RAA B;  1YKW A;  3CCS S;  1B7F A;  5SUH A;  3QAU A;  4FPR A;  4ZVU B;  1CC7 A;  1X31 C;  3KKF A;  1I94 F;  2F8H A;  2UXB J;  3DOL A;  2UZA A;  1UJ4 A;  5GME A;  4B02 A;  3PR5 B;  4QWA A;  1Q8B A;  3TJ8 A;  2W2Q P;  1NPP A;  1UVI A;  1JMT A;  4U67 Q;  1B7Y B;  4X4O A;  1MMD A;  2JFD A;  1PBA A;  3GPA A;  3RBD A;  1E6Y B;  1IVZ A;  3HLU A;  2E5G A;  4BWJ A;  4ZVP B;  1F0X A;  2QTW A;  5FLX Y;  2IM1 A;  5GAH U;  2RB7 A;  2MQP A;  4E0D A;  2V5H G;  1F2H A;  4F0H A;  1Y11 A;  1MWZ A;  2F4F A;  4O3Q A;  2RD5 C;  5A8K A;  3BSN A;  1X4C A;  2EI5 A;  2G0I A;  5ETV A;  2Y1J A;  3O5T B;  1S12 A;  3M8P B;  3WX4 A;  5KFH A;  1L3T A;  3WIU A;  3MED A;  3TZY A;  3JAM U;  4JV2 A;  1BLU A;  1UFW A;  4NCA A;  1NEE A;  2JX2 A;  5CHC B;  5KFU A;  3W5Z A;  1RTI A;  3KLG A;  4M5K A;  4ECV A;  2C2R A;  4OZ3 A;  1FKA F;  2KJV A;  3BDP A;  2R7O A;  3E3X A;  4KY3 A;  1VGY A;  1BQM B;  5E33 A;  4FYX B;  4DL6 A;  2CG4 A;  3DRR A;  4U7C A;  4F4Y A;  3CDE A;  1IBC B;  1SC6 A;  2B9E A;  3TZW A;  3GR0 A;  5KT3 A;  5EWF A;  1IKW A;  4ELU A;  1R8A A;  2OFG X;  1Q5V A;  3E51 A;  1HWL A;  4HTJ A;  2UXB F;  2EBE A;  2GQC A;  2XMK A;  2GGP B;  3L95 X;  3OV7 A;  3H98 A;  3A8K A;  3OLB A;  1WNE A;  2EK6 A;  4CLZ A;  2HK3 A;  2X51 A;  3JSY A;  4JV0 A;  2K1R A;  5A8R B;  1KVI A;  4NYO A;  1NO8 A;  2OMO A;  2QX0 A;  1FRL A;  3D28 A;  5EHH A;  4NXN F;  3R2C J;  1OJ4 A;  4X4U A;  2XO6 A;  1VRT B;  1TL5 A;  4B3T F;  5KG1 A;  2W9A A;  1N5Y B;  3H42 A;  2UVU A;  4CH1 A;  2G1H A;  4U95 A;  2R4F A;  5C24 B;  1YWX A;  3CED A;  5HRO A;  4X4N A;  5GAG I;  1VYA A;  1ZA1 B;  3ISN C;  5DG7 A;  2BJ7 A;  2VPW B;  3RU0 A;  1CJK A;  1WG4 A;  2C2K B;  5THW A;  2HMI B;  2WBR A;  3ZZT A;  2FHJ A;  3N28 A;  1FD2 A;  2MKC A;  2XCP A;  2LEB A;  1D9D A;  4M5N A;  4K4Y A;  1MSW D;  3IWL A;  1RTJ A;  4ID8 A;  4LRC A;  4OFZ A;  1RIS A;  3M8Q A;  2C2N A;  5M2R A;  1KOO A;  5CYM B;  2NLW A;  1TFY A;  2NSC A;  2OPR B;  2KZM A;  3ILO A;  1LK7 A;  3H5U A;  3P5T L;  3KLH B;  2HHQ A;  3M2V B;  3J7Z T;  1DTT A;  4F26 A;  4YQW A;  4J90 A;  4UOF A;  2HGN A;  3NS6 A;  3NS7 B;  2JSX A;  3ZTQ A;  2QT7 A;  3FEX B;  4FKX A;  4DPO A;  4A8M P;  1NKB A;  1Q82 T;  2HWT A;  1UW4 A;  3CJR A;  5JVH Q;  2HBR B;  3AJ1 A;  4CO5 A;  4KQZ A;  1T9W A;  5G0R A;  2E1A A;  3NEK A;  4WF9 Q;  4B3R J;  2I0X A;  1SB6 A;  3N6L A;  1PIE A;  3B82 A;  2GHV C;  3TA0 A;  2HQC A;  4UOG A;  4DCJ B;  2XZD B;  2EEY A;  3FZ2 A;  3R5B A;  3HF5 A;  2IJF A;  4PCQ A;  4UOC A;  1NDK A;  3LA0 A;  2Z0G A;  3D0H E;  4RJV A;  4PQU B;  1FEE A;  4USH A;  2CG8 A;  3VHQ A;  1HQU B;  5F3T A;  3Q8S B;  3KYL A;  2W9C A;  1NND A;  3KLI B;  2A6O A;  2B8P A;  1Q95 G;  4YHH F;  4LF5 F;  3UD5 A;  4DOZ A;  1UET A;  1FI4 A;  3V6K A;  3LAN A;  1SPB P;  5E3Q A;  1SKS A;  4YOE A;  3BSA A;  3PYE A;  4F3M A;  2E5L J;  4NCB A;  1U24 A;  3MMB A;  5F8L A;  3KJV B;  2QMW A;  2CQI A;  5HMX A;  2B4O A;  2OTL S;  4KKO B;  4QU6 A;  1VRU B;  3DLK B;  3K5P A;  3OTE A;  2JHE A;  5MAO A;  3QZ8 A;  1KS2 A;  2HGM A;  4DL4 A;  2B56 A;  2RRB A;  2CPI A;  2IM3 A;  3TP2 A;  1FRJ A;  4BWM A;  1U2F A;  4URQ U;  1GX6 A;  4W4M A;  2HLU A;  4I6Y A;  4Q0B B;  3W5Y A;  2OI2 A;  3Q8V A;  4J5O A;  2P9C A;  3I0R A;  4PG4 A;  1RWK B;  3IRX B;  2QEX S;  2RF2 B;  1RCX B;  1Q1K A;  4CNY A;  3AXM A;  2Z8Q A;  3G86 A;  2FHO B;  3TQE A;  5DG8 A;  4OHW A;  5D0R A;  2E5I A;  4QCL A;  4ZPW R;  1N33 F;  2ZZM A;  3HVA A;  2K06 A;  2WON B;  2DNH A;  4WFB Q;  3VZH A;  2JDJ A;  2AX1 A;  2IM2 A;  4Q2M A;  5J2N A;  4MK9 A;  4H4O A;  3ZTS A;  4CP5 A;  2NPF A;  1L5U A;  4USU A;  3NGD A;  4DQP A;  1HI1 A;  2V2Z A;  2V69 A;  3LP2 A;  5HQM A;  2XMU A;  5D15 A;  4I4B A;  3VF0 B;  3HSG A;  4O0I A;  2YX4 A;  3RTV A;  2BRK A;  1EET B;  1HKA A;  2AW0 A;  4RNH A;  1KKH A;  3UNY A;  4IFY A;  4IG0 A;  2VBY A;  3MM8 B;  1ZAX A;  1C2P A;  2YKQ A;  4M8L A;  4PXD A;  4I2P B;  2CXE A;  4X65 F;  2WVF A;  3C16 A;  4BDP A;  3MED B;  3CCW A;  3LZ8 A;  3TJ9 A;  2XCA A;  4DG1 B;  2OLW A;  5KFW A;  1VIX A;  2CWK A;  4TNO A;  4R8U A;  3U1M A;  2LXU A;  1AA1 B;  2VZ9 A;  4PG6 A;  4O3O A;  5D0G A;  1KTQ A;  3CW2 C;  