1GMWD

Structure of uree
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
138
Chain Sequence
b'MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTDFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UREE
molecule tags Chaperone
source organism Klebsiella aerogenes
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation
pubmed doi rcsb
total genus 32
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmwD02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmwD01
4L3KA 1EARA 3NXZA 3AGYA 1GMUA 1EB0A 3TJ9A 3AGZA 3LZ8A 3TJ8A 3I38A 1NLTA 2HFVA 4J80A 1XAOA 2Q2GA 2QLDA 1GMWD 3L9ZA 3NY0A 3TJAA 3LA0A 1C3GA 1GMWA 1GMVA 3AGXA 2B26A
chains in the Genus database with same CATH superfamily
3NWGA 4OHZA 5J1PA 2Y3YA 3TRGA 3KUHA 4NXMF 2VUGA 2HHQA 2J0QD 1KBRA 2ZH8A 1X4FA 3GV8B 1KWMA 1UW9A 1LWEA 3SFGA 2PT0A 1FDBA 5IOLA 1DTQA 2E5HA 4K7QA 5DM7Q 1U4BA 4WIIA 2XNQA 4GKKJ 2PDAA 1GNKA 2YNIB 2ZH5A 5KFIA 4DR6F 4MIBA 4EZ6A 2ZE2B 2CPHA 2AKWB 3CIZA 2K1RB 4FYYB 4NYPA 4F7VA 1SJ4P 4XO0A 2BW2A 2OELA 1LW0B 1X4GA 3QATA 4GRSA 1RT5A 1Q86T 1RSCA 1FI4A 1NSKL 2FYXA 2HRYA 3GR1A 4OYIA 3WIVA 1A7GE 3MMCB 1GMVA 3CMAS 2FLLA 2ZKTA 3OV7A 5LSRA 2GQ2A 1ZPWX 5F8MA 3QAUA 2DHGA 1S1WB 3LGNA 3KLGB 1VS3A 1YIJS 1J5OA 4X4NA 3I5CA 2UUAF 2QSWA 1RT7B 2QSFA 4WU3A 1BGXT 4N7TA 4ANDA 1Y00A 3MEDB 1WHVA 2VDHA 4FXWA 5J2PA 2RSQA 3PO4A 3TJ9A 2QRRA 4TLQA 3TP2A 3IBFB 3QQCD 1VQKS 1FESA 4KPYA 3F41A 1CEZA 2P9GA 2C22A 1U1OA 2V2KA 2RDDA 3DXBA 3GG0A 4KY3A 3OTCA 1XR7A 2F4FA 2CRLA 3MURP 4Z2XA 4ZVTB 1WF0A 3HI9A 4QYZJ 4R8UB 4F67A 3PO5A 5KFOA 1DLOA 3K5OA 1R0AA 4JI5F 2CNLB 5HBMA 2D3OR 1SKRA 2O1PA 5D78A 3SMZA 3R1HA 1TAQA 3RBXA 5HVFA 3CCJS 3NS7B 2Q1LA 2YQ0A 5FDLA 4USVA 3UN5A 1UPPA 1U8WA 3DRPB 3TAQA 4UUXA 5KT5A 5KFZA 3O44A 5IWAF 1YBTA 5KFGA 1IKVB 4OZ0A 3AD9C 1UFKA 3VZIA 3OLBA 5LMNF 1H98A 5MLCV 4UUWA 1NAQA 3UN2A 2OUGA 1TK5A 1FO1A 4ECSA 2V50A 2CWXA 1VRQC 3RAMA 5C2GA 4Q8EA 1WDDA 4OQJA 2Y8YA 2LMIA 2W7OA 2RVJA 1QVFR 2L3MA 2BOPA 4UY8T 4RW6A 3BEGB 4USUA 2ZJRQ 2LQ8A 2WW8A 3QT6A 3TX8A 3H5SA 4OX6A 4B3MF 3I0RA 2V4QA 1XWLA 4DX5A 4QPXA 4KC5A 1O5JA 2HHVA 1WOSA 2LA6A 4CO3A 4C3MA 3CJTA 2G13A 4U96A 1NKBA 4RBTA 4ECZA 4W4MA 1U45A 2K1RA 3W8GA 2B6AB 2MLZA 1AFJA 9RUBA 3B4MA 3A12A 5B0CA 2DT9A 4C8MA 1H2UX 1RTJA 3V5RA 3CD5A 2Z2YB 4GO5X 1HMVB 3BF4A 4M5IA 1JJ4A 1UWAA 2AF6A 4AT1B 2CQDA 2YWKA 5HROA 3TEGA 2MKCA 1VQOS 1QE1B 4EWTA 3VAKA 2HQDA 3Q24A 4V19X 1O8BA 3SXLA 1D09B 1DJ0A 1TR0A 2HK3A 2KKHA 2VH7A 2GIQA 2W2NP 2M8DB 2BMBA 4H4OB 2ZDPA 4ETZA 4X62F 3QBCA 1U0HB 5HP1B 4AXJA 2YNFA 4DX6A 1UW4A 3CCRS 1FA0A 5L39A 3MM7A 2XYGB 2RQKA 3B54A 3QRQA 2WZ1A 1S7HA 3DLKA 4JI2J 4HDGA 2EFNA 4ZLJA 3NXZA 3DM2A 4OZ3A 2GJ2A 1JLEA 3DGPA 4EO6A 4EBEA 3T6JA 4WWSA 5E3PA 3KK2A 2G0IA 3Q22A 4B3OA 2R7SA 2YNFB 3G2XA 2K7KA 2Y8WA 5A8WA 1RAEB 4DBQA 3J80Y 3BJYA 4CLSA 3OUYA 2NREA 1C0TA 2ZZNA 2CDRB 3CSKA 4M63A 5K9FA 2J76E 2IJNA 4G3IA 4KKOB 3CJKA 4DWIA 2RF2B 2G0JA 3HJFA 3PFOA 3P6YC 2PD1A 3Q2SC 3IAS9 1HIYA 1S6PA 1X8DA 3C6UB 3M6WA 4NZ0A 2ATCB 4P10A 3HHKA 3A8EA 1HNXF 5AE1A 3KJNB 2CKWA 2ROEA 5LSLA 4DFMA 1RA7A 4YHHF 3ETMA 1EETB 3P96A 2ZOFA 3ZC4A 3DRYA 3MUTP 1GX6A 1RWUA 3R8YA 3ZZZA 2QN6B 2WW4A 5CD4H 3EYZA 1MU2A 1X0FA 2KFNA 4OZ2A 3W65A 1LKZA 4LFBJ 2XCPA 4IOBA 4ES1A 1H3DA 1QSLA 5CYMA 4OX8A 3K57A 4QQBA 4CTAB 1UVLA 3KG1A 1ITPA 2ILZA 4X4OA 1NJXA 1XMOF 1TELA 1K1SA 2MKHA 3D1QA 3GP9A 4KGZB 1WTBA 4B3TJ 5K14A 3GIRA 4LVOP 4LSZB 3IGVA 5D0GA 3OFGA 5HBMB 2JX2A 4C3KA 1R6VA 1LWCA 1NK0A 4JI5J 5CHCB 1TKTB 3BS9A 3IM9A 4CT9A 4RBUA 2OMLA 4CNZA 1FXRA 4P2MA 2WBMA 1FWKA 3IS9B 4S0MA 2R2RA 2I2YA 2VF3A 3OD2A 4OMFG 4ALZA 4DF4A 3C14A 4F4XA 3I5AA 3PJWA 5SZTA 5H9EJ 3KFWX 3WC2A 1IJEB 2VU5A 1TUWA 3GCWP 4NLTA 3D5MA 2WTFA 4C0BA 3MUMP 3LPYA 1X4HA 3C19A 2KJWA 2YKMB 2DGOA 4JI8J 1VGYA 3DRSA 1Q1KA 1PYOB 1FFGB 2HNZA 3MMAA 4DR2J 1CQNA 1KS2A 5KFVA 2ZJPQ 4B3TF 2XS7A 3HHNB 4R8UA 2KG1A 2YKNB 3S01A 1JX4A 2QE5A 1PILA 4OI0A 5ETKA 3BGFA 2L9NA 4OLOA 3VQSA 4C98A 1Q0NA 3FFIB 2KN4A 1HQUA 5LMUF 4RBVA 5GAEI 2KXNB 3CJQA 5GADU 1R0BG 2DY1A 3H25A 1D8YA 2J8AA 3JQMA 3AJDA 4DL2A 1VQ7S 1S1TB 4A46A 2OI2A 4DJBA 4YDDB 1RAIB 4LRDA 5I3QA 1ZM3A 1JKHB 1VK3A 1F60B 1LXJA 3L7PA 2KYXA 1S6OA 3NCRA 2MHNA 2VG5A 3W2VB 3MEEB 4ED0A 5J2NA 3HHLA 2BM0A 3MEEA 1V3RA 4B3SF 5D8HB 2GC8A 3N79A 2W1BA 2L48A 4RW7B 1REVB 5T7LA 6FDRA 4ANEA 5KFNA 2XM3A 4J91A 2DJWA 3TR5A 2O01C 2R7RA 4XDDA 2XC9A 1BWVA 1UVMA 3DHXA 1SI9A 2IMWP 2KT5A 4KGXB 2AW0A 2GQCA 3E8OA 5A8RB 2K06A 1F9EB 3BH7B 1KFDA 3PJXA 3QT7A 1WOPA 3H8YA 4CLUA 4F3QA 3QNWB 2GW8A 4DV6J 1N33F 4CO0A 5ITHA 1YJNS 4WKYA 3MEGA 2QX0A 3EMTA 4AYBD 2DO0A 1QLNA 2BW7A 1CJKA 3EDQB 5B0EA 3CPWR 2B4OA 1HR0J 1FX2A 4LMZA 5G0RA 3M4XA 2DNHA 4YOEA 4Y3CA 2BE9B 2C3MA 2YPZA 2B5JA 1OQ3A 3GFZA 3M1VA 3BZQA 3DDIA 4KGVB 5KFPA 1RAJA 2BRKA 5LXRA 4EU0A 4X4TA 1LV5A 1FERA 1H6KX 1YZ7A 3BDEA 4K4SA 1B99A 1ZZFA 4QPTA 2GGPB 1WSRA 4CP5A 1NB2A 2JWNA 3IXQA 3WX8A 1HQEB 7AT1B 4PAAA 3D6TB 2Z2LA 3M8YA 3NCPA 1W7WA 4WIQA 3FMWA 3BREA 1H73A 5AT1B 5B0BA 1NK5A 2VOPA 2CQ3A 5M2RA 2CWKA 3H2UB 1RT4A 2MSSA 5ETVA 3E01A 2JFKA 2UU9F 1RHMB 2D3ZA 2MZTA 4R0JA 3UDEA 3IN5A 3SYZA 5JJBA 4DR4F 1TL7B 1SH2A 1Q4RA 3AH6A 2Y1IA 4FF2A 2GS8A 1R43A 1W25A 2HZVA 1NZAA 1PGZA 5LT5A 4ZCLA 2D3O1 1K9MT 4IG3A 1IR0A 1FTRA 1QUPA 4F2RA 1R89A 4CRJA 1EETA 2D7SA 2GZOA 3U1NA 1WKKA 1U1KA 1VRUB 3KXDA 3AA9A 2UXCF 1RT4B 1X5PA 3C3LA 2YNGA 3BQ2A 1AUSL 4HDHA 2XI2A 4OZ1A 1HI1A 4OYXA 4J9KA 2DNKA 2DKOB 4ZCIA 2D9OA 4CZCA 4LFCF 3PJ9A 5A8KB 1FNOA 3PYEA 2B4VA 3D67A 3VGTA 2FGOA 2XMKA 4FPRA 2HGMA 3QIPA 2HQFA 2HNDA 5A76A 4FYDA 3EXCX 4FYXB 1UETA 1L3SA 4L3KA 2ZOMA 4LSNA 3PRBA 5KFFA 2V8DA 2Z56B 3Q83A 1DTTA 4WJBA 5D0EA 2DGWA 4UT4A 3G8TA 3GZ7A 4DDFA 2JLGA 4ZVEA 1TV6A 4WFZA 1JKHA 2V34A 2UZAA 1WELA 1K1QA 3CDEA 4Y6IA 3TVKA 2VA3A 2DXEA 4M5NA 4Y65A 1IKYB 2FC8A 1IWGA 1FD2A 1ULRA 3A3OB 3DRSB 5CYQB 4YR3A 1U48A 2VA2A 1HNWJ 2RNEA 2O66A 2QL5B 1HBMA 4CO4A 3AXKA 3QGGA 3TZZA 1NB7A 4USHA 1M5PC 2L41A 4JI1J 3UNGC 3HLUA 1WACA 2M7SA 2ALZA 4DSEA 1WG5A 2VG5B 3Q8YA 4M1KA 3A1YG 3CCWA 2R2UA 1SQEA 2AMCB 3CIMA 4DUTA 3ZO7A 1UFWA 3FQKA 1MW7A 2B6AA 4DPOA 5DDOC 1BQMB 2DIUA 5K8OA 1O6XA 4F8RA 4ZLNA 4JI3J 4LR8A 2EFVA 1WI6A 1PC5A 1IUJA 2F65A 2Q79A 3MAAA 4J9UE 5AE2A 4OJHA 2E5LF 2H5JB 1M5HA 3MD1A 2WONA 3B6BA 1HHSA 2P9CA 2QIFA 2XMTA 3THVA 2YQ1A 3ZZ0A 3ENWA 3DOMA 4AL5A 4GMKA 4XK8C 2IM0A 2UP1A 2XEXA 1FRXA 1QAYA 1S48A 5JXSA 4RX6A 2CQGA 3TVZA 3KKFA 4X66F 5BYSA 3N4WA 4BHQA 3NRBA 1C4AA 1BHNA 4ID5B 1FWLA 4AL6A 3GSIA 5CAAA 2XY7A 5KAKA 3D1HA 1VLYA 3ZNUA 2IIHA 2J9CA 4LIRA 1BQMA 1JNZB 3TAMA 1S6PB 2P8IA 4ZVGA 2DH7A 1N52B 2VIHA 4F4YA 2DNZA 4LBHA 2EFGA 1TKTA 1YDLA 4LF9J 4K4TA 3HD2A 3IR6B 2PIIA 1XEZA 4WCEQ 3PRDA 1RK8A 4UOHA 2RD5C 2VASA 1KLMA 4P6QA 3TOQA 3KLGA 4DV4F 4NX9A 4M95A 3G82A 2N3OA 2VG6B 1LEOA 4QWEA 4CH1A 5IV3A 2OTJS 2D1CA 4B3RJ 4X2BA 2IVYA 2NSCA 4CTAA 1NSAA 2ACYA 3O6QA 2XMUA 2DTJA 3Q8VA 5KG6A 4HKQA 3MOZA 1LW0A 5IT4A 4LUBA 2QL7B 3M8WA 3GYNA 1IR2A 3RYLA 3UW1A 1WJ9A 2Q43A 3EWGA 2GVZB 2M3DA 3DGPB 2GCFA 3OXFA 4UOFA 1NDLA 5DG7A 1NK8A 3QAEA 4PYDA 2J9DE 2RU9A 4IH7A 2JEIA 2JVMA 4J9VA 5K8NA 4HYKA 3HP6A 1LWEB 5F8GA 2N82B 5KFRA 1B3TA 1X4AA 3H5XA 1NK6A 2DR5A 1NDCA 4C8LA 1X5TA 1U1RA 1IVZA 3ZZOA 4IFVB 4DV7F 3RAQA 3C6EC 2DHHA 2LCWA 3DLHA 2DYAA 4LF8F 4DR7F 4LR9A 5DLFA 1WOOA 4PABA 1M5VC 2AYEA 2YWEA 4KFBB 1SL0A 2C1EB 3I38A 1UZDA 2E5JA 1C1CA 3RR7A 4M5DA 1U02A 2LQBA 2YX1A 4C4WA 2A6OA 4G1IA 2M9KA 1JJHA 1F3FA 1X5OA 4OZ5A 4IG0A 1R8HA 4X4SA 4O3QA 3BSCA 1QE1A 3HVTA 1B0TA 2W4PA 2ZZMA 1SH3A 5EGYA 2KT3A 2DY9A 2A2CA 4I7FB 1K8AT 3GONA 1RGVA 2EWHA 1N36J 3M2VB 2F8EX 3V4MA 3H2LA 2W2QP 2FJBB 2WB1D 5EWGA 1RAOA 2F4VF 3E01B 4OX7A 3W8PA 5DQGA 3KHHA 4EMDA 2QC3A 4KV8B 3H4DA 3P49B 3SV4A 3BKTA 4DXLA 4ECTA 2VFVA 4CLYA 4KH1B 2DBBA 1T0TV 2PA8D 4TY8B 2MZRA 2L9DA 3H98A 3AJ2A 4HEA9 2CVEA 2M70A 1VQLS 2VQEJ 4B3RF 1YLXA 2U1AA 2IM2A 1SKWA 3VHQA 2KO1A 3QRRA 2J7UA 1VRTB 4ECRA 1JLBB 3V81B 3KTQA 1Y3JA 3OW2R 4YB6A 4RO0A 2V9WA 1M1HA 4OHWA 6AT1B 1Q53A 2RDIA 1F3VA 4PXDA 3LAMA 1RWKB 4K4VA 1X60A 1PAUB 3CD7A 3PDNA 2B0GA 1U1MA 2UUTA 1FXLA 1BWEA 2OEMA 1T9UA 2DEJA 1WF2A 3DHWC 2YH1A 1UFLA 2ZOGA 3C8YA 3DFEA 3EXYA 2HVHA 2RDJA 3ONQA 3GU0A 4CO1A 4DPTA 3DI6A 2JNJA 4ZIVA 3KK1B 2FJDB 3RU0A 1YRUA 2JJ4D 3HKWA 2FGCA 3GILA 3TI0A 2HGLA 4USIA 4C0OC 2X7IA 1VJWA 4N56A 5GMDA 4DFPA 2WVDA 2D69A 2XHCA 1C3GA 4IKAA 1RE1B 4LIWA 5J2NB 1T03B 4EFAC 1QVGR 2CNOB 3W2VA 5E3CA 2W24A 1NKCA 4LFBF 4RNOA 1C1BB 1UZHA 2PN6A 3OTBA 3GYXB 2DEIA 4PG4A 4Y2AA 1SC3B 3TYTA 2L08A 4J9LA 1N36F 3IC1A 3CMQA 4X84A 4LF6F 5IC4B 5D3GA 2HEKA 3CD6S 2VG7A 1EB0A 4J9PA 2MKYA 3CGIA 2ZC3A 5E41A 2VG7B 3J7ZT 3CMES 2CXEA 1RCOB 4RW9B 1DTQB 2G2YA 2OKQA 1W26A 1XMOJ 3TX0A 2FVQA 4TVAB 3W2WA 2B8PA 2LU2A 3LP2A 1WKJA 2LEBA 2BQ3A 2O67A 2EPIA 3HT0A 2QMUB 2HRUA 5F0WA 1QAXA 1TUVA 1MWQA 2UV8G 3KOAA 2PI4A 4MT1A 3MMAB 4FS2A 3CJ4A 4KTQA 5MAOA 5F8IA 3EGZA 3LOUA 3CXCR 2H65B 2HS3A 4DUZF 4Z7CA 1SC1B 3G6YA 3A8IA 1RTIB 4NMLA 1RBLA 2Q6BA 5L1LA 4E0DA 2UXCJ 2XMJA 4JI6F 2W4CA 3W2WB 3FVYA 2IC3B 3IS9A 1RT3A 2LA4A 2K2PA 4KPCA 2E7XA 3W7BA 4ZPDA 1FKAF 1NLKL 3SIPB 3OHAA 2FD2A 4DQSA 3AGZA 3TJ8A 4X4RA 2JEJA 4NLOA 1G4CA 3GJQB 1UJ4A 3MM8B 1RWPB 2KU7A 4WPAA 3SDEB 2HNZB 4DCJB 3CCSS 5I3UB 3V4IA 4EGLA 3NG8A 2MY8A 4F0MA 2YKMA 1D0EA 4U6PA 3HHLC 3C6TB 2X1BA 4U67Q 1GQEA 4K4XA 2CZ9A 4KIAA 2VB6A 4DR3J 5AXLA 4ED6A 3T3FA 2KFZA 3QIPB 2XBPA 5K20B 4X64J 3QRPA 3DRRA 1Q78A 4NLXA 3EVOA 1GAOA 1OSDA 1TU0B 3LP0B 5ETNA 2HW3A 4A8SA 2WHOA 5KFTA 4DU8A 2HHXA 5BJRA 4RUAA 2VQFF 1HW9A 2CJKA 4Y2MA 3VVTA 3IA0A 2CADA 4TXSA 5ETLA 2QTWA 4H4MA 4FN5A 2GAHC 4RU9A 4DX8H 2SXLA 2G2ZA 3O1LA 4XPCA 1YJ7A 1K47A 3NY0A 3M2UA 3N6NA 4I67A 4HI1A 3NCQA 3CCVS 3V81A 1IKXB 3G87A 3BQ1A 3V6HA 2DXDA 4DG1B 2NZ4A 2FZCB 1WEYA 2GHWA 1HD0A 2R2SA 2M4MA 4ZVRB 4X65J 2BJ1A 1JLQA 1OYEA 2EG1A 4KYZA 3ZZRA 3QLHB 3JXOA 5IWAJ 3ZTPA 4WKRA 3DXSX 2JLEA 3MF5A 4QIEA 5DO2A 3V6KA 2ZHOA 2K3IA 1TK8A 4I56A 3PX0A 1S4EA 2XLJA 1IBKJ 2RT3A 1GTEA 2MSTA 3RZAA 2HHSA 1RT2A 1MN9A 3T5LA 5DLGA 4DR7J 3W5XA 2QA4G 1XQIA 4K4WA 2UUCJ 4NYZA 4KO0B 4FXDA 1ZAXA 1YSJA 1RI7A 5HROB 3SCIE 3VZHA 2GGPA 1PKUA 2DNGA 2W2OP 4H4OA 1X5SA 8ATCB 1NZ8A 1JXVA 2KHDA 