1GMWD

Structure of uree
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
138
Chain Sequence
MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTDFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords UREE
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation
pubmed doi rcsb
source organism Klebsiella aerogenes
total genus 32
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmwD02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmwD01
3I38A 1GMUA 2QLDA 3LZ8A 2HFVA 1EARA 4L3KA 3TJ9A 2Q2GA 3AGZA 1GMVA 3TJAA 3NXZA 1GMWA 4J80A 1GMWD 1NLTA 2B26A 1C3GA 3AGYA 1XAOA 3NY0A 3L9ZA 1EB0A 3AGXA 3LA0A 3TJ8A
chains in the Genus database with same CATH superfamily
4U7UK 3NKYA 1RBLA 3MOJB 1VQ7S 5F0UA 5J2MB 4KSEB 2UXCJ 4LJMA 2CG8A 1S12A 4PWDB 1R43A 2V68A 5ETLA 4NASA 2XZTB 2LEBA 2FY1A 1UJ6A 2DNLA 2GCFA 3BKFA 4FF3A 2E5GA 2KG1A 4EYIB 1H0HB 3FCWA 2HK2A 3PJXA 4CI0B 5HLFA 4YHHF 3GYXB 2WTFA 2W1BA 4Q2MA 3D1QA 2R3VA 5HP1A 3JSBA 1HD1A 1S9FA 1WC4A 1Q8KA 4Q43A 4AFFA 2EBGA 4EU0A 2QSFA 3DLHA 3C19A 1HNWJ 3DM2B 2K3IA 1S6PB 4USTA 3CTRA 4I6YA 4C2MA 2CPFA 1UVKA 3AJDA 2HQGA 1HBNA 4DPUA 2AGQA 3BR9A 2CQCA 3ZZPA 2HHHF 1VQ9S 1H74A 2LKZA 2HFUA 4MMOA 2MQQA 1XC9A 3QSIA 2FZCB 4B3SF 5HVHA 1IKXB 3NGDA 6AT1B 2DNMA 5L1JA 1BHNA 3C6TA 3GJSB 4DSFA 2IVFB 3R1HA 4FPIA 2XMJA 3FQKA 3UNYA 3TI0A 4OI3A 4QWBA 4DR7F 1D8YA 4NE9C 2E66A 1K73T 1NUEA 1MLAA 3TVKA 2VG7A 3MEGB 2VFSA 2HZCA 4BDPA 4C97A 4G1IA 2FDNA 1U0HB 1SV5B 5KG2A 1U1OA 3MM7B 3A4TA 3QRQA 1LW0B 1J5EF 4B9VA 3TA2A 3J80Y 2M70A 3WX8A 4FF4A 4ITSA 5ETNA 4DFKA 2HAFA 4C11B 1RISA 5F3ZA 4F4WA 1Y7PA 4P6QA 3GIJA 2ACYA 5MAOA 4X4NA 3UFCX 2R8KA 3DOLA 1TUGB 3F44A 3BH7B 2VONA 3NOGA 1Y5IB 2AX0A 1MROA 2IRYA 3MM9A 5CD4H 1FVQA 4CLKA 2H1YA 1LWFA 1Y5NB 3PEJA 4Q0BB 3B4MA 2RUGA 1EZZB 1HI8A 2AP6A 3H20A 4LF1A 2W7AA 1D0EA 2QLFB 3EZ5A 3EE3A 5D4PA 3P49B 1UFKA 1VQ6S 3MPYA 1YRXA 4QIVA 5C42A 2HAIA 5C25A 4XPEA 1CULA 4RBTA 1K47A 2OUGA 2C3YA 1CJTB 4PG5A 2AW0A 2ATCB 2DNRA 1UJ5A 2F4FA 3EYZA 3QMQA 2W9CA 1V3SA 2H5EA 1XERA 3IS9B 3CCES 5LSRA 2CQ1A 1RU2A 1NK0A 4P10A 2QG9B 5CABA 3EWGA 2BJ8A 4O0NA 5A8WB 2FJAB 2I2YA 1S9EA 5KFOA 2JZ8A 2K7JA 1OIAA 1S1UB 2GNKA 2OSRA 2HHWA 4DUYJ 2W9BA 3TWZA 2BBEA 3FMWA 1Q95G 2RKIB 4I7FB 3Q8QB 5CCLA 2W4DA 2NS1B 3MECB 2DK2A 4WFXA 2RIJA 4W90B 2DNGA 5LMNJ 1S48A 1RTZA 2I6WA 1WC0A 1IBLF 2CJBA 4JUZA 1GXLA 1S9GA 3PW2A 1NK9A 1WUUA 3BGRB 1SKWA 1YJWS 5B7WA 1AB8A 3UWTA 3I9V9 3RBZA 3PO4A 2M88A 3QWPA 2R8HA 3HHLC 3LP0A 2UUCJ 5FDLB 3ZXWA 3CO9A 2E5HA 2R42A 4GKJF 2RHQB 4NLOA 4ID8A 1G1XA 1KRPA 3HSGA 4ED2A 2UXBJ 3MAAA 1NZ8A 3ZZYA 5D0HA 2C3OA 4B3TF 2DHSA 3OLAA 3DOKA 3MR7A 2YY3A 5HI7A 1WHYA 1AT1B 4J9SA 1TFWA 2MYFA 5I42A 4A8MP 3EUNA 1CJUA 1F3FA 5K8NA 2Q43A 4LF4J 3D1OA 2FY8A 2BUNA 1FRJA 1AZSA 1IWAA 3BO4A 3SBMA 3U1NA 1VDHA 3DU5A 2HS3A 3ENWA 3K2YA 5J1EA 5F8LA 2JEIA 1OPZA 4WU2A 4K2XA 2XNQA 4NXNF 1IBKF 3J7A1 2HLUA 3GV7B 3QRPA 3M2UB 4YS2A 2JEGA 3LP2A 2XSJB 5L9XA 2V2ZA 1YJNS 2ASDA 4CLLA 4CLTA 4ZS6A 5AE1A 1PJ5A 4OLPA 2FJVA 3KLFB 4NLSA 5HANA 1TL1A 3PG9A 2YQ3A 4NCGA 1N0VC 2ZVIA 3T41A 1FRMA 1C1BA 2R7QA 2ZBCA 1NU4A 2WVDA 2MLYA 4QR0A 1C0TA 1KR4A 3KLGA 4ZVGA 4LRDA 3GSIA 3R7SB 1TV6A 4U95A 3UN5A 2WZ1A 1ZH5A 5D4NA 5BYRA 3CCQS 5E0OA 3UVJA 2DXDA 2BRKA 3GV5B 2H9ZA 3GCWP 3FJ2A 4DPTA 2KYXA 3CSKA 1MN9A 3POTB 2VBXA 1IBMF 3QZ8A 3HJFA 2YKMA 5ETVA 3CJ0A 3H7HB 2ZJRQ 4JV2A 4ELVA 3I32A 3B78A 1OYDA 5KG1A 2D3O1 4QBUA 1UZHA 3TJ8A 2NR0A 1Q7LB 2V8VA 1LWCB 4PQAA 5LOQA 5IXUA 2CDRB 4EUVA 1TK5A 2CQHA 5DZ6A 3BQ0A 2XCAA 3PYEA 3FQLA 3WQPA 3DRRA 2DGSA 1T7PA 5I3PA 4F26A 2HVIA 3GJQB 2Y1JA 4X62F 4DV3F 4KO0A 4HI1A 4UW2A 2MKSA 3HHEA 1C1CA 2OEKA 4HL9A 2BEFA 3H2UB 4GKKF 3D3BJ 3KKFA 1RZMA 3D6MB 1MSWD 1U09A 1X4FA 2CQ0A 4M5KA 3EPIA 2YBVA 1R27B 1N6QA 3AB4B 5LL6d 3DMJB 2OMLA 1SIZA 4Z7CA 3AXKA 2CQ4A 2Q6CA 4LFAF 2RNEA 4FDFA 3MOZA 4ZPVR 4EK2A 2PA3A 1BQNB 4USWA 1YI2S 3AJ1A 4ECRA 4ED5A 1U6ZA 1VIOA 3J81U 4M5JA 2DGQA 1FK9B 4WFNQ 2JJ4D 1RTIA 2HFZA 4PXBA 1IR1A 3TRGA 4I67A 2F8MA 3DLGA 3PM9A 4R0JA 3SYZA 4FF1A 5J2QB 3H8YA 2QL7B 5EX3A 5M2UA 3I0RA 5KFMA 2R9LA 4JI4F 2R4FA 2PEHA 3R6LB 1VQ4S 3OVSA 2IVYA 1UA0A 3QT5A 3DC2A 1HR0F 3RAXA 2MKCA 4TQSA 4F4ZA 4J80A 3H4DA 1LWEA 3DCAA 2J7KA 3HHLA 5J1PA 4J7CA 2FTRA 2OPPB 3CD7A 6FDRA 3NBPA 1TVRA 3LQVA 4IG3A 4M5NA 3IWXA 3PRBA 2GJFA 3OV7A 1FJGF 3BBFA 2QMWA 1RTDB 5GADU 2WBRA 3V6DA 4DSIA 2W7OA 5SUHA 4RX6A 2IPOB 3NGRA 1IKWB 3TUPA 1REGX 3T1HJ 2IA0A 2YVSA 1TK0A 4ZVHA 3C6EC 1UW9A 1RE1B 3HVRA 2D74B 2B6AB 2OMOA 4IOBA 1U24A 1H2TZ 1WDDA 1X9SA 1XMQJ 1RBOB 3KK1A 4IO1A 3BF4A 4QPTA 1MMNA 3J7YU 1NKEA 4Q45A 3IR6B 1OMSA 1PG5B 2IM1A 2XMTA 3ZNUA 2VH7A 2Y1RI 1S4EA 2LXUA 1C0UB 1N5TA 1F5AA 2I1RA 3RB6A 4WP8A 4BHQA 4DV7F 1N32J 3GR1A 4A47A 1YZ7A 1VRQC 2YNGB 1ROFA 4OX9F 2V4QA 1EQMA 5E3AA 1NB2A 1MU2A 2J6UA 4RNNA 5U47A 2HBRB 1G2EA 3JSMA 1WC1A 5CQGA 5L1LA 3CJSA 2IC3A 4IRDA 1NLTA 3IG1A 1WD6A 1YBAA 4I0WA 3JTNA 2DNZA 4MJKA 1X4BA 4DCJB 3WZ0A 1WSRA 2L9DA 2BDPA 2G2ZA 3HZEA 2CQ3A 2L9NA 2FD2A 5FLXY 2H4WB 1QM9A 3OJSA 4GVBA 5HN0A 1URNA 1SUQA 4IFYB 1SVDA 1UFLA 3GB0A 1UFWA 2OPSA 3I55S 1VRTB 1QSSA 4FS2A 1U1LA 2BYCA 5G0RB 2HQFA 2KFYA 3ETOA 1RWWB 3GMGA 2ZHOA 3FSXA 1BMQB 1X4CA 3DHXA 4NZ7A 3H40A 1GH8A 3CEDA 3DLKA 1EETA 4L72B 2DNHA 1JLCA 2CNLB 2J8SA 2HGMA 1RAHB 4X66J 4IFVA 3MDFA 1CJVB 4N77A 3ZZ0A 2VKRA 1YBTA 4ZJOA 1RT7B 3W62A 2WW4A 4GO7X 5JJBA 4OJGA 2M3DA 4AL7A 2CPJA 4A4JA 3QGHA 1JXLA 2WW8A 3X1LB 1XEZA 4QR1A 3D3CJ 4LF8J 4N7TA 2M7SA 4FXVA 4IYQA 1ZTWA 1U1RA 1QAYA 4DXLA 2HFVA 4AYBD 4OYIA 5L46A 1SJ4P 3OSPA 2NXNA 3IP0A 3IA0A 4ED4A 2VBYA 4F25A 2IDEA 1V3RA 1I5OB 1CSJA 2NLWA 2JRSA 1K9MT 3CCRS 1REVB 2B4VA 2W2PP 4OYZA 4LSNB 4C0HA 2YNFB 8ATCB 2N7CA 1TKTB 5C24A 2B9XA 4ZVRB 2E7WA 4RW4A 1HNVA 2UU9F 2KT5A 3FRZA 3CDAA 4HDGA 3TP2A 2PI5A 4MFBA 4BCAA 2ZH9A 3WC2A 4CH7A 3IN5A 2FLLA 4YQWA 1TELA 2IA6A 4YEAA 5IC6B 2V8PA 3MEEB 2A3JA 1G7CB 2D9OA 4CM2A 1V5IB 2EFNA 1Y4ZB 2I38A 4C6AA 2NXUA 2Z56B 5J1NA 4LVOP 4J37A 2J7UA 1B0TA 3K8VA 3PW7A 5ETOA 2R2SA 5L8RC 3GIKA 4DG1A 1N33F 3R7BB 5J2NB 5JVGQ 2QLDA 1ZBTA 2PC6A 4IG0A 2V9WA 2QMXA 4UZBA 1FVSA 8RUCA 2AIRB 4ECYA 3MFHA 5AXKA 1VQLS 1DHMA 1XBWA 2WSEC 5HMYA 5D4OA 2GAGC 3R5GA 2QZ8A 1KVKA 7FDRA 3CCVS 2ZITA 4F4YA 3TAPA 4ZPWR 1R0AB 2B26A 2W8LA 3DRPB 1Y11A 3LAMA 5A8KB 4A8WA 2X7IA 3G87A 5HMWA 3ULHA 1L3SA 4K4UA 4RU9A 2CJ9A 4KTQA 4CYUB 3CXCR 1C3GA 2BE9B 4NEYA 5GADI 2MHNA 3W64A 1RAIB 1RQ0A 4F0HA 4R25A 2KJWA 3H42A 2BMBA 3TA1A 4NCBA 3NEKA 2E5LJ 4B3RF 3AOBA 4ZN3A 4NLUA 3IBWA 1S1VA 3QFHA 4EBDA 5CD4A 2HG4A 3FSIA 1K44A 4G65A 3RR7A 4W4MA 4IQXA 2XYHB 2BOAA 2EG2A 1DBDA 1N52B 3FK4A 2IM0A 2VG6A 2XLJA 2RRNA 4I6WA 1P27B 1H72C 1LFWA 2Z0GA 3QIPB 1T95A 1TP7A 1VCTA 1JXEA 3M8QA 1Z4UA 4ZKAA 1NH8A 4A8YA 4OYPA 2I5JB 3JAMU 3Q8RB 3JS9A 3DKDA 4U96A 1HQUB 1RT1A 3SQOP 2HFSA 1T9XA 2D3OR 1SJQA 4MAKA 4M5DA 2YX1A 3Q8PB 3TNVA 4MYTA 1DFDA 3H4BA 3CUNA 3NAIA 4KPCA 2N3OA 3HZGA 2R7UA 2HZAA 2Q79A 3SCKE 3THPA 1S7IA 4C8KA 1RK8A 4OHYA 3EPGA 2X1FA 4Z37A 2UUTA 3KDNA 1ELOA 3CPWR 2CQBA 4MKAA 5J2MA 1JJCB 2RS8A 4CO1A 3MCNA 3VTIA 4PKDB 2OPQA 4PWDA 5EWFA 4H4MA 4OYAA 3Q24A 3GTYX 2HSEB 1I51B 2MKJA 2CG4A 3HSZA 3T6JA 2WOMB 2ZH1A 3TX0A 2CQGA 2MB0B 2WCXA 3TZYA 1CC7A 2OTLS 4KGVB 2L3MA 1BD6A 1NK6A 5HVGA 3DM2A 1S6PA 1IR0A 2XYGB 3BBCA 1K1QA 2OI2A 3GLJA 1GMWD 1NK7A 3D28A 4YY3J 2ZH5A 2NPIA 4H4OB 5KT5A 2JH3A 2CRLA 2QYGA 3MZIA 1VK8A 3R1LA 2IHR1 1SC3B 1M5KC 4TXSA 1RHMB 1EX8A 1B0PA 1KLNA 4JI8J 4OI1A 3CCLS 1IKXA 1QVFR 2NZCA 1I3OB 2APOA 4DPOA 4DV5F 3FMBA 2FQQB 2H5JB 1WF0A 1VBYA 4DQSA 2BABA 1KQKA 2F1FA 2IRUA 3MEGA 2VD3A 1YJ7A 3NWRA 3VQSA 1U0HA 2CDQA 1SV5A 3GU0A 3MM7A 3QJPA 1LW0A 3KLEB 1KLMB 1PAUB 3BV8A 3QGPA 1VI7A 2CNOB 4C11A 3M6WA 4DPXA 3ENVA 1Q86T 3S6EA 1QSYA 4AUKA 5IT9Y 4TY8B 3ZZTA 1JLFB 3V81A 3I31A 3SSSA 1X7VA 3H2LA 1A9NB 4KV8B 2DO4A 4OHVA 1RACB 3W5XA 4OI4A 4X4OA 4L75A 4OHWA 3KK2B 3KJVA 4KH1B 5AE3A 3Q89A 1LOUA 2G2YA 2COLA 2ROGA 2C3UA 3M8PB 4C3KA 2PE8A 3I0SB 1SJRA 2RH3A 1DRZA 1FJEB 2BW7A 2HWTA 2YWHA 4OYMA 3W8GA 1WC3A 2ABYA 4DL7A 4CLFA 4OI0A 2KT3A 3RUBL 4KT0C 3JXOA 2D41A 3LF0A 1T9YA 2MY7A 2MHEA 3IS9A 1NSPA 4DR5F 4OQJA 2UVVA 4F0KA 1VQMS 3JYTB 3NAHA 4K4YA 4MK8A 4KC5A 3BZQA 1PYOB 1TMMA 4Z7YA 2CJXB 2XCPA 3HP6A 3GIIA 2DD8S 4ZVSB 5A8WA 1F9HA 5KG6A 2R7WA 1S0VA 4HHUA 3ZTQA 1FDAA 1S1UA 4UQTA 3OL9A 3EDRB 2RKIA 4O4RA 4I7FA 2JWNA 1S6QB 3MECA 4Q7AA 1J27A 4ERDA 1F9EB 1JNRB 1NKBA 4DR2F 1KFDA 1BQMB 1BE4A 2CIMA 2W2NP 3AXMA 4DX7A 4P73A 4MIAA 2GHPA 5LXYA 2BV3A 1FDBA 4A8QA 3BGRA 1A6LA 4LREA 2OO4A 2LQBA 3OQ2A 1FKPB 4E2FB 1CQMA 3LALA 1NKCA 1S1XA 5FDLA 5DZ7A 4XDDA 2MSTA 3LA0A 1RTJB 3KLHB 3K7RA 5CZXA 1ZA1B 5LMUF 2VC0A 4D3GA 3BREA 2OEJA 5KT4A 4EZ9A 5AJ3F 5F8JA 2BRLA 4DFPA 4DJBA 2DGWA 2K7KA 3PR4A 2ADCA 5CYMB 4URGA 1EARA 1FTCA 4ECXA 2JL9A 2RDDA 2VIHA 2BM1A 2ODXA 4YHHJ 4XK8C 2HNDB 4YR3A 4F4AA 2CWXA 3DDIA 1JXVA 3AD8C 4DV1F 4H4KC 3CDBA 4BWMA 5HBMB 1FEEA 3EXYA 5KG3A 3I87A 1CLFA 4HVZA 1P8GA 5E3CA 1LW2B 5DQHA 4OHXA 1F6TA 1W2IA 2BM0A 4JI3F 3M2UA 3RB4A 1RAOA 1N56A 4DZDA 2XSJA 2JRRA 1RWNB 3H59A 2HHHJ 5KG7A 2HLTA 1UVMA 1IUJA 3KLFA 3SIPB 4DL3A 2RVJA 3D67A 3OTOF 3HSDA 4NWBA 1HI0P 3A1YG 5KT3A 3CJ2A 2C1EB 2EBEA 3RRHA 1IXKA 2ZC3A 2RU9A 4AL6A 1N0UA 2ZJQQ 1RAFB 1NLKL 4F2RA 4F02A 3BEGB 5KG5A 2XMKA 2BKPA 1CS4B 4RW7B 3OSNA 2DNQA 4JV1A 1NK8A 4X4VA 3P6YC 3K5OA 2WB4A 3S8SA 1A0OB 3HFKA 3W9IA 2FLPA 4F7VA 3JB9k 4I4BA 1QLNA 2FB0A 3POTA 4PRFA 4O3OA 1GK8A 3U27A 3OTBA 3UI3A 2BOPA 5KFJA 2MY8A 1FO1A 2B9WA 1KQFB 4M94A 3QFWA 4EWTA 3NS7B 1Y3KA 3MMBB 4W98A 3D2WA 4QWAA 4U7UD 1T9WA 3GSDA 3PVXA 1Q8IA 1LWCA 3PHEA 3AODA 4TLRA 3MAQA 1GMVA 5IWAJ 2SXLA 3KJFB 5LM7E 3PIPQ 3KG0A 1YJVA 4PG7A 4K5SA 4CZCA 3K57A 1WHVA 4ZHRB 3RYLA 3BJYA 3T1YF 1WG5A 1WOPA 1IVZA 4UOFA 2WVEA 1T9TA 4P2XA 2FHJD 3TANA 2FYXA 3CIZA 3DN9A 4CLYA 4AT1B 2AZ1A 1M0SA 3MPUB 2MJUA 4LFBF 5F8IA 5D8HB 4M5IA 3C66A 1U2CA 3E3XA 5KFLA 1SL0A 4KGMA 4WK3A 3KG4A 4F8RA 3GG0A 4P2MA 4FNHA 3VVUA 1AFJA 1BQNA 3ELHA 3HFVA 3MEDB 2CPHA 2CADA 3HMJG 1U1NA 2F4VJ 1S0MA 1S99A 1KNZA 1NH7A 2HQDA 2MQNA 3QATA 5FJ4A 2YKQA 5DJBA 3W9HA 3BO2A 2V2KA 1RAJA 1T05B 2MQ8A 3E51A 1IBLJ 4IDKB 2LYVA 3BSOA 4NCAA 2JVOA 1FI4A 3JQMA 2ZBQA 4DX8H 3VALA 2P6SA 