2EC2 A;  2CNK B;  3CT9 A;  1FJ7 A;  2HNZ B;  1VC5 A;  4JI8 F;  3GSI A;  3MUT P;  3FSX A;  4KGX B;  3ONQ A;  3ZNJ 1;  4IH7 A;  4EWT A;  2FY1 A;  3SCL E;  1S4F A;  1RAB B;  1JIH A;  1T9X A;  2HKE A;  3GFZ A;  3BR9 A;  3LQV A;  2V8D A;  2K1R B;  4ELV A;  3B4M A;  2VFS A;  4UQT A;  2C3Y A;  3JQJ A;  2LDI A;  1FHT A;  4WIQ A;  5KG4 A;  1GK8 A;  3R97 A;  2XGQ A;  4J37 A;  3PKY A;  4DR1 F;  1N54 B;  3GSD A;  1ELO A;  3AXK A;  4C3M A;  3VAH A;  1GTH A;  3M7V A;  4YDX A;  1CJV B;  4ED7 A;  2XY5 A;  4QYZ J;  2HZA A;  4LMZ A;  4WFY A;  3GZ7 A;  1WC3 A;  3HHL C;  1Q5Y A;  2CZ4 A;  2MKY A;  3M4X A;  4WII A;  4WFX A;  2FHJ D;  4AND A;  1S0N A;  4GKJ F;  1FDB A;  3MR3 A;  4K4U A;  4G3I A;  1EIY B;  2LDY A;  1SXL A;  3W9J A;  5LMN F;  4HAC B;  2K7J A;  4OZJ A;  4X4R A;  3SSQ A;  1WHV A;  2ROP A;  3MFI A;  4C97 A;  2XQC A;  2FC9 A;  3VVT A;  1URN A;  2V8V A;  4YB5 A;  5CQG A;  1YZ7 A;  2XHC A;  3EWG A;  4J91 A;  5K14 B;  3TR5 A;  5HVH A;  3KLG B;  4DV7 F;  3U1L A;  4WU2 A;  1T3N A;  1F9H A;  4KH1 B;  5AE2 A;  2W24 A;  3SDE A;  1S9G A;  1CPZ A;  2KN4 A;  1N5V A;  1VS3 A;  2NYI A;  3FQL A;  3KJF B;  3IS9 B;  4HR2 A;  4LQ9 A;  1OY9 A;  1ARO P;  5A8K B;  2VA2 A;  4RZR A;  2C3O A;  3CJ3 A;  4NA2 A;  2VOO A;  4H4M B;  2HRY A;  1HBO B;  1HHQ A;  2KG0 A;  4ECT A;  2RSQ A;  4ID5 B;  2PFD A;  1HNW F;  3MPW A;  2RDI A;  2ASJ A;  2CDQ A;  1EJ7 L;  3MDF A;  2V8H A;  1VBK A;  1VBX A;  1F5B A;  2H3E B;  3LPE A;  4Q45 A;  2IVM A;  3RR7 A;  4B3M F;  5I42 B;  2ROE A;  3NY0 A;  1VQM S;  1TKX A;  2DGO A;  1CUL B;  3SCK E;  3H8Y A;  1VLO A;  2QJ3 A;  3PW0 A;  1JJ4 A;  2G13 A;  1I1G A;  1WHX A;  3I31 A;  4ZN3 A;  4RU2 A;  1QTN B;  1LXN A;  2HHP A;  1K9M T;  1RHR B;  3DHX A;  4H4K C;  2VG7 A;  2YWG A;  4NLY A;  1Y5I B;  4CT8 A;  2AGO A;  1S0M A;  1B0T A;  3K8V A;  4I0W A;  4Y2C A;  2R8G A;  4L74 A;  4I1T A;  4ECQ A;  4X64 J;  4ITS A;  1I3O B;  1SVD A;  5C24 A;  5HRO B;  4ECY A;  2ZBI A;  3QT7 A;  1VC0 A;  1ZM2 A;  1RTD A;  1VQL S;  1CJU B;  2DIT A;  1UTA A;  4OX8 A;  4AFF A;  4X4S A;  4FF3 A;  4WXW A;  5KFN A;  2MZJ A;  3G8Q A;  4P74 A;  5DG9 A;  3M6X A;  2V6A A;  3DOM B;  5LM7 E;  2FZC B;  1TKD A;  5C25 A;  3H2L A;  4IUF A;  3N4W A;  1UVM A;  3VCD A;  4L6V 3;  3VAL A;  3NNC A;  4QW9 A;  2W2O P;  3LUY A;  4XO0 A;  1H2V Z;  2H5J B;  3MUR P;  4C9D A;  4DPX A;  2G0C A;  2DR9 A;  2GZO A;  5H9E K;  1G3O A;  3DU6 A;  3DRY A;  1IKW B;  2CJX B;  3ET6 A;  4RWX A;  4EMD A;  1XMO F;  4OX9 J;  1U0H A;  3ILI A;  3D6T B;  2OIH A;  2UUA F;  4QR2 A;  2V4Q A;  1S6O A;  4B3T J;  1AXQ A;  4L75 A;  4WP9 A;  3F73 A;  2QLX A;  3UCZ P;  3K0J A;  2ZH5 A;  2CQ2 A;  1X5P A;  1UVK A;  3T1A A;  1VK3 A;  3CCR S;  1YK9 A;  5KOW A;  5GAH I;  4KIA A;  2J0X A;  3T5K A;  1C0U B;  2VON A;  4LR9 A;  1RHM B;  4JI3 J;  4IOA Q;  3CCJ S;  2WB1 D;  3AOC A;  3W60 A;  5DQH A;  4L72 B;  4OZ5 A;  2OEJ A;  3CJK B;  1VDH A;  5IT0 A;  3K57 A;  4IG3 B;  2P9G A;  3KK3 A;  4DV1 J;  4JI0 J;  3G87 A;  3H59 A;  2D74 B;  3BJY A;  2VHG A;  2V2V A;  4ICL B;  3IG1 A;  5G4D A;  2O66 A;  1DLO B;  3ENQ A;  4A46 A;  2B51 A;  5KFF A;  1VRU A;  3DLK A;  1H7W A;  3BRE A;  2CKW A;  4NEZ A;  2RQC A;  2VIC A;  1YDL A;  3L4B C;  1CJT B;  2KJW A;  1R31 A;  1YBA A;  2QIF A;  4ED0 A;  2V94 A;  4I2Q B;  1EX8 A;  5IOL A;  3HK2 A;  4K50 A;  4EBD A;  2JL9 A;  1BY9 A;  1SL2 A;  2B9Y A;  2DCL A;  5JUM A;  4ETX A;  4F50 A;  3OXL A;  3TVZ A;  2GMH A;  4MIW A;  5U47 A;  3T6B A;  2RQ4 A;  1HNW J;  2PEH A;  2ZWP A;  2NXN A;  4C8K A;  2X3D A;  4ZS6 A;  3I0S B;  3OT9 A;  4P2X A;  1QVF R;  3GFX A;  1NSQ A;  4PWD B;  1TAU A;  2UUB J;  2RQK A;  3EZO A;  1VQ7 S;  2CPF A;  3V5R A;  5GAE I;  4UZB A;  2ZH1 A;  4KC5 A;  1PGZ A;  1RAI B;  3CC4 S;  4ZCI A;  1RTD B;  1PJ5 A;  5KFE A;  1VMB A;  1NJY A;  1RAC B;  2DB1 A;  2C1E B;  2DR7 A;  3BM7 A;  1RWM B;  4PG8 A;  4B9N A;  1O8B A;  3GJT B;  3FVY A;  1GXU A;  3UWT A;  4DF4 A;  3RAX A;  2YNI B;  3LP0 A;  3PDN A;  4IFY B;  3LWL A;  2AJ2 A;  2VOD A;  1EQ0 A;  2M7S A;  4C0H A;  2ZEJ A;  4USW A;  1FWP A;  1TL3 A;  5B0A A;  4ES1 A;  3AB4 B;  2VPZ B;  1NRK A;  2WOM B;  4LJM A;  1ZH5 A;  5CAA