2HWHA 2WVEA 5K8MA 1L3VA 2PFFB 4C8OA 1H2TZ 1FRIA 2UUWA 1P8GA 3MWBA 5IXUA 5DGBA 1N6QB 1ZS6A 1S0MA 3QJLA 4CQ1A 2CPEA 2HNYA 3R5DA 5HJXA 3TQ1A 1HBNA 3BGRB 3Q8UA 2DK2A 4NLSA 4USTA 2IM3A 3KUEA 4C6AA 1RZMA 2HK2A 1LWFB 2EFOA 2QFIA 2W8LA 2YKNA 4XPEA 2VHGA 4DV2J 2BE2B 1S76D 1CJTB 1ZAVA 3CDBA 2DR9A 4JV0A 3OTEA 2GVDA 4RKUC 4HI2A 3PKYA 4GC6A 2C2EA 1JXEA 2C3UA 3I9ZA 4K2XA 2KL8A 2EXUA 2PMWA 1RHKB 3QFWA 1OWXA 1S9EA 4ZVSB 5KFYA 5GAEU 1DURA 3W9IA 2Z2MA 2XYHB 2EK1A 3PACA 3OSNA 3H5UA 3CW2C 5T14A 4B17A 2CJYB 2RHSB 1KONA 4LF2A 1URNA 2HQ3A 5KT2A 3CCUS 3D28A 1B4SA 3TUPA 3FCVA 2W9CA 3TQEA 1FRMA 1LWCB 1HKAA 2IYIA 3M8QA 3ET6A 1SXLA 4JI2F 2R8IA 4NXNJ 4LR7A 3POTA 3JS9A 2PO4A 3MPYA 2R8HA 4P75A 4CIOA 3BO4A 1CC7A 3MAQA 4LRAA 1I51B 4LBIA 4LREA 5L9XA 5KTQA 2EBGA 4U8VA 1SJRA 3R7NB 3VCDA 4ELTA 3O3LA 5E5NA 5H9FJ 2GMLA 2RAQA 3ILJA 4ID5A 3M32A 4L73A 2A10A 2C2NA 2JHEA 3KHLA 1L3UA 2Z4PA 3LPEA 1GK8A 2VONA 5I42B 1IN0A 1HWIA 5C25A 3CO0P 3F44A 3JQKA 2RE1A 3GJSB 1N48A 3TEHB 1VOMA 2WVBA 4B02A 1NCLA 1TL1A 2WK4A 4IRDA 5DGAA 2RQ4A 2R8KA 4ZP7A 1D9FA 3MEDA 1VMBA 3CTRA 1S9EB 4OYBA 4B9UA 1SCJB 3ZTSA 4USWA 3KMSA 2IC3A 1T3OA 2H9ZA 4KB7A 4QJVA 5HAOA 5JVGQ 3KMQA 3M30A 3MMBB 1S6QA 3ILLA 2HMIB 4L6V3 1IBMJ 4I2QA 4WP8A 1SC4B 4JI6J 1GXLA 3GB0A 3O2IA 4MYTA 3JAMU 3DU6A 5E7OB 5HMWA 2W9CB 4DQQA 2JFDA 3MMCA 1IBKF 4EYHB 2AGOA 3AXMA 2HFUA 2UV8A 4O3NA 3BH6B 1V9OA 1UVJA 2N3LA 2NSBA 4UQTA 4JV5J 5J1EB 3LA0A 2EKNA 5KFEA 3I0SA 4DF8A 3M9NB 3K5NA 2KZZA 2CIMA 1RWXB 4LT6A 4P72A 3UDVA 5LMUJ 2VPYB 5HL7Q 4WU2A 1HNVA 4NLDA 4LF5F 4ICLB 4KFBA 2CJAA 4ECWA 2XQCA 2BR0A 3U27A 3NAIA 3OLAA 1TV6B 4U95A 2DRAA 2M52A 1NU4A 1YJVA 4PXBA 1P6TA 2ZD1B 3EVMA 3SCLE 3PYDA 3QIDA 5GAHI 1VI7A 1HBNB 1FDAA 3AD8C 3GG1A 3IGNA 4JI8F 5LJ5Y 3R6GB 2MGZA 1XNRF 1BY9A 1S1XB 3ZNJ1 4RNFA 4UOGA 2HVIA 2RKIB 1T9VA 4BBYA 2FVCA 2N4CA 1MROB 5KOXA 2RHQB 1JLQB 1C4CA 2V6AA 3LQVA 4NYOA 2C3YA 1T9WA 2KHCA 3J7Z5 3BPSP 4P74A 4PYAA 1KDNA 3PRVA 4ER8A 3J7A1 4YB5A 1NHVA 2OFGX 3TA0A 5F3TA 1F5AA 4ZHRA 5HK4A 3U7JA 1KOOA 3OJUA 4FDFA 1M90T 2BJ7A 4C8YA 3LF0A 4K5RA 1KD1T 4DR1F 5HANA 1S1UA 1OS5A 1T9TA 5ETRA 5FD1A 2ASLA 1S99A 4K2JA 4RW6B 2ZH3A 3V6DB 1T3NA 2IY5B 3HMJG 2DCLA 2HBQB 3OBIA 1YRXA 3CULA 2RQMA 2CYYA 2FQQB 3N0VA 2FJWA 3PEHA 2FVSA 5L1KA 4IG3B 5AXNA 2FJAB 3AD7C 3ENVA 1NBEB 5EUHA 3OR2A 5J1NA 1T7PA 2IYGA 4MKYA 1YJWS 1VRUA 4RU2A 1UEUA 2V9KA 4HTJA 3H42A 4L76A 4J9RA 1Q8BA 2BKPA 1KRPA 4I6AA 4DLEA 1TL5A 2PGCA 4ZOSA 3M8PA 4DZ6A 3IWNC 4O44A 2CJQA 4JI1F 5HLFA 2YXLA 4RLEA 3MECA 1NDKA 4MKVA 3BBFA 4ECQA 4ZVHA 4F36A 3KG0A 3N01A 4JOUA 1N5YB 1AYEA 3H5YA 1QTNB 1X4BA 2I8EA 1GTHA 4GVLA 4LQ3A 4Q7AA 4M5HA 4OHYA 4HVZA 2DH8A 2UUBJ 2MJNA 4N5SA 4URSA 4DLGA 2J6UA 1T11A 1FDNA 4C11B 2GX8A 2RMLA 3M2VA 2HFOA 3EZ5A 2W8KA 3UD3P 3Q86A 1NXIA 1ZM2A 2QMXA 2YQ3A 2KG0A 1HWJA 2D41A 1NSPA 2I1RA 2MZJA 3R5JB 3PX6A 2MZSA 3NMAA 2GJFA 1UEVA 4NZ7A 3KJQB 5G0RB 2CZVC 2NXJA 1FKPA 5DZ7A 5CA5A 2E9ZA 2IAJA 4PG7A 2C28A 4DSIA 4LSLA 2AV5A 1YJRA 1PYSB 3WZ0A 5HJYA 3CJ8A 2CG8A 3PFEA 4NCAA 2RRAA 4KRWA 1EIYB 4NA1A 1N5SA 5ETQA 4KJIA 5H9FK 2GO9A 3K5LA 2HIQA 2KYZA 3I31A 3RB0A 3J7YI 2Z58B 2LU1A 5CXTA 1R7IA 1DQAA 2K7JA 3PIOQ 3T1HJ 2JEGA 1KVJA 1FEHA 4LQ9A 1VHIA 3NKYA 3AA8A 1L5UA 3VV2B 1S6UA 3JTOA 2IAJB 4WP9A 5B0DA 1VCTA 1NKEA 4YR0A 4F3OA 1RDRA 3AOAA 5B09A 4DV3F 5J2MA 4KQZA 2ZBIA 3RBEA 2G9OA 2RJZA 1BD6A 1JLGB 3IRXB 1UJ6A 4ECYA 3R1LA 4WF9Q 1S59A 3LAKA 1NPRA 5ADZA 5CH7B 2UXBF 2EVZA 4WZQA 1HQUB 1BLUA 3UWTA 3KHGA 4W92B 1J5OB 2NXCA 2G4BA 2GQQA 1HNWF 4X62J 3PYGA 2E7WA 2VV5A 4BS2A 5BR8J 3AJ1A 1RTDB 1DAXA 3NGKA 2XS5A 1P9YA 1Y5LB 2VG6A 3FCHA 4NE9C 2B26A 2IMOA 3MMBA 2R7VA 2DB1A 1M5SA 3A8KA 1T9YA 2P9EA 3HKZD 3KG4A 2ZDOA 4RNHA 5ETMA 4O4GB 4D3GA 3OL7A 1REGX 2YVSA 1VBKA 4NZ6A 3CWJA 2QLJB 1IBCB 5M2UA 3D68A 1VIXA 1IKWA 2F4VJ 3IMQJ 3BN7A 1H7WA 2KH9A 1MNEA 3CC7S 2J9DA 4DG1A 4U7CA 2X1AA 2FC9A 3ZZPA 3C15A 3NS5A 4OYMA 4B9NA 4WFXA 4FNIA 2KM8B 3T5HA 5KG1A 3TZXA 1T9XA 1NH8A 4DUYF 1AFIA 5FIIA 2N4DA 5EWEA 4B3MJ 4RNMA 4N76A 1NUEA 3ENQA 3EZOA 3IO1A 3J81j 3UNYA 3AGXA 1QDUB 4ZLPA 3QMQA 3LP1B 4AE5A 4XIUA 2WSEC 1XK8A 2BBEA 2RF2A 4I6WA 4DCOB 4ZN1A 4ED3A 3PZPA 5KFBA 2VDIA 3MECB 5D4PA 1WUUA 4M94A 1NJYA 3DYAB 3RW6A 4LF7J 3P4UB 3SBMA 1TQLA 3QT8A 5A6WA 2OHDA 2P2CB 4HLBA 3KK2B 1RLCL 3JSMA 3U02A 3PHTA 3DLLQ 1EP4B 3D6MB 3EE3A 3MCSA 2VICA 3FSXA 1TKZB 2V68A 3IG1A 5CYMB 4O0NA 4IO9Q 1VQ8S 4IR9A 4CI0B 2F8MA 1FJ7A 1KVKA 3THPA 3MMJA 3PNIA 2VQEF 1HYSB 2HHWA 3VGSA 4NLPA 3LH2S 3L7OA 4KHPJ 2DNLA 4OI4A 1RWVB 3GSDA 3DLGA 2VKZG 4GVBA 4CO2A 9ATCB 1XR6A 3W9HA 2FJVA 1LXNA 2ZH9A 1VR6A 2ZNZA 2MQPA 1J5EF 3TZWA 1SUQB 1FDDA 1HBOA 1S1XA 1R6YA 4RW8B 1LOUA 2E1PA 1SBRA 4N77A 3A4TA 2VKRA 5THWA 4LRBA 3WIUA 4PEOA 2HIYA 1RT6A 4DOZA 4F0KA 5J2QA 1KQSR 5EWFA 4U9RA 1I94J 1I5OB 1GT8A 1FK9A 1MWZA 2QL9B 1BMQB 5AJ3J 2P6TA 5DJBA 2C2KB 1NMEB 1JLAB 2DIVA 3HSDA 3MTJA 4DN9A 1ZOTA 1ZETA 1U2CA 5IQQA 3KLFA 1LWXA 2BACA 1PJ5A 2QLDA 4H54A 1WD6A 4GKJJ 3GFYA 4LF4J 3I4HX 1IJFB 2N7YA 3ISZA 5D15A 1KN6A 4IFYA 4RWXA 3DOKB 4USJC 4WYWA 5IM0B 2MGZB 3J80U 4DQIA 2LEPA 3HHDA 1RT6B 2XMMA 1XN9A 2APOA 4IFVA 1U1QA 1TL1B 1VLOA 2XB2D 3D0GE 4ZP9A 1RAHB 2G2OA 2MXYA 4E8UA 3OL6A 3RTVA 5ETTA 3B78A 5C24B 4A8YA 4DL5A 4DQRA 3M30B 4LF5J 4ILMA 4V19J 5F8LA 5F3ZA 3NMRA 3K8WA 2W25A 4I0WA 1APSA 1DBDA 2MKSA 2V63A 2HKEA 4RNNA 3Q8RB 2ZH4A 1FHTA 2I9SA 3GQCA 3S1TA 1S12A 1BE4A 3EGNA 3KHRA 1UVIA 2RILA 2YKOA 3QSIA 2AJQA 2YKPA 4ZK7M 5I42A 4WXWA 2FLNA 2ZH1A 3DRPA 3VAGA 1U7LA 4TU9A 4OYWA 5B0AA 1KQGB 1U49A 2AYGA 2VOOA 2V2QA 5F8NA 3K17A 2DPIA 4F50A 2Y1LB 3Q8PB 1G6BA 1KLMB 2M0GB 3CCZA 3J81Y 2NPFA 3BO2A 4DS5A 4IRCA 1OY6A 4KAIA 4YN3B 1FWPA 2F3JA 2CQCA 2QV6A 4URGA 4DHVA 3EICA 5KG2A 2DRDA 3PW0A 2NS1B 2DGXA 3FEYB 4NLUA 1TKXA 1B0VA 3H40A 1Q8KA 4NEZA 3GCXP 3W9JA 1RTZA 1RHRB 1B0PA 5AJ3F 1JLGA 1X7VA 3IRXA 4NA3A 5KFSA 5KFKA 1DQ9A 4DL3A 2CA9A 1NJWA 1TP7A 1CJVA 3FBBA 1Q82T 4K4UA 1JLBA 2MTLA 2JZ5A 5DDPC 5IT9U 3EDRB 1HR0F 1FT8A 4DSLA 5D0HA 2OD4A 3G6ES 2V67A 3CJKB 2F40A 4WP3A 2V8HA 4DMZA 1KHVA 4DU7A 4OHXA 1XIQA 1C0TB 2AJ2A 5L46A 2EI5A 2O5DA 3PIPQ 2OPRB 4J90A 2WCXA 1PBUA 1MMLA 2M8HA 3MR3A 1NM2A 1WC5A 4L75A 4P2FA 4EBCA 3KLEB 4QU7A 1RWWB 2NXNA 4P7VA 4XAKA 2LXUA 1MMDA 5E3RA 2QA2A 1S97A 2FY1A 2FHJD 2XZDB 1JLCB 2JLFA 1EQMA 2U2FA 1L3KA 2JVOA 3BR9A 3QGIA 2PMZD 2W01A 3AQPA 3G6XA 5JVHQ 3CCQS 1RLDA 3BR8A 1FFSB 2GNKA 2DHSA 2VFTA 1R8AA 5J2QB 3M7VA 1LQ9A 1NEEA 1J2VA 5IFMA 3V6JA 4JYAJ 4J9QA 1JQGA 1S0NA 5I4MA 3M9OB 3WC0A 4CLZA 3EX7B 2XTJP 3RRHA 2DITA 2VBWA 1X0PA 5ETSA 4NLRA 1Y4ZB 5KG0A 2BYCA 1WWHA 3D0IE 3ITHA 4I69A 1RYRA 4LF4F 3DCAA 1CS4B 2DPJA 1SIWB 3DOLA 5C42A 2NUHA 1XNQJ 1XMBA 3K8VA 3AOBA 4G1PA 1D9DA 3SSQA 4ED1A 3H59A 1SJFA 4MMOA 8AT1B 1K73T 3CJ0A 4A47A 1P9QC 2MB0B 3IG1B 2XO6A 2HNDB 4LBPA 1S9GB 2UXDF 4RW4B 2X1GA 1EP4A 3MPUB 2EFQA 1GEHA 1F5CA 1SVDA 2WRMA 1CSJA 2MQQA 2RS2A 2NYHA 2V8GA 2VFUA 4NLYA 1VBXA 3I96A 2ZWOA 3VWSA 3BYPA 3QWPA 4G1QB 3R2DJ 3OFEA 4ZPWR 2ZVSA 1XAOA 3DLEA 5L1JA 1VQMS 1VQPS 1A6LA 2R7UA 2PMHA 1UKUA 3TJAA 2QLWA 3BGLA 1X9SA 2LVWA 1B64A 1UA1A 5BYQA 4PRFA 1GMWA 3HHEA 3DI6B 3CC4S 3TWZA 3DRRB 4Z7YA 3W60A 2GIFA 4ZIWA 2LLZA 4B3SJ 4FF3A 4CYUA 4R25A 1YJUA 3N6MA 1R31A 4UF4A 4JUZA 4CM0A 4ZPVR 2XGPA 4DV1J 4K5SA 2NR0A 5B7WA 2KXFA 4RUCA 1AW0A 4ZN3A 3AGYA 3FK4A 3QFHA 3PTWA 3CO9A 3FQLA 3IBCB 2J0SD 1NHKL 2XO7A 4C48A 2DR7A 2KZMA 2AZ1A 1WG1A 3M8PB 2MZQA 3GE9A 2K8GA 4DV6F 1N33J 2XGQA 4O4GA 4ZPAA 4OX9J 5F9LA 2B5JB 3M1VB 1IQTA 2GIRA 3HFZB 1EX8A 4F4AA 4Q0BB 2BJ9A 2W2PP 1MN7A 3DKDA 3I87A 3TW0A 2B8QA 3C6TA 4JB8B 5FDLB 4O0IA 2GHVC 1P1TA 1RHUB 1TMJA 2XHWA 3Q0AA 1AZSB 5I3PA 1F1BB 2GA7A 2IBOA 1HI8A 1RTIA 2QG9B 1YHQS 1V5IB 4ECUA 3MM5A 5KFCA 1Q79A 3I6PA 5AE3A 2CFXA 2J0XA 1HNVB 2YWFA 5A8WB 2J8SA 2FLOA 3ZTRA 5KFJA 2R8JA 4TN2A 3RRKA 3I55S 4TU7A 1KFSA 2CQ1A 1R8PA 2HWIA 4DI6A 5CCMA 1VK8A 2V5HG 4FKXA 2F5GA 3VGUA 2R9LA 4ZHRB 3KYLA 4CCHA 2Q66A 1BUXA 4ZP8A 3UCGA 1NO8A 4KHMA 2BKNA 3TUIC 2FHKA 2WVCA 4TLRA 4DS4A 4WK1A 1FRHA 2AHOB 2B4UA 3MI7X 4YEAA 3R7BB 1RBOB 3BPDA 1IKWB 4TU8A 1F0XA 3P45B 3DOLB 2IRXA 1PC4A 3BYRA 4C7QA 1S1WA 1MROA 3KLVA 1HPZA 3LWLA 2R8GA 2CPYA 2V8PA 4MFBA 3J81U 2AWZA 1X9WA 2E1CA 1FD8A 1PIEA 3IRWP 4PQAA 2BXJA 3ISND 2DVIA 2V69A 4K4YA 2ATLA 1CQMA 3UR3C 4ZKAA 3VAIA 5GMKa 1NK4A 2BANA 2HS4A 1KHWA 2LEAA 2ZD1A 3H7HB 4OZJA 2ZE2A 4NOHA 4OZLA 3WQPA 3QWUA 3OTOJ 3B8HA 2ZM6F 2RUGA 1SJ1A 1SKUB 2HFZA 3BSAA 4IH5A 5J2MB 3D6HB 4EEYA 1T05B 1YBUA 1HBUB 2AX0A 2Z2ZA 4DQPA 3KNAA 3TUZC 5FLXY 1ZBTA 3HXMA 4R0EA 1SQGA 2UUCF 2CNNB 2GVZA 4MK9A 3T9NA 3I0SB 2HWTA 1FKOB 2XSFA 4QWDA 1T02A 3JYTB 2UVUA 1X9MA 4A8QA 4HHJA 1F6TA 3Q89A 4CLPA 3F73A 1H0HB 3KDNA 2HURA 5GAGI 1T03A 3NGRA 4JV5F 4RL1A 4F2SA 4MAKA 4MH8A 5DG8A 4J5OA 2ZJQQ 2ZUGA 2V0NA 4PUOA 1S0OA 1MG7A 1HD1A 2LECA 1EKSA 3DMJB 1A9NB 1TVRA 1H74A 1PAEX 1YK9A 3C66A 3S8SA 2PEHA 1Q5YA 3M8QB 1SC6A 3JSBA 3NAHA 3HT3A 5FLXU 4XDCA 1HLWA 5GMEA 4BC7A 1VDHA 2HHPA 3IWLA 3J7AN 3NNCA 3X3UA 2DH9A 1HNXJ 5KFDA 2W9BB 1CPZA 2J7KA 3DC2A 4ZLLA 1RQ0A 4NXNF 2ZWPA 3T1YF 1LW2B 1C0UA 4MIWA 3ENAA 4G6VB 3HSGA 1FJCA 2R4FA 4FVMA 3CT9A 1DHMA 1SQFA 3X1LB 2CDQA 5G4DA 2ZHBA 1N88A 1U6BA 2YPYA 3EZUA 2FY8A 2EFPA 2KDOA 4HL9A 4F26A 4R5PA 1Z1ZA 5U47A 3CJRA 1HNIA 5D6GA 3AKOB 2KVIA 3JQJA 3ZTQA 3MHYA 4DL6A 4ES2A 2OEKA 4Q2LA 2ROPA 3FSIA 3Q23A 4PWDB 5HN0A 2KXHA 5JUMA 4AXIA 1U2FA 4ELVA 4I6YA 4QR0A 3SZ2A 4QWAA 4NLGA 3MDFA 1JLAA 1WHYA 2ASYA 5H1SV 1S9FA 4DFKA 1WG4A 2FVPA 2UXDJ 2G0CA 1Q5VA 2XMWA 3RBDA 1TAUA 2JZ8A 3MPVA 3DLJA 2MQLA 2CNKB 4U7UD 1RT2B 2BRLA 5HATA 1HNZF 5F9NA 5KFQA 4YDXA 5GADI 4I2PA 4NCGB 4QOTA 2VFRA 2VJVA 4N41A 5A0YB 2E1RA 4NCGA 1WHXA 2E5GA 1KQFB 3F0NA 3P5BP 2H5EA 2GMJA 2RU3A 4KHPF 1RAGB 2YNIA 1EAYC 2FIUA 5IT0A 2D9PA 4CH0S 3B4DA 4I64A 1VC6A 4LFAF 3SQGB 4HH1A 3JAMY 2CPDA 1RHQB 4ED8A 3T9ZA 1I3OB 2XWXA 3CCLS 1YZ6A 2CVIA 3FZBA 2KFYA 3H20A 1RTHA 4CO5A 1PSDA 3NP5A 3M8SA 3OSPA 4FBTA 2CQBA 4DV2F 4RW8A 3OL8A 2WSFC 4FYVB 5LMNJ 2OD6A 3SCJE 4ED4A 3LW5C 4I2PB 4B9VA 1HNZJ 3HDSA 4C8ZA 1HW8A 5KFMA 5DRKA 2FHOB 2JRSA 3KUGA 1KC8T 2QA4S 1U0SA 1TL3A 2A3JA 2NXEA 2VODA 2VD3A 3UR0A 2AU0A 1PBAA 3MPDA 1RUSA 2WOMA 2IVFB 4KR0B 2DO4A 1B7YB 5IQ6A 4NPOA 4YHHJ 1PG5B 