3PV8A 2VDIA 2B0GA 1HLWA 4J5OA 3NCQA 5THWA 4JI2F 2W2OP 5C5JA 4DV6J 1H2UX 2FGOA 4WBFA 5D4LA 4YB6A 3D66A 5C2CA 1Y10A 2VB6A 5E2QA 4GKJJ 2BANB 4M1KA 2CQ2A 3GYNA 2BJ7A 2RQKA 3ADAC 2D9PA 5E41A 2EFOA 3KNGA 4DBQA 5HO4A 5L39A 3K5MA 2E1CA 2V63A 2PSZA 2MQOA 3NLCA 1IKWA 2D69A 3WIVA 5F8GA 1SIWB 3MUTP 3G71S 2GHWA 3ET6B 2R7XA 2B6AA 3GFYA 1KFSA 2P9EA 4H4KA 1PC4A 3M8WA 1FE4A 1G3OA 2DH7A 1H7WA 3GZ7A 4Z2XA 1H73A 1Q8LA 2ZDPA 2B4UA 1NK5A 3UDVA 4OI6A 3TZWA 3Q0AA 1NM2A 1T3NA 2POKA 5KT2A 3CF5Q 2R8JA 3GP9A 2X3DA 3RB3A 3G9CA 1C0UA 1BXNA 1QE1A 1HYSB 3CC2S 3Q8YA 4BC7A 2RUSA 4YUDA 2AZ3A 2XGPA 3OHAA 2DEIA 3PYFA 2LEAA 1C2PA 2YNGA 3MM5B 1WTBA 5KFNA 3C46A 3NGSA 4NL5A 2HS4A 3N6NA 2GVZB 2CPDA 2Z8QA 3KUHA 2Z58B 1X4EA 1RLCL 3M05A 2CQPA 4X4QA 3AOAA 1KQSR 4DS5A 2V2VA 3QJJA 2VPWB 2VDHA 2J0WA 2CJYB 1WKJA 2C2KB 2GMJA 1FFWB 2HHQA 2AYBA 1HWUA 2FHKA 4TN2A 2UUWA 4NLGA 4IFYA 3ZZUA 5I3QA 3UDCA 2UP1A 1QUVA 1DQ9A 4WK1A 1VRTA 4USKA 2KRBA 2F3JA 5G0RA 2EW9A 4MTPA 3M7VA 2NQPA 1B7FA 2VF3A 3N5BA 5KFEA 3MURP 3OJUA 2GIQA 3M9MB 3VAGA 3QT6A 3RBXA 3V6HA 4DN0A 4USHA 3AKOB 4NYPA 3VAHA 2BKNA 3QIDA 1UMJA 3TO8A 2ZBPA 1ZETA 3MCMA 3I56S 1RT7A 1TFYA 3ENQA 3FC9A 3RB0A 3J81j 2ASLA 3TUIC 3AB2B 1U0SA 2H65B 1O8BA 5HL7Q 1FRHA 2FC8A 3GQCA 1FF2A 3LUYA 4P7TA 5KFRA 3R5CA 3LZ8A 1R6YA 1ZA2B 4FPRA 4PG8A 2OTJS 2BACA 2RJZA 4X62J 5KFKA 1JMTA 2FIUA 5K8PA 1EIYB 1XR7A 4PXDA 2CVEA 5DETA 2AT1B 4EFAC 1N5VA 4HYKA 4RW6B 4QU7A 4GKKJ 1H38A 4R0EA 3R7NB 2XMWA 3IWLA 4RR5A 1REVA 3M9NB 4TKTA 1IJFB 3R9LA 2BZ2A 5CZVA 2AYEA 4LSNA 2YNFA 4PUOB 1KKHA 1TKTA 3J81Y 2PMWA 3MPWA 3FCHA 4OZ5A 3MMJA 5D15A 4JB8B 4U8VA 3UD5A 1VFJA 3FSYA 4ZP9A 2V50A 1GQEA 1D8ZA 4RUBA 3A13A 1GMWA 2B8PA 1Q79A 4HR2A 4ED8A 4DL5A 3HVTB 4ATNA 2YKNB 1GX5A 2QYCA 2RF2A 1NXIA 1NDLA 3EGWB 1VLOA 5J2PB 1KC8T 3EGZA 1HHTP 4NA1A 3UD3P 3K17A 1TAQA 3M30B 1QY7A 2HNZB 2A2DA 3O44A 4NI2B 4JI4J 3QGGA 4DLEA 3TW0A 1RDRA 3F56A 4ZCMA 3AQPA 2GQQA 1Y5LB 1HR0J 1X9MA 5DG7A 1DTQB 1U6BA 4EZ6A 2D1CA 4YB1P 4CCHA 5J2NA 1WTFA 2YWGA 4UY8T 2IYGA 3CJ8A 2LQ5A 1TK8A 1WF2A 1PBUA 2VBWA 3ISZA 1OSDA 1JJ4A 2JFDA 1W2BR 1O6XA 1JKHB 3M1VB 5AT1B 2OJ3A 1YG0A 1T9VA 2EK1A 2DISA 2ZH4A 2GZOA 3KMQA 2UV8G 4FYVB 2UUBF 3HM9A 1OQ6A 1AUDA 4H54A 2ATLA 1OPIA 3DRPA 2JHEA 2EKNA 5A8KA 3OVBA 2VJVA 5D0RA 4FYWB 2W24A 2MLXA 3UDLA 4DUYF 3W8PA 2V2QA 1RHQB 4JI0F 4C8YA 2IJFA 2DPJA 4USJC 2DHHA 2P5VA 1J5OB 2N4CA 2QN6B 2HFOA 3KUGA 4QW9A 1KP6A 4ELUA 1VQOS 3OFGA 2DRAA 1OYEA 4P71A 2DB1A 5AXLA 3FBEA 3IXQA 3HULA 2CJKA 4LBIA 1U1PA 1OWXA 2NREA 2DHXA 1JQGA 1WHWA 3LP1B 4J9NA 1R31A 3MD3A 3RJMB 4DV2J 2IM2A 1M90T 1WF1A 4C3MA 4HH1A 2UUCF 5KFIA 2ZZNA 4J90A 2X3GA 2B51A 1NCLA 4LRBA 4OZ2A 2UXBF 3QIPA 2JLEA 4Y34A 3LTOA 1MMDA 2DRBA 2NPFA 1VBZA 2HQ3A 2H54B 3EDQB 3VAMA 1TKXA 4LR9A 2ASYA 5E3PA 5HATA 1RHJB 2AX1A 4MIBA 2J5AA 2NXJA 2XSFA 4ID5B 1IKVA 3TAQA 2I5JA 5DLGA 1SJ1A 4LF7J 2O5DA 2HHSA 3NXZA 4JI6F 2AEFA 2W9AA 1X4AA 2G0CA 1N5YB 2AEJA 2EFGA 2BA9A 3MI7X 1C4CA 4KHMA 2RT3A 3M8ZA 1FWKA 1X8DA 3P5TL 1WACA 1RB0A 2KG0A 2ZM6F 4ILLA 3IR7B 1X0FA 3ZFVA 2HQIA 1S49A 2FGCA 2NSBA 1TKDA 2H4YB 2CNKB 3DXSX 1IJEB 4URQU 1SH3A 5H9FJ 1JIHA 3O1LA 2LA4A 3M4XA 4Y28C 3FZBA 3VGUA 2NZ4A 4CLPA 4C8LA 1X4DA 4G1QB 1N5QA 4J9PA 2KFNA 4K4TA 5KAKA 2HMIB 1G4CA 3OPKA 3ETMA 3CCWA 4W92B 1S59A 2I8EA 1FXDA 2YNIB 3V2UC 2JSXA 4YDDB 2CVIA 2QA2A 5BYQA 2RQMA 4Q44A 5E33A 1RKJA 1M5OC 2LXIA 2UU9J 2B4PA 2HPUA 3WHIA 5L1IA 2GVDB 3OTEA 3MUMP 1RTHB 4RLEA 3RZAA 1NSKL 1HW8A 4H4OA 4U67Q 4DCOB 2QLWA 1BLUA 2J0XA 5HAOA 2HGNA 3LW5C 2ZE2A 1PJ6A 3EZOA 1CVJA 1TR0A 4E98A 1LEOA 2AYGA 3MTKA 2I0XA 1ZZFA 4YR2A 4ES3A 1OY9A 4B3MJ 5CHCB 5A6WA 5DLFA 3DOMB 2HRTA 3QBCA 2FLNA 1VRUB 4B02A 3BGOP 4OZNA 4ICLB 3M6XA 2RQ4A 3DLLQ 3M2VB 2MTLA 4HDHA 3PCOB 3G8QA 2OD6A 2W01A 3M8YA 4FS1A 3OTDA 4P75A 4IR1A 1KLMA 3KWMA 5DG8A 2UXDF 3DGVA 4ANDA 3GV8B 3BM7A 2L08A 4CLZA 4LQ9A 4OX8A 1ZM3A 1LV5A 4TY8A 4OYBA 1UWAA 1JLFA 2Y3YA 4JOUA 3MR2A 2XHWA 1XN9A 3CCZA 3GFZA 1S9EB 4DPWA 2NUUG 2EWHA 1GEHA 4OZJA 4FXDA 2DPIA 2KKHA 4FBTA 4PYDA 1HBOB 1FHTA 3J7AN 1U25A 4UOGA 1KBRA 1HD0A 4HLBA 5DDOC 4J9RA 2Z30B 1AROP 1KS2A 2KO1A 3FEXB 2K1RB 3FVYA 1F2GA 3I0SA 1SH2A 4UTGA 1GX6A 1HNZF 2RHSB 3AQOA 3LPEA 2E9ZA 4B3RJ 1W25A 2LMIA 4TVAB 1YGYA 2M0GB 5B0AA 3CNQP 2R2UA 2VOPA 2VBZA 3NNCA 4ER8A 4MK9A 2V4RA 4DR4J 3N01A 3ILIA 2FHJA 2MMYA 3K5PA 3LP0B 1NJWA 3H5SA 1RLDA 3EM1A 3JYTA 1N8RT 2W25A 3UDEA 3R5JB 1H6KX 2XMUA 4ZVPB 2VG5B 1NHUA 4IH7A 2N3LA 1LQ9A 3JAMY 3FBBA 1ZPWX 3DOKB 2HZVA 5HROA 2MGZB 4RUCA 1QAIA 3T1HF 1Z1ZA 3EMTA 4LRFA 2CKWA 1S57A 2RQCA 3DHWC 5I42B 2N4DA 2WVBA 4BWJA 5A0YA 1YITS 4LF9F 4KGZB 4JI1J 4USIA 2VQEF 4G3IA 1S6QA 3D0GE 4FXWA 2Q1LA 4J9MA 2DT9A 4DR6F 1R8AA 4U7CA 2QMUB 5KOXA 2VQFJ 4NZ6A 2DHAA 4FKYA 2EKYA 4GC7A 1YK9A 3M8RA 4PAAA 5BXIA 1XK8A 4NLQA 1BGXT 3CCMS 3MMCA 4MYUA 4JI5J 3ILLA 3KFWX 1HKAA 4ZLLA 2ALZA 1N34J 1FKPA 1SJFA 1UA1A 1VQSA 2U2FA 1U6FA 3CGIA 3PYDA 1W26A 2FJDB 1JJHA 1RTJA 4FN5A 3KLHA 2XLKA 4JV0A 2VL1A 3T19A 2RDIA 3OTCA 2HHPA 1NJYA 2MEWA 2YX4A 2ZH7A 3TOQA 1HHQA 1KVIA 2R7RA 2WBMA 3VGTA 4PXCA 3RW7A 1N48A 1P1LA 1Q81T 3F0NA 1FFSB 2HNDA 3C16B 5KFZA 5HQMA 3BN7A 2H5IB 1JX4A 2DR7A 1RA6A 2ZH3A 1M5HA 5HBMA 1M1HA 4RUHA 1HQ2A 2YXLA 1U2RA 1TKZB 1F5CA 3Q8VA 3UN3A 4RWXA 4TYBA 5B0CA 1S0OA 1ZM2A 2JFKA 2CZVC 1GNKA 4BS2A 4QYZJ 4FVCA 4ZLPA 3UCUP 3L7UA 4FKXA 2LQ9A 2GX8A 2XYPB 2LP4A 2YKMB 5KFDA 1RAGB 2LU1A 4ZP7A 4CO3A 3MAHA 1QTMA 1DQAA 4XAKA 3KLVA 1G6BA 3QJLA 2E1PA 4X66F 2HWIA 4B08A 3U1MA 3T5JA 2F8EX 3TZXA 3NS5A 5IQQA 2M5YA 5GMEA 3Q8SB 4LF8F 1U49A 2GO9A 4O4GB 1VK3A 3P3DA 1NK4A 2ZD1A 2UVWA 4ILMA 4CLUA 3G6XA 3CD0A 2K06A 4KO0B 1IBCB 2HWHA 1CS4A 1V9OA 2HGLA 2NCKL 2XS2A 4RW7A 1R7IA 2ASJA 5BR8F 2HNYB 3NRBA 2VFUA 3IGNA 2MQPA 4DDFA 2V94A 4C9DA 5AE2A 2C2DA 1YTYA 3ENAA 2YPYA 1R6VA 4C8OA 2DEJA 3NL0A 3TEGA 3KJNB 2Z57B 2GS8A 1ZM4A 4QWDA 1N36J 1RT4A 4FVMA 4I2QB 1EKSA 3MMBA 4WFYA 1X31C 2NSCA 3M9OB 3BQ2A 4WKRA 4UT4A 5KFFA 3MGJA 2DNYA 2FVPA 3UPFA 5EDWA 4CM0A 5ITHA 2G1HA 4MH8A 2XLIA 4TLQA 3CJQA 2W4CA 4NLVA 3OHBA 3IM8A 2AKWB 4J91A 5HMXA 1SKRA 3I0RB 4ZHRA 3BN4A 2JC1A 4LF6F 1SCJB 2CZ9A 3OFHA 4CTAB 1V3ZA 1MWYA 2G9OA 1T3OA 4V1Ak 4V19X 3CMAS 2CYYA 1HA1A 4A8FA 2DGTA 3G8SA 1IM4A 3PR5B 3MM8A 1LWEB 4TU9A 3S1TA 3X3UA 3H98A 4ZVFA 3NBPB 5IC4B 4YMEA 1TVRB 4IG3B 1PBAA 3PZPA 4LRAA 1S1WB 3VVTA 2NXEA 4TQRA 2FJXA 4F4XA 3KDOA 5G4DA 2HBQB 4EYHB 5T41A 4ECWA 3HCXA 5H9EK 4OFZA 3LO3A 3P45B 4DLGA 4QIGA 3BS9A 2GQCA 4I56A 3K58A 1ZM9A 1FWLA 3DDKA 3IO1A 3MEDA 1FKAF 1Q8BA 3BR8A 3DGPA 3N9UC 3EJMA 2J7WA 3ONQA 4KY3A 4KHPJ 4OZ3A 1FTRA 5DDQC 3SQGA 4D3HA 3TAMB 2KM8B 3MM6B 3IAS9 3KOAA 3O2IA 4DR2J 3V4MA 3R97A 1FKOB 1T05A 3H5XA 4O44B 1Q16B 4IDKA 2A1BA 3HKZD 5E3RA 3W5ZA 2FJBB 2E5LF 2V6AA 1E6YA 4UOHA 3MCSA 1HQEA 3L09A 1U8WA 5AXMA 4CO4A 4DSLA 1NDCA 3UNGC 3T5KA 2GAHC 3E2EA 2QLBB 1DY3A 1YZ6A 2BANA 3CC7S 1P1TA 4Y6IA 1RT2A 1EAYC 3WBZA 5CCMA 2B3TB 4KHRA 4YR0A 3JSMB 3J7ZT 4AQYJ 3W65A 2DGOA 4X4PA 4CLSA 3BQ1A 2DBBA 2XZWA 4P7VA 2W4PA 3R5AA 4RPFA 2BJ9A 3ET6A 3PRDA 4DR1F 5F8MA 3N79A 3NGTA 2FHOB 4DV1J 2GFFA 3A12A 1FFGB 1UZDA 4C3LA 3AY0A 3JTPA 2PI4A 2OPSB 3FUYA 3CMQA 1KHVA 2AEMA 3DLJA 2ZBIA 3DRSB 3CDWA 4MIWA 4I64A 5IT4A 1EETB 3CJRA 4A8OA 3GFXA 3MM5A 2G1DA 3S01A 1WKLA 4CNZA 3CWJA 5CYJA 4IFVB 4X65J 2CPXA 3EVMA 3UD4P 2GVZA 1VBXA 4OZ1A 2LECA 2M2BA 3OR2B 4CO5A 1X4GA 1KTVA 1CC8A 2RE1A 3HSJA 3KMSA 2WONA 1Q5YA 4YDXA 1EJ7L 4LQ3A 4KRWA 3IWNC 2ZH8A 3ZTRA 2JZ5A 3U7JA 3EVWA 2OEMA 3QSYB 1RT6A 4R5PB 2WRMA 3L4BC 2PIIA 4DQPA 3IRXB 5F8NA 2UVRA 1XNQJ 3A3OB 3QYYA 3MD1A 3T9ZA 4DV0J 2AWZA 2DKOB 1DLOB 3BDPA 5C24B 3QO9A 5MLCV 3NMAA 1B0VA 4RW4B 1HNVB 3LAKA 2BE2B 1QSLA 2PMZD 4UQGA 5A8RB 4PG4A 2YWEA 1I1GA 3ZZRA 4IH5A 5DDRC 2QIFA 2D7SA 2JC0A 3OW2R 3S7RA 4JI8F 1IQZA 3VAFA 4AXJA 4XDCA 4ZVQB 1B64A 5M2RA 4WXOA 1N88A 4RU2A 2PO4A 4KH0B 5LT5A 4NLXA 1FESA 2K2PA 3P96A 2CJAA 5C2GA 3AT1B 2WB1D 3CJTA 3HX9A 1F3VA 3SI8A 2OELA 4DG1B 2C3PA 2WAQD 2E29A 4LFBJ 4RW6A 5E7OB 5EWGA 2BJDA 2KZMA 2MZQA 3BGLA 3G86A 4QIWD 3HK2A 1VMBA 2L48A 1UWBA 2J8AA 2XMAA 1LFPA 1MMLA 3CCTA 4Y65A 1VQ5S 3A8JA 2C2OB 2X51A 3VF0B 2AF6A 5B0EA 2VKZG 4N8NA 3MR5A 1UEVA 4NRTA 3HI9A 4HACB 1NDKA 4WU3A 5CYQB 3VHQA 4ZN1A 3HVTA 4QIFA 2ZUAA 5DQIA 1WEXA 4U8YA 3Q83A 3VGSA 1ZS6A 5J2PA 1SXLA 5SZTA 2JDJA 1VS3A 2RMLA 2YTCA 4QW8A 1BWEA 3QNWB 1X5TA 3M30A 4K4WA 4OX7A 4PXEA 3CW2C 3OR1B 1WSVA 1E6VB 2IBKA 2F9JA 2J6SA 1SBRA 1JLGB 4UZCA 4NXMJ 3C15B 1PGZA 1MG7A 1DTTB 1TL3B 4R8UB 2AHOB 3EICA 4WWSA 1DTQA 3QGIA 4RWWA 2W2MP 4NLRA 4A8KA 2QX0A 4C0BA 3KHRA 1IQTA 1S5ZA 2CA9A 2IMOA 4ILRA 4ZPDA 5DRKA 5D77A 3I6PA 5DGBA 2GGPB 2VG6B 4PABA 1JKHA 3M1VA 2KXHA 1PILA 4EEYA 3G4SS 1YWXA 4KB7A 3WX4A 1GAOA 2ZJPQ 1U7LA 3Q8UA 2LDIA 4EBCA 1HHSA 3O3LA 5CA5A 2IBOA 4Y2IA 2F9DA 3CJKA 2UZAA 3C14B 2ILZA 4PCQA 3FBFA 1CPZA 1T02A 3TA0A 3DFEA 5KFSA 3GE9A 1SQFA 2XEXA 5IV4A 4AL5A 4DV4J 4L73A 1WELA 2ACMA 2BVZA 3G2XA 1J5OA 1HBUB 3ICLA 2CNNB 2HURA 4ZPBA 5F9NA 1N5SA 1M1KT 4OJHA 2P9GA 4OL8A 3PYGA 3M32B 2BR0A 3RTVA 2F5GA 5CXTA 1NB7A 2WSFC 4QQBA 4NOHA 2ROPA 4CWBA 5HQLA 2OPRB 3MCOA 3AOCA 4ZP6A 3HD1A 2KH9A 4WP3A 1XIQA 4E8UA 3FRYA 4J9LA 4RNHA 1RT5A 2DXEA 1B4SA 3I5CA 4KPYA 4O3PA 4RW8B 2XI2A 3D9BA 4MKYA 2OPQB 2HBYB 1S97A 1FEHA 2VOOA 3PDNA 4NRUA 3DLBA 1FRIA 2YKAA 3QLHB 4JYAF 4H4MB 8AT1B 4DUZJ 4YN3B 3A3NB 2AMCB 2J76E 4FYYB 1UVNA 3PEHA 4ID5A 2LCWA 3WDOA 1H98A 2ZKTA 2VHGA 1FDDA 3BPSP 1T9UA 2ZH6A 5HJXA 3H0PA 2KHDA 1F0XA 3DLEB 4OV6A 3EZUA 3W5YA 4RBVA 3FGVA 4PYAA 1RWXB 1N5YA 2EFVA 1KHWA 3CIMA 5FD1A 2R7TA 5DDPC 4J9VA 2RAQA 3D0IE 3GIMA 1WKKA 4MKBA 3SXLA 3V4IB 2Y8WA 1S10A 1L3KA 5I3UB 1PYTA 1SL2A 1ZYQA 1KTQA 4CH0S 4UOCA 2IAJB 5KFXA 4C0OC 1SKSA 1RWKB 5CH7B 1UCNA 5B08A 2AGPA 2FJEB 5KFWA 3L9ZA 4EO8A 4CT8A 1YX2A 4LF5J 1D09B 4RL1A 1V6HA 4IH6A 5ETSA 4CIOA 4XIUA 3L3CA 2JNJA 4DWIA 3IRWP 2P8IA 1FRKA 3LPYA 2QSWA 2QO3A 3J7YI 2AJQA 4B9TA 1C4AA 4G1QA 5GAEU 1LK7A 1ZAWA 4KR0B 3VZIA 4K5RA 2HMIA 3D4JA 1FX4A 4B3OB 2C3MA 4ZIWA 2YNIA 1UEUA 2KU7A 5ADZA 1D9DA 4P74A 2EXUA 3PIOQ 3W1YC 1I94J 2AV5A 4JBCA 2FZGB 1GXTA 3ZZZA 3MPVA 1RHKB 3DNCA 1GTHA 2UUAJ 3KUEA 3O6QA 1HNIB 2YKPA 1ICEB 3V81B 2GVDA 1RTHA 3K59A 1OJ4A 3SSRA 1CEZA 1PCAA 3SCLE 3KHLA 1M5SA 1VQYA 1D1UA 