A;  3GCX P;  2ZVS A;  3VAI A;  3AGZ A;  3KDO A;  5ETO A;  5IQQ A;  2Q66 A;  4CLU A;  2CPE A;  1FRH A;  2KHC A;  1H2T Z;  4IG0 B;  1SIZ A;  2F65 A;  3B8H A;  2ZE2 A;  2MLY A;  2ZIT A;  3D1O A;  3DLJ A;  3NLC A;  2EFO A;  4NI2 B;  1Q78 A;  2IHR 1;  4F3Q A;  3CCV S;  2RHS B;  1JLC B;  3VAG A;  4WJB A;  2FLN A;  2AIR B;  2EK1 A;  3WC0 A;  1RU2 A;  1WD6 A;  1KHW A;  1EAY C;  1S1U A;  1UFK A;  2FTR A;  4Y2A A;  5FDL A;  1VHF A;  4RX6 A;  2I6W A;  2A10 A;  5CCM A;  4YY3 J;  3OHA A;  1U4B A;  1JLG A;  4C3L A;  3TAP A;  2W9B A;  1J27 A;  1NB2 A;  1MNE A;  2Q6C A;  5T14 A;  2WK4 A;  4U6P A;  3CJQ A;  2BDP A;  2J0Q D;  3DOM A;  4KR0 B;  1S1W B;  4DQR A;  1CS4 A;  3I5C A;  3PX6 A;  3U1N A;  1WOP A;  3MZI A;  4C8Z A;  3ETO A;  1U2C A;  1NDP A;  1UPP A;  5F9L A;  3AQO A;  3FNN A;  2IVY A;  4WPA A;  4J9O A;  4GMK A;  4OZN A;  4KGM A;  5LSR A;  1SJ4 P;  5D0E A;  2YNG A;  4DJB A;  3D2W A;  1LWF A;  4JI7 F;  1Y3J A;  2NXC A;  3CB4 A;  1H2U X;  2FHM A;  2GVD B;  3BO2 A;  2HVZ A;  1YTY A;  4WE1 A;  3RAM A;  2XZT B;  1S1X B;  3NOG A;  3OL9 A;  2CAD A;  3BN4 A;  1SQF A;  4CQ1 A;  2ZWO A;  5HJY A;  1T02 A;  1TEL A;  2HLT A;  1VQP S;  4LF2 A;  4PXC A;  3E01 B;  4LVO P;  4U8V A;  4EO6 A;  1YIT S;  5F8G A;  4O0N A;  4KBI A;  3WC2 A;  1HIY A;  1RT1 B;  2VL1 A;  1I5O B;  1UJ5 A;  3EXC X;  4ED4 A;  3TUZ C;  2MQO A;  2PMH A;  3TO8 A;  4OI0 A;  4FYD A;  1XK8 A;  4FP9 A;  1IKV A;  2CQ3 A;  4DR1 J;  1CQN A;  4FDF A;  4CM0 A;  1S48 A;  4PYD A;  2W4C A;  4ALZ A;  3M2R A;  2FLL A;  4NXN J;  2R8I A;  3DI6 B;  4ZCK A;  3CJ4 A;  2AKW B;  2D3U A;  2JNJ A;  2KRR A;  4QPX A;  3IM8 A;  1RKJ A;  4DSJ A;  2JZ5 A;  2V67 A;  4NI2 A;  4P2M A;  3MR5 A;  2BX6 A;  4ECW A;  2MGZ B;  4XK8 C;  3JXO A;  3GFY A;  1PO6 A;  3V81 A;  4WXO A;  1ACM B;  3DGP B;  4H4M A;  5IT4 A;  3D6H B;  3IGN A;  1QAY A;  1NZ8 A;  1XR6 A;  2XZW A;  5HBM A;  2FJE B;  1U1M A;  4FYW B;  2VQF F;  4JI4 J;  1LWX A;  2GNK A;  2QLW A;  1H3D A;  3CWJ A;  2E44 A;  4C8O A;  3AD7 C;  1K0T A;  3SQO P;  3N01 A;  4HYK A;  4B08 A;  4ILM A;  4P71 A;  5E3C A;  5HK4 A;  1RWP B;  2YX7 A;  4C11 A;  3OTO F;  3KLE B;  2JEG A;  1APS A;  4DFP A;  1P1T A;  1WF0 A;  4KYZ A;  1WOO A;  4ZVO B;  3VV2 B;  1R43 A;  4IR1 A;  4IH5 A;  3M6V A;  2YKM B;  4OYX A;  2LQ9 A;  1U45 A;  3M9O B;  3DLB A;  4LRB A;  1KBR A;  4UZC A;  3GV5 B;  4DFK A;  2V2Q A;  3C19 A;  2VC1 A;  3BR8 A;  4DL7 A;  2RHQ B;  1A9N B;  1RAF B;  5JVG Q;  4DR6 F;  4P6Q A;  1V3R A;  3OSN A;  1LW2 B;  2YNH A;  3O8W A;  1VI7 A;  5JMN A;  2BJ8 A;  4K4V A;  3I38 A;  2BAB A;  1YGY A;  2ZD1 A;  2KL8 A;  3FZB A;  4V19 J;  1KTV A;  2PII A;  2PI4 A;  2L9N A;  4RW8 B;  1U8W A;  3ZTP A;  3V6D A;  4M5D B;  2Y9H A;  2MYF A;  4B17 A;  3BKF A;  3F0N A;  1WOR A;  2BM0 A;  2DY1 A;  3LO3 A;  1SJF A;  2M52 A;  3GQC A;  2WW8 A;  2COL A;  3JAM Y;  3D0I E;  2YWE A;  2LEP A;  3I32 A;  2V9W A;  1EHW A;  1GT8 A;  2UVR A;  1IJF B;  3MAA B;  3R6L B;  4TU8 A;  5L38 A;  3HSZ A;  5FDL B;  2KFN A;  3C14 A;  1IR1 A;  2AGQ A;  4OZ0 A;  1EET A;  2XMM A;  3ZTO A;  2VA3 A;  2MKI A;  1H0H B;  3FSY A;  3MMJ A;  2ZUG A;  2KXH A;  2VFR A;  3MEE A;  3UDV A;  1AT1 B;  1HNZ J;  1HR0 J;  3ZZR A;  4EI2 A;  3L7P A;  3BH7 B;  4KGV B;  3HCX A;  2J0S D;  1RWW B;  1WG1 A;  1R0C B;  2ZOG A;  1RCO B;  2VD3 A;  2E1M C;  4ZLL A;  4C4W A;  2GCF A;  3G2X A;  2ASD A;  1NJI T;  2LA6 A;  3A3O B;  3QPI A;  4UUW A;  4ZPD A;  2QN6 B;  3BQ1 A;  3KJN B;  1B0P A;  2BQ3 A;  3D6F B;  2GHP A;  2HPU A;  2DHX A;  3DLG A;  3H40 A;  4LT6 A;  4BLG A;  2JH3 A;  1F2G A;  1XR5 A;  1YJ9 S;  2B4V A;  7AT1 B;  1LWF B;  2GX8 A;  1JJH A;  1IKX B;  5HL7 Q;  1QSL A;  2OFH X;  3FSI A;  2R7T A;  1VRT A;  3GR1 A;  1RKI A;  2ROG A;  4HDG A;  4OHY A;  2RE1 A;  3WX8 A;  5E0O A;  4JI0 F;  2X3G A;  1NHV A;  3NNH A;  1KFS A;  4LRD A;  1TVR B;  1PKU A;  2CFX A;  3P6Y C;  2D3Z A;  3HD2 A;  3FEY B;  3V2U C;  4CLL A;  1Z4U A;  1AUD A;  2IYG A;  2VFT A;  4Y2M A;  2KI2 A;  2J7K A;  3M2U B;  4PPZ A;  4P73 A;  3BBC A;  4ZP7 A;  4A8W A;  2HYI B;  4C8N A;  2G2Y A;  3ZTR A;  3KHG A;  3SBM A;  3ZZO A;  3FBE A;  3LGH A;  3V4I A;  3Q8U A;  1IR2 A;  3GJS