3TANA 4IOAQ 1N56A 2E5IA 1RU2A 1RAFB 1F9FA 3KLEA 3QPIA 1UMJA 2E1AA 2Z8QA 3QT5A 2J0WA 3DYAA 2YX4A 4WBFA 3S7RA 2HHHJ 1U1NA 2R7XA 4TYAA 1K0TA 4AD6A 4QYRA 2HAIA 2VQFJ 3C46A 2OO4A 2WONB 4ZS6A 2OEJA 2M2BA 3QSYB 2Z57B 3PX4A 3MAHA 3UCZP 5LXYA 4P2SA 2B51A 4Y0FA 2DGVA 4MKBA 5KT7A 2COLA 4M5MA 3MM9A 4ZJLA 1S72S 1S6QB 3MM6A 4BC9A 2ZM6J 4ECXA 4OJGA 4DFJA 1UA0A 1QSYA 1WC1A 4HR2A 1AA1B 2C3OA 4ZCKA 1V5VA 4DL4A 1VQ6S 4O3RA 3ETOA 5KOWA 3CJ2A 2CQIA 3M8ZA 3T1HF 1IR1A 3CNQP 1RU1A 2E1MC 4F3MA 1VC5A 2QLXA 3THTA 1QUVA 2XULA 2B3TB 2EC0A 1EKRA 2Z30B 4UW2A 3HD1A 2V2VA 5C25B 1Z4UA 1EZZB 3UVJB 3TNVA 2MDAA 4KHRA 1SIZA 1YX2A 3RUBL 3Q2TC 4ZMMA 2AYBA 4OL8A 4DPYA 3FEZA 3LP2B 3BKFA 5KG7A 5CABA 2HG4A 4P71A 2H3EB 3GTYX 2UUAJ 2AJFE 3I4PA 2OPPA 5C24A 1D3WA 2YBVA 1ELOA 4OI3A 4P73A 1NJIT 3MTKA 3RJMB 3SDEA 5DDQC 4DR6J 1H38A 4DL0C 2FLPA 3FGVA 2BA9A 4J9SA 3MEKA 3EUNA 3N5BA 4TYBA 3RG6A 3TAPA 2XZTB 1ZTTA 1GXTA 3GFHA 4FNHA 4ZITA 5H9EK 3TVYA 5EHHA 1G7CB 3OFFA 3ZFVA 3DOKA 1S77D 2AX1A 2VBXA 3IWXA 4W90B 1R8BA 4GC7A 1YRTA 2A18A 4WYLA 1FKOA 1WSVA 2X51A 3R6LB 3T1YJ 3BBBA 1N0VC 1S57A 1RTDA 2AP6A 4TQRA 3FJ2A 2ZNYA 3Q8QB 3OJSA 1DTTB 3GV5B 4DR5J 3LTOA 2NYIA 3PKMA 1LK5A 2J5AA 1VIOA 4I4BA 4U8YA 4B9SA 1TL3B 2JC0A 1Y7PA 4P52A 3R5GA 2WAQD 2YNGB 4DPXA 1Y9OA 5T41A 2VBZA 1CULA 2VFSA 4YQWA 2DR6A 5KFLA 3M2RB 5IM0A 2ADCA 1XMQJ 5CYQA 2DNRA 4PKDB 3U1MA 1LFPA 1N5QA 4ED2A 2C2ZB 4A8XA 2A2DA 4DPUA 3T5KA 1MWYA 4EZ9A 1OPZA 4MFBB 1YBAA 3MM5B 2H54B 3HVWA 4I1TA 1NPPA 2YNHB 3K5PA 4QIGA 3DDNA 3A3NB 4DCPB 1VQ5S 1RACB 1KSPA 4JI7J 5HI7A 1U8SA 2B9YA 4A8WA 1WTFA 3I82A 1N34J 2DGUA 1G3OA 4LSNB 3OTDA 4LF6J 4CLFA 3M9MB 3EPGA 3E51A 1TL4A 2QT7A 3BM7A 3N28A 2I6WA 3T19A 1I6JA 1C1BA 1DARA 3GR0A 3K7RA 4IDKB 2LDIA 4PPDA 4DN0A 1V3SA 2RRBA 2MKIA 4KT0C 2BABA 1URRA 1RT1A 1UEKA 1SUQA 2ZKUA 1L3TA 4TY8A 5HSPA 3PW2A 3LZ8A 3VAFA 2WBRA 4CYUB 1WI8A 3GIMA 2R42A 3MGJA 3IBWA 2AZ3A 4O23A 3LP0A 3DU5A 2XY6A 3L95X 3PW7A 3RR8A 1E6VA 4GKKF 1O0PA 3A3PB 1KR4A 5IS2A 2GJIA 2X3DA 2AJ1A 3NGDA 4A8OA 5L38A 1RABB 2JVRA 4DR3F 3SQOP 3K0JA 3G8SA 1OMSA 1A0OB 3UD5A 1NK7A 2ASJA 2DR8A 1RWNB 1CG2A 3FDSA 2OSQA 4EUVA 3O8WA 4WK3A 4O3OA 5DG9A 1NH7A 4NASA 4ITSA 4OLPA 3UQSA 4O44B 1TVRB 2HVZA 4ZVQB 2BZ2A 3FBEA 3R3TA 4DSKA 3FKBA 2QZ8A 2IBKA 1OY8A 2W4DA 3ULHA 4A8FA 1UL3A 4MIAA 3GIKA 3OR2B 3BQ0A 3ISNC 3M05A 3N5FA 1QAIA 4LF7F 1CJKB 4F02A 4RR5A 3MPWA 4J80A 1UPMB 2IRUA 3UE2A 2CQ0A 3G8QA 4KKOA 4DV4J 2V4RA 1GMWD 4FPIA 2LP4A 3NBPB 3BDPA 4DV5J 4KV8A 1IM4A 2HBZB 4MJKA 1ICEB 2XI3A 4G1QA 4MYUA 1M0SA 2KJVA 4PG6A 3R97A 1N5TA 4CWBA 3LWMA 3L7UA 2POKA 3OQ2A 1UCNA 2H4WB 3AFGA 3MM8A 4OJ1A 2EG2A 5L1IA 2LKZA 4Y2KA 2Y0BB 2CJBA 4ZDNA 1XJWB 4NI2B 5LJ3Y 4KGMA 2GMHA 2C2OB 2EC2A 4ZVOB 5KG5A 4JI4F 3FFIA 1JLCA 3WDOA 4TNOA 2NXUA 3JSRA 4K4ZA 2JSXA 1QAJA 3CE8A 3L09A 2BKOA 3UO0A 3LO3A 4AL7A 2HLTA 3RAXA 1IBMF 2IRYA 2JL9A 3OVSA 2AJ0A 4I2QB 2OPPB 4M5DB 2A0FB 4RJVA 3VGVA 4ETXA 2BJEA 3H90A 1RT5B 2IDLA 3L4BC 4FVCA 3CCMS 1CULB 1YKWA 2JDJA 2AGPA 5FJ4A 4FS1A 3MUVP 3GIJA 4IQXA 2YWHA 2A1BA 2AYMA 2GO8A 1F9HA 3K89A 4B9LA 1M5KC 1TKDA 2MHEA 3PVXA 1HWLA 4WE1B 4ZVFA 2BJDA 4DV0F 3C2PA 1HQ2A 3A8JA 2YTCA 2R2TA 2MMYA 2E9TA 1SH0A 1FTCA 3FRZA 3HCXA 3KDOA 5A2QY 3FZ2A 2HSEB 1IM6A 1U6ZA 3PW4A 2BEFA 1FRKA 1S1VA 3G86A 3LALA 3MM6B 5LM7E 3T6BA 4ZJQA 5B08A 3OHBA 2HHTA 3I5BA 4MKAA 1RP5A 1TKXB 2I38A 1FRJA 2BOAA 1RISA 4QIVA 1Q95G 3W63A 4TKTA 1RXOB 1UWBB 4GKJF 4B9TA 2BJ8A 1N5YA 2Q2GA 1Y3KA 4C8NA 1AROP 4DR2F 1IQZA 3D2WA 3K59A 1BQXA 2ROGA 1B7FA 1N32F 2YY3A 1IWAA 1U25A 1YG0A 2MLXA 2V4JA 1MLAA 1RAAB 1VYAA 2LQ9A 4NLWA 2HGNA 4QZVB 3W1YC 4HACA 2LFVA 2XMVA 3OXLA 1WORA 4HH0A 3NOGA 3P3DA 2R7OA 3C14B 3PG9A 4FZVA 4EBDA 1IBLF 1E6VB 1H2VZ 4ED7A 2G1DA 5KFAA 3M6UA 4D3HA 1FNMA 3OVBA 2J7WA 2OPQA 3FCWA 4WTOB 3V6DA 1JLFB 2CAJA 4YB1P 3KK1A 1U1LA 1S1UB 4LRFA 1S7IA 3DRXA 1NHUA 1RWOB 1CJTA 2DXFA 2ZFHA 4ZPCA 2HBYB 2O3DA 1X4DA 3L9ZA 4RWWA 3BN4A 1S9GA 3HM9A 2FTRA 4PPZA 3JSYA 1PYTA 2OFHX 4PR6A 4M5JA 3OUYB 4K0KJ 2RH3A 4QW8A 4C8KA 4Y2CA 2Y0SD 3HSJA 4NA2A 4ENOA 1VISA 4ES3A 3W3SA 2F7VA 2OSRA 2B9XA 1S5ZA 3FEXB 2AT1B 2DGSA 2NLWA 1RTHB 1KTVA 3EGWB 3MM7B 3ITHB 4UZCA 4ANCA 4QIWD 2B56A 2B7BB 2B7CB 3BGUA 4O4RA 3MFIA 4J9OA 3R2CJ 2PC6A 2K3KA 4C9DA 2GFFA 3AODA 1GMUA 1KOHA 1YQHA 4DEZA 3RGIA 4F04B 5DDRC 1SV5A 2FUG9 1NPKA 3GJRB 5C42B 2CQ2A 1LK7A 2W2MP 1U6FA 5BXIA 4OI6A 4I7FA 3RW7A 3PY8A 1OYDA 2HAFA 1VBZA 1HHQA 1Z2ZA 1FXDA 2KB2A 3ZZTA 3H0PA 5DM6Q 1WKLA 3KWMA 1U0HA 4J7CA 4Q45A 2DD8S 5HQLA 2BX6A 5HMYA 1WEXA 4UQGA 4X65F 4GVBB 4Q5VA 1UVKA 2KI2A 5AXMA 4NEYA 2OPRA 4OFZA 5BR8F 1C1CB 1VQNS 4UOCA 3E2EA 1M5OC 1QJHA 2XYPB 3I9V9 4FP9A 4IOCQ 3BB5A 5D4LA 1MSWD 3D3CJ 1GX5A 2HS0A 2P5VA 5K5MA 1SV5B 2H48B 3HVRA 3I0RB 1G2EA 4CLKA 4HHUA 3PV8A 4CNYA 2IFXA 2X3GA 4WTYA 2H4YB 3FNNA 1N5VA 3DLGB 4FKYA 4ZA1A 3G4SS 4P9SA 3LP1A 2CUYA 4OZNA 3KLIB 1W2IA 1HNIB 3TAMB 5DETA 2CQ4A 3EGVA 3FRYA 4LFAJ 3G71S 2R3VA 3HX9A 2B43A 4HHHA 3NL0A 3CDWA 2PI5A 3H4BA 1CJVB 1FEEA 5HQMA 1HI0P 2FVRA 4C0HA 1I94F 3QJPA 3SEOA 1U2RA 1Y5IB 1C0UB 2V94A 2VPXB 2EBEA 2ZBQA 4MK8A 1VC0A 1RYSA 5CQGA 1M1GA 3OT9A 1UTAA 2C2MB 3MCOA 2IHR1 4YMEA 5IV4A 3MOJB 2ZZTA 4PWUA 3NGSA 4CLLA 4Y00A 3DGVA 4DV3J 3TA1A 1PO6A 5K8PA 1P1LA 4LF9F 1RKJA 2CPFA 5AXKA 5C7PA 2WSCC 4R5PB 2E9RX 2OPSB 3G6VA 1JLFA 1R27B 5GVQA 1REVA 4RZRA 4E2FB 4G65A 2XLKA 2JC1A 4FXVA 4N47A 3UVJA 3HPOA 5HMXA 4LRCA 3DDKA 1LW2A 4ID8A 2IVMA 1Q8LA 5EN1A 2KRBA 4Y2IA 4LF1A 3VALA 3US5A 3KLHA 2XMAA 2XS2A 3GLJA 4GO7X 4N8NA 2BANB 2YWWA 1WNEA 3VAHA 1IXKA 2HQCA 2Q3PA 2YKAA 3CEDA 3FSYA 1EARA 4Q44A 3HFVA 3DLBA 4QYZK 2EKYA 3QO9B 5I3UA 1H72C 2A6MA 1HBUA 3BKUA 1IKYA 4TY9A 4UTGA 3SSRA 1DLOB 1R0AB 1T05A 2BE2A 3CB4A 1BXNA 1WEZA 3OPKA 4RPFA 3HF5A 4ED5A 2C42A 4H4KA 5D3GB 3NGUA 3QGPA 4UZBA 1ZZNA 3M8RA 1ZTWA 2UVRA 5DZ6A 2HVDA 3LANA 1HL6A 5E3QA 3FUYA 3HVAA 5L8RC 3NNHA 2GV1A 1VQ9S 3D9BA 4JP8A 4YP3A 3RRGA 2EK6A 2H51B 3AT1B 2MKJA 1AXQA 5KG4A 3T41A 3HHLB 3HFKA 2HQIA 1FKPB 2QA1A 4HT7A 2OP5A 4ZVPB 5BYRA 2AEMA 4DR1J 4UY85 3NEKA 2DCUB 1S79A 2KTQA 2P6SA 2RB7A 3D54A 1NK9A 1Y5NB 1MMNA 5E2QA 2W7AA 2HYIB 4MK7A 4L72B 1XNRJ 1TKZA 1ZPVA 2IJRA 4QWBA 2NZCA 1JNRB 4K59A 5KFWA 1N6QA 1P27B 1Y11A 2LYVA 2HFVA 3LGMA 3M6VA 3QLHA 1ZM4A 4IH6A 3V2UC 1SL2A 2BDPA 4Q8FA 1V6HA 4JV2A 3S6EA 2F63A 2GHPA 1FK9B 3RBZA 2OH2A 1HYSA 1VQYA 3VQTA 1FX4A 1R3NA 3W62A 2M88A 2MJUA 4X4PA 4YFUA 2BQUA 1FRLA 1TL7A 2I0XA 4NI2A 2PSZA 5ETOA 5JMNA 1XNQF 5KFUA 2XLIA 5LOQA 3E3XA 2ZHAA 3OFHA 4LVNP 1D1UA 3MCMA 1Z2LA 3D3BJ 3QGHA 3OR1A 4Q2MA 4C97A 1GFWB 1ZYQA 1NJZA 1DZ5A 3OXGA 2ZITA 4BDPA 1KLNA 4NWBA 2MKKA 4JI3F 5CZVA 4OHVA 5EDWA 4BLGA 1W2BR 2C3PA 4OYPA 2HHHF 3R5AA 1NLTA 1Q8IA 3NNAA 2EW9A 1NRKA 4IDKA 1E6YB 3QZ8A 3I56S 2DHAA 3K2YA 1FE0A 1U09A 3UD4P 4PQUB 4X4VA 1E6YA 5D77A 1Q81T 4CH7A 1WDTA 2AJ4A 2BUNA 3O5TB 3WBZA 3SI8A 2JEFA 1F2GA 4RUBA 5HVHA 1VQ4S 3HVTB 3U1LA 2OJ3A 1MU2B 3MCNA 3Q8SB 4FF4A 4PWDA 3OL9A 1RB0A 3FMBA 1HQEA 1JXLA 1RCXB 1KTQA 1UAWA 1FVQA 4JBCA 4RW4A 4DV1F 2DGTA 2AD9A 3HO1A 1S4FA 2FB0A 1U26A 5HP1A 1RT3B 3M6XA 4B9MA 5SUHA 4ILRA 2XG8A 3HZEA 2FJXA 4K50A 4OV6A 5DQHA 1S1VB 3CDUA 4F4KA 5E3AA 3FC9A 3TZYA 1ZH5A 4V1Ak 1NDPA 1KVIA 4IO1A 4RW7A 5T7LB 3ZZUA 4DUYJ 3P5TL 3GFXA 1TMMA 4EO8A 3KJFB 1TZ0A 2IM1A 3HZGA 2ABYA 3EJMA 4WFNQ 1RT1B 1HMVA 1T94A 4USMA 3JB9k 4JYAF 2YX7A 2R7TA 5KG3A 2YNHA 3WHIA 3BSNA 2LQ5A 2XSJB 3P8BB 1QM9A 2ERRA 2VJUA 1F2HA 1S1TA 5IT9Y 3HHLD 2X1FA 1QTMA 3CCES 2ZBCA 3RB4A 1UJ5A 2DNNA 4ZVUB 1FJEB 4QR2A 2XCAA 3VTIA 3PR4A 5GAHU 5DS7A 2R7QA 2ZUAA 3PYFA 4LSLB 5LL6d 3OTOF 2UVWA 4E98A 4QBUA 3AB4B 4CT8A 3CF5Q 3IR5B 2YWGA 2XNRA 2QLFB 3M2RA 1BC6A 3NOCA 2Z0GA 2DNMA 1PJ6A 5A8RA 1VBYA 2BQRA 3PXGa 3JYTA 3NLCA 2ACMA 5J1EA 2JOQA 2XSJA 3A13A 3ICLA 1X4EA 3PEJA 2N7CA 4C11A 4KE5A 1ACMB 3J7YU 3UFCX 1IKVA 2ZH7A 3FBFA 1WC0A 1JWWA 4RW9A 1YITS 3NBPA 1RTJB 4TQSA 4F4WA 4DR4J 1U24A 2F1FA 3LGHA 4OYZA 2ZC4A 1G1XA 1EQ0A 2PA3A 3M32B 3AY0A 5HO4A 2J6TA 2OPSA 1RHJB 2DGQA 1N0UA 5KFXA 2NCKL 3PR5B 1RADB 2I5JB 2IA6A 1O51A 1UP1A 3MAAB 3FBCA 4NL5A 1OQ6A 1WHWA 3CC2S 4Y34A 5GAGU 4A48A 3G82B 3HULA 3GV7B 5A2QU 3T5JA 2EEYA 2V8VA 3K5MA 2ADBA 5J2PB 1YJ9S 2RIJA 5HQ8A 2BE7D 3EVWA 4AUKA 4PG8A 3D7SB 3H2VE 4EI2A 5CCLA 4WFBQ 4QW9A 3OVAA 2C2DA 4KSEB 4ZPTR 3UCUP 2Y9HA 2MYFA 4OV1A 1N34F 4QU6A 2WOMB 3CD0A 5K14B 2RS8A 2FPHX 5LSOA 4JI7F 5CD4A 3T1AA 3MXHP 1HA1A 3L3CA 4J37A 2IDEA 5RUBA 3AQOA 1UWBA 1VQSA 1SPBP 5E33A 4DPWA 2KM8C 4F4ZA 2FHMA 4IRKA 2I5JA 3ELHA 3R5BA 2GAGC 1KEKA 3OR1B 6FD1A 2QLBB 3IAM9 2FZKB 3POTB 1FVSA 3VR1A 3D4JA 2MQOA 4JV1A 3DOMB 3GYGA 4IYQA 4B3OB 3MM9B 4AFFA 2Q6CA 2BV3A 2QYCA 1RWMB 4P2XA 4CDIA 4CM2A 5KFHA 4QWCA 4DV7J 4FBUA 3PCOB 3VAJA 4C3LA 1LFWA 2IPOB 1ZM9A 3AAWB 4N8OA 3WX4A 2XY5A 4ILLA 1HARA 2IA0A 3ADAC 4LJMA 4JI0F 3BGRA 1K44A 1ROFA 3CCTA 1AB8A 3GJTB 4PZVA 2ASDA 1JJ2R 1Q16B 2DNQA 3C6UA 3DLKB 4IFYB 1VHFA 3KLIA 3NGTA 2HBRB 2F9JA 4IG0B 1IBLJ 1CS4A 2HVEA 3CJSA 1HBMB 4WFYA 1WC3A 1TFWA 3C16A 3KJVB 4K0KF 5A0YA 2KVQE 1ZA2B 2MQ8A 2MY7A 2ZBRA 3C16B 3KJVA 4IUFA 3W5YA 4KBIA 3K58A 1DY3A 3VVUA 2LQJA 2QJ3A 4QR1A 3G9CA 1TK0A 2FHJA 2ZH6A 4OYOA 4X64F 3AB2B 2H5IB 2CPZA 2PFDA 3W5ZA 1OO0B 4M5KA 2OTLS 4OX9F 1FJGJ 4QIFA 3MR2A 2VC0A 2HNYB 2CPIA 3CJ5A 3GPAA 4U7UK 4Q43A 3SQGA 2HHUA 3D1OA 3MR5A 1WF1A 2YH0A 3B82A 2UXBJ 3TARA 3VAMA 1SL1A 3UI3A 1XR5A 2KT2A 1J27A 2XWYA 2MEWA 4DX7A 1F5BA 2HZAA 7FDRA 3MR6A 1J5EJ 4KH0B 2G1HA 3UDCA 1XERA 2OIHA 1NNDA 1X31C 3W61A 2AGQA 1FCAA 4B08A 1M1KT 3CJ3A 4A8KA 1XC9A 3BSOA 4IQMA 2UU9J 1CLFA 2ZEJA 5E0OA 2E66A 1HHTP 4USKA 4OI1A 3GMGA 1DFDA 2XZWA 1TFYA 2HPUA 5ETPA 3QO9A 1GXUA 2OPQB 2BM1A 3D0HE 4K8RA 2J9EA 3ILOA 3LUYA 4EYIB 3BV8A 4M8LA 3CDAA 2BVZA 1FF2A 1FFWB 1JK9B 2VL1A 3AOCA 1C2PA 1NSQA 5D4NA 1IKXA 3SV3A 2W9BA 1WC6A 3HJVA 1ZAWA 3UN3A 1HFEL 2FZGB 1QD1A 2V2ZA 5IC6B 4F0HA 4NLVA 2JRRA 3JSMB 2ODXA 2CJXB 2ALYB 1JB0C 4OIXA 2C2RA 2HMIA 1SJQA 2HFNA 4NRUA 3BBCA 1QY7A 4RUHA 5C2CA 1YJTA 3DMJA 1CJUB 3NS6A 7FD1A 3UPFA 3BO3A 1UVNA 1JMTA 4PUOB 1KP6A 2W9AA 2BJ3A 2OLWA 2CQHA 1T95A 4KGKA 4MTPA 4WXOA 2ZBPA 3HK2A 1OJ4A 1RJJA 2YKQA 5CZXA 1N4LA 2Y1RI 2PEBA 3JTNA 3GIIA 4ECVA 1YTYA 1ZA1B 2HLUA 4ERDA 5M2PA 1TUGB 3CVKA 1D9AA 4W98A 4ZP6A 5C5JA 4J9MA 