1SC1B 2VPXB 1JJ2R 1VOMA 4FF2A 3KJVB 1XR5A 1YJ9S 2CPIA 3CDEA 2F7VA 4O0IA 1S72S 1OY6A 1HBMB 5HMZA 2ZKUA 5A6PA 1S6UA 5KFQA 5B0DA 1PC5A 1HWKA 3JQKA 2Z2MA 3DOMA 2Z2LA 5IWAF 1VRUA 2ZFHA 3HT3A 1AA1B 2DGVA 4Q5VA 2K3KA 1FNXH 3I5AA 2E7VA 4ICLA 3QT8A 1NSQA 3M2VA 3HD2A 3EVOA 2DGXA 1D3WA 2DHGA 2IMWP 1WC5A 1HNXJ 4C8ZA 4L76A 4KIAA 2F8HA 1UJ4A 3W60A 3AGYA 2MXYA 3BB5A 4K4ZA 3OBIA 2VV5A 4A8XA 1VHFA 2DNNA 4DPYA 3SFUA 2JVMA 2YX7A 2XBPA 2E1RA 2MZSA 4WZMA 3BH6B 1Q53A 2UUBJ 2HEKA 3W66A 2MZJA 1JLQB 1U02A 3AGXA 2VODA 4U9RA 4Y00A 4CRJA 5A76A 2CXEA 4K0KF 1FCAA 2IJRA 3AA8A 3G8TA 2KVQE 1HBOA 9ATCB 2FZKB 3NS6A 3C5XC 2YKOA 4CQ1A 2GV1A 1RWOB 1LK5A 4O3NA 4JI0J 2HRUA 2F4VF 2BQUA 2PGCA 4P2SA 4OV1A 1U1KA 2E5JA 2K1RA 4K4XA 4HHHA 2G4BA 2ZNZA 2O66A 1T0TV 5ETRA 1HWLA 3ILOA 3LOUA 2RB7A 4JI7F 3SZ2A 4IOCQ 2GMHA 5F9LA 1ZAXA 4DV6F 3ZC4A 1R8PA 1NAQA 3GJRB 4QPXA 4HHJA 1TL7B 1S1XB 3PKMA 2CPYA 4NLPA 5LXRA 1DZ5A 4P52A 3HJVA 4RNOA 3P4UB 2CPEA 3DXBA 3G82B 1FT8A 2BJEA 2VG5A 2FVCA 2KXNB 3KYLA 1VQ8S 3K89A 4PQUB 3B4DA 3HKWA 3MUVP 2OSQA 2MGZA 1Q7YT 2LQ8A 2B5JB 4C8NA 5K8OA 2GJIA 1IN0A 4CT9A 4NPOA 3ZTOA 4JI6J 2WVCA 2DCUB 1S76D 4DR3J 4Q0BA 2HIYA 2XMMA 3T1AA 1N54B 2KM8C 1WOOA 2BW2A 4QJVA 1OO0B 1J2VA 4ZVUB 1K0VA 4NLDA 1NJXA 4KYZA 2MZTA 4ZCLA 1FD8A 3EXCX 2M8DB 1XMOJ 3MXHP 1V5VA 4CDIA 1RAAB 4DOZA 3I4HX 3VGVA 3BYPA 4WYWA 2ZM6J 1FRLA 4JV5J 2M8HA 3QWUA 1YDLA 4C7QA 3A8EA 2JX2A 3RU0A 4DF8A 4Y2CA 2ZEJA 1CJTA 1P9YA 3B54A 2KB2A 3PW4A 2XMVA 5ETKA 1ACMB 4X64F 2Y8YA 2BE7D 4KGKA 4LSZB 1YKWA 1WDTA 1KN6A 1Q78A 2O1PA 3G6ES 5F41A 3MMAB 3C16A 2ZOGA 4NMLA 2VC1A 4WTYA 2QFJA 2XB2D 3I82A 4XPCA 4DL2A 1NRKA 1TKZA 2VFVA 4ZIVA 2HHTA 2YH1A 2RSQA 2V69A 3E01B 2KHCA 3UE2A 3CJ3A 5L9NA 2R7SA 2ZUGA 2HKEA 3QAUA 3DYAB 3MPDA 2DXFA 2V8GA 1RAEB 2AJFE 5GAEI 4IOAQ 1CBKA 1SH0A 3R5BA 2AYMA 2E7XA 3UO0A 4DQIA 3GG1A 2ADBA 2E9TA 2KL8A 1NNDA 2VA2A 2B8QA 5KG4A 2HYIB 4TY9A 1U26A 3FEYB 3TZZA 3MEKA 4J9KA 4GMKA 4ZCIA 2XY6A 2VA3A 1SPBP 2QTWA 4O4GA 3KG1A 3MR6A 3LANA 3VQTA 2DO0A 2RRAA 1T03B 5B0FA 3W2WB 4F3MA 2IJNA 2OFHX 4G6VB 4MKVA 3THVA 2HNYA 2UXDJ 2R7VA 4I68A 4MT1A 4URSA 4ANCA 4ED7A 4HTIA 1HMVB 3A8KA 1GXUA 2MSSA 3CCJS 1QD1A 2ZWPA 3OFEA 1RWUA 2XWYA 1OQ3A 1JWWA 2QC3A 4WF9Q 1YSJA 5B0BA 3E8OA 4I2QA 3AJ2A 5F0WA 1WI6A 2DR6A 2Z2ZA 3PW0A 3AHPA 4ECUA 3FBCA 1O5JA 1HARA 1CQNA 1HNZJ 3O8WA 4CNYA 1FRXA 3JSYA 1URRA 5KOWA 4ED1A 1UTAA 3OXFA 2CPZA 4B3SJ 3Q2TC 3KXDA 4N41A 4CTAA 2W8KA 2MQMA 3UR3C 1VYAA 2HVZA 3N4WA 1SB6A 2DR9A 3RGIA 5BYSA 3N6MA 4QR2A 3PX0A 3MFIA 3FEZA 4ZP8A 2FJWA 4PWUA 4DR7J 2Y0SD 4P2FA 3PY8A 1EHWA 4IRKA 4EGLA 3VAKA 2K8GA 1T94A 2Y1IA 3OT9A 4ZVOB 3HDSA 1S1WA 1XJWB 2FVSA 3U02A 3KTQA 1RYRA 3KK3B 1J5EJ 1U47A 5KFAA 2F63A 1AW0A 1ZTTA 3PFOA 4A46A 5D0EA 4ZPCA 4RZRA 2A6OA 4DU7A 4U6PA 3GJTB 5HJYA 1P9QC 5KFGA 1MN7A 1RWPB 4LF9J 2PDAA 2VQEJ 5AXNA 1JLEB 2XULA 1YQHA 3V6JA 3TAMA 1XNRF 3DDNA 3MM6A 4DR6J 4LVNP 2DRDA 3KNAA 3I5BA 2VFRA 1TL4A 3OL8A 1FKOA 2PFDA 3DI6B 4O44A 1RSCA 5IM0B 1TQLA 2IFXA 4L3NA 2OAUA 1QE1B 3AH6A 1TZ0A 3TJ9A 3I4PA 3W7BA 2NXCA 3K8WA 3GYGA 4LFCF 4LMZA 4M5MA 1FNMA 3V6KA 3F41A 1VQKS 4OI2A 2VU5A 1HW9A 1R0CB 4DV2F 1X5SA 1R8BA 4I2PB 1HL6A 4O23A 4QWEA 3VZHA 3PJWA 1YHQS 4K4VA 4XO0A 4LUBA 5ETTA 5K20B 1EP4B 4K50A 4BBYA 3BSCA 3GWCA 3ISND 3R2DJ 3C6UB 2ILYA 4LIWA 2M4MA 5HSPA 3CCSS 5K5MA 3THTA 2DNPA 1Y00A 3DMJA 4X4SA 2QFIA 3RBDA 4ES2A 4YB5A 4WE1B 1PIEA 5HQ8A 4LF7F 1X9WA 5L38A 2HVDA 1WORA 4N5SA 3P8BB 1WEYA 3A3PB 3DRSA 1FK9A 2FVRA 1CJKB 2XC9A 1BWVA 3N5FA 3PACA 3MTJA 2GO8A 2BQRA 3SDEB 1TUWA 5J2QA 1BY9A 4M5GA 4GO5X 1F1BB 3CCUS 2F40A 1FXRA 2DIVA 2DY9A 4KFBB 3OR2A 4PWWA 1W7WA 2OPPA 4PPDA 1RT3B 2EG1A 1U1QA 4ZDNA 1GMUA 5IV3A 2ALYB 1VQNS 1RTDA 1AFIA 2ZWOA 5H9EJ 4B3TJ 4DFMA 3ZO7A 4DQRA 2XM3A 5BR8J 3NNHA 3NNAA 3UR0A 3UCGA 4LSLB 4OYWA 5KG0A 4R5PA 1S1TB 3HO1A 4ED3A 1QUPA 2YWKA 3IRXA 4M95A 1B99A 2HBZB 4Y2MA 1FNOA 5K14B 3QPIA 1TUVA 1DLOA 1KQGB 5ETPA 2XY7A 4DMZA 3TVYA 4B9UA 4N8OA 4KJIA 4CLWA 2BE2A 4NXNJ 3HXMA 5A8RA 1IBKJ 4ZJLA 1KOOA 2RF2B 1X5PA 1FWPA 2MQLA 5DS7A 2LDYA 7FD1A 4C8MA 3CULA 2P6TA 2Y9HA 2V4JB 5IT0A 2E1MC 2AJ0A 4B3MF 2HHVA 4NA2A 3H2VE 2E9RX 4LF6J 1Q5VA 3ZTSA 2EK6A 4NMXA 4KGXB 2KJVA 4L74A 1NZAA 3HVAA 2JOQA 1YJTA 2UXCF 3SSQA 3VR1A 4UY85 2V67A 2EFPA 5T7LB 3B6BA 4CO0A 2R8IA 2IVMA 1KDNA 1AYEA 2HK3A 1NHKL 3G96A 5H9FK 1OY8A 5D3GB 2CAJA 4KAIA 5LJ5Y 2V9KA 4ZCKA 4WFZA 2YWFA 4USUA 5K9FA 2ZVSA 5IZHA 2D3UA 4HACA 5CYQA 2ZHAA 1IBMJ 2B56A 4DL0C 5DM6Q 1Z2LA 2HQCA 2FC9A 1VLYA 3I96A 2ZC4A 4X2BA 2JLGA 1HNWF 2WVFA 3ZZOA 2XTJP 3ITHB 4RO0A 5T14A 3FFIB 4WYLA 3LWLA 2A18A 1CJVA 3BPDA 3OR1A 4Y3CA 3T5LA 1E6VA 1QVGR 4TU8A 2EC2A 1JLGA 3C15A 1DTTA 1TL3A 4WFBQ 3C3LA 2QL9B 4R8UA 1YVFA 1RYSA 4RW9B 4F50A 1UETA 3W2VB 1KSPA 2DIUA 3D5MA 4DR4F 2RILA 4OIXA 3IC1A 2ZHBA 1TU0B 1VC0A 4DV3J 2XHCA 3GILA 4ZOSA 2GGPA 3VV2B 4OYOA 5HVFA 5EUHA 4X4TA 2LFVA 4FYXB 3BO3A 5H1SV 3T9NA 4P9SA 1R3NA 2BJ3A 4OZLA 3C14A 1TKXB 1F60B 1F9FA 4DR1J 4Y2AA 4X84A 2C2RA 1MNEA 4HKQA 2M9KA 1IKVB 4LFAJ 1U48A 2C2EA 2XZDB 1L3TA 3J80U 4JI1F 3QT7A 1FJCA 3OUYB 3KJQB 1X0PA 3NP5A 1HBUA 2KXFA 3KHGA 4NYOA 1NO8A 1Q1KA 1KONA 1SI9A 3M32A 3MEEA 2VQFF 1XTZA 4I1TA 3V5RA 1SKUB 5DG9A 4TYAA 4TU7A 2KYZA 3NY0A 1RXOB 2OPRA 5D0GA 1VQPS 4JI5F 3KLIB 2FVQA 1HWIA 3PJ9A 3I38A 1LKZA 3EGVA 3OL6A 1H2VZ 1N34F 1NMEB 2O67A 1FDNA 2G0JA 4ETXA 4B9LA 2YNHB 1TAUA 3PKYA 2P2CB 4K8RA 2A0FB 3K5LA 1QAJA 4RW8A 4F67A 1UVLA 1SQGA 4WZQA 3JTOA 5KTQA 3RAMA 2GQ2A 2JLFA 2DR8A 1FJGJ 1RWVB 2YH0A 1JLAB 2GHVC 3QLHA 4QYRA 1NPKA 2UV8A 3OD2A 1AXQA 2J9DA 5L1KA 1Y0HA 4ED6A 2V8DA 4C48A 5LSOA 2VJUA 2B4OA 2KTQA 3PO5A 1KWMA 3BYRA 1R0AA 3VCDA 5LSLA 2KZZA 1VIXA 3TYTA 3DLEA 4PG6A 3L7OA 3M2RB 2HS0A 1WNEA 4F4KA 4LF2A 4CYUA 1B3TA 4KKOB 1IKYB 2QLJB 4F2SA 1AUSL 3US5A 3V4IA 1JLBB 1L5UA 3T5HA 5KFHA 3NCRA 1RGVA 1RHUB 5I3UA 5KT6A 2XG8A 5LMNF 2UVUA 2ZE2B 2IAJA 5D6GA 4DV7J 3TARA 4O3RA 1KVJA 1HPZB 1GT8A 4ECZA 4YFUA 1SQEA 5F3TA 2E44A 4OX9J 2AJ1A 3GCXP 2ERRA 4N76A 1S4FA 2A10A 4J9OA 1MWZA 1H3DA 2OHDA 2G0IA 1QTNB 5A2QY 3CD5A 3H5UA 3ISNC 4QU6A 2B7CB 4B3OA 5GMDA 2Q66A 4EBEA 4DF4A 3NGKA 4OLOA 6FD1A 3M8SA 2OP5A 3PX6A 2ZH2A 2ZZTA 1PJ7A 1ITPA 1EKRA 5IQ6A 2Q6BA 2FHMA 5HLFB 3PFEA 4OX6A 2CUYA 4USMA 4LF4F 4F3OA 1HNIA 2LLZA 1HQUA 2NYHA 5HP1B 2V34A 2P9CA 2RRBA 2M52A 2C2MB 3U1LA 1QDUB 2PEBA 5JXSA 1N36F 1RU1A 2VPZB 1UAWA 3PXGa 4LIRA 3Q22A 1XAOA 3D68A 1HBMA 1HBNB 1T11A 2XWXA 2DNKA 1NPPA 4QYZK 3NCPA 3HF5A 1X4HA 3PX4A 2QRRA 2VFTA 4NYZA 4QOTA 4LR7A 1IM6A 3C6TB 2KDOA 3CJ5A 3DU6A 1XQIA 4J9QA 3CMES 2V8HA 3T3FA 2AQ4A 1APSA 1UKUA 3FDSA 5K8MA 1U8SA 2OD4A 4DEZA 2E1AA 3K0JA 4N56A 2VG7B 3ZNJ1 4HH0A 3FCVA 4WJBA 4QIEA 3VAIA 2WOMA 1RBAA 2HHXA 5HROB 2KN4A 1JLQA 4BC9A 3PHTA 2JEJA 1R8CA 3R27A 2C42A 2BJ1A 3GPAA 4M5HA 4F3QA 3DOLB 5B09A 2XNRA 1WC6A 5A0YB 1MROB 3MM9B 4KHPF 3QAEA 1L3UA 2JVRA 1LWFB 2ROEA 3IM9A 1PKUA 3H25A 2QE5A 3BKTA 3JSRA 1JB0C 4ZPAA 1Y9OA 2NYIA 1UPPA 2GC8A 2DY1A 1RI7A 5GAHU 3D0HE 2KI2A 1K0TA 5F8HA 1N4LA 1UP1A 2EEYA 3MMCB 3OVAA 5GVQA 2GW8A 5C42B 3RW6A 2BQ3A 2B9EA 1TL7A 4DSKA 4TNOA 1NPRA 4A48A 1TMJA 4AXIA 5C25B 1CULB 4M5LA 4UUWA 2GIFA 1N33J 2C2ZB 4KBIA 3G82A 2EC0A 1DJ0A 4WTOB 4L3KA 4AQYF 2W9CB 4B9MA 3P5BP 3KLEA 2RDJA 4ALZA 3FNNA 3TJAA 4PQUA 3PTWA 1X5OA 3W63A 4OHZA 4O3QA 1IR2A 4HTJA 4JYAJ 2BKOA 2B5JA 2BXJA 2EVZA 2H48B 3RAQA 1YBUA 1CG2A 4IRCA 3BDEA 1LNQA 4KV8A 5EGYA 1WWHA 4OJ1A 2HHUA 5KFBA 4ZVTB 4GC6A 3KK2A 3UN2A 4ECSA 2C22A 2PD1A 2W9BB 4G1PA 4DU8A 3CE8A 3M8PA 2X1BA 4HT7A 5DQGA 2VUGA 1T8EA 2OLWA 5E5NA 4AE5A 4C4WA 1WEZA 4EI2A 3QZ7A 4DL6A 3AA9A 1S9GB 3TVZA 4USVA 4X65F 2B43A 4DZ6A 3F73A 2MZ1A 3VAJA 2ZBRA 2IDLA 3HFZB 2GA7A 1R0BG 4K2JA 2FUG9 5EHHA 1RUSA 2DYAA 2ZD1B 4Y0FA 2QEXS 2DJWA 2J6TA 3MAAB 1R89A 3N6LA 4B17A 1ZZNA 1WG4A 1S6OA 3D54A 4I69A 3MMAA 2JEFA 1OSCA 1NSAA 4LR8A 4DHVA 3UW1A 1UW4A 2EFQA 4JP8A 2C28A 1DAXA 2FPHX 2IIHA 5BJRA 1WJ9A 1XNQF 5IOLA 1CJUB 3E01A 4QCLA 2H3EB 1UPMB 1M5VC 1RP5A 1UVIA 4DV0F 4OMFG 7AT1B 3DYAA 3NG8A 1AZSB 1PAEX 3EX7B 1XMQF 5E3QA 1JNZB 3CDUA 5J1EB 1NJIT 5EWEA 3PNIA 1BQMA 1BQXA 1RT4B 3R6GB 3MR3A 1YRUA 4IQMA 4ECTA 1MW7A 2AJ4A 2O3DA 4K59A 4PEOA 4J9UE 4X4RA 2F65A 1N32F 4PPZA 1U4BA 1B7YB 3RG6A 3LP2B 2J0SD 5D78A 1YJRA 3D6TB 1VGYA 1SC6A 1HIYA 2YQ0A 4DX5A 1VBKA 5KFVA 1TL1B 4NCGB 2IY5B 1T03A 3PRVA 9RUBA 3RRGA 1C1BB 2VPYB 3W2WA 3PW5A 1GTEA 1KEKA 1C0TB 3MM8B 3KLGB 3Q86A 4HI2A 1RHRB 4RNFA 2XI3A 5CYMA 3IGVA 2VASA 1TV6B 1R8HA 4IR9A 3R3TA 1EQ0A 3EGNA 4WPAA 3HHNB 1K8AT 4ETZA 4N47A 1HMVA 1A7GE 3M6VA 3IBCB 3SCJE 4DN9A 3UVJB 5DM7Q 4WIQA 1YLXA 2XO6A 3OL7A 1FJ7A 5FLXU 4DX6A 4K0KJ 3C2PA 1LW2A 4P72A 4BLGA 1JK9B 1RKIA 1TL5A 1QAXA 3DGPB 2BX6A 4O3SA 1I6JA 4F0MA 4LBHA 2IRXA 4DI6A 3UQSA 4AD6A 3SQGB 1SL1A 4YB7A 1B70B 2D3ZA 2LA6A 3QQCD 2R2RA 2QL5B 1D9AA 2GJ2A 2DITA 2PT0A 1Y3JA 2ZDOA 3CD6S 1RADB 5KFTA 4JI7J 4NXMF 4DV5J 1E6YB 2AU0A 1HQEB 1SJ3P 1DARA 3D1HA 3IAM9 4YOEA 2QJ3A 1Q4RA 4QZVB 4I6AA 3DRRB 4LBPA 4OYXA 1NHVA 3J7Z5 2DGUA 2ZOMA 4WFAQ 3SEOA 3LGNA 2O01C 1RT2B 2CWKA 3TX8A 2CZ4A 3NMRA 1FE0A 4WXWA 4ES1A 3NOCA 1D9FA 4NEZA 4WIIA 3HLUA 3KK3A 1C1CB 2J0QD 5GAHI 5HK4A 3OXLA 4ED0A 3CO0P 2I9SA 2Z2YB 5DGAA 1FERA 2RU3A 3LWMA 1GFWB 3KHHA 1N6QB 4L6V3 3G6YA 3W61A 4NZ0A 1RABB 4DUTA 1JLEA 4DV4F 1DQ8A 5LJ3Y 4WCEQ 3TQEA 4K7QA 3DRYA 2DNOA 3WC0A 2QLXA 3LGHA 2E5IA 3DI6A 4ZLJA 3CVKA 5IFMA 5IM0A 1RTIB 2CJQA 3AD7C 4ZJQA 3DLGB 4OJ3A 4PR6A 5DO2A 3OFFA 2QA4S 3SV4A 4IUFA 1UL3A 4M8LA 4V19J 1H7XA 3L7PA 3LH2S 1M5PC 4E0DA 3NWGA 2WSCC 2MJNA 1L3VA 2HIQA 4I2PA 4ZVEA 4NLWA 4ZA1A 4Y2KA 3VWSA 2XY5A 3Q2SC 4RJVA 3HHLB 4X64J 1EP4A 4DR5J 2MPUA 1YRTA 3R2CJ 3NGUA 4IO9Q 3C6UA 4DSEA 4NX9A 4UF4A 3GFHA 3BKUA 3HPOA 4FBUA 2WONB 5KFCA 4IKAA 2CQIA 4DUZF 1HWJA 3R5DA 4LT6A 3V6DB 3CJ4A 2U1AA 4ZITA 1X60A 4KE5A 4WE1A 2J9EA 2OH2A 4UUXA 1RT6B 4ANEA 2DTJA 2DVIA 3HHKA 2XS5A 3Q23A 1CJKA 1KD1T 3SV3A 2EI5A 3QO9B 2W2QP 4B9SA 3RBEA 4QWCA 2ZZMA 4OZ0A 3SDEA 2ZNYA 3O5TB 1O0PA 3KK1B 3GR0A 3MHYA 2X1AA 2LEPA 1XR6A 4ZMMA 1VC5A 4Q8FA 2HRYA 4X4UA 3GONA 1DURA 1FXLA 3QRRA 2G13A 5IS2A 3W3SA 2WK4A 4RNMA 1PSDA 4HT5A 4KFBA 2AJ2A 4WP9A 3A8IA 5EN1A 5B0GA 4LF5F 1M1GA 1RT3A 1MU2B 1WHXA 1U1MA 1ZAVA 5GAGU 3ILJA 5ETQA 2G2OA 4FZVA 2QA1A 2OFGX 5LMUJ 2IC3B 4FP9A 3IG1B 1FA0A 3TEHB 5AJ3J 1ZOTA 2R7OA 5I4MA 2MDAA 2YWWA 3K5NA 1K1SA 4LSLA 2Z4PA 3AGZA 1S1TA 1VR6A 1I94F 2QV6A 4GVBB 1UWBB 1PO6A 5K14A 1SUQB 1OS5A 1PYSB 2MLZA 4A8SA 5ETMA 2UUAF 3OLBA 5JMNA 2QA4G 1XWLA 4DL4A 1LXNA 4WKYA 5JUMA 4EMDA 2CFXA 2V0NA 4JI3J 2Y1LB 1HYSA 5C7PA 2B7BB 3DLKB 2R8GA 2V4JA 1JLCB 2X1GA 3D6HB 1Q0NA 1VJQA 1RA7A 3H5YA 5GMKa 3N0VA 4ENOA 4ECQA 1S0NA 4EO6A 2MKKA 1IWGA 1U45A 2IM3A 1HI1A 1NDPA 3OTOJ 3I9ZA 1ULRA 3DRXA 4KQZA 5T7LA 3HHDA 1Q82T 2KVIA 4F36A 1HNXF 2Q3PA 2PMHA 1NEEA 4M63A 2LVWA 2QGFB 2DR5A 2RD5C 1S77D 5D3GA 1VHIA 5EX0A 2PFFB 3IMQJ 1FD2A 3AD9C 2LQJA 3BGUA 2L9WA 3D6FB 1RWMB 2OKQA 3CJKB 4PZVA 3TUJC 2MKIA 1NJZA 4ZK7M 5KFUA 2DH8A 1WG1A 2XQCA 5KFYA 3T6BA 4DSJA 3UCZP 3ITHA 1XNRJ 4YY3F 3CB4A 2A6MA 3BSAA 3FFIA 4FYDA 4MFBB 2H51B 2GMLA 3AAWB 4ECVA 2YPZA 2DH9A 2RS2A 1O51A 1RJJA 4RUAA 1XMBA 2IYIA 1MWQA 1S79A 4MK7A 4LFCJ 3OXGA 2YQ1A 4Q2LA 4XTTA 2J9CA 2HW3A 2AD9A 4RW9A 3T1YJ 1ZPVA 3W2VA 2B9YA 4DCPB 1YIJS 2HFNA 2XS7A 1KOHA 1RT5B 4ZLNA 3SMZA 2PA8D 2J9DE 3IR5B 1U2FA 3HHLD 1S7HA 2OGUA 3FZ2A 3TQ1A 2PN6A 3H90A 4Q8EA 3M6UA 1RCOB 3D7SB 4IG0B 5A2QU 2ZOFA 2OIHA 4DQQA 3LGMA 4PUOA 3MF5A 1F5BA 2VZ9A 1WOSA 1NBEB 4NLTA 2MZRA 3AFGA 4C98A 1RCXB 2HVEA 3HT0A 2MKHA 1BUXA 3MWBA 2N7YA 1UVJA 1VC6A 2KT2A 3OUYA 4RBUA 4DR3F 2HVHA 2YKNA 3BGFA 1LWXA 4GRSA 4LRCA 5IT9U 3IBFB 4F04B 3WIUA 2N82B 3C8YA 2NUHA 2AGOA 1SC4B 4CO2A 5RUBA 2LU2A 1XMOF 3RRKA 2HNZA 1Z2ZA 2EPIA 4NI2A 3KLIA 2L41A 4NLYA 4ELTA 5KT7A 4JV5F 1WI8A 3W9JA 4FNIA 3G6VA 4JI2J 1S1VB 2WHOA 2YNHA 1F2HA 2Y0BB 5CAAA 4B9NA 3SCIE 4CP5A 4YP3A 1HFEL 2Q2GA 3IFEA 1LXJA 2XO7A 4NA3A 2LXFA 1JLAA 2VICA 5JVHQ 3B82A 2XGQA 2GIRA 1UEKA 1BC6A 5KFPA 1P6TA 4GVLA 2V5HG 4S0MA 1QJHA 3M8QB 4DS4A 5M2PA 2MKYA 3N28A 2W7PA 2A2CA 1VISA 4HEA9 3M2RA 2R2TA 4CH1A 3TR5A 3FKBA 5FIIA 5GAGI 2QT7A 3TUZC 3JQJA 3B8HA 4KKOA 1IKYA 1FX2A 2C2NA 2FLOA 3GIRA 3BSNA 1RT1B 2KRRA 2KFZA 3BBBA 3SFGA 1JLBA 1EB0A 3R8YA 4K4SA 1VJWA 2DCLA 4ZPTR 3ZTPA 3HVWA 4M5DB 3CT9A 3CC4S 4RKUC 2CQDA 1TTHB 1HPZA 4DFJA 1YJUA 3L95X 3RR8A 3LP1A
chains in the Genus database with same CATH topology
3I38A 1GMUA 2QLDA 3LZ8A 2HFVA 1EARA 4L3KA 3TJ9A 2Q2GA 3AGZA 1GMVA 3TJAA 3NXZA 1GMWA 4J80A 1GMWD 1NLTA 2B26A 1C3GA 3AGYA 1XAOA 3NY0A 3L9ZA 1EB0A 3AGXA 3LA0A 3TJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I38 A;  1GMU A;  2QLD A;  3LZ8 A;  2HFV A;  1EAR A;  4L3K A;  3TJ9 A;  2Q2G A;  3AGZ A;  1GMV A;  3TJA A;  3NXZ A;  1GMW A;  4J80 A;  1GMW D;  1NLT A;  2B26 A;  1C3G A;  3AGY A;  1XAO A;  3NY0 A;  3L9Z A;  1EB0 A;  3AGX A;  3LA0 A;  3TJ8 A; 
#chains in the Genus database with same CATH topology
 4U7U K;  3NKY A;  1RBL A;  3MOJ B;  1VQ7 S;  5F0U A;  5J2M B;  4KSE B;  2UXC J;  4LJM A;  2CG8 A;  1S12 A;  4PWD B;  1R43 A;  2V68 A;  5ETL A;  4NAS A;  2XZT B;  2LEB A;  2FY1 A;  1UJ6 A;  2DNL A;  2GCF A;  3BKF A;  4FF3 A;  2E5G A;  2KG1 A;  4EYI B;  1H0H B;  3FCW A;  2HK2 A;  3PJX A;  4CI0 B;  5HLF A;  4YHH F;  3GYX B;  2WTF A;  2W1B A;  4Q2M A;  3D1Q A;  2R3V A;  5HP1 A;  3JSB A;  1HD1 A;  1S9F A;  1WC4 A;  1Q8K A;  4Q43 A;  4AFF A;  2EBG A;  4EU0 A;  2QSF A;  3DLH A;  3C19 A;  1HNW J;  3DM2 B;  2K3I A;  1S6P B;  4UST A;  3CTR A;  4I6Y A;  4C2M A;  2CPF A;  1UVK A;  3AJD A;  2HQG A;  1HBN A;  4DPU A;  2AGQ A;  3BR9 A;  2CQC A;  3ZZP A;  2HHH F;  1VQ9 S;  1H74 A;  2LKZ A;  2HFU A;  4MMO A;  2MQQ A;  1XC9 A;  3QSI A;  2FZC B;  4B3S F;  5HVH A;  1IKX B;  3NGD A;  6AT1 B;  2DNM A;  5L1J A;  1BHN A;  3C6T A;  3GJS B;  4DSF A;  2IVF B;  3R1H A;  4FPI A;  2XMJ A;  3FQK A;  3UNY A;  3TI0 A;  4OI3 A;  4QWB A;  4DR7 F;  1D8Y A;  4NE9 C;  2E66 A;  1K73 T;  1NUE A;  1MLA A;  3TVK A;  2VG7 A;  3MEG B;  2VFS A;  2HZC A;  4BDP A;  4C97 A;  4G1I A;  2FDN A;  1U0H B;  1SV5 B;  5KG2 A;  1U1O A;  3MM7 B;  3A4T A;  3QRQ A;  1LW0 B;  1J5E F;  4B9V A;  3TA2 A;  3J80 Y;  2M70 A;  3WX8 A;  4FF4 A;  4ITS A;  5ETN A;  4DFK A;  2HAF A;  4C11 B;  1RIS A;  5F3Z A;  4F4W A;  1Y7P A;  4P6Q A;  3GIJ A;  2ACY A;  5MAO A;  4X4N A;  3UFC X;  2R8K A;  3DOL A;  1TUG B;  3F44 A;  3BH7 B;  2VON A;  3NOG A;  1Y5I B;  2AX0 A;  1MRO A;  2IRY A;  3MM9 A;  5CD4 H;  1FVQ A;  4CLK A;  2H1Y A;  1LWF A;  1Y5N B;  3PEJ A;  4Q0B B;  3B4M A;  2RUG A;  1EZZ B;  1HI8 A;  2AP6 A;  3H20 A;  4LF1 A;  2W7A A;  1D0E A;  2QLF B;  3EZ5 A;  3EE3 A;  5D4P A;  3P49 B;  1UFK A;  1VQ6 S;  3MPY A;  1YRX A;  4QIV A;  5C42 A;  2HAI A;  5C25 A;  4XPE A;  1CUL A;  4RBT A;  1K47 A;  2OUG A;  2C3Y A;  1CJT B;  4PG5 A;  2AW0 A;  2ATC B;  2DNR A;  1UJ5 A;  2F4F A;  3EYZ A;  3QMQ A;  2W9C A;  1V3S A;  2H5E A;  1XER A;  3IS9 B;  3CCE S;  5LSR A;  2CQ1 A;  1RU2 A;  1NK0 A;  4P10 A;  2QG9 B;  5CAB A;  3EWG A;  2BJ8 A;  4O0N A;  5A8W B;  2FJA B;  2I2Y A;  1S9E A;  5KFO A;  2JZ8 A;  2K7J A;  1OIA A;  1S1U B;  2GNK A;  2OSR A;  2HHW A;  4DUY J;  2W9B A;  3TWZ A;  2BBE A;  3FMW A;  1Q95 G;  2RKI B;  4I7F B;  3Q8Q B;  5CCL A;  2W4D A;  2NS1 B;  3MEC B;  2DK2 A;  4WFX A;  2RIJ A;  4W90 B;  2DNG A;  5LMN J;  1S48 A;  1RTZ A;  2I6W A;  1WC0 A;  1IBL F;  2CJB A;  4JUZ A;  1GXL A;  1S9G A;  3PW2 A;  1NK9 A;  1WUU A;  3BGR B;  1SKW A;  1YJW S;  5B7W A;  1AB8 A;  3UWT A;  3I9V 9;  3RBZ A;  3PO4 A;  2M88 A;  3QWP A;  2R8H A;  3HHL C;  3LP0 A;  2UUC J;  5FDL B;  3ZXW A;  3CO9 A;  2E5H A;  2R42 A;  4GKJ F;  2RHQ B;  4NLO A;  4ID8 A;  1G1X A;  1KRP A;  3HSG A;  4ED2 A;  2UXB J;  3MAA A;  1NZ8 A;  3ZZY A;  5D0H A;  2C3O A;  4B3T F;  2DHS A;  3OLA A;  3DOK A;  3MR7 A;  2YY3 A;  5HI7 A;  1WHY A;  1AT1 B;  4J9S A;  1TFW A;  2MYF A;  5I42 A;  4A8M P;  3EUN A;  1CJU A;  1F3F A;  5K8N A;  2Q43 A;  4LF4 J;  3D1O A;  2FY8 A;  2BUN A;  1FRJ A;  1AZS A;  1IWA A;  3BO4 A;  3SBM A;  3U1N A;  1VDH A;  3DU5 A;  2HS3 A;  3ENW A;  3K2Y A;  5J1E A;  5F8L A;  2JEI A;  1OPZ A;  4WU2 A;  4K2X A;  2XNQ A;  4NXN F;  1IBK F;  3J7A 1;  2HLU A;  3GV7 B;  3QRP A;  3M2U B;  4YS2 A;  2JEG A;  3LP2 A;  2XSJ B;  5L9X A;  2V2Z A;  1YJN S;  2ASD A;  4CLL A;  4CLT A;  4ZS6 A;  5AE1 A;  1PJ5 A;  4OLP A;  2FJV A;  3KLF B;  4NLS A;  5HAN A;  1TL1 A;  3PG9 A;  2YQ3 A;  4NCG A;  1N0V C;  2ZVI A;  3T41 A;  1FRM A;  1C1B A;  2R7Q A;  2ZBC A;  1NU4 A;  2WVD A;  2MLY A;  4QR0 A;  1C0T A;  1KR4 A;  3KLG A;  4ZVG A;  4LRD A;  3GSI A;  3R7S B;  1TV6 A;  4U95 A;  3UN5 A;  2WZ1 A;  1ZH5 A;  5D4N A;  5BYR A;  3CCQ S;  5E0O A;  3UVJ A;  2DXD A;  2BRK A;  3GV5 B;  2H9Z A;  3GCW P;  3FJ2 A;  4DPT A;  2KYX A;  3CSK A;  1MN9 A;  3POT B;  2VBX A;  1IBM F;  3QZ8 A;  3HJF A;  2YKM A;  5ETV A;  3CJ0 A;  3H7H B;  2ZJR Q;  4JV2 A;  4ELV A;  3I32 A;  3B78 A;  1OYD A;  5KG1 A;  2D3O 1;  4QBU A;  1UZH A;  3TJ8 A;  2NR0 A;  1Q7L B;  2V8V A;  1LWC B;  4PQA A;  5LOQ A;  5IXU A;  2CDR B;  4EUV A;  1TK5 A;  2CQH A;  5DZ6 A;  3BQ0 A;  2XCA A;  3PYE A;  3FQL A;  3WQP A;  3DRR A;  2DGS A;  1T7P A;  5I3P A;  4F26 A;  2HVI A;  3GJQ B;  2Y1J A;  4X62 F;  4DV3 F;  4KO0 A;  4HI1 A;  4UW2 A;  2MKS A;  3HHE A;  1C1C A;  2OEK A;  4HL9 A;  2BEF A;  3H2U B;  4GKK F;  3D3B J;  3KKF A;  1RZM A;  3D6M B;  1MSW D;  1U09 A;  1X4F A;  2CQ0 A;  4M5K A;  3EPI A;  2YBV A;  1R27 B;  1N6Q A;  3AB4 B;  5LL6 d;  3DMJ B;  2OML A;  1SIZ A;  4Z7C A;  3AXK A;  2CQ4 A;  2Q6C A;  4LFA F;  2RNE A;  4FDF A;  3MOZ A;  4ZPV R;  4EK2 A;  2PA3 A;  1BQN B;  4USW A;  1YI2 S;  3AJ1 A;  4ECR A;  4ED5 A;  1U6Z A;  1VIO A;  3J81 U;  4M5J A;  2DGQ A;  1FK9 B;  4WFN Q;  2JJ4 D;  1RTI A;  2HFZ A;  4PXB A;  1IR1 A;  3TRG A;  4I67 A;  2F8M A;  3DLG A;  3PM9 A;  4R0J A;  3SYZ A;  4FF1 A;  5J2Q B;  3H8Y A;  2QL7 B;  5EX3 A;  5M2U A;  3I0R A;  5KFM A;  2R9L A;  4JI4 F;  2R4F A;  2PEH A;  3R6L B;  1VQ4 S;  3OVS A;  2IVY A;  1UA0 A;  3QT5 A;  3DC2 A;  1HR0 F;  3RAX A;  2MKC A;  4TQS A;  4F4Z A;  4J80 A;  3H4D A;  1LWE A;  3DCA A;  2J7K A;  3HHL A;  5J1P A;  4J7C A;  2FTR A;  2OPP B;  3CD7 A;  6FDR A;  3NBP A;  1TVR A;  3LQV A;  4IG3 A;  4M5N A;  3IWX A;  3PRB A;  2GJF A;  3OV7 A;  1FJG F;  3BBF A;  2QMW A;  1RTD B;  5GAD U;  2WBR A;  3V6D A;  4DSI A;  2W7O A;  5SUH A;  4RX6 A;  2IPO B;  3NGR A;  1IKW B;  3TUP A;  1REG X;  3T1H J;  2IA0 A;  2YVS A;  1TK0 A;  4ZVH A;  3C6E C;  1UW9 A;  1RE1 B;  3HVR A;  2D74 B;  2B6A B;  2OMO A;  4IOB A;  1U24 A;  1H2T Z;  1WDD A;  1X9S A;  1XMQ J;  1RBO B;  3KK1 A;  4IO1 A;  3BF4 A;  4QPT A;  1MMN A;  3J7Y U;  1NKE A;  4Q45 A;  3IR6 B;  1OMS A;  1PG5 B;  2IM1 A;  2XMT A;  3ZNU A;  2VH7 A;  2Y1R I;  1S4E A;  2LXU A;  1C0U B;  1N5T A;  1F5A A;  2I1R A;  3RB6 A;  4WP8 A;  4BHQ A;  4DV7 F;  1N32 J;  3GR1 A;  4A47 A;  1YZ7 A;  1VRQ C;  2YNG B;  1ROF A;  4OX9 F;  2V4Q A;  1EQM A;  5E3A A;  1NB2 A;  1MU2 A;  2J6U A;  4RNN A;  5U47 A;  2HBR B;  1G2E A;  3JSM A;  1WC1 A;  5CQG A;  5L1L A;  3CJS A;  2IC3 A;  4IRD A;  1NLT A;  3IG1 A;  1WD6 A;  1YBA A;  4I0W A;  3JTN A;  2DNZ A;  4MJK A;  1X4B A;  4DCJ B;  3WZ0 A;  1WSR A;  2L9D A;  2BDP A;  2G2Z A;  3HZE A;  2CQ3 A;  2L9N A;  2FD2 A;  5FLX Y;  2H4W B;  1QM9 A;  3OJS A;  4GVB A;  5HN0 A;  1URN A;  1SUQ A;  4IFY B;  1SVD A;  1UFL A;  3GB0 A;  1UFW A;  2OPS A;  3I55 S;  1VRT B;  1QSS A;  4FS2 A;  1U1L A;  2BYC A;  5G0R B;  2HQF A;  2KFY A;  3ETO A;  1RWW B;  3GMG A;  2ZHO A;  3FSX A;  1BMQ B;  1X4C A;  3DHX A;  4NZ7 A;  3H40 A;  1GH8 A;  3CED A;  3DLK A;  1EET A;  4L72 B;  2DNH A;  1JLC A;  2CNL B;  2J8S A;  2HGM A;  1RAH B;  4X66 J;  4IFV A;  3MDF A;  1CJV B;  4N77 A;  3ZZ0 A;  2VKR A;  1YBT A;  4ZJO A;  1RT7 B;  3W62 A;  2WW4 A;  4GO7 X;  5JJB A;  4OJG A;  2M3D A;  4AL7 A;  2CPJ A;  4A4J A;  3QGH A;  1JXL A;  2WW8 A;  3X1L B;  1XEZ A;  4QR1 A;  3D3C J;  4LF8 J;  4N7T A;  2M7S A;  4FXV A;  4IYQ A;  1ZTW A;  1U1R A;  1QAY A;  4DXL A;  2HFV A;  4AYB D;  4OYI A;  5L46 A;  1SJ4 P;  3OSP A;  2NXN A;  3IP0 A;  3IA0 A;  4ED4 A;  2VBY A;  4F25 A;  2IDE A;  1V3R A;  1I5O B;  1CSJ A;  2NLW A;  2JRS A;  1K9M T;  3CCR S;  1REV B;  2B4V A;  2W2P P;  4OYZ A;  4LSN B;  4C0H A;  2YNF B;  8ATC B;  2N7C A;  1TKT B;  5C24 A;  2B9X