B;  1AFJ A;  3QSI A;  3C15 B;  3MMA A;  3UDE A;  1C4C A;  4ZVS B;  3THV A;  2FJB B;  2KYZ A;  5F0W A;  5LXY A;  1RTI B;  3TVK A;  2I5J A;  3MTK A;  5J2P B;  4AQY J;  3N79 A;  1TKT A;  2DRA A;  2HQG A;  1VR6 A;  3MHY A;  1NK6 A;  2G2Z A;  3GV7 B;  1JX4 A;  1GEH A;  3IG1 B;  1JXL A;  2F4V F;  2KVI A;  2HUR A;  2JC0 A;  3NGT A;  1K1S A;  3QO9 A;  1EB0 A;  3CD7 A;  3ILL A;  2KH9 A;  2GO8 A;  5KFX A;  3CD6 S;  3EMT A;  3KG1 A;  1FWK A;  4ZCM A;  4PG5 A;  4EZ6 A;  5E5N A;  3ZZY A;  2ZZN A;  5K8O A;  2GW8 A;  3D4J A;  2WTF A;  4TKT A;  3CSK A;  3ZO7 A;  3J7Y U;  2MGZ A;  2E7X A;  5A76 A;  4P2S A;  5I4M A;  2AZ3 A;  1U02 A;  2ZE2 B;  3CC2 S;  5KFS A;  1BUX A;  3RW6 A;  3G6V A;  3GCW P;  1M90 T;  3DXB A;  1S77 D;  5EWG A;  1AYE A;  1FKO B;  1QVG R;  2HW3 A;  5ETS A;  2RKI A;  4AXJ A;  1LW2 A;  4DV7 J;  1HW9 A;  1S9F A;  2NRE A;  4C8Y A;  1ROF A;  2ZHO A;  3GIR A;  3DRP B;  1NB7 A;  3ULH A;  4LFC J;  3CCQ S;  2HSE B;  5HAN A;  4CWB A;  2IA0 A;  3BGF A;  1DY3 A;  4DUZ F;  1HI0 P;  2DRB A;  5H1S V;  5HP1 A;  4XTT A;  1FWL A;  1IN0 A;  2DEI A;  1KD1 T;  4ILL A;  2YH1 A;  4CO4 A;  3CME S;  3CUL A;  2VOP A;  1CJK B;  2HBZ B;  3CCZ A;  2BM1 A;  2HWH A;  2Z2M A;  3D54 A;  3QT8 A;  4UTG A;  3RUB L;  4A48 A;  1W7W A;  2GVD A;  3NBP A;  3AHP A;  3DDN A;  1LWE B;  4YB6 A;  5A8W A;  3EVM A;  3EM1 A;  3UN5 A;  1H7X A;  2K3I A;  3ITH B;  3ZZZ A;  3CDA A;  2W2P P;  4A47 A;  4CYU B;  3BPD A;  3JYT B;  4YR2 A;  2PSZ A;  1FFS B;  5HI7 A;  2BAN B;  3W2V A;  2LU2 A;  1MRO B;  3GG0 A;  3QBC A;  3RZA A;  5KFJ A;  3MCM A;  1FK9 B;  3HHK A;  3TQ1 A;  1VBZ A;  4DR3 F;  3K17 A;  4IRK A;  5G0R B;  4M5M A;  2VFV A;  2FZG B;  2ZKU A;  3FEZ A;  3KJQ B;  5KT5 A;  1Y7P A;  4NA1 A;  2WW4 A;  1FJE B;  4LF9 J;  4JI4 F;  2MDA A;  2R2R A;  1BC6 A;  3T1H J;  2MJN A;  3TYT A;  1IKY A;  3RR8 A;  3IGV A;  2BBE A;  3TZZ A;  1VJW A;  4KAI A;  4R0J A;  1RT2 B;  2XYP B;  4LF7 J;  1JQG A;  4M5H A;  3VAJ A;  1N8R T;  1MN7 A;  1TAQ A;  4YEA A;  1HYS B;  3P49 B;  3QRP A;  3EX7 B;  1L3S A;  5E3A A;  5ETL A;  4X66 J;  4B3S F;  3H2V E;  4MIB A;  5J2M B;  2VJV A;  2MMY A;  8RUC A;  3QSY B;  1ZM3 A;  4KGK A;  1YIJ S;  3VQS A;  2CYY A;  2IRY A;  4B9T A;  2C2O B;  1S6P B;  3OFH A;  1TUG B;  2YKP A;  3JTP A;  5DDQ C;  4B9M A;  2AJQ A;  2M0G B;  2YX1 A;  1WKK A;  3PHT A;  5IQ6 A;  4EBC A;  1GXT A;  3HZG A;  3C66 A;  4A8S A;  5KG2 A;  4Z37 A;  1IWG A;  2X1B A;  5KTQ A;  1P9Y A;  3IFE A;  3QGI A;  3S8S A;  3UDL A;  2IVF B;  3SZ2 A;  3MXH P;  2OEK A;  4MYT A;  1VJQ A;  1G4C A;  2CPX A;  2IIH A;  3RW7 A;  1ZYQ A;  1GMU A;  3DRP A;  1SQG A;  2Z57 B;  2ZOF A;  4CO2 A;  2H4Y B;  2R7X A;  3E2E A;  4Q0B A;  1FKP B;  4JYA J;  4IDK A;  1JLE A;  1TZ0 A;  2J8S A;  3LGN A;  2ZVI A;  3PCO B;  5HAO A;  3BPS P;  3L9Z A;  4OX9 F;  3RG6 A;  3MAQ A;  4MKB A;  1O0P A;  2W1B A;  1T0T V;  3Q2T C;  3IC1 A;  1V3S A;  3R5C A;  4MIA A;  4CRJ A;  2DH7 A;  1RT6 B;  2L9W A;  1JLB B;  2WCX A;  2DO4 A;  1VQ5 S;  4B9L A;  3M1V A;  2XNR A;  4MFB A;  3R9L A;  1TKZ B;  2N82 B;  3M05 A;  2V4J B;  2HNY B;  4CI0 B;  2F40 A;  2OPS B;  5CZX A;  2E1C A;  2J76 E;  3R27 A;  1KEK A;  1YHQ S;  4CLT A;  4E8U A;  4J9P A;  4J9K A;  3QGG A;  4DG1 A;  4Z7C A;  4D3H A;  5DLG A;  3AA9 A;  1MG7 A;  2PT0 A;  4RPF A;  4B3R F;  1R0B G;  3B6B A;  1C1B B;  4KO0 B;  3OL6 A;  1N6Q A;  1IM6 A;  1YJ7 A;  3PYG A;  1I94 J;  1WTB A;  2Y8W A;  1Y5N B;  3HD1 A;  2DGQ A;  4DL2 A;  4DV1 F;  2PA3 A;  2W8K A;  4UY8 T;  2E5J A;  2K3K A;  1XWL A;  2QO3 A;  5EX3 A;  2ACM A;  1M5O C;  5KFD A;  5IV4 A;  3LP1 A;  4Q7A A;  2DPJ A;  5J1E A;  1D3W A;  1VQY A;  4LSZ B;  5DJB A;  4UT4 A;  1U1R A;  5GMK a;  2IC3 A;  1TL4 A;  2ZC3 A;  3OFE A;  4AYB D;  3CCU S;  3MEG A;  2XY6 A;  3HSD A;  4CT9 A;  3QIP B;  3DLH A;  2F63 A;  2EFG A;  3NMR A;  1X8D A;  1SUQ B;  2OHD A;  4NYZ A;  1ULR A;  2UV8 G;  4N8O A;  4OHZ A;  3NP5 A;  5KFC A;  2KT5 A;  1ZTT A;  3R8Y A;  2ZH8 A;  1OPI A;  5B0E A;  3I4P A;  5CCL A;  3N6M A;  4K8R A;  4B3S J;  4TLQ A;  4ZP8 A;  2DH8 A;  4WE1 B;  3GIK A;  1TUV A;  4DPW A;  1TL1 B;  3M8R A;  3G71 S;  4K0K F;  2QA4 S;  2CVE A;  1C0T A;  2J8A