1U1PA 1D8ZA 1H7XA 1FE4A 1R0CB 2QYGA 3C15B 1R8CA 4OYAA 3G96A 4O3SA 4FF1A 3IM8A 1OY9A 1S49A 1N32J 2B9WA 2ZVIA 1PCAA 2DNPA 2LXFA 2RRNA 3CUNA 4DSJA 1SKSA 2E7VA 3ZZYA 5KT3A 2D74B 4NCBA 1RBAA 4BWJA 1SJ3P 1LWFA 4QCLA 5CYJA 4A4JA 3IFEA 1JJCB 4DSFA 1Y0HA 4FYWB 4OJ3A 2FDNA 1LNQA 4P7TA 5KT6A 2UVVA 1CVJA 1YI2S 4I68A 1PJ7A 1FJGF 5A6PA 4YY3F 3QJJA 1KQKA 3ET6B 2PE8A 1Y10A 2CG4A 3N9UC 3R5CA 4CLTA 5F8HA 4PXEA 2QMWA 3TO8A 2W7PA 4DUZJ 2DRBA 1RT7A 4LF8J 3PM9A 2E44A 2VBYA 2DHXA 2DNOA 2VPZB 4BWMA 3KK3B 2QEXS 2CZ4A 1TTHB 1XBWA 1B70B 1YVFA 4WE1A 3R7SB 3MFHA 3DNCA 4AQYF 5HMZA 3R27A 1CC8A 5F0UA 2DNYA 3SFUA 3W64A 4DR5F 2NQPA 1GH8A 3ZXWA 1OSCA 2HFSA 2CQPA 4NXMJ 1EJ7L 2CJ9A 1T8EA 3C5XC 1Q7LB 3MR7A 3MD3A 3R9LA 4J9NA 3SCKE 3KNGA 2ZH2A 2MQNA 3SSSA 5L9NA 5DQIA 3EPIA 1VJQA 3W66A 4ZPBA 1I1GA 1HBOB 5D4OA 1SB6A 3PW5A 1U47A 2F8HA 2GVDB 1V3ZA 2MQMA 2OMOA 4X66J 3KK3A 1KKHA 2AQ4A 2QO3A 2WB4A 5HVGA 1K0VA 1VFJA 1HPZB 3HSZA 3QZ7A 4ELUA 1KNZA 4DZDA 2B9EA 1AZSA 2NUUG 2VC1A 4HT5A 4H4KC 5F41A 4JI4J 2JH3A 2CPJA 4OI2A 3RB6A 4YB7A 4DV0J 2LXIA 3N6LA 4YUDA 4NMXA 2E5LJ 5F8JA 2QGFB 4AQYJ 4F25A 4PQUA 2M5YA 3KLHB 1DRZA 4URQU 3KLFB 4L3NA 3GWCA 3EM1A 2UUBF 1HWKA 5A8KA 5EX3A 2OAUA 4H4MB 4O3PA 1BQNA 2H1YA 2KRRA 4ATNA 4YS2A 4WFAQ 1XMQF 2R7WA 2RQCA 1OPIA 2NPIA 4M5GA 2DISA 4JI0J 3TUJC 3VF0B 3I32A 3IP0A 3M2UB 4KO0A 5EX0A 1S10A 2FJEB 3NWRA 2D3UA 2AIRB 1VRTA 3AHPA 5KT4A 2IJFA 3MZIA 3PHEA 4PG5A 1DQ8A 4IR1A 4LFCJ 1YGYA 2Y1JA 2WVFA 3ZTOA 5IZHA 2L9WA 1CJUA 3F56A 4ZJOA 3DLEB 4WZMA 1OIAA 1BQNB 2B4PA 2RUSA 2HZCA 4NRTA 4X4QA 1N54B 3V4IB 5HLFB 3DN9A 4PCQA 2VPWB 4Y28C 4C2MA 4EK2A 8RUCA 4Q0BA 1JIHA 2F9DA 2HQGA 2MLYA 2RKIA 3QYYA 1JLEB 4YR2A 1QSSA 1S0VA 1AUDA 2VZ9A 4M5LA 1RA6A 4HACB 2AEJA 3DM2B 4PWWA 4PXCA 4DL7A 1FNXH 5B0GA 2HRTA 2V4JB 4NLQA 1CBKA 3IR7B 3UDLA 3D6FB 2LDYA 4XTTA 1XTZA 3ILIA 3D66A 4BCAA 1HWUA 1EHWA 3JTPA 4YY3J 1YWXA 4L74A 4HTIA 4A8MP 3MEGB 3RB3A 4X4UA 1RKIA 4ICLA 1AT1B 5D0RA 2QFJA 2ILYA 2OGUA 2E29A 1WC4A 2MPUA 3TA2A 4ZCMA 1Q7YT 4DV5F 3BGOP 1X4CA 2AEFA 2CPXA 2MZ1A 2J6SA 4Z37A 1N8RT 4CLWA 5B0FA
chains in the Genus database with same CATH topology
4L3KA 1EARA 3NXZA 3AGYA 1GMUA 1EB0A 3TJ9A 3AGZA 3LZ8A 3TJ8A 3I38A 1NLTA 2HFVA 4J80A 1XAOA 2Q2GA 2QLDA 1GMWD 3L9ZA 3NY0A 3TJAA 3LA0A 1C3GA 1GMWA 1GMVA 3AGXA 2B26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3K A;  1EAR A;  3NXZ A;  3AGY A;  1GMU A;  1EB0 A;  3TJ9 A;  3AGZ A;  3LZ8 A;  3TJ8 A;  3I38 A;  1NLT A;  2HFV A;  4J80 A;  1XAO A;  2Q2G A;  2QLD A;  1GMW D;  3L9Z A;  3NY0 A;  3TJA A;  3LA0 A;  1C3G A;  1GMW A;  1GMV A;  3AGX A;  2B26 A; 
#chains in the Genus database with same CATH topology
 3NWG A;  4OHZ A;  5J1P A;  2Y3Y A;  3TRG A;  3KUH A;  4NXM F;  2VUG A;  2HHQ A;  2J0Q D;  1KBR A;  2ZH8 A;  1X4F A;  3GV8 B;  1KWM A;  1UW9 A;  1LWE A;  3SFG A;  2PT0 A;  1FDB A;  5IOL A;  1DTQ A;  2E5H A;  4K7Q A;  5DM7 Q;  1U4B A;  4WII A;  2XNQ A;  4GKK J;  2PDA A;  1GNK A;  2YNI B;  2ZH5 A;  5KFI A;  4DR6 F;  4MIB A;  4EZ6 A;  2ZE2 B;  2CPH A;  2AKW B;  3CIZ A;  2K1R B;  4FYY B;  4NYP A;  4F7V A;  1SJ4 P;  4XO0 A;  2BW2 A;  2OEL A;  1LW0 B;  1X4G A;  3QAT A;  4GRS A;  1RT5 A;  1Q86 T;  1RSC A;  1FI4 A;  1NSK L;  2FYX A;  2HRY A;  3GR1 A;  4OYI A;  3WIV A;  1A7G E;  3MMC B;  1GMV A;  3CMA S;  2FLL A;  2ZKT A;  3OV7 A;  5LSR A;  2GQ2 A;  1ZPW X;  5F8M A;  3QAU A;  2DHG A;  1S1W B;  3LGN A;  3KLG B;  1VS3 A;  1YIJ S;  1J5O A;  4X4N A;  3I5C A;  2UUA F;  2QSW A;  1RT7 B;  2QSF A;  4WU3 A;  1BGX T;  4N7T A;  4AND A;  1Y00 A;  3MED B;  1WHV A;  2VDH A;  4FXW A;  5J2P A;  2RSQ A;  3PO4 A;  3TJ9 A;  2QRR A;  4TLQ A;  3TP2 A;  3IBF B;  3QQC D;  1VQK S;  1FES A;  4KPY A;  3F41 A;  1CEZ A;  2P9G A;  2C22 A;  1U1O A;  2V2K A;  2RDD A;  3DXB A;  3GG0 A;  4KY3 A;  3OTC A;  1XR7 A;  2F4F A;  2CRL A;  3MUR P;  4Z2X A;  4ZVT B;  1WF0 A;  3HI9 A;  4QYZ J;  4R8U B;  4F67 A;  3PO5 A;  5KFO A;  1DLO A;  3K5O A;  1R0A A;  4JI5 F;  2CNL B;  5HBM A;  2D3O R;  1SKR A;  2O1P A;  5D78 A;  3SMZ A;  3R1H A;  1TAQ A;  3RBX A;  5HVF A;  3CCJ S;  3NS7 B;  2Q1L A;  2YQ0 A;  5FDL A;  4USV A;  3UN5 A;  1UPP A;  1U8W A;  3DRP B;  3TAQ A;  4UUX A;  5KT5 A;  5KFZ A;  3O44 A;  5IWA F;  1YBT A;  5KFG A;  1IKV B;  4OZ0 A;  3AD9 C;  1UFK A;  3VZI A;  3OLB A;  5LMN F;  1H98 A;  5MLC V;  4UUW A;  1NAQ A;  3UN2 A;  2OUG A;  1TK5 A;  1FO1 A;  4ECS A;  2V50 A;  2CWX A;  1VRQ C;  3RAM A;  5C2G A;  4Q8E A;  1WDD A;  4OQJ A;  2Y8Y A;  2LMI A;  2W7O A;  2RVJ A;  1QVF R;  2L3M A;  2BOP A;  4UY8 T;  4RW6 A;  3BEG B;  4USU A;  2ZJR Q;  2LQ8 A;  2WW8 A;  3QT6 A;  3TX8 A;  3H5S A;  4OX6 A;  4B3M F;  3I0R A;  2V4Q A;  1XWL A;  4DX5 A;  4QPX A;  4KC5 A;  1O5J A;  2HHV A;  1WOS A;  2LA6 A;  4CO3 A;  4C3M A;  3CJT A;  2G13 A;  4U96 A;  1NKB A;  4RBT A;  4ECZ A;  4W4M A;  1U45 A;  2K1R A;  3W8G A;  2B6A B;  2MLZ A;  1AFJ A;  9RUB A;  3B4M A;  3A12 A;  5B0C A;  2DT9 A;  4C8M A;  1H2U X;  1RTJ A;  3V5R A;  3CD5 A;  2Z2Y B;  4GO5 X;  1HMV B;  3BF4 A;  4M5I A;  1JJ4 A;  1UWA A;  2AF6 A;  4AT1 B;  2CQD A;  2YWK A;  5HRO A;  3TEG A;  2MKC A;  1VQO S;  1QE1 B;  4EWT A;  3VAK A;  2HQD A;  3Q24 A;  4V19 X;  1O8B A;  3SXL A;  1D09 B;  1DJ0 A;  1TR0 A;  2HK3 A;  2KKH A;  2VH7 A;  2GIQ A;  2W2N P;  2M8D B;  2BMB A;  4H4O B;  2ZDP A;  4ETZ A;  4X62 F;  3QBC A;  1U0H B;  5HP1 B;  4AXJ A;  2YNF A;  4DX6 A;  1UW4 A;  3CCR S;  1FA0 A;  5L39 A;  3MM7 A;  2XYG B;  2RQK A;  3B54 A;  3QRQ A;  2WZ1 A;  1S7H A;  3DLK A;  4JI2 J;  4HDG A;  2EFN A;  4ZLJ A;  3NXZ A;  3DM2 A;  4OZ3 A;  2GJ2 A;  1JLE A;  3DGP A;  4EO6 A;  4EBE A;  3T6J A;  4WWS A;  5E3P A;  3KK2 A;  2G0I A;  3Q22 A;  4B3O A;  2R7S A;  2YNF B;  3G2X A;  2K7K A;  2Y8W A;  5A8W A;  1RAE B;  4DBQ A;  3J80 Y;  3BJY A;  4CLS A;  3OUY A;  2NRE A;  1C0T A;  2ZZN A;  2CDR B;  3CSK A;  4M63 A;  5K9F A;  2J76 E;  2IJN A;  4G3I A;  4KKO B;  3CJK A;  4DWI A;  2RF2 B;  2G0J A;  3HJF A;  3PFO A;  3P6Y C;  2PD1 A;  3Q2S C;  3IAS 9;  1HIY A;  1S6P A;  1X8D A;  3C6U B;  3M6W A;  4NZ0 A;  2ATC B;  4P10 A;  3HHK A;  3A8E A;  1HNX F;  5AE1 A;  3KJN B;  2CKW A;  2ROE A;  5LSL A;  4DFM A;  1RA7 A;  4YHH F;  3ETM A;  1EET B;  3P96 A;  2ZOF A;  3ZC4 A;  3DRY A;  3MUT P;  1GX6 A;  1RWU A;  3R8Y A;  3ZZZ A;  2QN6 B;  2WW4 A;  5CD4 H;  3EYZ A;  1MU2 A;  1X0F A;  2KFN A;  4OZ2 A;  3W65 A;  1LKZ A;  4LFB J;  2XCP A;  4IOB A;  4ES1 A;  1H3D A;  1QSL A;  5CYM A;  4OX8 A;  3K57 A;  4QQB A;  4CTA B;  1UVL A;  3KG1 A;  1ITP A;  2ILZ A;  4X4O A;  1NJX A;  1XMO F;  1TEL A;  1K1S A;  2MKH A;  3D1Q A;  3GP9 A;  4KGZ B;  1WTB A;  4B3T J;  5K14 A;  3GIR A;  4LVO P;  4LSZ B;  3IGV A;  5D0G A;  3OFG A;  5HBM B;  2JX2 A;  4C3K A;  1R6V A;  1LWC A;  1NK0 A;  4JI5 J;  5CHC B;  1TKT B;  3BS9 A;  3IM9 A;  4CT9 A;  4RBU A;  2OML A;  4CNZ A;  1FXR A;  4P2M A;  2WBM A;  1FWK A;  3IS9 B;  4S0M A;  2R2R A;  2I2Y A;  2VF3 A;  3OD2 A;  4OMF G;  4ALZ A;  4DF4 A;  3C14 A;  4F4X A;  3I5A A;  3PJW A;  5SZT A;  5H9E J;  3KFW X;  3WC2 A;  1IJE B;  2VU5 A;  1TUW A;  3GCW P;  4NLT A;  3D5M A;  2WTF A;  4C0B A;  3MUM P;  3LPY A;  1X4H A;  3C19 A;  2KJW A;  2YKM B;  2DGO A;  4JI8 J;  1VGY A;  3DRS A;  1Q1K A;  1PYO B;  1FFG B;  2HNZ A;  3MMA A;  4DR2 J;  1CQN A;  1KS2 A;  5KFV A;  2ZJP Q;  4B3T F;  2XS7 A;  3HHN B;  4R8U A;  2KG1 A;  2YKN B;  3S01 A;  1JX4 A;  2QE5 A;  1PIL A;  4OI0 A;  5ETK A;  3BGF A;  2L9N A;  4OLO A;  3VQS A;  4C98 A;  1Q0N A;  3FFI B;  2KN4 A;  1HQU A;  5LMU F;  4RBV A;  5GAE I;  2KXN B;  3CJQ A;  5GAD U;  1R0B G;  2DY1 A;  3H25 A;  1D8Y A;  2J8A A;  3JQM A;  3AJD A;  4DL2 A;  1VQ7 S;  1S1T B;  4A46 A;  2OI2 A;  4DJB A;  4YDD B;  1RAI B;  4LRD A;  5I3Q A;  1ZM3 A;  1JKH B;  1VK3 A;  1F60 B;  1LXJ A;  3L7P A;  2KYX A;  1S6O A;  3NCR A;  2MHN A;  2VG5 A;  3W2V B;  3MEE B;  4ED0 A;  5J2N A;  3HHL A;  2BM0 A;  3MEE A;  1V3R A;  4B3S F;  5D8H B;  2GC8 A;  3N79 A;  2W1B A;  2L48 A;  4RW7 B;  1REV B;  5T7L A;  6FDR A;  4ANE A;  5KFN A;  2XM3 A;  4J91 A;  2DJW A;  3TR5 A;  2O01 C;  2R7R A;  4XDD A;  2XC9 A;  1BWV A;  1UVM A;  3DHX A;  1SI9 A;  2IMW P;  2KT5 A;  4KGX B;  2AW0 A;  2GQC A;  3E8O A;  5A8R B;  2K06 A;  1F9E B;  3BH7 B;  1KFD A;  3PJX A;  3QT7 A;  1WOP A;  3H8Y A;  4CLU A;  4F3Q A;  3QNW B;  2GW8 A;  4DV6 J;  1N33 F;  4CO0 A;  5ITH A;  1YJN S;  4WKY A;  3MEG A;  2QX0 A;  3EMT A;  4AYB D;  2DO0 A;  1QLN A;  2BW7 A;  1CJK A;  3EDQ B;  5B0E A;  3CPW R;  2B4O A;  1HR0 J;  1FX2 A;  4LMZ A;  5G0R A;  3M4X A;  2DNH A;  4YOE A;  4Y3C A;  2BE9 B;  2C3M A;  2YPZ A;  2B5J A;  1OQ3 A;  3GFZ A;  3M1V A;  3BZQ A;  3DDI A;  4KGV B;  5KFP A;  1RAJ A;  2BRK A;  5LXR A;  4EU0 A;  4X4T A;  1LV5 A;  1FER A;  1H6K X;  1YZ7 A;  3BDE A;  4K4S A;  1B99 A;  1ZZF A;  4QPT A;  2GGP B;  1WSR A;  4CP5 A;  1NB2 A;  2JWN A;  3IXQ A;  3WX8 A;  1HQE B;  7AT1 B;  4PAA A;  3D6T B;  2Z2L A;  3M8Y A;  3NCP A;  1W7W A;  4WIQ A;  3FMW A;  3BRE A;  1H73 A;  5AT1 B;  5B0B A;  1NK5 A;  2VOP A;  2CQ3 A;  5M2R A;  2CWK A;  3H2U B;  1RT4 A;  2MSS A;  5ETV A;  3E01 A;  2JFK A;  2UU9 F;  1RHM B;  2D3Z A;  2MZT A;  4R0J A;  3UDE A;  3IN5 A;  3SYZ A;  5JJB A;  4DR4 F;  1TL7 B;  1SH2 A;  1Q4R A;  3AH6 A;  2Y1I A;  4FF2 A;  2GS8 A;  1R43 A;  1W25 A;  2HZV A;  1NZA A;  1PGZ A;  5LT5 A;  4ZCL A;  2D3O 1;  1K9M T;  4IG3 A;  1IR0 A;  1FTR A;  1QUP A;  4F2R A;  1R89 A;  4CRJ A;  1EET A;  2D7S A;  2GZO A;  3U1N A;  1WKK A;  1U1K A;  1VRU B;  3KXD A;  3AA9 A;  2UXC F;  1RT4 B;  1X5P A;  3C3L A;  2YNG A;  3BQ2 A;  1AUS L;  4HDH A;  2XI2 A;  4OZ1 A;  1HI1 A;  4OYX A;  4J9K A;  2DNK A;  2DKO B;  4ZCI A;  2D9O A;  4CZC A;  4LFC F;  3PJ9 A;  5A8K B;  1FNO A;  3PYE A;  2B4V A;  3D67 A;  3VGT A;  2FGO A;  2XMK A;  4FPR A;  2HGM A;  3QIP A;  2HQF A;  2HND A;  5A76 A;  4FYD A;  3EXC X;  4FYX B;  1UET A;  1L3S A;  4L3K A;  2ZOM A;  4LSN A;  3PRB A;  5KFF A;  2V8D A;  2Z56 B;  3Q83 A;  1DTT A;  4WJB A;  5D0E A;  2DGW A;  4UT4 A;  3G8T A;  3GZ7 A;  4DDF A;  2JLG A;  4ZVE A;  1TV6 A;  4WFZ A;  1JKH A;  2V34 A;  2UZA A;  1WEL A;  1K1Q A;  3CDE A;  4Y6I A;  3TVK A;  2VA3 A;  2DXE A;  4M5N A;  4Y65 A;  1IKY B;  2FC8 A;  1IWG A;  1FD2 A;  1ULR A;  3A3O B;  3DRS B;  5CYQ B;  4YR3 A;  1U48 A;  2VA2 A;  1HNW J;  2RNE A;  2O66 A;  2QL5 B;  1HBM A;  4CO4 A;  3AXK A;  3QGG A;  3TZZ A;  1NB7 A;  4USH A;  1M5P C;  2L41 A;  4JI1 J;  3UNG C;  3HLU A;  1WAC A;  2M7S A;  2ALZ A;  4DSE A;  1WG5 A;  2VG5 B;  3Q8Y A;  4M1K A;  3A1Y G;  3CCW A;  2R2U A;  1SQE A;  2AMC B;  3CIM A;  4DUT A;  3ZO7 A;  1UFW A;  3FQK A;  1MW7 A;  2B6A A;  4DPO A;  5DDO C;  1BQM B;  2DIU A;  5K8O A;  1O6X A;  4F8R A;  4ZLN A;  4JI3 J;  4LR8 A;  2EFV A;  1WI6 A;  1PC5 A;  1IUJ A;  2F65 A;  2Q79 A;  3MAA A;  4J9U E;  5AE2 A;  4OJH A;  2E5L F;  2H5J B;  1M5H A;  3MD1 A;  2WON A;  3B6B A;  1HHS A;  2P9C A;  2QIF A;  2XMT A;  3THV A;  2YQ1 A;  3ZZ0 A;  3ENW A;  3DOM A;  4AL5 A;  4GMK A;  4XK8 C;  2IM0 A;  2UP1 A;  2XEX A;  1FRX A;  1QAY A;  1S48 A;  5JXS A;  4RX6 A;  2CQG A;  3TVZ A;  3KKF A;  4X66 F;  5BYS A;  3N4W A;  4BHQ A;  3NRB A;  1C4A A;  1BHN A;  4ID5 B;  1FWL A;  4AL6 A;  3GSI A;  5CAA A;  2XY7 A;  5KAK A;  3D1H A;  1VLY A;  3ZNU A;  2IIH A;  2J9C A;  4LIR A;  1BQM A;  1JNZ B;  3TAM A;  1S6P B;  2P8I A;  4ZVG A;  2DH7 A;  1N52 B;  2VIH A;  4F4Y A;  2DNZ A;  4LBH A;  2EFG A;  1TKT A;  1YDL A;  4LF9 J;  4K4T A;  3HD2 A;  3IR6 B;  2PII A;  1XEZ A;  4WCE Q;  3PRD A;  1RK8 A;  4UOH A;  2RD5 C;  2VAS A;  1KLM A;  4P6Q A;  3TOQ A;  3KLG A;  4DV4 F;  4NX9 A;  4M95 A;  3G82 A;  2N3O A;  2VG6 B;  1LEO A;  4QWE A;  4CH1 A;  5IV3 A;  2OTJ S;  2D1C A;  4B3R J;  4X2B A;  2IVY A;  2NSC A;  4CTA A;  1NSA A;  2ACY A;  3O6Q A;  2XMU A;  2DTJ A;  3Q8V A;  5KG6 A;  4HKQ A;  3MOZ A;  1LW0 A;  5IT4 A;  4LUB A;  2QL7 B;  3M8W A;  3GYN A;  1IR2 A;  3RYL A;  3UW1 A;  1WJ9 A;  2Q43 A;  3EWG A;  2GVZ B;  2M3D A;  3DGP B;  2GCF A;  3OXF A;  4UOF A;  1NDL A;  5DG7 A;  1NK8 A;  3QAE A;  4PYD A;  2J9D E;  2RU9 A;  4IH7 A;  2JEI A;  2JVM A;  4J9V A;  5K8N A;  4HYK A;  3HP6 A;  1LWE B;  5F8G A;  2N82 B;  5KFR A;  1B3T A;  1X4A A;  3H5X A;  1NK6 A;  2DR5 A;  1NDC A;  4C8L A;  1X5T A;  1U1R A;  1IVZ A;  3ZZO A;  4IFV B;  4DV7 F;  3RAQ A;  3C6E C;  2DHH A;  2LCW A;  3DLH A;  2DYA A;  4LF8 F;  4DR7 F;  4LR9 A;  5DLF A;  1WOO A;  4PAB A;  1M5V C;  2AYE A;  2YWE A;  4KFB B;  1SL0 A;  2C1E B;  3I38 A;  1UZD A;  2E5J A;  1C1C A;  3RR7 A;  4M5D A;  1U02 A;  2LQB A;  2YX1 A;  4C4W A;  2A6O A;  4G1I A;  2M9K A;  1JJH A;  1F3F A;  1X5O A;  4OZ5 A;  4IG0 A;  1R8H A;  4X4S A;  4O3Q A;  3BSC A;  1QE1 A;  3HVT A;  1B0T A;  2W4P A;  2ZZM A;  1SH3 A;  5EGY A;  2KT3 A;  2DY9 A;  2A2C A;  4I7F B;  1K8A T;  3GON A;  1RGV A;  2EWH A;  1N36 J;  3M2V B;  2F8E X;  3V4M A;  3H2L A;  2W2Q P;  2FJB B;  2WB1 D;  5EWG A;  1RAO A;  2F4V F;  3E01 B;  4OX7 A;  3W8P A;  5DQG A;  3KHH A;  4EMD A;  2QC3 A;  4KV8 B;  3H4D A;  3P49 B;  3SV4 A;  3BKT A;  4DXL A;  4ECT A;  2VFV A;  4CLY A;  4KH1 B;  2DBB A;  1T0T V;  2PA8 D;  4TY8 B;  2MZR A;  2L9D A;  3H98 A;  3AJ2 A;  4HEA 9;  2CVE A;  2M70 A;  1VQL S;  2VQE J;  4B3R F;  1YLX A;  2U1A A;  2IM2 A;  1SKW A;  3VHQ A;  2KO1 A;  3QRR A;  2J7U A;  1VRT B;  4ECR A;  1JLB B;  3V81 B;  3KTQ A;  1Y3J A;  3OW2 R;  4YB6 A;  4RO0 A;  2V9W A;  1M1H A;  4OHW A;  6AT1 B;  1Q53 A;  2RDI A;  1F3V A;  4PXD A;  3LAM A;  1RWK B;  4K4V A;  1X60 A;  1PAU B;  3CD7 A;  3PDN A;  2B0G A;  1U1M A;  2UUT A;  1FXL A;  1BWE A;  2OEM A;  1T9U A;  2DEJ A;  1WF2 A;  3DHW C;  2YH1 A;  1UFL A;  2ZOG A;  3C8Y A;  3DFE A;  3EXY A;  2HVH A;  2RDJ A;  3ONQ A;  3GU0 A;  4CO1 A;  4DPT A;  3DI6 A;  2JNJ A;  4ZIV A;  3KK1 B;  2FJD B;  3RU0 A;  1YRU A;  2JJ4 D;  3HKW A;  2FGC A;  3GIL A;  3TI0 A;  2HGL A;  4USI A;  4C0O C;  2X7I A;  1VJW A;  4N56 A;  5GMD A;  4DFP A;  2WVD A;  2D69 A;  2XHC A;  1C3G A;  4IKA A;  1RE1 B;  4LIW A;  5J2N B;  1T03 B;  4EFA C;  1QVG R;  2CNO B;  3W2V A;  5E3C A;  2W24 A;  1NKC A;  4LFB F;  4RNO A;  1C1B B;  1UZH A;  2PN6 A;  3OTB A;  3GYX B;  2DEI A;  4PG4 A;  4Y2A A;  1SC3 B;  3TYT A;  2L08 A;  4J9L A;  1N36 F;  3IC1 A;  3CMQ A;  4X84 A;  4LF6 F;  5IC4 B;  5D3G A;  2HEK A;  3CD6 S;  2VG7 A;  1EB0 A;  4J9P A;  2MKY A;  3CGI A;  2ZC3 A;  5E41 A;  2VG7 B;  3J7Z T;  3CME S;  2CXE A;  1RCO B;  4RW9 B;  1DTQ B;  2G2Y A;  2OKQ A;  1W26 A;  1XMO J;  3TX0 A;  2FVQ A;  4TVA B;  3W2W A;  2B8P A;  2LU2 A;  3LP2 A;  1WKJ A;  2LEB A;  2BQ3 A;  2O67 A;  2EPI A;  3HT0 A;  2QMU B;  2HRU A;  5F0W A;  1QAX A;  1TUV A;  1MWQ A;  2UV8 G;  3KOA A;  2PI4 A;  4MT1 A;  3MMA B;  4FS2 A;  3CJ4 A;  4KTQ A;  5MAO A;  5F8I A;  3EGZ A;  3LOU A;  3CXC R;  2H65 B;  2HS3 A;  4DUZ F;  4Z7C A;  1SC1 B;  3G6Y A;  3A8I A;  1RTI B;  4NML A;  1RBL A;  2Q6B A;  5L1L A;  4E0D A;  2UXC J;  2XMJ A;  4JI6 F;  2W4C A;  3W2W B;  3FVY A;  2IC3 B;  3IS9 A;  1RT3 A;  2LA4 A;  2K2P A;  4KPC A;  2E7X A;  3W7B A;  4ZPD A;  1FKA F;  1NLK L;  3SIP B;  3OHA A;  2FD2 A;  4DQS A;  3AGZ A;  3TJ8 A;  4X4R A;  2JEJ A;  4NLO A;  1G4C A;  3GJQ B;  1UJ4 A;  3MM8 B;  1RWP B;  2KU7 A;  4WPA A;  3SDE B;  2HNZ B;  4DCJ B;  3CCS S;  5I3U B;  3V4I A;  4EGL A;  3NG8 A;  2MY8 A;  4F0M A;  2YKM A;  1D0E A;  4U6P A;  3HHL C;  3C6T B;  2X1B A;  4U67 Q;  1GQE A;  4K4X A;  2CZ9 A;  4KIA A;  2VB6 A;  4DR3 J;  5AXL A;  4ED6 A;  3T3F A;  2KFZ A;  3QIP B;  2XBP A;  5K20 B;  4X64 J;  3QRP A;  3DRR A;  1Q78 A;  4NLX A;  3EVO A;  1GAO A;  1OSD A;  1TU0 B;  3LP0 B;  5ETN A;  2HW3 A;  4A8S A;  2WHO A;  5KFT A;  4DU8 A;  2HHX A;  5BJR A;  4RUA A;  2VQF F;  1HW9 A;  2CJK A;  4Y2M A;  3VVT A;  3IA0 A;  2CAD A;  4TXS A;  5ETL A;  2QTW A;  4H4M A;  4FN5 A;  2GAH C;  4RU9 A;  4DX8 H;  2SXL A;  2G2Z A;  3O1L A;  4XPC A;  1YJ7 A;  1K47 A;  3NY0 A;  3M2U A;  3N6N A;  4I67 A;  4HI1 A;  3NCQ A;  3CCV S;  3V81 A;  1IKX B;  3G87 A;  3BQ1 A;  3V6H A;  2DXD A;  4DG1 B;  2NZ4 A;  2FZC B;  1WEY A;  2GHW A;  1HD0 A;  2R2S A;  2M4M A;  4ZVR B;  4X65 J;  2BJ1 A;  1JLQ A;  1OYE A;  2EG1 A;  4KYZ A;  3ZZR A;  3QLH B;  3JXO A;  5IWA J;  3ZTP A;  4WKR A;  3DXS X;  2JLE A;  3MF5 A;  4QIE A;  5DO2 A;  3V6K A;  2ZHO A;  2K3I A;  1TK8 A;  4I56 A;  3PX0 A;  1S4E A;  2XLJ A;  1IBK J;  2RT3 A;  1GTE A;  2MST A;  3RZA A;  2HHS A;  1RT2 A;  1MN9 A;  3T5L A;  5DLG A;  4DR7 J;  3W5X A;  2QA4 G;  1XQI A;  4K4W A;  2UUC J;  4NYZ A;  4KO0 B;  4FXD A;  1ZAX A;  1YSJ A;  1RI7 A;  5HRO B;  3SCI E;  3VZH A;  2GGP A;  1PKU A;  2DNG A;  2W2O P;  4H4O A;  1X5S A;  8ATC B;  1NZ8 A;  1JXV A;  2KHD A;  2HWH A;  2WVE A;  5K8M A;  1L3V A;  2PFF B;  4C8O A;  1H2T Z;  1FRI A;  2UUW A;  1P8G A;  3MWB A;  5IXU A;  5DGB A;  1N6Q B;  1ZS6 A;  1S0M A;  3QJL A;  4CQ1 A;  2CPE A;  2HNY A;  3R5D A;  5HJX A;  3TQ1 A;  1HBN A;  3BGR B;  3Q8U A;  2DK2 A;  4NLS A;  4UST A;  2IM3 A;  3KUE A;  4C6A A;  1RZM A;  2HK2 A;  1LWF B;  2EFO A;  2QFI A;  2W8L A;  2YKN A;  4XPE A;  2VHG A;  4DV2 J;  2BE2 B;  1S76 D;  1CJT B;  1ZAV A;  3CDB A;  2DR9 A;  4JV0 A;  3OTE A;  2GVD A;  4RKU C;  4HI2 A;  3PKY A;  4GC6 A;  2C2E A;  1JXE A;  2C3U A;  3I9Z A;  4K2X A;  2KL8 A;  2EXU A;  2PMW A;  1RHK B;  3QFW A;  1OWX A;  1S9E A;  4ZVS B;  5KFY A;  5GAE U;  1DUR A;  3W9I A;  2Z2M A;  2XYH B;  2EK1 A;  3PAC A;  3OSN A;  3H5U A;  3CW2 C;  5T14 A;  4B17 A;  2CJY B;  2RHS B;  1KON A;  4LF2 A;  1URN A;  2HQ3 A;  5KT2 A;  3CCU S;  3D28 A;  1B4S A;  3TUP A;  3FCV A;  2W9C A;  3TQE A;  1FRM A;  1LWC B;  1HKA A;  2IYI A;  3M8Q A;  3ET6 A;  1SXL A;  4JI2 F;  2R8I A;  4NXN J;  4LR7 A;  3POT A;  3JS9 A;  2PO4 A;  3MPY A;  2R8H A;  4P75 A;  4CIO A;  3BO4 A;  1CC7 A;  3MAQ A;  4LRA A;  1I51 B;  4LBI A;  4LRE A;  5L9X A;  5KTQ A;  2EBG A;  4U8V A;  1SJR A;  3R7N B;  3VCD A;  4ELT A;  3O3L A;  5E5N A;  5H9F J;  2GML A;  2RAQ A;  3ILJ A;  4ID5 A;  3M32 A;  4L73 A;  2A10 A;  2C2N A;  2JHE A;  3KHL A;  1L3U A;  2Z4P A;  3LPE A;  1GK8 A;  2VON A;  5I42 B;  1IN0 A;  1HWI A;  5C25 A;  3CO0 P;  3F44 A;  3JQK A;  2RE1 A;  3GJS B;  1N48 A;  3TEH B;  1VOM A;  2WVB A;  4B02 A;  1NCL A;  1TL1 A;  2WK4 A;  4IRD A;  5DGA A;  2RQ4 A;  2R8K A;  4ZP7 A;  1D9F A;  3MED A;  1VMB A;  3CTR A;  1S9E B;  4OYB A;  4B9U A;  1SCJ B;  3ZTS A;  4USW A;  3KMS A;  2IC3 A;  1T3O A;  2H9Z A;  4KB7 A;  4QJV A;  5HAO A;  5JVG Q;  3KMQ A;  3M30 A;  3MMB B;  1S6Q A;  3ILL A;  2HMI B;  4L6V 3;  1IBM J;  4I2Q A;  4WP8 A;  1SC4 B;  4JI6 J;  1GXL A;  3GB0 A;  3O2I A;  4MYT A;  3JAM U;  3DU6 A;  5E7O B;  5HMW A;  2W9C B;  4DQQ A;  2JFD A;  3MMC A;  1IBK F;  4EYH B;  2AGO A;  3AXM A;  2HFU A;  2UV8 A;  4O3N A;  3BH6 B;  1V9O A;  1UVJ A;  2N3L A;  2NSB A;  4UQT A;  4JV5 J;  5J1E B;  3LA0 A;  2EKN A;  5KFE A;  3I0S A;  4DF8 A;  3M9N B;  3K5N A;  2KZZ A;  2CIM A;  1RWX B;  4LT6 A;  4P72 A;  3UDV A;  5LMU J;  2VPY B;  5HL7 Q;  4WU2 A;  1HNV A;  4NLD A;  4LF5 F;  4ICL B;  4KFB A;  2CJA A;  4ECW A;  2XQC A;  2BR0 A;  3U27 A;  3NAI A;  3OLA A;  1TV6 B;  4U95 A;  2DRA A;  2M52 A;  1NU4 A;  1YJV A;  4PXB A;  1P6T A;  2ZD1 B;  3EVM A;  3SCL E;  3PYD A;  3QID A;  5GAH I;  1VI7 A;  1HBN B;  1FDA A;  3AD8 C;  3GG1 A;  3IGN A;  4JI8 F;  5LJ5 Y;  3R6G B;  2MGZ A;  1XNR F;  1BY9 A;  1S1X B;  3ZNJ 1;  4RNF A;  4UOG A;  2HVI A;  2RKI B;  1T9V A;  4BBY A;  2FVC A;  2N4C A;  1MRO B;  5KOX A;  2RHQ B;  1JLQ B;  1C4C A;  2V6A A;  3LQV A;  4NYO A;  2C3Y A;  1T9W A;  2KHC A;  3J7Z 5;  3BPS P;  4P74 A;  4PYA A;  1KDN A;  3PRV A;  4ER8 A;  3J7A 1;  4YB5 A;  1NHV A;  2OFG X;  3TA0 A;  5F3T A;  1F5A A;  4ZHR A;  5HK4 A;  3U7J A;  1KOO A;  3OJU A;  4FDF A;  1M90 T;  2BJ7 A;  4C8Y A;  3LF0 A;  4K5R A;  1KD1 T;  4DR1 F;  5HAN A;  1S1U A;  1OS5 A;  1T9T A;  5ETR A;  5FD1 A;  2ASL A;  1S99 A;  4K2J A;  4RW6 B;  2ZH3 A;  3V6D B;  1T3N A;  2IY5 B;  3HMJ G;  2DCL A;  2HBQ B;  3OBI A;  1YRX A;  3CUL A;  2RQM A;  2CYY A;  2FQQ B;  3N0V A;  2FJW A;  3PEH A;  2FVS A;  5L1K A;  4IG3 B;  5AXN A;  2FJA B;  3AD7 C;  3ENV A;  1NBE B;  5EUH A;  3OR2 A;  5J1N A;  