A;  4ZVR B;  2E7W A;  4RW4 A;  1HNV A;  2UU9 F;  2KT5 A;  3FRZ A;  3CDA A;  4HDG A;  3TP2 A;  2PI5 A;  4MFB A;  4BCA A;  2ZH9 A;  3WC2 A;  4CH7 A;  3IN5 A;  2FLL A;  4YQW A;  1TEL A;  2IA6 A;  4YEA A;  5IC6 B;  2V8P A;  3MEE B;  2A3J A;  1G7C B;  2D9O A;  4CM2 A;  1V5I B;  2EFN A;  1Y4Z B;  2I38 A;  4C6A A;  2NXU A;  2Z56 B;  5J1N A;  4LVO P;  4J37 A;  2J7U A;  1B0T A;  3K8V A;  3PW7 A;  5ETO A;  2R2S A;  5L8R C;  3GIK A;  4DG1 A;  1N33 F;  3R7B B;  5J2N B;  5JVG Q;  2QLD A;  1ZBT A;  2PC6 A;  4IG0 A;  2V9W A;  2QMX A;  4UZB A;  1FVS A;  8RUC A;  2AIR B;  4ECY A;  3MFH A;  5AXK A;  1VQL S;  1DHM A;  1XBW A;  2WSE C;  5HMY A;  5D4O A;  2GAG C;  3R5G A;  2QZ8 A;  1KVK A;  7FDR A;  3CCV S;  2ZIT A;  4F4Y A;  3TAP A;  4ZPW R;  1R0A B;  2B26 A;  2W8L A;  3DRP B;  1Y11 A;  3LAM A;  5A8K B;  4A8W A;  2X7I A;  3G87 A;  5HMW A;  3ULH A;  1L3S A;  4K4U A;  4RU9 A;  2CJ9 A;  4KTQ A;  4CYU B;  3CXC R;  1C3G A;  2BE9 B;  4NEY A;  5GAD I;  2MHN A;  3W64 A;  1RAI B;  1RQ0 A;  4F0H A;  4R25 A;  2KJW A;  3H42 A;  2BMB A;  3TA1 A;  4NCB A;  3NEK A;  2E5L J;  4B3R F;  3AOB A;  4ZN3 A;  4NLU A;  3IBW A;  1S1V A;  3QFH A;  4EBD A;  5CD4 A;  2HG4 A;  3FSI A;  1K44 A;  4G65 A;  3RR7 A;  4W4M A;  4IQX A;  2XYH B;  2BOA A;  2EG2 A;  1DBD A;  1N52 B;  3FK4 A;  2IM0 A;  2VG6 A;  2XLJ A;  2RRN A;  4I6W A;  1P27 B;  1H72 C;  1LFW A;  2Z0G A;  3QIP B;  1T95 A;  1TP7 A;  1VCT A;  1JXE A;  3M8Q A;  1Z4U A;  4ZKA A;  1NH8 A;  4A8Y A;  4OYP A;  2I5J B;  3JAM U;  3Q8R B;  3JS9 A;  3DKD A;  4U96 A;  1HQU B;  1RT1 A;  3SQO P;  2HFS A;  1T9X A;  2D3O R;  1SJQ A;  4MAK A;  4M5D A;  2YX1 A;  3Q8P B;  3TNV A;  4MYT A;  1DFD A;  3H4B A;  3CUN A;  3NAI A;  4KPC A;  2N3O A;  3HZG A;  2R7U A;  2HZA A;  2Q79 A;  3SCK E;  3THP A;  1S7I A;  4C8K A;  1RK8 A;  4OHY A;  3EPG A;  2X1F A;  4Z37 A;  2UUT A;  3KDN A;  1ELO A;  3CPW R;  2CQB A;  4MKA A;  5J2M A;  1JJC B;  2RS8 A;  4CO1 A;  3MCN A;  3VTI A;  4PKD B;  2OPQ A;  4PWD A;  5EWF A;  4H4M A;  4OYA A;  3Q24 A;  3GTY X;  2HSE B;  1I51 B;  2MKJ A;  2CG4 A;  3HSZ A;  3T6J A;  2WOM B;  2ZH1 A;  3TX0 A;  2CQG A;  2MB0 B;  2WCX A;  3TZY A;  1CC7 A;  2OTL S;  4KGV B;  2L3M A;  1BD6 A;  1NK6 A;  5HVG A;  3DM2 A;  1S6P A;  1IR0 A;  2XYG B;  3BBC A;  1K1Q A;  2OI2 A;  3GLJ A;  1GMW D;  1NK7 A;  3D28 A;  4YY3 J;  2ZH5 A;  2NPI A;  4H4O B;  5KT5 A;  2JH3 A;  2CRL A;  2QYG A;  3MZI A;  1VK8 A;  3R1L A;  2IHR 1;  1SC3 B;  1M5K C;  4TXS A;  1RHM B;  1EX8 A;  1B0P A;  1KLN A;  4JI8 J;  4OI1 A;  3CCL S;  1IKX A;  1QVF R;  2NZC A;  1I3O B;  2APO A;  4DPO A;  4DV5 F;  3FMB A;  2FQQ B;  2H5J B;  1WF0 A;  1VBY A;  4DQS A;  2BAB A;  1KQK A;  2F1F A;  2IRU A;  3MEG A;  2VD3 A;  1YJ7 A;  3NWR A;  3VQS A;  1U0H A;  2CDQ A;  1SV5 A;  3GU0 A;  3MM7 A;  3QJP A;  1LW0 A;  3KLE B;  1KLM B;  1PAU B;  3BV8 A;  3QGP A;  1VI7 A;  2CNO B;  4C11 A;  3M6W A;  4DPX A;  3ENV A;  1Q86 T;  3S6E A;  1QSY A;  4AUK A;  5IT9 Y;  4TY8 B;  3ZZT A;  1JLF B;  3V81 A;  3I31 A;  3SSS A;  1X7V A;  3H2L A;  1A9N B;  4KV8 B;  2DO4 A;  4OHV A;  1RAC B;  3W5X A;  4OI4 A;  4X4O A;  4L75 A;  4OHW A;  3KK2 B;  3KJV A;  4KH1 B;  5AE3 A;  3Q89 A;  1LOU A;  2G2Y A;  2COL A;  2ROG A;  2C3U A;  3M8P B;  4C3K A;  2PE8 A;  3I0S B;  1SJR A;  2RH3 A;  1DRZ A;  1FJE B;  2BW7 A;  2HWT A;  2YWH A;  4OYM A;  3W8G A;  1WC3 A;  2ABY A;  4DL7 A;  4CLF A;  4OI0 A;  2KT3 A;  3RUB L;  4KT0 C;  3JXO A;  2D41 A;  3LF0 A;  1T9Y A;  2MY7 A;  2MHE A;  3IS9 A;  1NSP A;  4DR5 F;  4OQJ A;  2UVV A;  4F0K A;  1VQM S;  3JYT B;  3NAH A;  4K4Y A;  4MK8 A;  4KC5 A;  3BZQ A;  1PYO B;  1TMM A;  4Z7Y A;  2CJX B;  2XCP A;  3HP6 A;  3GII A;  2DD8 S;  4ZVS B;  5A8W A;  1F9H A;  5KG6 A;  2R7W A;  1S0V A;  4HHU A;  3ZTQ A;  1FDA A;  1S1U A;  4UQT A;  3OL9 A;  3EDR B;  2RKI A;  4O4R A;  4I7F A;  2JWN A;  1S6Q B;  3MEC A;  4Q7A A;  1J27 A;  4ERD A;  1F9E B;  1JNR B;  1NKB A;  4DR2 F;  1KFD A;  1BQM B;  1BE4 A;  2CIM A;  2W2N P;  3AXM A;  4DX7 A;  4P73 A;  4MIA A;  2GHP A;  5LXY A;  2BV3 A;  1FDB A;  4A8Q A;  3BGR A;  1A6L A;  4LRE A;  2OO4 A;  2LQB A;  3OQ2 A;  1FKP B;  4E2F B;  1CQM A;  3LAL A;  1NKC A;  1S1X A;  5FDL A;  5DZ7 A;  4XDD A;  2MST A;  3LA0 A;  1RTJ B;  3KLH B;  3K7R A;  5CZX A;  1ZA1 B;  5LMU F;  2VC0 A;  4D3G A;  3BRE A;  2OEJ A;  5KT4 A;  4EZ9 A;  5AJ3 F;  5F8J A;  2BRL A;  4DFP A;  4DJB A;  2DGW A;  2K7K A;  3PR4 A;  2ADC A;  5CYM B;  4URG A;  1EAR A;  1FTC A;  4ECX A;  2JL9 A;  2RDD A;  2VIH A;  2BM1 A;  2ODX A;  4YHH J;  4XK8 C;  2HND B;  4YR3 A;  4F4A A;  2CWX A;  3DDI A;  1JXV A;  3AD8 C;  4DV1 F;  4H4K C;  3CDB A;  4BWM A;  5HBM B;  1FEE A;  3EXY A;  5KG3 A;  3I87 A;  1CLF A;  4HVZ A;  1P8G A;  5E3C A;  1LW2 B;  5DQH A;  4OHX A;  1F6T A;  1W2I A;  2BM0 A;  4JI3 F;  3M2U A;  3RB4 A;  1RAO A;  1N56 A;  4DZD A;  2XSJ A;  2JRR A;  1RWN B;  3H59 A;  2HHH J;  5KG7 A;  2HLT A;  1UVM A;  1IUJ A;  3KLF A;  3SIP B;  4DL3 A;  2RVJ A;  3D67 A;  3OTO F;  3HSD A;  4NWB A;  1HI0 P;  3A1Y G;  5KT3 A;  3CJ2 A;  2C1E B;  2EBE A;  3RRH A;  1IXK A;  2ZC3 A;  2RU9 A;  4AL6 A;  1N0U A;  2ZJQ Q;  1RAF B;  1NLK L;  4F2R A;  4F02 A;  3BEG B;  5KG5 A;  2XMK A;  2BKP A;  1CS4 B;  4RW7 B;  3OSN A;  2DNQ A;  4JV1 A;  1NK8 A;  4X4V A;  3P6Y C;  3K5O A;  2WB4 A;  3S8S A;  1A0O B;  3HFK A;  3W9I A;  2FLP A;  4F7V A;  3JB9 k;  4I4B A;  1QLN A;  2FB0 A;  3POT A;  4PRF A;  4O3O A;  1GK8 A;  3U27 A;  3OTB A;  3UI3 A;  2BOP A;  5KFJ A;  2MY8 A;  1FO1 A;  2B9W A;  1KQF B;  4M94 A;  3QFW A;  4EWT A;  3NS7 B;  1Y3K A;  3MMB B;  4W98 A;  3D2W A;  4QWA A;  4U7U D;  1T9W A;  3GSD A;  3PVX A;  1Q8I A;  1LWC A;  3PHE A;  3AOD A;  4TLR A;  3MAQ A;  1GMV A;  5IWA J;  2SXL A;  3KJF B;  5LM7 E;  3PIP Q;  3KG0 A;  1YJV A;  4PG7 A;  4K5S A;  4CZC A;  3K57 A;  1WHV A;  4ZHR B;  3RYL A;  3BJY A;  3T1Y F;  1WG5 A;  1WOP A;  1IVZ A;  4UOF A;  2WVE A;  1T9T A;  4P2X A;  2FHJ D;  3TAN A;  2FYX A;  3CIZ A;  3DN9 A;  4CLY A;  4AT1 B;  2AZ1 A;  1M0S A;  3MPU B;  2MJU A;  4LFB F;  5F8I A;  5D8H B;  4M5I A;  3C66 A;  1U2C A;  3E3X A;  5KFL A;  1SL0 A;  4KGM A;  4WK3 A;  3KG4 A;  4F8R A;  3GG0 A;  4P2M A;  4FNH A;  3VVU A;  1AFJ A;  1BQN A;  3ELH A;  3HFV A;  3MED B;  2CPH A;  2CAD A;  3HMJ G;  1U1N A;  2F4V J;  1S0M A;  1S99 A;  1KNZ A;  1NH7 A;  2HQD A;  2MQN A;  3QAT A;  5FJ4 A;  2YKQ A;  5DJB A;  3W9H A;  3BO2 A;  2V2K A;  1RAJ A;  1T05 B;  2MQ8 A;  3E51 A;  1IBL J;  4IDK B;  2LYV A;  3BSO A;  4NCA A;  2JVO A;  1FI4 A;  3JQM A;  2ZBQ A;  4DX8 H;  3VAL A;  2P6S A;  3PV8 A;  2VDI A;  2B0G A;  1HLW A;  4J5O A;  3NCQ A;  5THW A;  4JI2 F;  2W2O P;  5C5J A;  4DV6 J;  1H2U X;  2FGO A;  4WBF A;  5D4L A;  4YB6 A;  3D66 A;  5C2C A;  1Y10 A;  2VB6 A;  5E2Q A;  4GKJ J;  2BAN B;  4M1K A;  2CQ2 A;  3GYN A;  2BJ7 A;  2RQK A;  3ADA C;  2D9P A;  5E41 A;  2EFO A;  3KNG A;  4DBQ A;  5HO4 A;  5L39 A;  3K5M A;  2E1C A;  2V63 A;  2PSZ A;  2MQO A;  3NLC A;  1IKW A;  2D69 A;  3WIV A;  5F8G A;  1SIW B;  3MUT P;  3G71 S;  2GHW A;  3ET6 B;  2R7X A;  2B6A A;  3GFY A;  1KFS A;  2P9E A;  4H4K A;  1PC4 A;  3M8W A;  1FE4 A;  1G3O A;  2DH7 A;  1H7W A;  3GZ7 A;  4Z2X A;  1H73 A;  1Q8L A;  2ZDP A;  2B4U A;  1NK5 A;  3UDV A;  4OI6 A;  3TZW A;  3Q0A A;  1NM2 A;  1T3N A;  2POK A;  5KT2 A;  3CF5 Q;  2R8J A;  3GP9 A;  2X3D A;  3RB3 A;  3G9C A;  1C0U A;  1BXN A;  1QE1 A;  1HYS B;  3CC2 S;  3Q8Y A;  4BC7 A;  2RUS A;  4YUD A;  2AZ3 A;  2XGP A;  3OHA A;  2DEI A;  3PYF A;  2LEA A;  1C2P A;  2YNG A;  3MM5 B;  1WTB A;  5KFN A;  3C46 A;  3NGS A;  4NL5 A;  2HS4 A;  3N6N A;  2GVZ B;  2CPD A;  2Z8Q A;  3KUH A;  2Z58 B;  1X4E A;  1RLC L;  3M05 A;  2CQP A;  4X4Q A;  3AOA A;  1KQS R;  4DS5 A;  2V2V A;  3QJJ A;  2VPW B;  2VDH A;  2J0W A;  2CJY B;  1WKJ A;  2C2K B;  2GMJ A;  1FFW B;  2HHQ A;  2AYB A;  1HWU A;  2FHK A;  4TN2 A;  2UUW A;  4NLG A;  4IFY A;  3ZZU A;  5I3Q A;  3UDC A;  2UP1 A;  1QUV A;  1DQ9 A;  4WK1 A;  1VRT A;  4USK A;  2KRB A;  2F3J A;  5G0R A;  2EW9 A;  4MTP A;  3M7V A;  2NQP A;  1B7F A;  2VF3 A;  3N5B A;  5KFE A;  3MUR P;  3OJU A;  2GIQ A;  3M9M B;  3VAG A;  3QT6 A;  3RBX A;  3V6H A;  4DN0 A;  4USH A;  3AKO B;  4NYP A;  3VAH A;  2BKN A;  3QID A;  1UMJ A;  3TO8 A;  2ZBP A;  1ZET A;  3MCM A;  3I56 S;  1RT7 A;  1TFY A;  3ENQ A;  3FC9 A;  3RB0 A;  3J81 j;  2ASL A;  3TUI C;  3AB2 B;  1U0S A;  2H65 B;  1O8B A;  5HL7 Q;  1FRH A;  2FC8 A;  3GQC A;  1FF2 A;  3LUY A;  4P7T A;  5KFR A;  3R5C A;  3LZ8 A;  1R6Y A;  1ZA2 B;  4FPR A;  4PG8 A;  2OTJ S;  2BAC A;  2RJZ A;  4X62 J;  5KFK A;  1JMT A;  2FIU A;  5K8P A;  1EIY B;  1XR7 A;  4PXD A;  2CVE A;  5DET A;  2AT1 B;  4EFA C;  1N5V A;  4HYK A;  4RW6 B;  4QU7 A;  4GKK J;  1H38 A;  4R0E A;  3R7N B;  2XMW A;  3IWL A;  4RR5 A;  1REV A;  3M9N B;  4TKT A;  1IJF B;  3R9L A;  2BZ2 A;  5CZV A;  2AYE A;  4LSN A;  2YNF A;  4PUO B;  1KKH A;  1TKT A;  3J81 Y;  2PMW A;  3MPW A;  3FCH A;  4OZ5 A;  3MMJ A;  5D15 A;  4JB8 B;  4U8V A;  3UD5 A;  1VFJ A;  3FSY A;  4ZP9 A;  2V50 A;  1GQE A;  1D8Z A;  4RUB A;  3A13 A;  1GMW A;  2B8P A;  1Q79 A;  4HR2 A;  4ED8 A;  4DL5 A;  3HVT B;  4ATN A;  2YKN B;  1GX5 A;  2QYC A;  2RF2 A;  1NXI A;  1NDL A;  3EGW B;  1VLO A;  5J2P B;  1KC8 T;  3EGZ A;  1HHT P;  4NA1 A;  3UD3 P;  3K17 A;  1TAQ A;  3M30 B;  1QY7 A;  2HNZ B;  2A2D A;  3O44 A;  4NI2 B;  4JI4 J;  3QGG A;  4DLE A;  3TW0 A;  1RDR A;  3F56 A;  4ZCM A;  3AQP A;  2GQQ A;  1Y5L B;  1HR0 J;  1X9M A;  5DG7 A;  1DTQ B;  1U6B A;  4EZ6 A;  2D1C A;  4YB1 P;  4CCH A;  5J2N A;  1WTF A;  2YWG A;  4UY8 T;  2IYG A;  3CJ8 A;  2LQ5 A;  1TK8 A;  1WF2 A;  1PBU A;  2VBW A;  3ISZ A;  1OSD A;  1JJ4 A;  2JFD A;  1W2B R;  1O6X A;  1JKH B;  3M1V B;  5AT1 B;  2OJ3 A;  1YG0 A;  1T9V A;  2EK1 A;  2DIS A;  2ZH4 A;  2GZO A;  3KMQ A;  2UV8 G;  4FYV B;  2UUB F;  3HM9 A;  1OQ6 A;  1AUD A;  4H54 A;  2ATL A;  1OPI A;  3DRP A;  2JHE A;  2EKN A;  5A8K A;  3OVB A;  2VJV A;  5D0R A;  4FYW B;  2W24 A;  2MLX A;  3UDL A;  4DUY F;  3W8P A;  