A;  1CSJ A;  3G82 B;  2KG1 A;  1QJH A;  3GIM A;  5L1L A;  1FVQ A;  4OJG A;  5B0G A;  4NCG B;  3M8W A;  3D9B A;  1KFD A;  4OYA A;  2IDE A;  1WDT A;  1NBE B;  2HHX A;  2UXD F;  1C3G A;  3OSP A;  4CM2 A;  3IMQ J;  3FC9 A;  3SSS A;  2XWX A;  3SMZ A;  1HNI B;  4QWD A;  4J9S A;  4C8L A;  1FTR A;  4DFJ A;  4ZP9 A;  1KNZ A;  3KHL A;  4KTQ A;  2RVJ A;  5EX0 A;  1TKX B;  2UP1 A;  2CPY A;  5GAD U;  1M1K T;  2JC1 A;  1V5V A;  2HND A;  2DEJ A;  3GFH A;  5T7L A;  2LLZ A;  3EGV A;  4NZ0 A;  2IRU A;  4NML A;  3MM9 A;  3KHH A;  4O4R A;  4UQG A;  1LXJ A;  1T05 B;  2HBQ B;  3V81 B;  1VRQ C;  5ITH A;  1XTZ A;  4KPC A;  3KK1 A;  3T1Y J;  5KFM A;  3RRH A;  3R1H A;  4TLR A;  5KT2 A;  3OXG A;  3PEJ A;  3M32 B;  1HBO A;  2KVQ E;  3GU0 A;  4ED6 A;  4EBE A;  1IQZ A;  2BV3 A;  1WC6 A;  4KHP F;  4RNN A;  3C46 A;  4HHH A;  2FC8 A;  3J7Z 5;  2WBM A;  4LF4 J;  1SCJ B;  3OLA A;  1U49 A;  5DDO C;  2QSW A;  2PN6 A;  3C5X C;  2VIH A;  1WKJ A;  3SFU A;  1M5K C;  3HZE A;  2RNE A;  3IM9 A;  3FGV A;  2XBP A;  3VGV A;  4IH6 A;  3GJR B;  4URG A;  2R9L A;  3V4I B;  2J6S A;  2IBK A;  2OPP A;  4DHV A;  1L3U A;  5HSP A;  3SV3 A;  1XC9 A;  4R0E A;  1WC0 A;  4HI1 A;  4F0M A;  3WQP A;  3M2U A;  4TXS A;  3M30 A;  5D4N A;  5A0Y B;  4N56 A;  2DGS A;  2V2K A;  4YS2 A;  1UZH A;  2KXN B;  4MFB B;  2GA7 A;  2N4C A;  4HAC A;  3MM5 A;  2HVE A;  3IWX A;  4FN5 A;  4ZVT B;  4EK2 A;  4CIO A;  1FNX H;  2K7K A;  4OYM A;  3VZI A;  2BE7 D;  3KXD A;  4OZ2 A;  3US5 A;  2G0J A;  2MZR A;  4TQR A;  4I67 A;  5HN0 A;  1HQE A;  3L7O A;  5LSO A;  2CNL B;  5GAG U;  2WVB A;  4LF8 F;  1GQE A;  2B4U A;  3QT5 A;  2ATL A;  1J5E J;  2BJD A;  1FKP A;  2EKY A;  1EKS A;  1ZA2 B;  3HP6 A;  3BSC A;  2DNM A;  4U7U K;  3OR2 A;  5DQG A;  2OGU A;  4W98 A;  4H4K A;  3T5L A;  5A6W A;  3QAE A;  2CA9 A;  4B3O B;  3AGY A;  3D7S B;  1PG5 B;  4IG3 A;  4Q5V A;  3KK3 B;  1U6F A;  2NZC A;  3ISN D;  4LSL A;  3KDN A;  2RS2 A;  2HVH A;  1NJZ A;  2BJE A;  5IWA J;  2UUT A;  1MLA A;  2W9C B;  4RBU A;  2XB2 D;  2RH3 A;  5BJR A;  2RUG A;  4CH0 S;  3H7H B;  5DZ7 A;  3S1T A;  4F36 A;  1UWA A;  4KHR A;  1KR4 A;  5KFP A;  1U6B A;  3EGZ A;  2RJZ A;  1S99 A;  1B3T A;  2UXD J;  3DLL Q;  1JLA B;  3LOU A;  2E5L F;  4DV3 J;  2O67 A;  2A0F B;  2FY8 A;  3DLE A;  4ILR A;  4ZLN A;  3FFI B;  2QLD A;  5B0B A;  3HJF A;  2JLG A;  3R7B B;  2G1D A;  2GQQ A;  1ZOT A;  3HHL B;  3MCS A;  1M5H A;  4ZVR B;  3NRB A;  3WBZ A;  2NR0 A;  1IBL F;  2XHW A;  1HBM B;  1QUP A;  1IQT A;  1XMO J;  1Z2L A;  2LVW A;  4KFB B;  2RDJ A;  1VQO S;  5L1J A;  1D9F A;  3HXM A;  4DV5 F;  1MU2 B;  1TL7 A;  4WP3 A;  3U02 A;  4F4W A;  5KT7 A;  2GML A;  4PQA A;  1BE4 A;  4WKR A;  3VGS A;  5C2C A;  5FLX U;  4LFC F;  5LL6 d;  3E8O A;  3HX9 A;  3SXL A;  4RW7 B;  1D09 B;  3Q23 A;  3H0P A;  2N3O A;  3M30 B;  1SBR A;  2VC0 A;  1B70 B;  1RGV A;  2JLF A;  3EDR B;  4ZJQ A;  3C15 A;  1S6U A;  2FB0 A;  2L48 A;  3G82 A;  3W63 A;  2AYB A;  2APO A;  4ZJO A;  4NRT A;  1JLB A;  3EZU A;  1BQM A;  1U8S A;  3FK4 A;  1HWJ A;  3OR1 A;  3SQG A;  2ASY A;  4DR5 F;  4NLQ A;  2DH9 A;  3ADA C;  2NQP A;  1YJW S;  5J1P A;  1X9S A;  4QYZ K;  3PRD A;  2DJW A;  2GIR A;  5J2M A;  2C2E A;  4PUO A;  3KMS A;  2EVZ A;  2M9K A;  5KFG A;  3EZ5 A;  1DLO A;  2R8J A;  1CLF A;  2YWF A;  3OL8 A;  1X60 A;  1TL3 B;  3I96 A;  3AOB A;  2YWK A;  5DDP C;  2NXE A;  3K5M A;  3VAF A;  2MSS A;  1Z1Z A;  2E29 A;  4RW9 B;  2PMZ D;  1T05 A;  2V8G A;  4B3O A;  3CCE S;  3Q24 A;  3TJA A;  1J5O A;  1NSA A;  1U1P A;  3I55 S;  3THP A;  1VQS A;  3TRG A;  4OIX A;  3J81 U;  1R27 B;  4IYQ A;  4Q44 A;  1WHY A;  1HMV A;  4IOC Q;  2GVZ A;  5BYS A;  2Y8Y A;  5KFQ A;  2V63 A;  4F4A A;  5DGA A;  4C3K A;  2D9O A;  2L3M A;  4PYA A;  4WFN Q;  3BYP A;  2A1B A;  2GC8 A;  2LA4 A;  3BZQ A;  2CPZ A;  3MM7 A;  2FJA B;  3AD9 C;  3K58 A;  2QFI A;  2AMC B;  2ZM6 J;  4D3G A;  1GX5 A;  1E6V B;  3FKB A;  2D41 A;  3C2P A;  1HQE B;  3PM9 A;  3HPO A;  4A8F A;  1WEY A;  2RML A;  3FJ2 A;  3SV4 A;  2RIL A;  4JI5 F;  5KG6 A;  4BHQ A;  3UVJ B;  4LRF A;  2YNG B;  4M63 A;  3K5L A;  1FRM A;  1TUW A;  2FZK B;  2YKM A;  2PC6 A;  1TK5 A;  2P9E A;  3F44 A;  