1T7P A;  2IYG A;  4MKY A;  1YJW S;  1VRU A;  4RU2 A;  1UEU A;  2V9K A;  4HTJ A;  3H42 A;  4L76 A;  4J9R A;  1Q8B A;  2BKP A;  1KRP A;  4I6A A;  4DLE A;  1TL5 A;  2PGC A;  4ZOS A;  3M8P A;  4DZ6 A;  3IWN C;  4O44 A;  2CJQ A;  4JI1 F;  5HLF A;  2YXL A;  4RLE A;  3MEC A;  1NDK A;  4MKV A;  3BBF A;  4ECQ A;  4ZVH A;  4F36 A;  3KG0 A;  3N01 A;  4JOU A;  1N5Y B;  1AYE A;  3H5Y A;  1QTN B;  1X4B A;  2I8E A;  1GTH A;  4GVL A;  4LQ3 A;  4Q7A A;  4M5H A;  4OHY A;  4HVZ A;  2DH8 A;  2UUB J;  2MJN A;  4N5S A;  4URS A;  4DLG A;  2J6U A;  1T11 A;  1FDN A;  4C11 B;  2GX8 A;  2RML A;  3M2V A;  2HFO A;  3EZ5 A;  2W8K A;  3UD3 P;  3Q86 A;  1NXI A;  1ZM2 A;  2QMX A;  2YQ3 A;  2KG0 A;  1HWJ A;  2D41 A;  1NSP A;  2I1R A;  2MZJ A;  3R5J B;  3PX6 A;  2MZS A;  3NMA A;  2GJF A;  1UEV A;  4NZ7 A;  3KJQ B;  5G0R B;  2CZV C;  2NXJ A;  1FKP A;  5DZ7 A;  5CA5 A;  2E9Z A;  2IAJ A;  4PG7 A;  2C28 A;  4DSI A;  4LSL A;  2AV5 A;  1YJR A;  1PYS B;  3WZ0 A;  5HJY A;  3CJ8 A;  2CG8 A;  3PFE A;  4NCA A;  2RRA A;  4KRW A;  1EIY B;  4NA1 A;  1N5S A;  5ETQ A;  4KJI A;  5H9F K;  2GO9 A;  3K5L A;  2HIQ A;  2KYZ A;  3I31 A;  3RB0 A;  3J7Y I;  2Z58 B;  2LU1 A;  5CXT A;  1R7I A;  1DQA A;  2K7J A;  3PIO Q;  3T1H J;  2JEG A;  1KVJ A;  1FEH A;  4LQ9 A;  1VHI A;  3NKY A;  3AA8 A;  1L5U A;  3VV2 B;  1S6U A;  3JTO A;  2IAJ B;  4WP9 A;  5B0D A;  1VCT A;  1NKE A;  4YR0 A;  4F3O A;  1RDR A;  3AOA A;  5B09 A;  4DV3 F;  5J2M A;  4KQZ A;  2ZBI A;  3RBE A;  2G9O A;  2RJZ A;  1BD6 A;  1JLG B;  3IRX B;  1UJ6 A;  4ECY A;  3R1L A;  4WF9 Q;  1S59 A;  3LAK A;  1NPR A;  5ADZ A;  5CH7 B;  2UXB F;  2EVZ A;  4WZQ A;  1HQU B;  1BLU A;  3UWT A;  3KHG A;  4W92 B;  1J5O B;  2NXC A;  2G4B A;  2GQQ A;  1HNW F;  4X62 J;  3PYG A;  2E7W A;  2VV5 A;  4BS2 A;  5BR8 J;  3AJ1 A;  1RTD B;  1DAX A;  3NGK A;  2XS5 A;  1P9Y A;  1Y5L B;  2VG6 A;  3FCH A;  4NE9 C;  2B26 A;  2IMO A;  3MMB A;  2R7V A;  2DB1 A;  1M5S A;  3A8K A;  1T9Y A;  2P9E A;  3HKZ D;  3KG4 A;  2ZDO A;  4RNH A;  5ETM A;  4O4G B;  4D3G A;  3OL7 A;  1REG X;  2YVS A;  1VBK A;  4NZ6 A;  3CWJ A;  2QLJ B;  1IBC B;  5M2U A;  3D68 A;  1VIX A;  1IKW A;  2F4V J;  3IMQ J;  3BN7 A;  1H7W A;  2KH9 A;  1MNE A;  3CC7 S;  2J9D A;  4DG1 A;  4U7C A;  2X1A A;  2FC9 A;  3ZZP A;  3C15 A;  3NS5 A;  4OYM A;  4B9N A;  4WFX A;  4FNI A;  2KM8 B;  3T5H A;  5KG1 A;  3TZX A;  1T9X A;  1NH8 A;  4DUY F;  1AFI A;  5FII A;  2N4D A;  5EWE A;  4B3M J;  4RNM A;  4N76 A;  1NUE A;  3ENQ A;  3EZO A;  3IO1 A;  3J81 j;  3UNY A;  3AGX A;  1QDU B;  4ZLP A;  3QMQ A;  3LP1 B;  4AE5 A;  4XIU A;  2WSE C;  1XK8 A;  2BBE A;  2RF2 A;  4I6W A;  4DCO B;  4ZN1 A;  4ED3 A;  3PZP A;  5KFB A;  2VDI A;  3MEC B;  5D4P A;  1WUU A;  4M94 A;  1NJY A;  3DYA B;  3RW6 A;  4LF7 J;  3P4U B;  3SBM A;  1TQL A;  3QT8 A;  5A6W A;  2OHD A;  2P2C B;  4HLB A;  3KK2 B;  1RLC L;  3JSM A;  3U02 A;  3PHT A;  3DLL Q;  1EP4 B;  3D6M B;  3EE3 A;  3MCS A;  2VIC A;  3FSX A;  1TKZ B;  2V68 A;  3IG1 A;  5CYM B;  4O0N A;  4IO9 Q;  1VQ8 S;  4IR9 A;  4CI0 B;  2F8M A;  1FJ7 A;  1KVK A;  3THP A;  3MMJ A;  3PNI A;  2VQE F;  1HYS B;  2HHW A;  3VGS A;  4NLP A;  3LH2 S;  3L7O A;  4KHP J;  2DNL A;  4OI4 A;  1RWV B;  3GSD A;  3DLG A;  2VKZ G;  4GVB A;  4CO2 A;  9ATC B;  1XR6 A;  3W9H A;  2FJV A;  1LXN A;  2ZH9 A;  1VR6 A;  2ZNZ A;  2MQP A;  1J5E F;  3TZW A;  1SUQ B;  1FDD A;  1HBO A;  1S1X A;  1R6Y A;  4RW8 B;  1LOU A;  2E1P A;  1SBR A;  4N77 A;  3A4T A;  2VKR A;  5THW A;  4LRB A;  3WIU A;  4PEO A;  2HIY A;  1RT6 A;  4DOZ A;  4F0K A;  5J2Q A;  1KQS R;  5EWF A;  4U9R A;  1I94 J;  1I5O B;  1GT8 A;  1FK9 A;  1MWZ A;  2QL9 B;  1BMQ B;  5AJ3 J;  2P6T A;  5DJB A;  2C2K B;  1NME B;  1JLA B;  2DIV A;  3HSD A;  3MTJ A;  4DN9 A;  1ZOT A;  1ZET A;  1U2C A;  5IQQ A;  3KLF A;  1LWX A;  2BAC A;  1PJ5 A;  2QLD A;  4H54 A;  1WD6 A;  4GKJ J;  3GFY A;  4LF4 J;  3I4H X;  1IJF B;  2N7Y A;  3ISZ A;  5D15 A;  1KN6 A;  4IFY A;  4RWX A;  3DOK B;  4USJ C;  4WYW A;  5IM0 B;  2MGZ B;  3J80 U;  4DQI A;  2LEP A;  3HHD A;  1RT6 B;  2XMM A;  1XN9 A;  2APO A;  4IFV A;  1U1Q A;  1TL1 B;  1VLO A;  2XB2 D;  3D0G E;  4ZP9 A;  1RAH B;  2G2O A;  2MXY A;  4E8U A;  3OL6 A;  3RTV A;  5ETT A;  3B78 A;  5C24 B;  4A8Y A;  4DL5 A;  4DQR A;  3M30 B;  4LF5 J;  4ILM A;  4V19 J;  5F8L A;  5F3Z A;  3NMR A;  3K8W A;  2W25 A;  4I0W A;  1APS A;  1DBD A;  2MKS A;  2V63 A;  2HKE A;  4RNN A;  3Q8R B;  2ZH4 A;  1FHT A;  2I9S A;  3GQC A;  3S1T A;  1S12 A;  1BE4 A;  3EGN A;  3KHR A;  1UVI A;  2RIL A;  2YKO A;  3QSI A;  2AJQ A;  2YKP A;  4ZK7 M;  5I42 A;  4WXW A;  2FLN A;  2ZH1 A;  3DRP A;  3VAG A;  1U7L A;  4TU9 A;  4OYW A;  5B0A A;  1KQG B;  1U49 A;  2AYG A;  2VOO A;  2V2Q A;  5F8N A;  3K17 A;  2DPI A;  4F50 A;  2Y1L B;  3Q8P B;  1G6B A;  1KLM B;  2M0G B;  3CCZ A;  3J81 Y;  2NPF A;  3BO2 A;  4DS5 A;  4IRC A;  1OY6 A;  4KAI A;  4YN3 B;  1FWP A;  2F3J A;  2CQC A;  2QV6 A;  4URG A;  4DHV A;  3EIC A;  5KG2 A;  2DRD A;  3PW0 A;  2NS1 B;  2DGX A;  3FEY B;  4NLU A;  1TKX A;  1B0V A;  3H40 A;  1Q8K A;  4NEZ A;  3GCX P;  3W9J A;  1RTZ A;  1RHR B;  1B0P A;  5AJ3 F;  1JLG A;  1X7V A;  3IRX A;  4NA3 A;  5KFS A;  5KFK A;  1DQ9 A;  4DL3 A;  2CA9 A;  1NJW A;  1TP7 A;  1CJV A;  3FBB A;  1Q82 T;  4K4U A;  1JLB A;  2MTL A;  2JZ5 A;  5DDP C;  5IT9 U;  3EDR B;  1HR0 F;  1FT8 A;  4DSL A;  5D0H A;  2OD4 A;  3G6E S;  2V67 A;  3CJK B;  2F40 A;  4WP3 A;  2V8H A;  4DMZ A;  1KHV A;  4DU7 A;  4OHX A;  1XIQ A;  1C0T B;  2AJ2 A;  5L46 A;  2EI5 A;  2O5D A;  3PIP Q;  2OPR B;  4J90 A;  2WCX A;  1PBU A;  1MML A;  2M8H A;  3MR3 A;  1NM2 A;  1WC5 A;  4L75 A;  4P2F A;  4EBC A;  3KLE B;  4QU7 A;  1RWW B;  2NXN A;  4P7V A;  4XAK A;  2LXU A;  1MMD A;  5E3R A;  2QA2 A;  1S97 A;  2FY1 A;  2FHJ D;  2XZD B;  1JLC B;  2JLF A;  1EQM A;  2U2F A;  1L3K A;  2JVO A;  3BR9 A;  3QGI A;  2PMZ D;  2W01 A;  3AQP A;  3G6X A;  5JVH Q;  3CCQ S;  1RLD A;  3BR8 A;  1FFS B;  2GNK A;  2DHS A;  2VFT A;  1R8A A;  5J2Q B;  3M7V A;  1LQ9 A;  1NEE A;  1J2V A;  5IFM A;  3V6J A;  4JYA J;  4J9Q A;  1JQG A;  1S0N A;  5I4M A;  3M9O B;  3WC0 A;  4CLZ A;  3EX7 B;  2XTJ P;  3RRH A;  2DIT A;  2VBW A;  1X0P A;  5ETS A;  4NLR A;  1Y4Z B;  5KG0 A;  2BYC A;  1WWH A;  3D0I E;  3ITH A;  4I69 A;  1RYR A;  4LF4 F;  3DCA A;  1CS4 B;  2DPJ A;  1SIW B;  3DOL A;  5C42 A;  2NUH A;  1XNQ J;  1XMB A;  3K8V A;  3AOB A;  4G1P A;  1D9D A;  3SSQ A;  4ED1 A;  3H59 A;  1SJF A;  4MMO A;  8AT1 B;  1K73 T;  3CJ0 A;  4A47 A;  1P9Q C;  2MB0 B;  3IG1 B;  2XO6 A;  2HND B;  4LBP A;  1S9G B;  2UXD F;  4RW4 B;  2X1G A;  1EP4 A;  3MPU B;  2EFQ A;  1GEH A;  1F5C A;  1SVD A;  2WRM A;  1CSJ A;  2MQQ A;  2RS2 A;  2NYH A;  2V8G A;  2VFU A;  4NLY A;  1VBX A;  3I96 A;  2ZWO A;  3VWS A;  3BYP A;  3QWP A;  4G1Q B;  3R2D J;  3OFE A;  4ZPW R;  2ZVS A;  1XAO A;  3DLE A;  5L1J A;  1VQM S;  1VQP S;  1A6L A;  2R7U A;  2PMH A;  1UKU A;  3TJA A;  2QLW A;  3BGL A;  1X9S A;  2LVW A;  1B64 A;  1UA1 A;  5BYQ A;  4PRF A;  1GMW A;  3HHE A;  3DI6 B;  3CC4 S;  3TWZ A;  3DRR B;  4Z7Y A;  3W60 A;  2GIF A;  4ZIW A;  2LLZ A;  4B3S J;  4FF3 A;  4CYU A;  4R25 A;  1YJU A;  3N6M A;  1R31 A;  4UF4 A;  4JUZ A;  4CM0 A;  4ZPV R;  2XGP A;  4DV1 J;  4K5S A;  2NR0 A;  5B7W A;  2KXF A;  4RUC A;  1AW0 A;  4ZN3 A;  3AGY A;  3FK4 A;  3QFH A;  3PTW A;  3CO9 A;  3FQL A;  3IBC B;  2J0S D;  1NHK L;  2XO7 A;  4C48 A;  2DR7 A;  2KZM A;  2AZ1 A;  1WG1 A;  3M8P B;  2MZQ A;  3GE9 A;  2K8G A;  4DV6 F;  1N33 J;  2XGQ A;  4O4G A;  4ZPA A;  4OX9 J;  5F9L A;  2B5J B;  3M1V B;  1IQT A;  2GIR A;  3HFZ B;  1EX8 A;  4F4A A;  4Q0B B;  2BJ9 A;  2W2P P;  1MN7 A;  3DKD A;  3I87 A;  3TW0 A;  2B8Q A;  3C6T A;  4JB8 B;  5FDL B;  4O0I A;  2GHV C;  1P1T A;  1RHU B;  1TMJ A;  2XHW A;  3Q0A A;  1AZS B;  5I3P A;  1F1B B;  2GA7 A;  2IBO A;  1HI8 A;  1RTI A;  2QG9 B;  1YHQ S;  1V5I B;  4ECU A;  3MM5 A;  5KFC A;  1Q79 A;  3I6P A;  5AE3 A;  2CFX A;  2J0X A;  1HNV B;  2YWF A;  5A8W B;  2J8S A;  2FLO A;  3ZTR A;  5KFJ A;  2R8J A;  4TN2 A;  3RRK A;  3I55 S;  4TU7 A;  1KFS A;  2CQ1 A;  1R8P A;  2HWI A;  4DI6 A;  5CCM A;  1VK8 A;  2V5H G;  4FKX A;  2F5G A;  3VGU A;  2R9L A;  4ZHR B;  3KYL A;  4CCH A;  2Q66 A;  1BUX A;  4ZP8 A;  3UCG A;  1NO8 A;  4KHM A;  2BKN A;  3TUI C;  2FHK A;  2WVC A;  4TLR A;  4DS4 A;  4WK1 A;  1FRH A;  2AHO B;  2B4U A;  3MI7 X;  4YEA A;  3R7B B;  1RBO B;  3BPD A;  1IKW B;  4TU8 A;  1F0X A;  3P45 B;  3DOL B;  2IRX A;  1PC4 A;  3BYR A;  4C7Q A;  1S1W A;  1MRO A;  3KLV A;  1HPZ A;  3LWL A;  2R8G A;  2CPY A;  2V8P A;  4MFB A;  3J81 U;  2AWZ A;  1X9W A;  2E1C A;  1FD8 A;  1PIE A;  3IRW P;  4PQA A;  2BXJ A;  3ISN D;  2DVI A;  2V69 A;  4K4Y A;  2ATL A;  1CQM A;  3UR3 C;  4ZKA A;  3VAI A;  5GMK a;  1NK4 A;  2BAN A;  2HS4 A;  1KHW A;  2LEA A;  2ZD1 A;  3H7H B;  4OZJ A;  2ZE2 A;  4NOH A;  4OZL A;  3WQP A;  3QWU A;  3OTO J;  3B8H A;  2ZM6 F;  2RUG A;  1SJ1 A;  1SKU B;  2HFZ A;  3BSA A;  4IH5 A;  5J2M B;  3D6H B;  4EEY A;  1T05 B;  1YBU A;  1HBU B;  2AX0 A;  2Z2Z A;  4DQP A;  3KNA A;  3TUZ C;  5FLX Y;  1ZBT A;  3HXM A;  4R0E A;  1SQG A;  2UUC F;  2CNN B;  2GVZ A;  4MK9 A;  3T9N A;  3I0S B;  2HWT A;  1FKO B;  2XSF A;  4QWD A;  1T02 A;  3JYT B;  2UVU A;  1X9M A;  4A8Q A;  4HHJ A;  1F6T A;  3Q89 A;  4CLP A;  3F73 A;  1H0H B;  3KDN A;  2HUR A;  5GAG I;  1T03 A;  3NGR A;  4JV5 F;  4RL1 A;  4F2S A;  4MAK A;  4MH8 A;  5DG8 A;  4J5O A;  2ZJQ Q;  2ZUG A;  2V0N A;  4PUO A;  1S0O A;  1MG7 A;  1HD1 A;  2LEC A;  1EKS A;  3DMJ B;  1A9N B;  1TVR A;  1H74 A;  1PAE X;  1YK9 A;  3C66 A;  3S8S A;  2PEH A;  1Q5Y A;  3M8Q B;  1SC6 A;  3JSB A;  3NAH A;  3HT3 A;  5FLX U;  4XDC A;  1HLW A;  5GME A;  4BC7 A;  1VDH A;  2HHP A;  3IWL A;  3J7A N;  3NNC A;  3X3U A;  2DH9 A;  1HNX J;  5KFD A;  2W9B B;  1CPZ A;  2J7K A;  3DC2 A;  4ZLL A;  1RQ0 A;  4NXN F;  2ZWP A;  3T1Y F;  1LW2 B;  1C0U A;  4MIW A;  3ENA A;  4G6V B;  3HSG A;  1FJC A;  2R4F A;  4FVM A;  3CT9 A;  1DHM A;  1SQF A;  3X1L B;  2CDQ A;  5G4D A;  2ZHB