2V2Q A;  1RHQ B;  4JI0 F;  4C8Y A;  2IJF A;  2DPJ A;  4USJ C;  2DHH A;  2P5V A;  1J5O B;  2N4C A;  2QN6 B;  2HFO A;  3KUG A;  4QW9 A;  1KP6 A;  4ELU A;  1VQO S;  3OFG A;  2DRA A;  1OYE A;  4P71 A;  2DB1 A;  5AXL A;  3FBE A;  3IXQ A;  3HUL A;  2CJK A;  4LBI A;  1U1P A;  1OWX A;  2NRE A;  2DHX A;  1JQG A;  1WHW A;  3LP1 B;  4J9N A;  1R31 A;  3MD3 A;  3RJM B;  4DV2 J;  2IM2 A;  1M90 T;  1WF1 A;  4C3M A;  4HH1 A;  2UUC F;  5KFI A;  2ZZN A;  4J90 A;  2X3G A;  2B51 A;  1NCL A;  4LRB A;  4OZ2 A;  2UXB F;  3QIP A;  2JLE A;  4Y34 A;  3LTO A;  1MMD A;  2DRB A;  2NPF A;  1VBZ A;  2HQ3 A;  2H54 B;  3EDQ B;  3VAM A;  1TKX A;  4LR9 A;  2ASY A;  5E3P A;  5HAT A;  1RHJ B;  2AX1 A;  4MIB A;  2J5A A;  2NXJ A;  2XSF A;  4ID5 B;  1IKV A;  3TAQ A;  2I5J A;  5DLG A;  1SJ1 A;  4LF7 J;  2O5D A;  2HHS A;  3NXZ A;  4JI6 F;  2AEF A;  2W9A A;  1X4A A;  2G0C A;  1N5Y B;  2AEJ A;  2EFG A;  2BA9 A;  3MI7 X;  1C4C A;  4KHM A;  2RT3 A;  3M8Z A;  1FWK A;  1X8D A;  3P5T L;  1WAC A;  1RB0 A;  2KG0 A;  2ZM6 F;  4ILL A;  3IR7 B;  1X0F A;  3ZFV A;  2HQI A;  1S49 A;  2FGC A;  2NSB A;  1TKD A;  2H4Y B;  2CNK B;  3DXS X;  1IJE B;  4URQ U;  1SH3 A;  5H9F J;  1JIH A;  3O1L A;  2LA4 A;  3M4X A;  4Y28 C;  3FZB A;  3VGU A;  2NZ4 A;  4CLP A;  4C8L A;  1X4D A;  4G1Q B;  1N5Q A;  4J9P A;  2KFN A;  4K4T A;  5KAK A;  2HMI B;  1G4C A;  3OPK A;  3ETM A;  3CCW A;  4W92 B;  1S59 A;  2I8E A;  1FXD A;  2YNI B;  3V2U C;  2JSX A;  4YDD B;  2CVI A;  2QA2 A;  5BYQ A;  2RQM A;  4Q44 A;  5E33 A;  1RKJ A;  1M5O C;  2LXI A;  2UU9 J;  2B4P A;  2HPU A;  3WHI A;  5L1I A;  2GVD B;  3OTE A;  3MUM P;  1RTH B;  4RLE A;  3RZA A;  1NSK L;  1HW8 A;  4H4O A;  4U67 Q;  4DCO B;  2QLW A;  1BLU A;  2J0X A;  5HAO A;  2HGN A;  3LW5 C;  2ZE2 A;  1PJ6 A;  3EZO A;  1CVJ A;  1TR0 A;  4E98 A;  1LEO A;  2AYG A;  3MTK A;  2I0X A;  1ZZF A;  4YR2 A;  4ES3 A;  1OY9 A;  4B3M J;  5CHC B;  5A6W A;  5DLF A;  3DOM B;  2HRT A;  3QBC A;  2FLN A;  1VRU B;  4B02 A;  3BGO P;  4OZN A;  4ICL B;  3M6X A;  2RQ4 A;  3DLL Q;  3M2V B;  2MTL A;  4HDH A;  3PCO B;  3G8Q A;  2OD6 A;  2W01 A;  3M8Y A;  4FS1 A;  3OTD A;  4P75 A;  4IR1 A;  1KLM A;  3KWM A;  5DG8 A;  2UXD F;  3DGV A;  4AND A;  3GV8 B;  3BM7 A;  2L08 A;  4CLZ A;  4LQ9 A;  4OX8 A;  1ZM3 A;  1LV5 A;  4TY8 A;  4OYB A;  1UWA A;  1JLF A;  2Y3Y A;  4JOU A;  3MR2 A;  2XHW A;  1XN9 A;  3CCZ A;  3GFZ A;  1S9E B;  4DPW A;  2NUU G;  2EWH A;  1GEH A;  4OZJ A;  4FXD A;  2DPI A;  2KKH A;  4FBT A;  4PYD A;  1HBO B;  1FHT A;  3J7A N;  1U25 A;  4UOG A;  1KBR A;  1HD0 A;  4HLB A;  5DDO C;  4J9R A;  2Z30 B;  1ARO P;  1KS2 A;  2KO1 A;  3FEX B;  2K1R B;  3FVY A;  1F2G A;  3I0S A;  1SH2 A;  4UTG A;  1GX6 A;  1HNZ F;  2RHS B;  3AQO A;  3LPE A;  2E9Z A;  4B3R J;  1W25 A;  2LMI A;  4TVA B;  1YGY A;  2M0G B;  5B0A A;  3CNQ P;  2R2U A;  2VOP A;  2VBZ A;  3NNC A;  4ER8 A;  4MK9 A;  2V4R A;  4DR4 J;  3N01 A;  3ILI A;  2FHJ A;  2MMY A;  3K5P A;  3LP0 B;  1NJW A;  3H5S A;  1RLD A;  3EM1 A;  3JYT A;  1N8R T;  2W25 A;  3UDE A;  3R5J B;  1H6K X;  2XMU A;  4ZVP B;  2VG5 B;  1NHU A;  4IH7 A;  2N3L A;  1LQ9 A;  3JAM Y;  3FBB A;  1ZPW X;  3DOK B;  2HZV A;  5HRO A;  2MGZ B;  4RUC A;  1QAI A;  3T1H F;  1Z1Z A;  3EMT A;  4LRF A;  2CKW A;  1S57 A;  2RQC A;  3DHW C;  5I42 B;  2N4D A;  2WVB A;  4BWJ A;  5A0Y A;  1YIT S;  4LF9 F;  4KGZ B;  4JI1 J;  4USI A;  2VQE F;  4G3I A;  1S6Q A;  3D0G E;  4FXW A;  2Q1L A;  4J9M A;  2DT9 A;  4DR6 F;  1R8A A;  4U7C A;  2QMU B;  5KOX A;  2VQF J;  4NZ6 A;  2DHA A;  4FKY A;  2EKY A;  4GC7 A;  1YK9 A;  3M8R A;  4PAA A;  5BXI A;  1XK8 A;  4NLQ A;  1BGX T;  3CCM S;  3MMC A;  4MYU A;  4JI5 J;  3ILL A;  3KFW X;  1HKA A;  4ZLL A;  2ALZ A;  1N34 J;  1FKP A;  1SJF A;  1UA1 A;  1VQS A;  2U2F A;  1U6F A;  3CGI A;  3PYD A;  1W26 A;  2FJD B;  1JJH A;  1RTJ A;  4FN5 A;  3KLH A;  2XLK A;  4JV0 A;  2VL1 A;  3T19 A;  2RDI A;  3OTC A;  2HHP A;  1NJY A;  2MEW A;  2YX4 A;  2ZH7 A;  3TOQ A;  1HHQ A;  1KVI A;  2R7R A;  2WBM A;  3VGT A;  4PXC A;  3RW7 A;  1N48 A;  1P1L A;  1Q81 T;  3F0N A;  1FFS B;  2HND A;  3C16 B;  5KFZ A;  5HQM A;  3BN7 A;  2H5I B;  1JX4 A;  2DR7 A;  1RA6 A;  2ZH3 A;  1M5H A;  5HBM A;  1M1H A;  4RUH A;  1HQ2 A;  2YXL A;  1U2R A;  1TKZ B;  1F5C A;  3Q8V A;  3UN3 A;  4RWX A;  4TYB A;  5B0C A;  1S0O A;  1ZM2 A;  2JFK A;  2CZV C;  1GNK A;  4BS2 A;  4QYZ J;  4FVC A;  4ZLP A;  3UCU P;  3L7U A;  4FKX A;  2LQ9 A;  2GX8 A;  2XYP B;  2LP4 A;  2YKM B;  5KFD A;  1RAG B;  2LU1 A;  4ZP7 A;  4CO3 A;  3MAH A;  1QTM A;  1DQA A;  4XAK A;  3KLV A;  1G6B A;  3QJL A;  2E1P A;  4X66 F;  2HWI A;  4B08 A;  3U1M A;  3T5J A;  2F8E X;  3TZX A;  3NS5 A;  5IQQ A;  2M5Y A;  5GME A;  3Q8S B;  4LF8 F;  1U49 A;  2GO9 A;  4O4G B;  1VK3 A;  3P3D A;  1NK4 A;  2ZD1 A;  2UVW A;  4ILM A;  4CLU A;  3G6X A;  3CD0 A;  2K06 A;  4KO0 B;  1IBC B;  2HWH A;  1CS4 A;  1V9O A;  2HGL A;  2NCK L;  2XS2 A;  4RW7 A;  1R7I A;  2ASJ A;  5BR8 F;  2HNY B;  3NRB A;  2VFU A;  3IGN A;  2MQP A;  4DDF A;  2V94 A;  4C9D A;  5AE2 A;  2C2D A;  1YTY A;  3ENA A;  2YPY A;  1R6V A;  4C8O A;  2DEJ A;  3NL0 A;  3TEG A;  3KJN B;  2Z57 B;  2GS8 A;  1ZM4 A;  4QWD A;  1N36 J;  1RT4 A;  4FVM A;  4I2Q B;  1EKS A;  3MMB A;  4WFY A;  1X31 C;  2NSC A;  3M9O B;  3BQ2 A;  4WKR A;  4UT4 A;  5KFF A;  3MGJ A;  2DNY A;  2FVP A;  3UPF A;  5EDW A;  4CM0 A;  5ITH A;  2G1H A;  4MH8 A;  2XLI A;  4TLQ A;  3CJQ A;  2W4C A;  4NLV A;  3OHB A;  3IM8 A;  2AKW B;  4J91 A;  5HMX A;  1SKR A;  3I0R B;  4ZHR A;  3BN4 A;  2JC1 A;  4LF6 F;  1SCJ B;  2CZ9 A;  3OFH A;  4CTA B;  1V3Z A;  1MWY A;  2G9O A;  1T3O A;  4V1A k;  4V19 X;  3CMA S;  2CYY A;  1HA1 A;  4A8F A;  2DGT A;  3G8S A;  1IM4 A;  3PR5 B;  3MM8 A;  1LWE B;  4TU9 A;  3S1T A;  3X3U A;  3H98 A;  4ZVF A;  3NBP B;  5IC4 B;  4YME A;  1TVR B;  4IG3 B;  1PBA A;  3PZP A;  4LRA A;  1S1W B;  3VVT A;  2NXE A;  4TQR A;  2FJX A;  4F4X A;  3KDO A;  5G4D A;  2HBQ B;  4EYH B;  5T41 A;  4ECW A;  3HCX A;  5H9E K;  4OFZ A;  3LO3 A;  3P45 B;  4DLG A;  4QIG A;  3BS9 A;  2GQC A;  4I56 A;  3K58 A;  1ZM9 A;  1FWL A;  3DDK A;  3IO1 A;  3MED A;  1FKA F;  1Q8B A;  3BR8 A;  3DGP A;  3N9U C;  3EJM A;  2J7W A;  3ONQ A;  4KY3 A;  4KHP J;  4OZ3 A;  1FTR A;  5DDQ C;  3SQG A;  4D3H A;  3TAM B;  2KM8 B;  3MM6 B;  3IAS 9;  3KOA A;  3O2I A;  4DR2 J;  3V4M A;  3R97 A;  1FKO B;  1T05 A;  3H5X A;  4O44 B;  1Q16 B;  4IDK A;  2A1B A;  3HKZ D;  5E3R A;  3W5Z A;  2FJB B;  2E5L F;  2V6A A;  1E6Y A;  4UOH A;  3MCS A;  1HQE A;  3L09 A;  1U8W A;  5AXM A;  4CO4 A;  4DSL A;  1NDC A;  3UNG C;  3T5K A;  2GAH C;  3E2E A;  2QLB B;  1DY3 A;  1YZ6 A;  2BAN A;  3CC7 S;  1P1T A;  4Y6I A;  1RT2 A;  1EAY C;  3WBZ A;  5CCM A;  2B3T B;  4KHR A;  4YR0 A;  3JSM B;  3J7Z T;  4AQY J;  3W65 A;  2DGO A;  4X4P A;  4CLS A;  3BQ1 A;  2DBB A;  2XZW A;  4P7V A;  2W4P A;  3R5A A;  4RPF A;  2BJ9 A;  3ET6 A;  3PRD A;  4DR1 F;  5F8M A;  3N79 A;  3NGT A;  2FHO B;  4DV1 J;  2GFF A;  3A12 A;  1FFG B;  1UZD A;  4C3L A;  3AY0 A;  3JTP A;  2PI4 A;  2OPS B;  3FUY A;  3CMQ A;  1KHV A;  2AEM A;  3DLJ A;  2ZBI A;  3DRS B;  3CDW A;  4MIW A;  4I64 A;  5IT4 A;  1EET B;  3CJR A;  4A8O A;  3GFX A;  3MM5 A;  2G1D A;  3S01 A;  1WKL A;  4CNZ A;  3CWJ A;  5CYJ A;  4IFV B;  4X65 J;  2CPX A;  3EVM A;  3UD4 P;  2GVZ A;  1VBX A;  4OZ1 A;  2LEC A;  2M2B A;  3OR2 B;  4CO5 A;  1X4G A;  1KTV A;  1CC8 A;  2RE1 A;  3HSJ A;  3KMS A;  2WON A;  1Q5Y A;  4YDX A;  1EJ7 L;  4LQ3 A;  4KRW A;  3IWN C;  2ZH8 A;  3ZTR A;  2JZ5 A;  3U7J A;  3EVW A;  2OEM A;  3QSY B;  1RT6 A;  4R5P B;  2WRM A;  3L4B C;  2PII A;  4DQP A;  3IRX B;  5F8N A;  2UVR A;  1XNQ J;  3A3O B;  3QYY A;  3MD1 A;  3T9Z A;  4DV0 J;  2AWZ A;  2DKO B;  1DLO B;  3BDP A;  5C24 B;  3QO9 A;  5MLC V;  3NMA A;  1B0V A;  4RW4 B;  1HNV B;  3LAK A;  2BE2 B;  1QSL A;  2PMZ D;  4UQG A;  5A8R B;  4PG4 A;  2YWE A;  1I1G A;  3ZZR A;  4IH5 A;  5DDR C;  2QIF A;  2D7S A;  2JC0 A;  3OW2 R;  3S7R A;  4JI8 F;  1IQZ A;  3VAF A;  4AXJ A;  4XDC A;  4ZVQ B;  1B64 A;  5M2R A;  4WXO A;  1N88 A;  4RU2 A;  2PO4 A;  4KH0 B;  5LT5 A;  4NLX A;  1FES A;  2K2P A;  3P96 A;  2CJA A;  5C2G A;  3AT1 B;  2WB1 D;  3CJT A;  3HX9 A;  1F3V A;  3SI8 A;  2OEL A;  4DG1 B;  2C3P A;  2WAQ D;  2E29 A;  4LFB J;  4RW6 A;  5E7O B;  5EWG A;  2BJD A;  2KZM A;  2MZQ A;  3BGL A;  3G86 A;  4QIW D;  3HK2 A;  1VMB A;  2L48 A;  1UWB A;  2J8A A;  2XMA A;  1LFP A;  1MML A;  3CCT A;  4Y65 A;  1VQ5 S;  3A8J A;  2C2O B;  2X51 A;  3VF0 B;  2AF6 A;  5B0E A;  2VKZ G;  4N8N A;  3MR5 A;  1UEV A;  4NRT A;  3HI9 A;  4HAC B;  1NDK A;  4WU3 A;  5CYQ B;  3VHQ A;  4ZN1 A;  3HVT A;  4QIF A;  2ZUA A;  5DQI A;  1WEX A;  4U8Y A;  3Q83 A;  3VGS A;  1ZS6 A;  5J2P A;  1SXL A;  5SZT A;  2JDJ A;  1VS3 A;  2RML A;  2YTC A;  4QW8 A;  1BWE A;  3QNW B;  1X5T A;  3M30 A;  4K4W A;  4OX7 A;  4PXE A;  3CW2 C;  3OR1 B;  1WSV A;  1E6V B;  2IBK A;  2F9J A;  2J6S A;  1SBR A;  1JLG B;  4UZC A;  4NXM J;  3C15 B;  1PGZ A;  1MG7 A;  1DTT B;  1TL3 B;  4R8U B;  2AHO B;  3EIC A;  4WWS A;  1DTQ A;  3QGI A;  4RWW A;  2W2M P;  4NLR A;  4A8K A;  2QX0 A;  4C0B A;  3KHR A;  1IQT A;  1S5Z A;  2CA9 A;  2IMO A;  4ILR A;  4ZPD A;  5DRK A;  5D77 A;  3I6P A;  5DGB A;  2GGP B;  2VG6 B;  4PAB A;  1JKH A;  3M1V A;  2KXH A;  1PIL A;  4EEY A;  3G4S S;  1YWX A;  4KB7 A;  3WX4 A;  1GAO A;  2ZJP Q;  1U7L A;  3Q8U A;  2LDI A;  4EBC A;  1HHS A;  3O3L A;  5CA5 A;  2IBO A;  4Y2I A;  2F9D A;  3CJK A;  2UZA A;  3C14 B;  2ILZ A;  4PCQ A;  3FBF A;  1CPZ A;  1T02 A;  3TA0 A;  3DFE A;  5KFS A;  3GE9 A;  1SQF A;  2XEX A;  5IV4 A;  4AL5 A;  4DV4 J;  4L73 A;  1WEL A;  2ACM A;  2BVZ A;  3G2X A;  1J5O A;  1HBU B;  3ICL A;  2CNN B;  2HUR A;  4ZPB A;  5F9N A;  1N5S A;  1M1K T;  4OJH A;  2P9G A;  4OL8 A;  3PYG A;  3M32 B;  2BR0 A;  3RTV A;  2F5G A;  5CXT A;  1NB7 A;  2WSF C;  4QQB A;  4NOH A;  2ROP A;  4CWB A;  5HQL A;  2OPR B;  3MCO A;  3AOC A;  4ZP6 A;  3HD1 A;  2KH9 A;  4WP3 A;  1XIQ A;  4E8U A;  3FRY A;  4J9L A;  4RNH A;  