2GAG C;  4C0B A;  2W2N P;  3QRQ A;  5A8W B;  4AQY F;  2QMX A;  3OR2 B;  2OD4 A;  4QW8 A;  2HMI A;  2IMO A;  4N41 A;  1VOM A;  3MOJ B;  1PCA A;  2DT9 A;  4DX8 H;  1C0T B;  4GKJ J;  1LNQ A;  2JLE A;  1S76 D;  4L3K A;  1MWY A;  1RT3 A;  3HM9 A;  5LOQ A;  5KOX A;  1O51 A;  4AD6 A;  3MTJ A;  3TA2 A;  4JV5 J;  4B9S A;  3KTQ A;  2LQ5 A;  3OTB A;  4DV4 F;  1QUV A;  1RJJ A;  1WSV A;  4DWI A;  2IMW P;  3O44 A;  4N76 A;  2BQU A;  4O44 A;  2C3U A;  1C0U A;  2B5J B;  2J9D A;  3EIC A;  3RB3 A;  2DNG A;  4DL5 A;  4W92 B;  4YP3 A;  4MKA A;  3W2W A;  1UMJ A;  2X1G A;  1QY7 A;  1S72 S;  3BB5 A;  3T5H A;  5ETQ A;  4LF6 F;  2DK2 A;  4CH7 A;  1RHU B;  1WF2 A;  2FIU A;  3WDO A;  4AL5 A;  3C16 B;  4NLS A;  5LJ5 Y;  5IFM A;  3SEO A;  1DUR A;  3DCA A;  1WDD A;  1YBU A;  4ZVE A;  3HHL D;  1IXK A;  4DQQ A;  2HAF A;  3W9H A;  4R8U B;  4TQS A;  1NJW A;  1S1U B;  3W3S A;  2R7U A;  1ITP A;  2B7B B;  3A3P B;  3QAT A;  4EEY A;  1JK9 B;  3QFW A;  2R42 A;  3FCV A;  2ZH9 A;  2A2D A;  4A8X A;  3GE9 A;  2R8K A;  2FVR A;  1NCL A;  1LK5 A;  1KP6 A;  3HHN B;  1FRI A;  3GWC A;  5I3U A;  2Y1R I;  3BS9 A;  2KO1 A;  1SJR A;  2Z56 B;  3MM7 B;  4L73 A;  1HI8 A;  3G96 A;  1JLF B;  2ZM6 F;  4EU0 A;  4ZCL A;  5EGY A;  3PFO A;  4P7V A;  2OAU A;  2HS3 A;  1UEK A;  1UWB A;  4R25 A;  4RW4 B;  3Q8P B;  4LFA F;  2UU9 F;  2NZ4 A;  3RYL A;  1XER A;  4IQX A;  1JKH B;  3EJM A;  1BWV A;  1S59 A;  1TMJ A;  4KE5 A;  4MK8 A;  3NL0 A;  3UN3 A;  2QZ8 A;  3CDU A;  4DUZ J;  4KHP J;  3Q8Q B;  1IBK J;  2ZD1 B;  3GJQ B;  1BHN A;  1JLE B;  2CZV C;  3UR3 C;  1D1U A;  4JI7 J;  1YLX A;  2LQJ A;  3N5B A;  1ICE B;  2PI5 A;  2FVQ A;  3H2U B;  4X62 F;  4LQ3 A;  2NYH A;  4K2J A;  4M5I A;  1MU2 A;  2I5J B;  5J2P A;  3PKM A;  4NLX A;  4KSE B;  3EYZ A;  2VQF J;  3A1Y G;  3GYN A;  4UST A;  1VK8 A;  1KRP A;  1FE4 A;  1QE1 B;  4DLE A;  5E2Q A;  1N4L A;  3PW5 A;  5D0H A;  3C6U B;  3HVT B;  4FBT A;  2NUH A;  1NH8 A;  2VPY B;  2VKZ G;  1RAD B;  4GVL A;  2LEC A;  4WZM A;  3DLG B;  1R6V A;  4O3R A;  3P5B P;  1NDC A;  1UCN A;  4EZ9 A;  2OML A;  4JI3 F;  1FD8 A;  3Q0A A;  3CJK A;  2VF3 A;  2CQ1 A;  1OO0 B;  2FLO A;  3B4D A;  4NLW A;  1JLA A;  1HWU A;  4WYL A;  5B08 A;  4O3S A;  3IS9 A;  4C48 A;  1C1B A;  4KO0 A;  1EQM A;  2HIQ A;  2Z4P A;  1LFW A;  2HK2 A;  4C11 B;  3BQ2 A;  4F8R A;  4IRC A;  2E7V A;  5I3Q A;  4WFZ A;  2VG6 A;  1NDL A;  1MMN A;  1T11 A;  2W4P A;  4WK3 A;  3PO4 A;  1R8C A;  5E7O B;  3TX0 A;  2MQ8 A;  4JI8 J;  4Q8F A;  3KUG A;  2F9D A;  2XI3 A;  3PV8 A;  3C6T A;  1HQ2 A;  3AB2 B;  3H20 A;  2V50 A;  1DTQ A;  2ZFH A;  3CUN A;  1X4A A;  5DRK A;  5J2Q A;  2AYE A;  1AUS L;  1PYO B;  2DKO B;  2XEX A;  1GMW A;  4QIG A;  4JYA F;  2BOA A;  5F8I A;  3RB6 A;  3KLF B;  1UZD A;  1UP1 A;  2BVZ A;  5RUB A;  2DNN A;  3ZFV A;  1XNQ F;  4DV3 F;  4ED3 A;  4M5D A;  4ECR A;  4NLP A;  1R3N A;  1LWE A;  1RLC L;  3MI7 X;  4RWW A;  2XG8 A;  3MEC B;  4NRU A;  4RLE A;  4FS2 A;  2J6U A;  2GV1 A;  1Y10 A;  1NM2 A;  1S9E B;  5SZT A;  1DRZ A;  1TL1 A;  4K5S A;  4CYU A;  2VDH A;  1RAG B;  3MAA A;  3A8E A;  3CIZ A;  1Q8I A;  4ZPA A;  3BO4 A;  2BXJ A;  2F8E X;  4ZDN A;  3IWN C;  3JTO A;  1DFD A;  1O6X A;  3ZNU A;  4R5P B;  2I9S A;  4ED1 A;  1RYS A;  2D1C A;  1QE1 A;  2ZBC A;  3R1L A;  1S6Q B;  1TTH B;  1SC3 B;  5D4O A;  1UJ6 A;  1MN9 A;  5LMU F;  3A4T A;  4DEZ A;  1RQ0 A;  2HHU A;  2CWX A;  1DJ0 A;  4EGL A;  2XS5 A;  1EP4 B;  3OJU A;  3MOZ A;  4J9M A;  3CTR A;  4RNM A;  5KG5 A;  3O1L A;  1KQG B;  2KT2 A;  4F4Z A;  1RT2 A;  4A8K A;  4CTA A;  1N56 A;  3TUI C;  4G1Q A;  3HHL A;  4ZHR B;  3SCJ E;  3R5J B;  2R3V A;  3AH6 A;  2HQ3 A;  3KK1 B;  1UVN A;  2EFV A;  1YI2 S;  4DV2 J;  1X4D A;  2RU9 A;  3DLE B;  1RWV B;  3QWU A;  3UN2 A;  1JKH A;  2PE8 A;  4OHV A;  2LCW A;  2XTJ P;  4HH1 A;  4HTI A;  1BQN B;  2B6A A;  4PXB A;  4XDC A;  4QPT A;  1YG0 A;  3R5A A;  3HHD A;  4OJ3 A;  3UE2 A;  1EZZ B;  1ZM4 A;  2XMT A;  5HMY A;  2FJW A;  4K4X A;  3C6T B;  1N0V C;  1XNQ J;  4OL8 A;  3PIP Q;  1N52 B;  1PYS B;  5F8J A;  2ZBP A;  1R7I A;  3BV8 A;  3I0R B;  1NKC A;  5I3U B;  4ZVH A;  2LQ8 A;  5C5J A;  1HPZ A;  3HSJ A;  4DR7 J;  3WZ0 A;  