A;  1N88 A;  1U6B A;  2YPY A;  3EZU A;  2FY8 A;  2EFP A;  2KDO A;  4HL9 A;  4F26 A;  4R5P A;  1Z1Z A;  5U47 A;  3CJR A;  1HNI A;  5D6G A;  3AKO B;  2KVI A;  3JQJ A;  3ZTQ A;  3MHY A;  4DL6 A;  4ES2 A;  2OEK A;  4Q2L A;  2ROP A;  3FSI A;  3Q23 A;  4PWD B;  5HN0 A;  2KXH A;  5JUM A;  4AXI A;  1U2F A;  4ELV A;  4I6Y A;  4QR0 A;  3SZ2 A;  4QWA A;  4NLG A;  3MDF A;  1JLA A;  1WHY A;  2ASY A;  5H1S V;  1S9F A;  4DFK A;  1WG4 A;  2FVP A;  2UXD J;  2G0C A;  1Q5V A;  2XMW A;  3RBD A;  1TAU A;  2JZ8 A;  3MPV A;  3DLJ A;  2MQL A;  2CNK B;  4U7U D;  1RT2 B;  2BRL A;  5HAT A;  1HNZ F;  5F9N A;  5KFQ A;  4YDX A;  5GAD I;  4I2P A;  4NCG B;  4QOT A;  2VFR A;  2VJV A;  4N41 A;  5A0Y B;  2E1R A;  4NCG A;  1WHX A;  2E5G A;  1KQF B;  3F0N A;  3P5B P;  2H5E A;  2GMJ A;  2RU3 A;  4KHP F;  1RAG B;  2YNI A;  1EAY C;  2FIU A;  5IT0 A;  2D9P A;  4CH0 S;  3B4D A;  4I64 A;  1VC6 A;  4LFA F;  3SQG B;  4HH1 A;  3JAM Y;  2CPD A;  1RHQ B;  4ED8 A;  3T9Z A;  1I3O B;  2XWX A;  3CCL S;  1YZ6 A;  2CVI A;  3FZB A;  2KFY A;  3H20 A;  1RTH A;  4CO5 A;  1PSD A;  3NP5 A;  3M8S A;  3OSP A;  4FBT A;  2CQB A;  4DV2 F;  4RW8 A;  3OL8 A;  2WSF C;  4FYV B;  5LMN J;  2OD6 A;  3SCJ E;  4ED4 A;  3LW5 C;  4I2P B;  4B9V A;  1HNZ J;  3HDS A;  4C8Z A;  1HW8 A;  5KFM A;  5DRK A;  2FHO B;  2JRS A;  3KUG A;  1KC8 T;  2QA4 S;  1U0S A;  1TL3 A;  2A3J A;  2NXE A;  2VOD A;  2VD3 A;  3UR0 A;  2AU0 A;  1PBA A;  3MPD A;  1RUS A;  2WOM A;  2IVF B;  4KR0 B;  2DO4 A;  1B7Y B;  5IQ6 A;  4NPO A;  4YHH J;  1PG5 B;  3TAN A;  4IOA Q;  1N56 A;  2E5I A;  1RU2 A;  1RAF B;  1F9F A;  3KLE A;  3QPI A;  1UMJ A;  2E1A A;  2Z8Q A;  3QT5 A;  2J0W A;  3DYA A;  2YX4 A;  4WBF A;  3S7R A;  2HHH J;  1U1N A;  2R7X A;  4TYA A;  1K0T A;  4AD6 A;  4QYR A;  2HAI A;  2VQF J;  3C46 A;  2OO4 A;  2WON B;  4ZS6 A;  2OEJ A;  2M2B A;  3QSY B;  2Z57 B;  3PX4 A;  3MAH A;  3UCZ P;  5LXY A;  4P2S A;  2B51 A;  4Y0F A;  2DGV A;  4MKB A;  5KT7 A;  2COL A;  4M5M A;  3MM9 A;  4ZJL A;  1S72 S;  1S6Q B;  3MM6 A;  4BC9 A;  2ZM6 J;  4ECX A;  4OJG A;  4DFJ A;  1UA0 A;  1QSY A;  1WC1 A;  4HR2 A;  1AA1 B;  2C3O A;  4ZCK A;  1V5V A;  4DL4 A;  1VQ6 S;  4O3R A;  3ETO A;  5KOW A;  3CJ2 A;  2CQI A;  3M8Z A;  3T1H F;  1IR1 A;  3CNQ P;  1RU1 A;  2E1M C;  4F3M A;  1VC5 A;  2QLX A;  3THT A;  1QUV A;  2XUL A;  2B3T B;  2EC0 A;  1EKR A;  2Z30 B;  4UW2 A;  3HD1 A;  2V2V A;  5C25 B;  1Z4U A;  1EZZ B;  3UVJ B;  3TNV A;  2MDA A;  4KHR A;  1SIZ A;  1YX2 A;  3RUB L;  3Q2T C;  4ZMM A;  2AYB A;  4OL8 A;  4DPY A;  3FEZ A;  3LP2 B;  3BKF A;  5KG7 A;  5CAB A;  2HG4 A;  4P71 A;  2H3E B;  3GTY X;  2UUA J;  2AJF E;  3I4P A;  2OPP A;  5C24 A;  1D3W A;  2YBV A;  1ELO A;  4OI3 A;  4P73 A;  1NJI T;  3MTK A;  3RJM B;  3SDE A;  5DDQ C;  4DR6 J;  1H38 A;  4DL0 C;  2FLP A;  3FGV A;  2BA9 A;  4J9S A;  3MEK A;  3EUN A;  3N5B A;  4TYB A;  3RG6 A;  3TAP A;  2XZT B;  1ZTT A;  1GXT A;  3GFH A;  4FNH A;  4ZIT A;  5H9E K;  3TVY A;  5EHH A;  1G7C B;  3OFF A;  3ZFV A;  3DOK A;  1S77 D;  2AX1 A;  2VBX A;  3IWX A;  4W90 B;  1R8B A;  4GC7 A;  1YRT A;  2A18 A;  4WYL A;  1FKO A;  1WSV A;  2X51 A;  3R6L B;  3T1Y J;  3BBB A;  1N0V C;  1S57 A;  1RTD A;  2AP6 A;  4TQR A;  3FJ2 A;  2ZNY A;  3Q8Q B;  3OJS A;  1DTT B;  3GV5 B;  4DR5 J;  3LTO A;  2NYI A;  3PKM A;  1LK5 A;  2J5A A;  1VIO A;  4I4B A;  4U8Y A;  4B9S A;  1TL3 B;  2JC0 A;  1Y7P A;  4P52 A;  3R5G A;  2WAQ D;  2YNG B;  4DPX A;  1Y9O A;  5T41 A;  2VBZ A;  1CUL A;  2VFS A;  4YQW A;  2DR6 A;  5KFL A;  3M2R B;  5IM0 A;  2ADC A;  1XMQ J;  5CYQ A;  2DNR A;  4PKD B;  3U1M A;  1LFP A;  1N5Q A;  4ED2 A;  2C2Z B;  4A8X A;  2A2D A;  4DPU A;  3T5K A;  1MWY A;  4EZ9 A;  1OPZ A;  4MFB B;  1YBA A;  3MM5 B;  2H54 B;  3HVW A;  4I1T A;  1NPP A;  2YNH B;  3K5P A;  4QIG A;  3DDN A;  3A3N B;  4DCP B;  1VQ5 S;  1RAC B;  1KSP A;  4JI7 J;  5HI7 A;  1U8S A;  2B9Y A;  4A8W A;  1WTF A;  3I82 A;  1N34 J;  2DGU A;  1G3O A;  4LSN B;  3OTD A;  4LF6 J;  4CLF A;  3M9M B;  3EPG A;  3E51 A;  1TL4 A;  2QT7 A;  3BM7 A;  3N28 A;  2I6W A;  3T19 A;  1I6J A;  1C1B A;  1DAR A;  3GR0 A;  3K7R A;  4IDK B;  2LDI A;  4PPD A;  4DN0 A;  1V3S A;  2RRB A;  2MKI A;  4KT0 C;  2BAB A;  1URR A;  1RT1 A;  1UEK A;  1SUQ A;  2ZKU A;  1L3T A;  4TY8 A;  5HSP A;  3PW2 A;  3LZ8 A;  3VAF A;  2WBR A;  4CYU B;  1WI8 A;  3GIM A;  2R42 A;  3MGJ A;  3IBW A;  2AZ3 A;  4O23 A;  3LP0 A;  3DU5 A;  2XY6 A;  3L95 X;  3PW7 A;  3RR8 A;  1E6V A;  4GKK F;  1O0P A;  3A3P B;  1KR4 A;  5IS2 A;  2GJI A;  2X3D A;  2AJ1 A;  3NGD A;  4A8O A;  5L38 A;  1RAB B;  2JVR A;  4DR3 F;  3SQO P;  3K0J A;  3G8S A;  1OMS A;  1A0O B;  3UD5 A;  1NK7 A;  2ASJ A;  2DR8 A;  1RWN B;  1CG2 A;  3FDS A;  2OSQ A;  4EUV A;  3O8W A;  4WK3 A;  4O3O A;  5DG9 A;  1NH7 A;  4NAS A;  4ITS A;  4OLP A;  3UQS A;  4O44 B;  1TVR B;  2HVZ A;  4ZVQ B;  2BZ2 A;  3FBE A;  3R3T A;  4DSK A;  3FKB A;  2QZ8 A;  2IBK A;  1OY8 A;  2W4D A;  3ULH A;  4A8F A;  1UL3 A;  4MIA A;  3GIK A;  3OR2 B;  3BQ0 A;  3ISN C;  3M05 A;  3N5F A;  1QAI A;  4LF7 F;  1CJK B;  4F02 A;  4RR5 A;  3MPW A;  4J80 A;  1UPM B;  2IRU A;  3UE2 A;  2CQ0 A;  3G8Q A;  4KKO A;  4DV4 J;  2V4R A;  1GMW D;  4FPI A;  2LP4 A;  3NBP B;  3BDP A;  4DV5 J;  4KV8 A;  1IM4 A;  2HBZ B;  4MJK A;  1ICE B;  2XI3 A;  4G1Q A;  4MYU A;  1M0S A;  2KJV A;  4PG6 A;  3R97 A;  1N5T A;  4CWB A;  3LWM A;  3L7U A;  2POK A;  3OQ2 A;  1UCN A;  2H4W B;  3AFG A;  3MM8 A;  4OJ1 A;  2EG2 A;  5L1I A;  2LKZ A;  4Y2K A;  2Y0B B;  2CJB A;  4ZDN A;  1XJW B;  4NI2 B;  5LJ3 Y;  4KGM A;  2GMH A;  2C2O B;  2EC2 A;  4ZVO B;  5KG5 A;  4JI4 F;  3FFI A;  1JLC A;  3WDO A;  4TNO A;  2NXU A;  3JSR A;  4K4Z A;  2JSX A;  1QAJ A;  3CE8 A;  3L09 A;  2BKO A;  3UO0 A;  3LO3 A;  4AL7 A;  2HLT A;  3RAX A;  1IBM F;  2IRY A;  2JL9 A;  3OVS A;  2AJ0 A;  4I2Q B;  2OPP B;  4M5D B;  2A0F B;  4RJV A;  3VGV A;  4ETX A;  2BJE A;  3H90 A;  1RT5 B;  2IDL A;  3L4B C;  4FVC A;  3CCM S;  1CUL B;  1YKW A;  2JDJ A;  2AGP A;  5FJ4 A;  4FS1 A;  3MUV P;  3GIJ A;  4IQX A;  2YWH A;  2A1B A;  2AYM A;  2GO8 A;  1F9H A;  3K89 A;  4B9L A;  1M5K C;  1TKD A;  2MHE A;  3PVX A;  1HWL A;  4WE1 B;  4ZVF A;  2BJD A;  4DV0 F;  3C2P A;  1HQ2 A;  3A8J A;  2YTC A;  2R2T A;  2MMY A;  2E9T A;  1SH0 A;  1FTC A;  3FRZ A;  3HCX A;  3KDO A;  5A2Q Y;  3FZ2 A;  2HSE B;  1IM6 A;  1U6Z A;  3PW4 A;  2BEF A;  1FRK A;  1S1V A;  3G86 A;  3LAL A;  3MM6 B;  5LM7 E;  3T6B A;  4ZJQ A;  5B08 A;  3OHB A;  2HHT A;  3I5B A;  4MKA A;  1RP5 A;  1TKX B;  2I38 A;  1FRJ A;  2BOA A;  1RIS A;  4QIV A;  1Q95 G;  3W63 A;  4TKT A;  1RXO B;  1UWB B;  4GKJ F;  4B9T A;  2BJ8 A;  1N5Y A;  2Q2G A;  1Y3K A;  4C8N A;  1ARO P;  4DR2 F;  1IQZ A;  3D2W A;  3K59 A;  1BQX A;  2ROG A;  1B7F A;  1N32 F;  2YY3 A;  1IWA A;  1U25 A;  1YG0 A;  2MLX A;  2V4J A;  1MLA A;  1RAA B;  1VYA A;  2LQ9 A;  4NLW A;  2HGN A;  4QZV B;  3W1Y C;  4HAC A;  2LFV A;  2XMV A;  3OXL A;  1WOR A;  4HH0 A;  3NOG A;  3P3D A;  2R7O A;  3C14 B;  3PG9 A;  4FZV A;  4EBD A;  1IBL F;  1E6V B;  1H2V Z;  4ED7 A;  2G1D A;  5KFA A;  3M6U A;  4D3H A;  1FNM A;  3OVB A;  2J7W A;  2OPQ A;  3FCW A;  4WTO B;  3V6D A;  1JLF B;  2CAJ A;  4YB1 P;  3KK1 A;  1U1L A;  1S1U B;  4LRF A;  1S7I A;  3DRX A;  1NHU A;  1RWO B;  1CJT A;  2DXF A;  2ZFH A;  4ZPC A;  2HBY B;  2O3D A;  1X4D A;  3L9Z A;  4RWW A;  3BN4 A;  1S9G A;  3HM9 A;  2FTR A;  4PPZ A;  3JSY A;  1PYT A;  2OFH X;  4PR6 A;  4M5J A;  3OUY B;  4K0K J;  2RH3 A;  4QW8 A;  4C8K A;  4Y2C A;  2Y0S D;  3HSJ A;  4NA2 A;  4ENO A;  1VIS A;  4ES3 A;  3W3S A;  2F7V A;  2OSR A;  2B9X A;  1S5Z A;  3FEX B;  2AT1 B;  2DGS A;  2NLW A;  1RTH B;  1KTV A;  3EGW B;  3MM7 B;  3ITH B;  4UZC A;  4ANC A;  4QIW D;  2B56 A;  2B7B B;  2B7C B;  3BGU A;  4O4R A;  3MFI A;  4J9O A;  3R2C J;  2PC6 A;  2K3K A;  4C9D A;  2GFF A;  3AOD A;  1GMU A;  1KOH A;  1YQH A;  4DEZ A;  3RGI A;  4F04 B;  5DDR C;  1SV5 A;  2FUG 9;  1NPK A;  3GJR B;  5C42 B;  2CQ2 A;  1LK7 A;  2W2M P;  1U6F A;  5BXI A;  4OI6 A;  4I7F A;  3RW7 A;  3PY8 A;  1OYD A;  2HAF A;  1VBZ A;  1HHQ A;  1Z2Z A;  1FXD A;  2KB2 A;  3ZZT A;  3H0P A;  5DM6 Q;  1WKL A;  3KWM A;  1U0H A;  4J7C A;  4Q45 A;  2DD8 S;  5HQL A;  2BX6 A;  5HMY A;  1WEX A;  4UQG A;  4X65 F;  4GVB B;  4Q5V A;  1UVK A;  2KI2 A;  5AXM A;  4NEY A;  2OPR A;  4OFZ A;  5BR8 F;  1C1C B;  1VQN S;  4UOC A;  3E2E A;  1M5O C;  1QJH A;  2XYP B;  3I9V 9;  4FP9 A;  4IOC Q;  3BB5 A;  5D4L A;  1MSW D;  3D3C J;  1GX5 A;  2HS0 A;  2P5V A;  5K5M A;  1SV5 B;  2H48 B;  3HVR A;  3I0R B;  1G2E A;  4CLK A;  4HHU A;  3PV8 A;  4CNY A;  2IFX A;  2X3G A;  4WTY A;  2H4Y B;  3FNN A;  1N5V A;  3DLG B;  4FKY A;  4ZA1 A;  3G4S S;  4P9S A;  3LP1 A;  2CUY A;  4OZN A;  3KLI B;  1W2I A;  1HNI B;  3TAM B;  5DET A;  2CQ4 A;  3EGV A;  3FRY A;  4LFA J;  3G71 S;  2R3V A;  3HX9 A;  2B43 A;  4HHH A;  3NL0 A;  3CDW A;  2PI5 A;  3H4B A;  1CJV B;  1FEE A;  5HQM A;  1HI0 P;  2FVR A;  4C0H A;  1I94 F;  3QJP A;  3SEO A;  1U2R A;  1Y5I B;  1C0U B;  2V94 A;  2VPX B;  2EBE A;  2ZBQ A;  4MK8 A;  1VC0 A;  1RYS A;  5CQG A;  1M1G A;  3OT9 A;  1UTA A;  2C2M B;  3MCO A;  2IHR 1;  4YME A;  5IV4 A;  3MOJ B;  2ZZT A;  4PWU A;  3NGS A;  4CLL A;  4Y00 A;  3DGV A;  4DV3 J;  3TA1 A;  1PO6 A;  5K8P A;  1P1L A;  4LF9 F;  1RKJ A;  2CPF A;  5AXK A;  5C7P A;  2WSC C;  4R5P B;  2E9R X;  2OPS B;  3G6V A;  1JLF A;  1R27 B;  5GVQ A;  1REV A;  4RZR A;  4E2F B;  4G65 A;  2XLK A;  2JC1 A;  4FXV A;  4N47 A;  3UVJ A;  3HPO A;  5HMX A;  4LRC A;  3DDK A;  1LW2 A;  4ID8 A;  2IVM A;  1Q8L A;  5EN1 A;  2KRB A;  4Y2I A;  4LF1 A;  3VAL A;  3US5 A;  3KLH A;  2XMA A;  2XS2 A;  3GLJ A;  4GO7 X;  4N8N A;  2BAN B;  2YWW A;  1WNE A;  3VAH A;  1IXK A;  2HQC A;  2Q3P A;  2YKA A;  3CED A;  3FSY A;  1EAR A;  4Q44 A;  3HFV A;  3DLB A;  4QYZ K;  2EKY A;  3QO9 B;  5I3U A;  1H72 C;  2A6M A;  1HBU A;  3BKU A;  1IKY A;  4TY9 A;  4UTG A;  3SSR A;  1DLO B;  1R0A B;  1T05 A;  2BE2 A;  3CB4 A;  1BXN A;  1WEZ A;  3OPK A;  4RPF A;  3HF5 A;  4ED5 A;  