1RT5 A;  2DXE A;  1B4S A;  3I5C A;  4KPY A;  4O3P A;  4RW8 B;  2XI2 A;  3D9B A;  4MKY A;  2OPQ B;  2HBY B;  1S97 A;  1FEH A;  2VOO A;  3PDN A;  4NRU A;  3DLB A;  1FRI A;  2YKA A;  3QLH B;  4JYA F;  4H4M B;  8AT1 B;  4DUZ J;  4YN3 B;  3A3N B;  2AMC B;  2J76 E;  4FYY B;  1UVN A;  3PEH A;  4ID5 A;  2LCW A;  3WDO A;  1H98 A;  2ZKT A;  2VHG A;  1FDD A;  3BPS P;  1T9U A;  2ZH6 A;  5HJX A;  3H0P A;  2KHD A;  1F0X A;  3DLE B;  4OV6 A;  3EZU A;  3W5Y A;  4RBV A;  3FGV A;  4PYA A;  1RWX B;  1N5Y A;  2EFV A;  1KHW A;  3CIM A;  5FD1 A;  2R7T A;  5DDP C;  4J9V A;  2RAQ A;  3D0I E;  3GIM A;  1WKK A;  4MKB A;  3SXL A;  3V4I B;  2Y8W A;  1S10 A;  1L3K A;  5I3U B;  1PYT A;  1SL2 A;  1ZYQ A;  1KTQ A;  4CH0 S;  4UOC A;  2IAJ B;  5KFX A;  4C0O C;  1SKS A;  1RWK B;  5CH7 B;  1UCN A;  5B08 A;  2AGP A;  2FJE B;  5KFW A;  3L9Z A;  4EO8 A;  4CT8 A;  1YX2 A;  4LF5 J;  1D09 B;  4RL1 A;  1V6H A;  4IH6 A;  5ETS A;  4CIO A;  4XIU A;  3L3C A;  2JNJ A;  4DWI A;  3IRW P;  2P8I A;  1FRK A;  3LPY A;  2QSW A;  2QO3 A;  3J7Y I;  2AJQ A;  4B9T A;  1C4A A;  4G1Q A;  5GAE U;  1LK7 A;  1ZAW A;  4KR0 B;  3VZI A;  4K5R A;  2HMI A;  3D4J A;  1FX4 A;  4B3O B;  2C3M A;  4ZIW A;  2YNI A;  1UEU A;  2KU7 A;  5ADZ A;  1D9D A;  4P74 A;  2EXU A;  3PIO Q;  3W1Y C;  1I94 J;  2AV5 A;  4JBC A;  2FZG B;  1GXT A;  3ZZZ A;  3MPV A;  1RHK B;  3DNC A;  1GTH A;  2UUA J;  3KUE A;  3O6Q A;  1HNI B;  2YKP A;  1ICE B;  3V81 B;  2GVD A;  1RTH A;  3K59 A;  1OJ4 A;  3SSR A;  1CEZ A;  1PCA A;  3SCL E;  3KHL A;  1M5S A;  1VQY A;  1D1U A;  1SC1 B;  2VPX B;  1JJ2 R;  1VOM A;  4FF2 A;  3KJV B;  1XR5 A;  1YJ9 S;  2CPI A;  3CDE A;  2F7V A;  4O0I A;  1S72 S;  1OY6 A;  1HBM B;  5HMZ A;  2ZKU A;  5A6P A;  1S6U A;  5KFQ A;  5B0D A;  1PC5 A;  1HWK A;  3JQK A;  2Z2M A;  3DOM A;  2Z2L A;  5IWA F;  1VRU A;  2ZFH A;  3HT3 A;  1AA1 B;  2DGV A;  4Q5V A;  2K3K A;  1FNX H;  3I5A A;  2E7V A;  4ICL A;  3QT8 A;  1NSQ A;  3M2V A;  3HD2 A;  3EVO A;  2DGX A;  1D3W A;  2DHG A;  2IMW P;  1WC5 A;  1HNX J;  4C8Z A;  4L76 A;  4KIA A;  2F8H A;  1UJ4 A;  3W60 A;  3AGY A;  2MXY A;  3BB5 A;  4K4Z A;  3OBI A;  2VV5 A;  4A8X A;  1VHF A;  2DNN A;  4DPY A;  3SFU A;  2JVM A;  2YX7 A;  2XBP A;  2E1R A;  2MZS A;  4WZM A;  3BH6 B;  1Q53 A;  2UUB J;  2HEK A;  3W66 A;  2MZJ A;  1JLQ B;  1U02 A;  3AGX A;  2VOD A;  4U9R A;  4Y00 A;  4CRJ A;  5A76 A;  2CXE A;  4K0K F;  1FCA A;  2IJR A;  3AA8 A;  3G8T A;  2KVQ E;  1HBO A;  9ATC B;  2FZK B;  3NS6 A;  3C5X C;  2YKO A;  4CQ1 A;  2GV1 A;  1RWO B;  1LK5 A;  4O3N A;  4JI0 J;  2HRU A;  2F4V F;  2BQU A;  2PGC A;  4P2S A;  4OV1 A;  1U1K A;  2E5J A;  2K1R A;  4K4X A;  4HHH A;  2G4B A;  2ZNZ A;  2O66 A;  1T0T V;  5ETR A;  1HWL A;  3ILO A;  3LOU A;  2RB7 A;  4JI7 F;  3SZ2 A;  4IOC Q;  2GMH A;  5F9L A;  1ZAX A;  4DV6 F;  3ZC4 A;  1R8P A;  1NAQ A;  3GJR B;  4QPX A;  4HHJ A;  1TL7 B;  1S1X B;  3PKM A;  2CPY A;  4NLP A;  5LXR A;  1DZ5 A;  4P52 A;  3HJV A;  4RNO A;  3P4U B;  2CPE A;  3DXB A;  3G82 B;  1FT8 A;  2BJE A;  2VG5 A;  2FVC A;  2KXN B;  3KYL A;  1VQ8 S;  3K89 A;  4PQU B;  3B4D A;  3HKW A;  3MUV P;  2OSQ A;  2MGZ A;  1Q7Y T;  2LQ8 A;  2B5J B;  4C8N A;  5K8O A;  2GJI A;  1IN0 A;  4CT9 A;  4NPO A;  3ZTO A;  4JI6 J;  2WVC A;  2DCU B;  1S76 D;  4DR3 J;  4Q0B A;  2HIY A;  2XMM A;  3T1A A;  1N54 B;  2KM8 C;  1WOO A;  2BW2 A;  4QJV A;  1OO0 B;  1J2V A;  4ZVU B;  1K0V A;  4NLD A;  1NJX A;  4KYZ A;  2MZT A;  4ZCL A;  1FD8 A;  3EXC X;  2M8D B;  1XMO J;  3MXH P;  1V5V A;  4CDI A;  1RAA B;  4DOZ A;  3I4H X;  3VGV A;  3BYP A;  4WYW A;  2ZM6 J;  1FRL A;  4JV5 J;  2M8H A;  3QWU A;  1YDL A;  4C7Q A;  3A8E A;  2JX2 A;  3RU0 A;  4DF8 A;  4Y2C A;  2ZEJ A;  1CJT A;  1P9Y A;  3B54 A;  2KB2 A;  3PW4 A;  2XMV A;  5ETK A;  1ACM B;  4X64 F;  2Y8Y A;  2BE7 D;  4KGK A;  4LSZ B;  1YKW A;  1WDT A;  1KN6 A;  1Q78 A;  2O1P A;  3G6E S;  5F41 A;  3MMA B;  3C16 A;  2ZOG A;  4NML A;  2VC1 A;  4WTY A;  2QFJ A;  2XB2 D;  3I82 A;  4XPC A;  4DL2 A;  1NRK A;  1TKZ A;  2VFV A;  4ZIV A;  2HHT A;  2YH1 A;  2RSQ A;  2V69 A;  3E01 B;  2KHC A;  3UE2 A;  3CJ3 A;  5L9N A;  2R7S A;  2ZUG A;  2HKE A;  3QAU A;  3DYA B;  3MPD A;  2DXF A;  2V8G A;  1RAE B;  2AJF E;  5GAE I;  4IOA Q;  1CBK A;  1SH0 A;  3R5B A;  2AYM A;  2E7X A;  3UO0 A;  4DQI A;  3GG1 A;  2ADB A;  2E9T A;  2KL8 A;  1NND A;  2VA2 A;  2B8Q A;  5KG4 A;  2HYI B;  4TY9 A;  1U26 A;  3FEY B;  3TZZ A;  3MEK A;  4J9K A;  4GMK A;  4ZCI A;  2XY6 A;  2VA3 A;  1SPB P;  2QTW A;  4O4G A;  3KG1 A;  3MR6 A;  3LAN A;  3VQT A;  2DO0 A;  2RRA A;  1T03 B;  5B0F A;  3W2W B;  4F3M A;  2IJN A;  2OFH X;  4G6V B;  4MKV A;  3THV A;  2HNY A;  2UXD J;  2R7V A;  4I68 A;  4MT1 A;  4URS A;  4ANC A;  4ED7 A;  4HTI A;  1HMV B;  3A8K A;  1GXU A;  2MSS A;  3CCJ S;  1QD1 A;  2ZWP A;  3OFE A;  1RWU A;  2XWY A;  1OQ3 A;  1JWW A;  2QC3 A;  4WF9 Q;  1YSJ A;  5B0B A;  3E8O A;  4I2Q A;  3AJ2 A;  5F0W A;  1WI6 A;  2DR6 A;  2Z2Z A;  3PW0 A;  3AHP A;  4ECU A;  3FBC A;  1O5J A;  1HAR A;  1CQN A;  1HNZ J;  3O8W A;  4CNY A;  1FRX A;  3JSY A;  1URR A;  5KOW A;  4ED1 A;  1UTA A;  3OXF A;  2CPZ A;  4B3S J;  3Q2T C;  3KXD A;  4N41 A;  4CTA A;  2W8K A;  2MQM A;  3UR3 C;  1VYA A;  2HVZ A;  3N4W A;  1SB6 A;  2DR9 A;  3RGI A;  5BYS A;  3N6M A;  4QR2 A;  3PX0 A;  3MFI A;  3FEZ A;  4ZP8 A;  2FJW A;  4PWU A;  4DR7 J;  2Y0S D;  4P2F A;  3PY8 A;  1EHW A;  4IRK A;  4EGL A;  3VAK A;  2K8G A;  1T94 A;  2Y1I A;  3OT9 A;  4ZVO B;  3HDS A;  1S1W A;  1XJW B;  2FVS A;  3U02 A;  3KTQ A;  1RYR A;  3KK3 B;  1J5E J;  1U47 A;  5KFA A;  2F63 A;  1AW0 A;  1ZTT A;  3PFO A;  4A46 A;  5D0E A;  4ZPC A;  4RZR A;  2A6O A;  4DU7 A;  4U6P A;  3GJT B;  5HJY A;  1P9Q C;  5KFG A;  1MN7 A;  1RWP B;  4LF9 J;  2PDA A;  2VQE J;  5AXN A;  1JLE B;  2XUL A;  1YQH A;  3V6J A;  3TAM A;  1XNR F;  3DDN A;  3MM6 A;  4DR6 J;  4LVN P;  2DRD A;  3KNA A;  3I5B A;  2VFR A;  1TL4 A;  3OL8 A;  1FKO A;  2PFD A;  3DI6 B;  4O44 A;  1RSC A;  5IM0 B;  1TQL A;  2IFX A;  4L3N A;  2OAU A;  1QE1 B;  3AH6 A;  1TZ0 A;  3TJ9 A;  3I4P A;  3W7B A;  2NXC A;  3K8W A;  3GYG A;  4LFC F;  4LMZ A;  4M5M A;  1FNM A;  3V6K A;  3F41 A;  1VQK S;  4OI2 A;  2VU5 A;  1HW9 A;  1R0C B;  4DV2 F;  1X5S A;  1R8B A;  4I2P B;  1HL6 A;  4O23 A;  4QWE A;  3VZH A;  3PJW A;  1YHQ S;  4K4V A;  4XO0 A;  4LUB A;  5ETT A;  5K20 B;  1EP4 B;  4K50 A;  4BBY A;  3BSC A;  3GWC A;  3ISN D;  3R2D J;  3C6U B;  2ILY A;  4LIW A;  2M4M A;  5HSP A;  3CCS S;  5K5M A;  3THT A;  2DNP A;  1Y00 A;  3DMJ A;  4X4S A;  2QFI A;  3RBD A;  4ES2 A;  4YB5 A;  4WE1 B;  1PIE A;  5HQ8 A;  4LF7 F;  1X9W A;  5L38 A;  2HVD A;  1WOR A;  4N5S A;  3P8B B;  1WEY A;  3A3P B;  3DRS A;  1FK9 A;  2FVR A;  1CJK B;  2XC9 A;  1BWV A;  3N5F A;  3PAC A;  3MTJ A;  2GO8 A;  2BQR A;  3SDE B;  1TUW A;  5J2Q A;  1BY9 A;  4M5G A;  4GO5 X;  1F1B B;  3CCU S;  2F40 A;  1FXR A;  2DIV A;  2DY9 A;  4KFB B;  3OR2 A;  4PWW A;  1W7W A;  2OPP A;  4PPD A;  1RT3 B;  2EG1 A;  1U1Q A;  4ZDN A;  1GMU A;  5IV3 A;  2ALY B;  1VQN S;  1RTD A;  1AFI A;  2ZWO A;  5H9E J;  4B3T J;  4DFM A;  3ZO7 A;  4DQR A;  2XM3 A;  5BR8 J;  3NNH A;  3NNA A;  3UR0 A;  3UCG A;  4LSL B;  4OYW A;  5KG0 A;  4R5P A;  1S1T B;  3HO1 A;  4ED3 A;  1QUP A;  2YWK A;  3IRX A;  4M95 A;  1B99 A;  2HBZ B;  4Y2M A;  1FNO A;  5K14 B;  3QPI A;  1TUV A;  1DLO A;  1KQG B;  5ETP A;  2XY7 A;  4DMZ A;  3TVY A;  4B9U A;  4N8O A;  4KJI A;  4CLW A;  2BE2 A;  4NXN J;  3HXM A;  5A8R A;  1IBK J;  4ZJL A;  1KOO A;  2RF2 B;  1X5P A;  1FWP A;  2MQL A;  5DS7 A;  2LDY A;  7FD1 A;  4C8M A;  3CUL A;  2P6T A;  2Y9H A;  2V4J B;  5IT0 A;  2E1M C;  2AJ0 A;  4B3M F;  2HHV A;  4NA2 A;  3H2V E;  2E9R X;  4LF6 J;  1Q5V A;  3ZTS A;  2EK6 A;  4NMX A;  4KGX B;  2KJV A;  4L74 A;  1NZA A;  3HVA A;  2JOQ A;  1YJT A;  2UXC F;  3SSQ A;  3VR1 A;  4UY8 5;  2V67 A;  2EFP A;  5T7L B;  3B6B A;  4CO0 A;  2R8I A;  2IVM A;  1KDN A;  1AYE A;  2HK3 A;  1NHK L;  3G96 A;  5H9F K;  1OY8 A;  5D3G B;  2CAJ A;  4KAI A;  5LJ5 Y;  2V9K A;  4ZCK A;  4WFZ A;  2YWF A;  4USU A;  5K9F A;  2ZVS A;  5IZH A;  2D3U A;  4HAC A;  5CYQ A;  2ZHA A;  1IBM J;  2B56 A;  4DL0 C;  5DM6 Q;  1Z2L A;  2HQC A;  2FC9 A;  1VLY A;  3I96 A;  2ZC4 A;  4X2B A;  2JLG A;  1HNW F;  2WVF A;  3ZZO A;  2XTJ P;  3ITH B;  4RO0 A;  5T14 A;  3FFI B;  4WYL A;  3LWL A;  2A18 A;  1CJV A;  3BPD A;  3OR1 A;  4Y3C A;  3T5L A;  1E6V A;  1QVG R;  4TU8 A;  2EC2 A;  1JLG A;  3C15 A;  1DTT A;  1TL3 A;  4WFB Q;  3C3L A;  2QL9 B;  4R8U A;  1YVF A;  1RYS A;  4RW9 B;  4F50 A;  1UET A;  3W2V B;  1KSP A;  2DIU A;  3D5M A;  4DR4 F;  2RIL A;  4OIX A;  3IC1 A;  2ZHB A;  1TU0 B;  1VC0 A;  4DV3 J;  2XHC A;  3GIL A;  4ZOS A;  2GGP A;  3VV2 B;  4OYO A;  5HVF A;  5EUH A;  4X4T A;  2LFV A;  4FYX B;  3BO3 A;  5H1S V;  3T9N A;  4P9S A;  1R3N A;  2BJ3 A;  4OZL A;  3C14 A;  1TKX B;  1F60 B;  1F9F A;  4DR1 J;  4Y2A A;  4X84 A;  2C2R A;  1MNE A;  4HKQ A;  2M9K A;  1IKV B;  4LFA J;  1U48 A;  2C2E A;  2XZD B;  1L3T A;  3J80 U;  4JI1 F;  3QT7 A;  1FJC A;  3OUY B;  3KJQ B;  1X0P A;  3NP5 A;  1HBU A;  2KXF A;  3KHG A;  4NYO A;  1NO8 A;  1Q1K A;  1KON A;  1SI9 A;  3M32 A;  3MEE A;  2VQF F;  1XTZ A;  4I1T A;  3V5R A;  1SKU B;  5DG9 A;  4TYA A;  4TU7 A;  2KYZ A;  3NY0 A;  1RXO B;  2OPR A;  5D0G A;  1VQP S;  4JI5 F;  3KLI B;  2FVQ A;  1HWI A;  3PJ9 A;  3I38 A;  1LKZ A;  3EGV A;  3OL6 A;  1H2V Z;  1N34 F;  1NME B;  2O67 A;  1FDN A;  2G0J A;  4ETX A;  4B9L A;  2YNH B;  1TAU A;  3PKY A;  2P2C B;  4K8R A;  2A0F B;  3K5L A;  1QAJ A;  4RW8 A;  4F67 A;  1UVL A;  1SQG A;  4WZQ A;  3JTO A;  5KTQ A;  3RAM A;  2GQ2 A;  2JLF A;  2DR8 A;  1FJG J;  1RWV B;  2YH0 A;  1JLA B;  2GHV C;  3QLH A;  4QYR A;  1NPK A;  2UV8 A;  3OD2 A;  1AXQ A;  2J9D A;  5L1K A;  1Y0H A;  4ED6 A;  2V8D A;  4C48 A;  5LSO A;  2VJU A;  2B4O A;  2KTQ A;  3PO5 A;  1KWM A;  3BYR A;  1R0A A;  3VCD A;  5LSL A;  2KZZ A;  1VIX A;  3TYT A;  3DLE A;  4PG6 A;  3L7O A;  3M2R B;  2HS0 A;  1WNE A;  4F4K A;  4LF2 A;  4CYU A;  1B3T