4W90 B;  3UCG A;  9ATC B;  5L9N A;  1WAC A;  3J80 U;  1KDN A;  5K8M A;  2DR5 A;  4OYI A;  4P52 A;  3NKY A;  2YKA A;  4KGZ B;  3D66 A;  1UA1 A;  4RUC A;  4K4W A;  3CJ5 A;  3ISZ A;  4MKV A;  3CD0 A;  1RT4 A;  4PWW A;  1RI7 A;  3OR1 B;  3SIP B;  3VWS A;  1K73 T;  3HVR A;  2JRR A;  4RNO A;  4UUX A;  2HG4 A;  3DXS X;  1WSR A;  1Y3K A;  2KHD A;  2R7V A;  1U2R A;  3IBW A;  1X9W A;  2ZBQ A;  2ZHA A;  3Q8Y A;  1QAI A;  1QTM A;  1F3V A;  1RSC A;  2YXL A;  4PWD A;  4IDK B;  3LGM A;  3CC7 S;  1FK9 A;  2V8P A;  4Q8E A;  4Q43 A;  3RB4 A;  1RT1 A;  3JSM A;  1VCT A;  1YJT A;  3DRX A;  3EGW B;  3K89 A;  2Y3Y A;  1B0V A;  1YQH A;  1TV6 A;  2JFK A;  1NME B;  1NSK L;  4LBI A;  3TNV A;  5M2U A;  3KK2 B;  3UCU P;  2YH0 A;  4ER8 A;  1WOS A;  4EYH B;  1K44 A;  2WB4 A;  3HVW A;  3ITH A;  5ETT A;  1IBM J;  4ZMM A;  1F5C A;  1A7G E;  4B9U A;  5IZH A;  2MZS A;  2QFJ A;  4JB8 B;  1HMV B;  1N34 F;  2XS7 A;  1NHU A;  1S57 A;  1VHI A;  1JXV A;  1LW0 A;  2RT3 A;  1L3K A;  1NSP A;  3MF5 A;  4CLP A;  4DL0 C;  5IS2 A;  2OTJ S;  4UY8 5;  2AQ4 A;  1F6T A;  5GAE U;  3W8P A;  3H25 A;  2LU1 A;  2M88 A;  3OD2 A;  1WTF A;  3DRR B;  1FTC A;  4FKY A;  2UUA J;  3GV8 B;  4IO1 A;  3GII A;  2JVR A;  4DV0 J;  4DF8 A;  5IC6 B;  4ZK7 M;  2AEF A;  3CVK A;  1U1Q A;  1PYT A;  4ICL A;  1KWM A;  2HZV A;  4QZV B;  1B99 A;  3CMQ A;  3KWM A;  5CAB A;  1N36 F;  4OZL A;  2VQE F;  3FBF A;  1HPZ B;  2XYG B;  1PIL A;  2H4W B;  3SSR A;  1HYS A;  2BKP A;  1N5S A;  1R8B A;  4G1P A;  4Y00 A;  4N5S A;  1WI8 A;  3CXC R;  2L08 A;  1F5A A;  3DMJ A;  3J81 j;  2FLP A;  1RYR A;  1HNX J;  2XSJ B;  1I6J A;  5MLC V;  2VBZ A;  8ATC B;  3DM2 A;  3LF0 A;  2CQD A;  4CO0 A;  2HHW A;  2BJ1 A;  3V4M A;  1NKE A;  1WEX A;  2DNL A;  3R5G A;  4ECU A;  3EGN A;  4C2M A;  3DRS A;  1RA7 A;  4MH8 A;  5F9N A;  4RW7 A;  2F1F A;  2ADC A;  3DN9 A;  3FBB A;  3AJD A;  3THT A;  2Q3P A;  3V6D B;  5DQI A;  1HWK A;  4NCG A;  2ASL A;  3PXG a;  3MR7 A;  1CJU A;  4F2R A;  1NXI A;  1VFJ A;  3JSM B;  1TKT B;  4AE5 A;  3C8Y A;  3CCM S;  4EYI B;  4DLG A;  1VIS A;  4TN2 A;  3JSR A;  1LKZ A;  5AE3 A;  2JVM A;  1LV5 A;  1VQ9 S;  4FVM A;  2V4J A;  1RBA A;  3ENW A;  2QA2 A;  4KT0 C;  3GIJ A;  1DZ5 A;  1S1X A;  3CJ2 A;  3PY8 A;  2BUN A;  3DC2 A;  1C1C B;  3CF5 Q;  1UVL A;  2IBO A;  1HW8 A;  3OHB A;  1VQN S;  4DQI A;  4NLV A;  1R0A A;  1P6T A;  4NXM F;  4NX9 A;  3DDI A;  2HEK A;  2XI2 A;  5A6P A;  4JV5 F;  4Z2X A;  2BKO A;  1S1T B;  1QSY A;  4U7U D;  1CJT A;  4I6W A;  5HMZ A;  2ZKT A;  1CEZ A;  2QLB B;  2EC0 A;  2LXI A;  5KT4 A;  1PAE X;  1WC4 A;  3D3B J;  3MMC B;  5H9F J;  4C98 A;  1TR0 A;  3MEG B;  2VQE J;  3KUE A;  2CQB A;  2HQF A;  3W62 A;  1HHT P;  1S1W A;  3CO0 P;  4WP8 A;  3DKD A;  3V6J A;  3F41 A;  3LP1 B;  3QGH A;  4DPU A;  5HQ8 A;  5EDW A;  3IBC B;  4LF6 J;  1OIA A;  3CJT A;  3J81 Y;  2DNQ A;  1M0S A;  2ZUA A;  2HFU A;  1VIO A;  3NCQ A;  3GIL A;  4L3N A;  5LT5 A;  1SC1 B;  4NZ7 A;  1PJ7 A;  2RU3 A;  4K4Z A;  1GMW D;  1Z2Z A;  1S0O A;  1CQM A;  5D4P A;  1R89 A;  2MKJ A;  2QL9 B;  4NLG A;  3EVW A;  2IJR A;  2BE9 B;  2J7W A;  1S1V A;  5B0C A;  5LMN J;  5GVQ A;  3CNQ P;  1HNV B;  2IAJ A;  4C7Q A;  2AHO B;  2CAJ A;  4QU7 A;  4WZQ A;  3SFG A;  2H9Z A;  3W66 A;  4JI1 F;  3DOL B;  1X4E A;  5FII A;  3UW1 A;  4FBU A;  2PMW A;  1X7V A;  4QYR A;  4OLP A;  5C25 B;  1ZPV A;  3H4D A;  2DNZ A;  3IAM 9;  2R7R A;  3H90 A;  2R2T A;  3M1V B;  1FXR A;  2YQ1 A;  2AJ0 A;  4XPC A;  2FDN A;  1VBY A;  2M2B A;  2RDD A;  4ZVF A;  3T19 A;  3N0V A;  3BGL A;  4ZVG A;  4H4O B;  5DGB A;  2ABY A;  3IA0 A;  2ZH7 A;  2HHH J;  2M8D B;  3BGO P;  2EFP A;  5HJX A;  1GH8 A;  1LW0 B;  1UAW A;  3ET6 B;  2XUL A;  1WG5 A;  2G2O A;  3O3L A;  2BJ3 A;  2ZC4 A;  2MJU A;  1S0V A;  1KSP A;  4DR2 F;  2CJQ A;  1PC4 A;  1DBD A;  2MZQ A;  1X4F A;  4IFV B;  5K5M A;  1P27 B;  1NLT A;  1UEU A;  2CUY A;  4HHJ A;  3IRW P;  1GXL A;  1FRK A;  3CPW R;  2V4R A;  2D3O 1;  2KFY A;  4NOH A;  1WUU A;  4ENO A;  1EAR A;  3MCN A;  4B3M J;  3DGP A;  4Y28 C;  2XO7 A;  3VAK A;  3BSO A;  1QSS A;  3OVA A;  1HBN A;  3BN7 A;  2J0W A;  1P9Q C;  2FHK A;  2KM8 C;  2FVS A;  4DX5 A;  1JXE A;  