2C42 A;  4H4K A;  5D3G B;  3NGU A;  3QGP A;  4UZB A;  1ZZN A;  3M8R A;  1ZTW A;  2UVR A;  5DZ6 A;  2HVD A;  3LAN A;  1HL6 A;  5E3Q A;  3FUY A;  3HVA A;  5L8R C;  3NNH A;  2GV1 A;  1VQ9 S;  3D9B A;  4JP8 A;  4YP3 A;  3RRG A;  2EK6 A;  2H51 B;  3AT1 B;  2MKJ A;  1AXQ A;  5KG4 A;  3T41 A;  3HHL B;  3HFK A;  2HQI A;  1FKP B;  2QA1 A;  4HT7 A;  2OP5 A;  4ZVP B;  5BYR A;  2AEM A;  4DR1 J;  4UY8 5;  3NEK A;  2DCU B;  1S79 A;  2KTQ A;  2P6S A;  2RB7 A;  3D54 A;  1NK9 A;  1Y5N B;  1MMN A;  5E2Q A;  2W7A A;  2HYI B;  4MK7 A;  4L72 B;  1XNR J;  1TKZ A;  1ZPV A;  2IJR A;  4QWB A;  2NZC A;  1JNR B;  4K59 A;  5KFW A;  1N6Q A;  1P27 B;  1Y11 A;  2LYV A;  2HFV A;  3LGM A;  3M6V A;  3QLH A;  1ZM4 A;  4IH6 A;  3V2U C;  1SL2 A;  2BDP A;  4Q8F A;  1V6H A;  4JV2 A;  3S6E A;  2F63 A;  2GHP A;  1FK9 B;  3RBZ A;  2OH2 A;  1HYS A;  1VQY A;  3VQT A;  1FX4 A;  1R3N A;  3W62 A;  2M88 A;  2MJU A;  4X4P A;  4YFU A;  2BQU A;  1FRL A;  1TL7 A;  2I0X A;  4NI2 A;  2PSZ A;  5ETO A;  5JMN A;  1XNQ F;  5KFU A;  2XLI A;  5LOQ A;  3E3X A;  2ZHA A;  3OFH A;  4LVN P;  1D1U A;  3MCM A;  1Z2L A;  3D3B J;  3QGH A;  3OR1 A;  4Q2M A;  4C97 A;  1GFW B;  1ZYQ A;  1NJZ A;  1DZ5 A;  3OXG A;  2ZIT A;  4BDP A;  1KLN A;  4NWB A;  2MKK A;  4JI3 F;  5CZV A;  4OHV A;  5EDW A;  4BLG A;  1W2B R;  2C3P A;  4OYP A;  2HHH F;  3R5A A;  1NLT A;  1Q8I A;  3NNA A;  2EW9 A;  1NRK A;  4IDK A;  1E6Y B;  3QZ8 A;  3I56 S;  2DHA A;  3K2Y A;  1FE0 A;  1U09 A;  3UD4 P;  4PQU B;  4X4V A;  1E6Y A;  5D77 A;  1Q81 T;  4CH7 A;  1WDT A;  2AJ4 A;  2BUN A;  3O5T B;  3WBZ A;  3SI8 A;  2JEF A;  1F2G A;  4RUB A;  5HVH A;  1VQ4 S;  3HVT B;  3U1L A;  2OJ3 A;  1MU2 B;  3MCN A;  3Q8S B;  4FF4 A;  4PWD A;  3OL9 A;  1RB0 A;  3FMB A;  1HQE A;  1JXL A;  1RCX B;  1KTQ A;  1UAW A;  1FVQ A;  4JBC A;  4RW4 A;  4DV1 F;  2DGT A;  2AD9 A;  3HO1 A;  1S4F A;  2FB0 A;  1U26 A;  5HP1 A;  1RT3 B;  3M6X A;  4B9M A;  5SUH A;  4ILR A;  2XG8 A;  3HZE A;  2FJX A;  4K50 A;  4OV6 A;  5DQH A;  1S1V B;  3CDU A;  4F4K A;  5E3A A;  3FC9 A;  3TZY A;  1ZH5 A;  4V1A k;  1NDP A;  1KVI A;  4IO1 A;  4RW7 A;  5T7L B;  3ZZU A;  4DUY J;  3P5T L;  3GFX A;  1TMM A;  4EO8 A;  3KJF B;  1TZ0 A;  2IM1 A;  3HZG A;  2ABY A;  3EJM A;  4WFN Q;  1RT1 B;  1HMV A;  1T94 A;  4USM A;  3JB9 k;  4JYA F;  2YX7 A;  2R7T A;  5KG3 A;  2YNH A;  3WHI A;  3BSN A;  2LQ5 A;  2XSJ B;  3P8B B;  1QM9 A;  2ERR A;  2VJU A;  1F2H A;  1S1T A;  5IT9 Y;  3HHL D;  2X1F A;  1QTM A;  3CCE S;  2ZBC A;  3RB4 A;  1UJ5 A;  2DNN A;  4ZVU B;  1FJE B;  4QR2 A;  2XCA A;  3VTI A;  3PR4 A;  5GAH U;  5DS7 A;  2R7Q A;  2ZUA A;  3PYF A;  4LSL B;  5LL6 d;  3OTO F;  2UVW A;  4E98 A;  4QBU A;  3AB4 B;  4CT8 A;  3CF5 Q;  3IR5 B;  2YWG A;  2XNR A;  2QLF B;  3M2R A;  1BC6 A;  3NOC A;  2Z0G A;  2DNM A;  1PJ6 A;  5A8R A;  1VBY A;  2BQR A;  3PXG a;  3JYT A;  3NLC A;  2ACM A;  5J1E A;  2JOQ A;  2XSJ A;  3A13 A;  3ICL A;  1X4E A;  3PEJ A;  2N7C A;  4C11 A;  4KE5 A;  1ACM B;  3J7Y U;  3UFC X;  1IKV A;  2ZH7 A;  3FBF A;  1WC0 A;  1JWW A;  4RW9 A;  1YIT S;  3NBP A;  1RTJ B;  4TQS A;  4F4W A;  4DR4 J;  1U24 A;  2F1F A;  3LGH A;  4OYZ A;  2ZC4 A;  1G1X A;  1EQ0 A;  2PA3 A;  3M32 B;  3AY0 A;  5HO4 A;  2J6T A;  2OPS A;  1RHJ B;  2DGQ A;  1N0U A;  5KFX A;  2NCK L;  3PR5 B;  1RAD B;  2I5J B;  2IA6 A;  1O51 A;  1UP1 A;  3MAA B;  3FBC A;  4NL5 A;  1OQ6 A;  1WHW A;  3CC2 S;  4Y34 A;  5GAG U;  4A48 A;  3G82 B;  3HUL A;  3GV7 B;  5A2Q U;  3T5J A;  2EEY A;  2V8V A;  3K5M A;  2ADB A;  5J2P B;  1YJ9 S;  2RIJ A;  5HQ8 A;  2BE7 D;  3EVW A;  4AUK A;  4PG8 A;  3D7S B;  3H2V E;  4EI2 A;  5CCL A;  4WFB Q;  4QW9 A;  3OVA A;  2C2D A;  4KSE B;  4ZPT R;  3UCU P;  2Y9H A;  2MYF A;  4OV1 A;  1N34 F;  4QU6 A;  2WOM B;  3CD0 A;  5K14 B;  2RS8 A;  2FPH X;  5LSO A;  4JI7 F;  5CD4 A;  3T1A A;  3MXH P;  1HA1 A;  3L3C A;  4J37 A;  2IDE A;  5RUB A;  3AQO A;  1UWB A;  1VQS A;  1SPB P;  5E33 A;  4DPW A;  2KM8 C;  4F4Z A;  2FHM A;  4IRK A;  2I5J A;  3ELH A;  3R5B A;  2GAG C;  1KEK A;  3OR1 B;  6FD1 A;  2QLB B;  3IAM 9;  2FZK B;  3POT B;  1FVS A;  3VR1 A;  3D4J A;  2MQO A;  4JV1 A;  3DOM B;  3GYG A;  4IYQ A;  4B3O B;  3MM9 B;  4AFF A;  2Q6C A;  2BV3 A;  2QYC A;  1RWM B;  4P2X A;  4CDI A;  4CM2 A;  5KFH A;  4QWC A;  4DV7 J;  4FBU A;  3PCO B;  3VAJ A;  4C3L A;  1LFW A;  2IPO B;  1ZM9 A;  3AAW B;  4N8O A;  3WX4 A;  2XY5 A;  4ILL A;  1HAR A;  2IA0 A;  3ADA C;  4LJM A;  4JI0 F;  3BGR A;  1K44 A;  1ROF A;  3CCT A;  1AB8 A;  3GJT B;  4PZV A;  2ASD A;  1JJ2 R;  1Q16 B;  2DNQ A;  3C6U A;  3DLK B;  4IFY B;  1VHF A;  3KLI A;  3NGT A;  2HBR B;  2F9J A;  4IG0 B;  1IBL J;  1CS4 A;  2HVE A;  3CJS A;  1HBM B;  4WFY A;  1WC3 A;  1TFW A;  3C16 A;  3KJV B;  4K0K F;  5A0Y A;  2KVQ E;  1ZA2 B;  2MQ8 A;  2MY7 A;  2ZBR A;  3C16 B;  3KJV A;  4IUF A;  3W5Y A;  4KBI A;  3K58 A;  1DY3 A;  3VVU A;  2LQJ A;  2QJ3 A;  4QR1 A;  3G9C A;  1TK0 A;  2FHJ A;  2ZH6 A;  4OYO A;  4X64 F;  3AB2 B;  2H5I B;  2CPZ A;  2PFD A;  3W5Z A;  1OO0 B;  4M5K A;  2OTL S;  4OX9 F;  1FJG J;  4QIF A;  3MR2 A;  2VC0 A;  2HNY B;  2CPI A;  3CJ5 A;  3GPA A;  4U7U K;  4Q43 A;  3SQG A;  2HHU A;  3D1O A;  3MR5 A;  1WF1 A;  2YH0 A;  3B82 A;  2UXB J;  3TAR A;  3VAM A;  1SL1 A;  3UI3 A;  1XR5 A;  2KT2 A;  1J27 A;  2XWY A;  2MEW A;  4DX7 A;  1F5B A;  2HZA A;  7FDR A;  3MR6 A;  1J5E J;  4KH0 B;  2G1H A;  3UDC A;  1XER A;  2OIH A;  1NND A;  1X31 C;  3W61 A;  2AGQ A;  1FCA A;  4B08 A;  1M1K T;  3CJ3 A;  4A8K A;  1XC9 A;  3BSO A;  4IQM A;  2UU9 J;  1CLF A;  2ZEJ A;  5E0O A;  2E66 A;  1HHT P;  4USK A;  4OI1 A;  3GMG A;  1DFD A;  2XZW A;  1TFY A;  2HPU A;  5ETP A;  3QO9 A;  1GXU A;  2OPQ B;  2BM1 A;  3D0H E;  4K8R A;  2J9E A;  3ILO A;  3LUY A;  4EYI B;  3BV8 A;  4M8L A;  3CDA A;  2BVZ A;  1FF2 A;  1FFW B;  1JK9 B;  2VL1 A;  3AOC A;  1C2P A;  1NSQ A;  5D4N A;  1IKX A;  3SV3 A;  2W9B A;  1WC6 A;  3HJV A;  1ZAW A;  3UN3 A;  1HFE L;  2FZG B;  1QD1 A;  2V2Z A;  5IC6 B;  4F0H A;  4NLV A;  2JRR A;  3JSM B;  2ODX A;  2CJX B;  2ALY B;  1JB0 C;  4OIX A;  2C2R A;  2HMI A;  1SJQ A;  2HFN A;  4NRU A;  3BBC A;  1QY7 A;  4RUH A;  5C2C A;  1YJT A;  3DMJ A;  1CJU B;  3NS6 A;  7FD1 A;  3UPF A;  3BO3 A;  1UVN A;  1JMT A;  4PUO B;  1KP6 A;  2W9A A;  2BJ3 A;  2OLW A;  2CQH A;  1T95 A;  4KGK A;  4MTP A;  4WXO A;  2ZBP A;  3HK2 A;  1OJ4 A;  1RJJ A;  2YKQ A;  5CZX A;  1N4L A;  2Y1R I;  2PEB A;  3JTN A;  3GII A;  4ECV A;  1YTY A;  1ZA1 B;  2HLU A;  4ERD A;  5M2P A;  1TUG B;  3CVK A;  1D9A A;  4W98 A;  4ZP6 A;  5C5J A;  4J9M A;  1U1P A;  1D8Z A;  1H7X A;  1FE4 A;  1R0C B;  2QYG A;  3C15 B;  1R8C A;  4OYA A;  3G96 A;  4O3S A;  4FF1 A;  3IM8 A;  1OY9 A;  1S49 A;  1N32 J;  2B9W A;  2ZVI A;  1PCA A;  2DNP A;  2LXF A;  2RRN A;  3CUN A;  4DSJ A;  1SKS A;  2E7V A;  3ZZY A;  5KT3 A;  2D74 B;  4NCB A;  1RBA A;  4BWJ A;  1SJ3 P;  1LWF A;  4QCL A;  5CYJ A;  4A4J A;  3IFE A;  1JJC B;  4DSF A;  1Y0H A;  4FYW B;  4OJ3 A;  2FDN A;  1LNQ A;  4P7T A;  5KT6 A;  2UVV A;  1CVJ A;  1YI2 S;  4I68 A;  1PJ7 A;  1FJG F;  5A6P A;  4YY3 F;  3QJJ A;  1KQK A;  3ET6 B;  2PE8 A;  1Y10 A;  2CG4 A;  3N9U C;  3R5C A;  4CLT A;  5F8H A;  4PXE A;  2QMW A;  3TO8 A;  2W7P A;  4DUZ J;  2DRB A;  1RT7 A;  4LF8 J;  3PM9 A;  2E44 A;  2VBY A;  2DHX A;  2DNO A;  2VPZ B;  4BWM A;  3KK3 B;  2QEX S;  2CZ4 A;  1TTH B;  1XBW A;  1B70 B;  1YVF A;  4WE1 A;  3R7S B;  3MFH A;  3DNC A;  4AQY F;  5HMZ A;  3R27 A;  1CC8 A;  5F0U A;  2DNY A;  3SFU A;  3W64 A;  4DR5 F;  2NQP A;  1GH8 A;  3ZXW A;  1OSC A;  2HFS A;  2CQP A;  4NXM J;  1EJ7 L;  2CJ9 A;  1T8E A;  3C5X C;  1Q7L B;  3MR7 A;  3MD3 A;  3R9L A;  4J9N A;  3SCK E;  3KNG A;  2ZH2 A;  2MQN A;  3SSS A;  5L9N A;  5DQI A;  3EPI A;  1VJQ A;  3W66 A;  4ZPB A;  1I1G A;  1HBO B;  5D4O A;  1SB6 A;  3PW5 A;  1U47 A;  2F8H A;  2GVD B;  1V3Z A;  2MQM A;  2OMO A;  4X66 J;  3KK3 A;  1KKH A;  2AQ4 A;  2QO3 A;  2WB4 A;  5HVG A;  1K0V A;  1VFJ A;  1HPZ B;  3HSZ A;  3QZ7 A;  4ELU A;  1KNZ A;  4DZD A;  2B9E A;  1AZS A;  2NUU G;  2VC1 A;  4HT5 A;  4H4K C;  5F41 A;  4JI4 J;  2JH3 A;  2CPJ A;  4OI2 A;  3RB6 A;  4YB7 A;  4DV0 J;  2LXI A;  3N6L A;  4YUD A;  4NMX A;  2E5L J;  5F8J A;  2QGF B;  4AQY J;  4F25 A;  4PQU A;  2M5Y A;  3KLH B;  1DRZ A;  4URQ U;  3KLF B;  4L3N A;  3GWC A;  3EM1 A;  2UUB F;  1HWK A;  5A8K A;  5EX3 A;  2OAU A;  4H4M B;  4O3P A;  1BQN A;  2H1Y A;  2KRR A;  4ATN A;  4YS2 A;  4WFA Q;  1XMQ F;  2R7W A;  2RQC A;  1OPI A;  2NPI A;  4M5G A;  2DIS A;  4JI0 J;  3TUJ C;  3VF0 B;  3I32 A;  3IP0 A;  3M2U B;  4KO0 A;  5EX0 A;  1S10 A;  2FJE B;  3NWR A;  2D3U A;  2AIR B;  1VRT A;  3AHP A;  5KT4 A;  2IJF A;  3MZI A;  3PHE A;  4PG5 A;  1DQ8 A;  4IR1 A;  4LFC J;  1YGY A;  2Y1J A;  2WVF A;  3ZTO A;  5IZH A;  2L9W A;  1CJU A;  3F56 A;  4ZJO A;  3DLE B;  4WZM A;  1OIA A;  1BQN B;  2B4P A;  2RUS A;  2HZC A;  4NRT A;  4X4Q A;  1N54 B;  3V4I B;  5HLF B;  3DN9 A;  4PCQ A;  2VPW B;  4Y28 C;  4C2M A;  4EK2 A;  8RUC A;  4Q0B A;  1JIH A;  2F9D A;  2HQG A;  2MLY A;  2RKI A;  3QYY A;  1JLE B;  4YR2 A;  1QSS A;  1S0V A;  1AUD A;  2VZ9 A;  4M5L A;  1RA6 A;  4HAC B;  2AEJ A;  3DM2 B;  4PWW A;  4PXC A;  4DL7 A;  1FNX H;  5B0G A;  2HRT A;  2V4J B;  4NLQ A;  1CBK A;  3IR7 B;  3UDL A;  3D6F B;  2LDY A;  4XTT A;  1XTZ A;  3ILI A;  3D66 A;  4BCA A;  1HWU A;  1EHW A;  3JTP A;  4YY3 J;  1YWX A;  4L74 A;  4HTI A;  4A8M P;  3MEG B;  3RB3 A;  4X4U A;  1RKI A;  4ICL A;  1AT1 B;  5D0R A;  2QFJ A;  2ILY A;  2OGU A;  2E29 A;  1WC4 A;  2MPU A;  3TA2 A;  4ZCM A;  1Q7Y T;  4DV5 F;  3BGO P;  1X4C A;  2AEF A;  2CPX A;  2MZ1 A;  2J6S A;  4Z37 A;  1N8R T;  4CLW A;  5B0F A; 
#chains in the Genus database with same CATH homology
 4L3K A;  1EAR A;  3NXZ A;  3AGY A;  1GMU A;  1EB0 A;  3TJ9 A;  3AGZ A;  3LZ8 A;  3TJ8 A;  3I38 A;  1NLT A;  2HFV A;  4J80 A;  1XAO A;  2Q2G A;  2QLD A;  1GMW D;  3L9Z A;  3NY0 A;  3TJA A;  3LA0 A;  1C3G A;  1GMW A;  1GMV A;  3AGX A;  2B26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...