A;  4KKO B;  1IKY B;  2QLJ B;  4F2S A;  1AUS L;  3US5 A;  3V4I A;  1JLB B;  1L5U A;  3T5H A;  5KFH A;  3NCR A;  1RGV A;  1RHU B;  5I3U A;  5KT6 A;  2XG8 A;  5LMN F;  2UVU A;  2ZE2 B;  2IAJ A;  5D6G A;  4DV7 J;  3TAR A;  4O3R A;  1KVJ A;  1HPZ B;  1GT8 A;  4ECZ A;  4YFU A;  1SQE A;  5F3T A;  2E44 A;  4OX9 J;  2AJ1 A;  3GCX P;  2ERR A;  4N76 A;  1S4F A;  2A10 A;  4J9O A;  1MWZ A;  1H3D A;  2OHD A;  2G0I A;  1QTN B;  5A2Q Y;  3CD5 A;  3H5U A;  3ISN C;  4QU6 A;  2B7C B;  4B3O A;  5GMD A;  2Q66 A;  4EBE A;  4DF4 A;  3NGK A;  4OLO A;  6FD1 A;  3M8S A;  2OP5 A;  3PX6 A;  2ZH2 A;  2ZZT A;  1PJ7 A;  1ITP A;  1EKR A;  5IQ6 A;  2Q6B A;  2FHM A;  5HLF B;  3PFE A;  4OX6 A;  2CUY A;  4USM A;  4LF4 F;  4F3O A;  1HNI A;  2LLZ A;  1HQU A;  2NYH A;  5HP1 B;  2V34 A;  2P9C A;  2RRB A;  2M52 A;  2C2M B;  3U1L A;  1QDU B;  2PEB A;  5JXS A;  1N36 F;  1RU1 A;  2VPZ B;  1UAW A;  3PXG a;  4LIR A;  3Q22 A;  1XAO A;  3D68 A;  1HBM A;  1HBN B;  1T11 A;  2XWX A;  2DNK A;  1NPP A;  4QYZ K;  3NCP A;  3HF5 A;  1X4H A;  3PX4 A;  2QRR A;  2VFT A;  4NYZ A;  4QOT A;  4LR7 A;  1IM6 A;  3C6T B;  2KDO A;  3CJ5 A;  3DU6 A;  1XQI A;  4J9Q A;  3CME S;  2V8H A;  3T3F A;  2AQ4 A;  1APS A;  1UKU A;  3FDS A;  5K8M A;  1U8S A;  2OD4 A;  4DEZ A;  2E1A A;  3K0J A;  4N56 A;  2VG7 B;  3ZNJ 1;  4HH0 A;  3FCV A;  4WJB A;  4QIE A;  3VAI A;  2WOM A;  1RBA A;  2HHX A;  5HRO B;  2KN4 A;  1JLQ A;  4BC9 A;  3PHT A;  2JEJ A;  1R8C A;  3R27 A;  2C42 A;  2BJ1 A;  3GPA A;  4M5H A;  4F3Q A;  3DOL B;  5B09 A;  2XNR A;  1WC6 A;  5A0Y B;  1MRO B;  3MM9 B;  4KHP F;  3QAE A;  1L3U A;  2JVR A;  1LWF B;  2ROE A;  3IM9 A;  1PKU A;  3H25 A;  2QE5 A;  3BKT A;  3JSR A;  1JB0 C;  4ZPA A;  1Y9O A;  2NYI A;  1UPP A;  2GC8 A;  2DY1 A;  1RI7 A;  5GAH U;  3D0H E;  2KI2 A;  1K0T A;  5F8H A;  1N4L A;  1UP1 A;  2EEY A;  3MMC B;  3OVA A;  5GVQ A;  2GW8 A;  5C42 B;  3RW6 A;  2BQ3 A;  2B9E A;  1TL7 A;  4DSK A;  4TNO A;  1NPR A;  4A48 A;  1TMJ A;  4AXI A;  5C25 B;  1CUL B;  4M5L A;  4UUW A;  2GIF A;  1N33 J;  2C2Z B;  4KBI A;  3G82 A;  2EC0 A;  1DJ0 A;  4WTO B;  4L3K A;  4AQY F;  2W9C B;  4B9M A;  3P5B P;  3KLE A;  2RDJ A;  4ALZ A;  3FNN A;  3TJA A;  4PQU A;  3PTW A;  1X5O A;  3W63 A;  4OHZ A;  4O3Q A;  1IR2 A;  4HTJ A;  4JYA J;  2BKO A;  2B5J A;  2BXJ A;  2EVZ A;  2H48 B;  3RAQ A;  1YBU A;  1CG2 A;  4IRC A;  3BDE A;  1LNQ A;  4KV8 A;  5EGY A;  1WWH A;  4OJ1 A;  2HHU A;  5KFB A;  4ZVT B;  4GC6 A;  3KK2 A;  3UN2 A;  4ECS A;  2C22 A;  2PD1 A;  2W9B B;  4G1P A;  4DU8 A;  3CE8 A;  3M8P A;  2X1B A;  4HT7 A;  5DQG A;  2VUG A;  1T8E A;  2OLW A;  5E5N A;  4AE5 A;  4C4W A;  1WEZ A;  4EI2 A;  3QZ7 A;  4DL6 A;  3AA9 A;  1S9G B;  3TVZ A;  4USV A;  4X65 F;  2B43 A;  4DZ6 A;  3F73 A;  2MZ1 A;  3VAJ A;  2ZBR A;  2IDL A;  3HFZ B;  2GA7 A;  1R0B G;  4K2J A;  2FUG 9;  5EHH A;  1RUS A;  2DYA A;  2ZD1 B;  4Y0F A;  2QEX S;  2DJW A;  2J6T A;  3MAA B;  1R89 A;  3N6L A;  4B17 A;  1ZZN A;  1WG4 A;  1S6O A;  3D54 A;  4I69 A;  3MMA A;  2JEF A;  1OSC A;  1NSA A;  4LR8 A;  4DHV A;  3UW1 A;  1UW4 A;  2EFQ A;  4JP8 A;  2C28 A;  1DAX A;  2FPH X;  2IIH A;  5BJR A;  1WJ9 A;  1XNQ F;  5IOL A;  1CJU B;  3E01 A;  4QCL A;  2H3E B;  1UPM B;  1M5V C;  1RP5 A;  1UVI A;  4DV0 F;  4OMF G;  7AT1 B;  3DYA A;  3NG8 A;  1AZS B;  1PAE X;  3EX7 B;  1XMQ F;  5E3Q A;  1JNZ B;  3CDU A;  5J1E B;  1NJI T;  5EWE A;  3PNI A;  1BQM A;  1BQX A;  1RT4 B;  3R6G B;  3MR3 A;  1YRU A;  4IQM A;  4ECT A;  1MW7 A;  2AJ4 A;  2O3D A;  4K59 A;  4PEO A;  4J9U E;  4X4R A;  2F65 A;  1N32 F;  4PPZ A;  1U4B A;  1B7Y B;  3RG6 A;  3LP2 B;  2J0S D;  5D78 A;  1YJR A;  3D6T B;  1VGY A;  1SC6 A;  1HIY A;  2YQ0 A;  4DX5 A;  1VBK A;  5KFV A;  1TL1 B;  4NCG B;  2IY5 B;  1T03 A;  3PRV A;  9RUB A;  3RRG A;  1C1B B;  2VPY B;  3W2W A;  3PW5 A;  1GTE A;  1KEK A;  1C0T B;  3MM8 B;  3KLG B;  3Q86 A;  4HI2 A;  1RHR B;  4RNF A;  2XI3 A;  5CYM A;  3IGV A;  2VAS A;  1TV6 B;  1R8H A;  4IR9 A;  3R3T A;  1EQ0 A;  3EGN A;  4WPA A;  3HHN B;  1K8A T;  4ETZ A;  4N47 A;  1HMV A;  1A7G E;  3M6V A;  3IBC B;  3SCJ E;  4DN9 A;  3UVJ B;  5DM7 Q;  4WIQ A;  1YLX A;  2XO6 A;  3OL7 A;  1FJ7 A;  5FLX U;  4DX6 A;  4K0K J;  3C2P A;  1LW2 A;  4P72 A;  4BLG A;  1JK9 B;  1RKI A;  1TL5 A;  1QAX A;  3DGP B;  2BX6 A;  4O3S A;  1I6J A;  4F0M A;  4LBH A;  2IRX A;  4DI6 A;  3UQS A;  4AD6 A;  3SQG B;  1SL1 A;  4YB7 A;  1B70 B;  2D3Z A;  2LA6 A;  3QQC D;  2R2R A;  2QL5 B;  1D9A A;  2GJ2 A;  2DIT A;  2PT0 A;  1Y3J A;  2ZDO A;  3CD6 S;  1RAD B;  5KFT A;  4JI7 J;  4NXM F;  4DV5 J;  1E6Y B;  2AU0 A;  1HQE B;  1SJ3 P;  1DAR A;  3D1H A;  3IAM 9;  4YOE A;  2QJ3 A;  1Q4R A;  4QZV B;  4I6A A;  3DRR B;  4LBP A;  4OYX A;  1NHV A;  3J7Z 5;  2DGU A;  2ZOM A;  4WFA Q;  3SEO A;  3LGN A;  2O01 C;  1RT2 B;  2CWK A;  3TX8 A;  2CZ4 A;  3NMR A;  1FE0 A;  4WXW A;  4ES1 A;  3NOC A;  1D9F A;  4NEZ A;  4WII A;  3HLU A;  3KK3 A;  1C1C B;  2J0Q D;  5GAH I;  5HK4 A;  3OXL A;  4ED0 A;  3CO0 P;  2I9S A;  2Z2Y B;  5DGA A;  1FER A;  2RU3 A;  3LWM A;  1GFW B;  3KHH A;  1N6Q B;  4L6V 3;  3G6Y A;  3W61 A;  4NZ0 A;  1RAB B;  4DUT A;  1JLE A;  4DV4 F;  1DQ8 A;  5LJ3 Y;  4WCE Q;  3TQE A;  4K7Q A;  3DRY A;  2DNO A;  3WC0 A;  2QLX A;  3LGH A;  2E5I A;  3DI6 A;  4ZLJ A;  3CVK A;  5IFM A;  5IM0 A;  1RTI B;  2CJQ A;  3AD7 C;  4ZJQ A;  3DLG B;  4OJ3 A;  4PR6 A;  5DO2 A;  3OFF A;  2QA4 S;  3SV4 A;  4IUF A;  1UL3 A;  4M8L A;  4V19 J;  1H7X A;  3L7P A;  3LH2 S;  1M5P C;  4E0D A;  3NWG A;  2WSC C;  2MJN A;  1L3V A;  2HIQ A;  4I2P A;  4ZVE A;  4NLW A;  4ZA1 A;  4Y2K A;  3VWS A;  2XY5 A;  3Q2S C;  4RJV A;  3HHL B;  4X64 J;  1EP4 A;  4DR5 J;  2MPU A;  1YRT A;  3R2C J;  3NGU A;  4IO9 Q;  3C6U A;  4DSE A;  4NX9 A;  4UF4 A;  3GFH A;  3BKU A;  3HPO A;  4FBU A;  2WON B;  5KFC A;  4IKA A;  2CQI A;  4DUZ F;  1HWJ A;  3R5D A;  4LT6 A;  3V6D B;  3CJ4 A;  2U1A A;  4ZIT A;  1X60 A;  4KE5 A;  4WE1 A;  2J9E A;  2OH2 A;  4UUX A;  1RT6 B;  4ANE A;  2DTJ A;  2DVI A;  3HHK A;  2XS5 A;  3Q23 A;  1CJK A;  1KD1 T;  3SV3 A;  2EI5 A;  3QO9 B;  2W2Q P;  4B9S A;  3RBE A;  4QWC A;  2ZZM A;  4OZ0 A;  3SDE A;  2ZNY A;  3O5T B;  1O0P A;  3KK1 B;  3GR0 A;  3MHY A;  2X1A A;  2LEP A;  1XR6 A;  4ZMM A;  1VC5 A;  4Q8F A;  2HRY A;  4X4U A;  3GON A;  1DUR A;  1FXL A;  3QRR A;  2G13 A;  5IS2 A;  3W3S A;  2WK4 A;  4RNM A;  1PSD A;  4HT5 A;  4KFB A;  2AJ2 A;  4WP9 A;  3A8I A;  5EN1 A;  5B0G A;  4LF5 F;  1M1G A;  1RT3 A;  1MU2 B;  1WHX A;  1U1M A;  1ZAV A;  5GAG U;  3ILJ A;  5ETQ A;  2G2O A;  4FZV A;  2QA1 A;  2OFG X;  5LMU J;  2IC3 B;  4FP9 A;  3IG1 B;  1FA0 A;  3TEH B;  5AJ3 J;  1ZOT A;  2R7O A;  5I4M A;  2MDA A;  2YWW A;  3K5N A;  1K1S A;  4LSL A;  2Z4P A;  3AGZ A;  1S1T A;  1VR6 A;  1I94 F;  2QV6 A;  4GVB B;  1UWB B;  1PO6 A;  5K14 A;  1SUQ B;  1OS5 A;  1PYS B;  2MLZ A;  4A8S A;  5ETM A;  2UUA F;  3OLB A;  5JMN A;  2QA4 G;  1XWL A;  4DL4 A;  1LXN A;  4WKY A;  5JUM A;  4EMD A;  2CFX A;  2V0N A;  4JI3 J;  2Y1L B;  1HYS A;  5C7P A;  2B7B B;  3DLK B;  2R8G A;  2V4J A;  1JLC B;  2X1G A;  3D6H B;  1Q0N A;  1VJQ A;  1RA7 A;  3H5Y A;  5GMK a;  3N0V A;  4ENO A;  4ECQ A;  1S0N A;  4EO6 A;  2MKK A;  1IWG A;  1U45 A;  2IM3 A;  1HI1 A;  1NDP A;  3OTO J;  3I9Z A;  1ULR A;  3DRX A;  4KQZ A;  5T7L A;  3HHD A;  1Q82 T;  2KVI A;  4F36 A;  1HNX F;  2Q3P A;  2PMH A;  1NEE A;  4M63 A;  2LVW A;  2QGF B;  2DR5 A;  2RD5 C;  1S77 D;  5D3G A;  1VHI A;  5EX0 A;  2PFF B;  3IMQ J;  1FD2 A;  3AD9 C;  2LQJ A;  3BGU A;  2L9W A;  3D6F B;  1RWM B;  2OKQ A;  3CJK B;  4PZV A;  3TUJ C;  2MKI A;  1NJZ A;  4ZK7 M;  5KFU A;  2DH8 A;  1WG1 A;  2XQC A;  5KFY A;  3T6B A;  4DSJ A;  3UCZ P;  3ITH A;  1XNR J;  4YY3 F;  3CB4 A;  2A6M A;  3BSA A;  3FFI A;  4FYD A;  4MFB B;  2H51 B;  2GML A;  3AAW B;  4ECV A;  2YPZ A;  2DH9 A;  2RS2 A;  1O51 A;  1RJJ A;  4RUA A;  1XMB A;  2IYI A;  1MWQ A;  1S79 A;  4MK7 A;  4LFC J;  3OXG A;  2YQ1 A;  4Q2L A;  4XTT A;  2J9C A;  2HW3 A;  2AD9 A;  4RW9 A;  3T1Y J;  1ZPV A;  3W2V A;  2B9Y A;  4DCP B;  1YIJ S;  2HFN A;  2XS7 A;  1KOH A;  1RT5 B;  4ZLN A;  3SMZ A;  2PA8 D;  2J9D E;  3IR5 B;  1U2F A;  3HHL D;  1S7H A;  2OGU A;  3FZ2 A;  3TQ1 A;  2PN6 A;  3H90 A;  4Q8E A;  3M6U A;  1RCO B;  3D7S B;  4IG0 B;  5A2Q U;  2ZOF A;  2OIH A;  4DQQ A;  3LGM A;  4PUO A;  3MF5 A;  1F5B A;  2VZ9 A;  1WOS A;  1NBE B;  4NLT A;  2MZR A;  3AFG A;  4C98 A;  1RCX B;  2HVE A;  3HT0 A;  2MKH A;  1BUX A;  3MWB A;  2N7Y A;  1UVJ A;  1VC6 A;  2KT2 A;  3OUY A;  4RBU A;  4DR3 F;  2HVH A;  2YKN A;  3BGF A;  1LWX A;  4GRS A;  4LRC A;  5IT9 U;  3IBF B;  4F04 B;  3WIU A;  2N82 B;  3C8Y A;  2NUH A;  2AGO A;  1SC4 B;  4CO2 A;  5RUB A;  2LU2 A;  1XMO F;  3RRK A;  2HNZ A;  1Z2Z A;  2EPI A;  4NI2 A;  3KLI A;  2L41 A;  4NLY A;  4ELT A;  5KT7 A;  4JV5 F;  1WI8 A;  3W9J A;  4FNI A;  3G6V A;  4JI2 J;  1S1V B;  2WHO A;  2YNH A;  1F2H A;  2Y0B B;  5CAA A;  4B9N A;  3SCI E;  4CP5 A;  4YP3 A;  1HFE L;  2Q2G A;  3IFE A;  1LXJ A;  2XO7 A;  4NA3 A;  2LXF A;  1JLA A;  2VIC A;  5JVH Q;  3B82 A;  2XGQ A;  2GIR A;  1UEK A;  1BC6 A;  5KFP A;  1P6T A;  4GVL A;  2V5H G;  4S0M A;  1QJH A;  3M8Q B;  4DS4 A;  5M2P A;  2MKY A;  3N28 A;  2W7P A;  2A2C A;  1VIS A;  4HEA 9;  3M2R A;  2R2T A;  4CH1 A;  3TR5 A;  3FKB A;  5FII A;  5GAG I;  2QT7 A;  3TUZ C;  3JQJ A;  3B8H A;  4KKO A;  1IKY A;  1FX2 A;  2C2N A;  2FLO A;  3GIR A;  3BSN A;  1RT1 B;  2KRR A;  2KFZ A;  3BBB A;  3SFG A;  1JLB A;  1EB0 A;  3R8Y A;  4K4S A;  1VJW A;  2DCL A;  4ZPT R;  3ZTP A;  3HVW A;  4M5D B;  3CT9 A;  3CC4 S;  4RKU C;  2CQD A;  1TTH B;  1HPZ A;  4DFJ A;  1YJU A;  3L95 X;  3RR8 A;  3LP1 A; 
#chains in the Genus database with same CATH homology
 3I38 A;  1GMU A;  2QLD A;  3LZ8 A;  2HFV A;  1EAR A;  4L3K A;  3TJ9 A;  2Q2G A;  3AGZ A;  1GMV A;  3TJA A;  3NXZ A;  1GMW A;  4J80 A;  1GMW D;  1NLT A;  2B26 A;  1C3G A;  3AGY A;  1XAO A;  3NY0 A;  3L9Z A;  1EB0 A;  3AGX A;  3LA0 A;  3TJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...