3I9Z A;  3VR1 A;  2AJ4 A;  4AXI A;  4RUA A;  1RWO B;  1Y4Z B;  1JWW A;  1DHM A;  1T9V A;  2A2C A;  1FEH A;  2U2F A;  4WU3 A;  1J5O B;  2MST A;  5AE1 A;  5T7L B;  4DSE A;  4HI2 A;  1DTQ B;  5J2Q B;  2OO4 A;  2VPX B;  2DHA A;  4Y0F A;  1U1N A;  1JLC A;  3PFE A;  3DOK B;  5ADZ A;  4PQU A;  4DR5 J;  4DUT A;  2HRU A;  2NUU G;  4DV6 J;  5F41 A;  3MR2 A;  4M5G A;  2CPH A;  5CA5 A;  2PO4 A;  2Q1L A;  4V19 X;  1Q8L A;  2NS1 B;  4ED5 A;  1SI9 A;  1G7C B;  2I38 A;  1U7L A;  4EUV A;  1FJC A;  1SJ1 A;  1FJG J;  2CJA A;  2ZZT A;  3AD8 C;  2DY9 A;  1KQS R;  2MB0 B;  2VV5 A;  4USM A;  1NK9 A;  5AXK A;  3T9N A;  4A8O A;  3IBF B;  4DR6 J;  3DNC A;  1YBT A;  2D7S A;  1HNI A;  3JYT A;  3NGS A;  3W61 A;  2JOQ A;  4XPE A;  2YNH B;  2AJ1 A;  3GG1 A;  3IR6 B;  2N7Y A;  3HI9 A;  4LIR A;  3N6N A;  3FQK A;  3KFW X;  4WKY A;  3P45 B;  1KC8 T;  2WZ1 A;  3FCW A;  3IRX A;  3RBX A;  4BS2 A;  3MM5 B;  2ILY A;  1ZAW A;  4XAK A;  3CIM A;  4P10 A;  1CC8 A;  1OQ3 A;  3DRS B;  5HAT A;  4E2F B;  5HVG A;  1MWQ A;  2ZDO A;  3PG9 A;  4LF1 A;  4GO7 X;  3TVY A;  3PYD A;  1YRX A;  2DIV A;  1MML A;  2YTC A;  2WVD A;  1OY6 A;  2HFV A;  2MY7 A;  2ZOM A;  4QWE A;  1YJN S;  3NGK A;  5CH7 B;  7FD1 A;  3UPF A;  4RR5 A;  3W65 A;  3CE8 A;  4BC9 A;  1OWX A;  2H5E A;  4RUB A;  5ETR A;  4WTY A;  5FJ4 A;  2AD9 A;  1F9F A;  4YFU A;  4GC7 A;  3PZP A;  5K8N A;  2W25 A;  4LF4 F;  1CJV A;  5K20 B;  1U1O A;  1WEZ A;  4X4T A;  3MM8 A;  4N47 A;  1PJ6 A;  4DN0 A;  5KFA A;  3W7B A;  1S6P A;  2IC3 B;  1HD0 A;  1TVR A;  3BEG B;  1HQU A;  1QM9 A;  2EG2 A;  1P1L A;  2DGV A;  4K5R A;  1ZS6 A;  4EO8 A;  4CZC A;  3W5X A;  4CCH A;  1F9E B;  4DV6 F;  1K8A T;  2AJF E;  4LRA A;  2WSC C;  4C8M A;  2JEI A;  1DAX A;  3Q83 A;  4DCO B;  3OVS A;  2F7V A;  2EG1 A;  2W7P A;  1URR A;  3HJV A;  4OI4 A;  3M6U A;  4A4J A;  2N3L A;  4ZA1 A;  4P9S A;  2W4D A;  2CJY B;  5KFK A;  4UOH A;  1SKR A;  4JI6 F;  2B0G A;  2GIQ A;  2ALY B;  2YKN A;  2AV5 A;  5KFI A;  5KT6 A;  2NXJ A;  1VQK S;  2DXE A;  4NWB A;  2FD2 A;  3S01 A;  5C7P A;  3E01 A;  1SJQ A;  1T95 A;  3I9V 9;  2YKO A;  4FVC A;  2WSE C;  1KON A;  1B4S A;  1UL3 A;  2DGX A;  2BKN A;  3UO0 A;  4X66 F;  1Q8K A;  4DSL A;  1RXO B;  3T6J A;  3DGV A;  2MXY A;  2FVC A;  4OI2 A;  2AYM A;  2UXC J;  4I56 A;  3Q8R B;  3MEE B;  2J9C A;  3MM6 B;  3OTD A;  4DX6 A;  3LTO A;  4P75 A;  4DUY F;  1QD1 A;  4WTO B;  2CRL A;  2HHT A;  3G4S S;  2N4D A;  5FD1 A;  3PW4 A;  2RRA A;  3JQM A;  3GON A;  1Q0N A;  4MT1 A;  5BYR A;  1X5T A;  2HVD A;  3L09 A;  1TFW A;  3EXY A;  3N9U C;  3GMG A;  4IKA A;  1H74 A;  2WSF C;  2M8H A;  4IOB A;  4RO0 A;  4C6A A;  5IWA F;  1F60 B;  3B78 A;  1A6L A;  3HFZ B;  4U8Y A;  4YN3 B;  1AZS A;  2EFN A;  4FF1 A;  2UUW A;  3BBF A;  3K7R A;  3UQS A;  1RU1 A;  1H73 A;  3TUJ C;  1ZAV A;  2C3P A;  3KJV A;  4LFB J;  3JB9 k;  4OI1 A;  2L41 A;  2BA9 A;  2VB6 A;  4YY3 F;  2XY7 A;  1U1K A;  1XNR F;  4HL9 A;  2VDI A;  4M94 A;  3GTY X;  1FES A;  3TAM A;  5HQL A;  4YB1 P;  1FKO A;  2DHS A;  2ZDP A;  4ZLP A;  3CJS A;  4QWB A;  2HNZ A;  1X0F A;  1UVJ A;  2GJF A;  1RBO B;  4KH0 B;  2ERR A;  1RT5 A;  5IM0 B;  2R7W A;  1TMM A;  1N0U A;  2KB2 A;  3LWM A;  2I2Y A;  2LXF A;  1BQN A;  2B6A B;  4I2Q A;  4HEA 9;  4C0O C;  2VJU A;  2IPO B;  4N7T A;  3RRK A;  1JJ2 R;  1T8E A;  1JLF A;  4FYV B;  4YB7 A;  5L39 A;  3PYF A;  1UPM B;  1LOU A;  4IO9 Q;  4RW9 A;  1UWB B;  3RRG A;  3OFG A;  2FJX A;  1GMV A;  2YQ3 A;  2DGU A;  3OUY A;  2E9Z A;  1W2I A;  2HHS A;  5AXN A;  4CLY A;  5L46 A;  1JB0 C;  4F2S A;  1OYD A;  3NMA A;  1RLD A;  3MPY A;  4ELT A;  1XIQ A;  2BJ9 A;  4ED2 A;  2UUC J;  3LP2 B;  1RHJ B;  4DZ6 A;  3AAW B;  3J7Y I;  3D67 A;  1OPZ A;  1O5J A;  1R8H A;  2P2C B;  3ENV A;  4PG7 A;  1NK0 A;  4ZPC A;  4G1I A;  2DNK A;  2WON A; 
#chains in the Genus database with same CATH homology
 3L9Z A;  1XAO A;  3TJA A;  3NY0 A;  2Q2G A;  4L3K A;  2QLD A;  1C3G A;  3NXZ A;  4J80 A;  1GMW D;  3AGZ A;  1GMV A;  1GMW A;  1NLT A;  1EB0 A;  3TJ8 A;  2HFV A;  3AGX A;  3AGY A;  1GMU A;  3LZ8 A;  3TJ9 A;  1EAR A;  3LA0 A;  3I38 A;  2B26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...