1GMWD

Structure of uree
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
138
structure length
138
Chain Sequence
MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTDFVQVIAADEEVSVVRCDDPFMLAKACYALGNRHVPLQIMPGELRYHHDHVLDDMLRQFGLTVTFGQLPFEPEAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation
pubmed doi rcsb
source organism Klebsiella aerogenes
molecule tags Chaperone
molecule keywords UREE
total genus 32
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmwD02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmwD01
3I38A 2QLDA 1XAOA 4L3KA 3L9ZA 3AGYA 1C3GA 1NLTA 1GMVA 2Q2GA 4J80A 1GMWD 3LA0A 3AGXA 3LZ8A 3NXZA 1GMWA 1EB0A 3NY0A 3AGZA 2B26A 2HFVA 1EARA 3TJ8A 3TJ9A 1GMUA 3TJAA
chains in the Genus database with same CATH superfamily
3CJ0A 5F8MA 1UWBB 4QIGA 2ILYA 1TKXA 5IQ6A 5F8IA 2G1HA 1J5OA 5IC4B 1IR2A 3TUIC 1RHKB 4NLGA 2MZTA 3U1LA 4X4PA 4QU7A 4XK8C 2OGUA 2O5DA 1VI7A 3OL6A 5J2PA 2LA6A 2E5LJ 1NKCA 3ZTSA 5DZ7A 3GV5B 3H7HB 1FWPA 3GWCA 4X4RA 3SCLE 2EBGA 2CYYA 1RAFB 2DIUA 4DUYF 1HARA 2CQ2A 3GV8B 5DDPC 4LFCJ 1HBOA 2CVEA 2ZH5A 2N3OA 1UETA 4M5KA 1LNQA 3MPVA 3QAUA 5E3CA 5HVGA 1TR0A 1RTZA 2G2YA 4ZIWA 3T5KA 3HLUA 1KBRA 5DZ6A 2W4DA 2XGPA 2QJ3A 2X1GA 2RILA 3ETMA 2GHVC 4PYAA 4DX8H 4ZVUB 3QT6A 3WDOA 2EFNA 2HGLA 3DN9A 4JI1J 4NMLA 1HWJA 3J7Z5 3IBCB 1IKYA 4WXWA 1KFDA 1O6XA 2JLFA 2HFZA 4ANDA 1C3GA 1C1BB 4G1IA 1WF0A 3HVRA 1FESA 2FLPA 4WZMA 1YKWA 4ZPWR 3P3DA 1VC5A 2NUHA 2Z2MA 3M32A 5KFDA 4LRBA 3TZYA 2OHDA 4DLGA 2J0XA 4TYAA 1RCOB 1LKZA 2CVIA 3W64A 7AT1B 3MR3A 2FLNA 1IBKF 4OZ3A 5HO4A 2RQMA 4DFJA 2LXIA 3G4SS 1Y5IB 3HHLD 4ZPTR 1TZ0A 1LWFA 1SV5A 2HQ3A 2W4PA 3MD3A 1CS4A 2Z57B 2XYPB 4L74A 5A6WA 4CO1A 3LP1A 2RKIB 1S7HA 3UVJB 4DXLA 4X64F 3GILA 4DQPA 2QT7A 3CJRA 3DRSB 4I69A 1LWCA 3CCZA 5J1PA 4NLXA 4I2PA 4B3MJ 1X0FA 1C0TA 1H0HB 4LF4J 2JRSA 3RB4A 1YI2S 1EP4B 4TQRA 4ZP8A 1SKUB 2XSFA 1NZ8A 4TU8A 3OTOJ 2W7OA 1T0TV 1C2PA 4KE5A 3RBZA 3TUJC 2WOMA 2LQBA 1TAQA 3KUEA 4ETZA 5DETA 2GFFA 5ETMA 4XO0A 2FY1A 2OP5A 2PGCA 3C6TB 2BVZA 1U1PA 1AFJA 2IRXA 3KLIB 2GGPA 4C3LA 4HDHA 3HT3A 2WVCA 1MU2B 3NAHA 2XY5A 1Y5NB 3NXZA 4CT8A 2MGZA 2IDLA 2KG0A 1TKDA 2PD1A 1TQLA 3HSGA 4ED3A 4QOTA 1JNRB 4F0KA 3X1LB 3CJ3A 4CNYA 2YQ1A 5HROB 5LSRA 3I56S 4IG3A 1IBLF 4PXBA 4BCAA 4YQWA 4F4YA 1YHQS 2UUAF 4JI5J 1OYDA 3MM9B 3V6DA 3KJVA 5CXTA 2F8HA 2LEAA 2HHSA 1BY9A 1URNA 3C46A 4KGXB 3TA0A 4DR3J 2LCWA 2AJ0A 4OYAA 2Q6BA 4KGMA 4LF5F 2ADBA 3DOKB 3W9JA 1RT3B 2GQ2A 3AHPA 2P2CB 2VJUA 3W2VB 1VQ7S 4LF9J 3T5HA 1FFSB 1WTFA 2IDEA 3QLHA 4CYUA 1QSYA 3RB6A 2XNQA 3QT8A 3CCVS 2J6SA 3LA0A 4ITSA 3M9MB 5ETNA 2HVHA 3CDAA 3NS5A 2VDHA 1VS3A 1KEKA 2WK4A 3CMQA 3POTA 4LFAF 1RLCL 2FC8A 2V8HA 4Y3CA 5HMXA 2HNZB 3EZ5A 1VISA 5CH7B 1FD8A 4Z2XA 1VBXA 1X4CA 1FHTA 3OR1A 5FLXU 2BEFA 1MROA 1R3NA 3DYAA 4DPWA 4NEYA 3PY8A 2KJVA 1LWEB 4USMA 5CAAA 5E5NA 1F5BA 3IN5A 4Y2AA 4DSLA 3MEEB 3L9ZA 1FDDA 3HX9A 1DAXA 3OW2R 2QLXA 1I5OB 2FZGB 2OPQB 1EIYB 3IS9B 3R3TA 3SBMA 3PVXA 1I6JA 1MG7A 4UQTA 3A8JA 3CWJA 1MN7A 4DHVA 2K8GA 3NGDA 3H2UB 4ERDA 2KZMA 4YEAA 4KV8B 3CT9A 2HHHJ 2MJNA 2B51A 2M52A 1SIZA 3BGLA 3PYDA 2PMZD 4ZJOA 3U1MA 1BGXT 4JI0J 4K0KJ 2KRBA 1NLKL 4NLTA 1ZAWA 2RUGA 2DITA 5LXRA 3PZPA 1LW0A 3CJ4A 1KWMA 3AD9C 2LQ5A 3MURP 2XS7A 4BC7A 5AJ3J 3I9ZA 4OIXA 3DLEA 4EFAC 3DOMB 4FBUA 4R0JA 4F67A 2VHGA 4U9RA 2CIMA 4M8LA 2R8IA 2HVEA 5H9EJ 4W98A 4A8OA 1IN0A 2EVZA 1RU2A 2GCFA 4WCEQ 4OI2A 2GVZA 5A2QY 2F9JA 3KHHA 1NSKL 2NS1B 8AT1B 3NNAA 3MMBB 1NJWA 4DN9A 1F9EB 2CQPA 4KYZA 2MTLA 2NREA 4JI4J 3ZFVA 4ILRA 1IM6A 1FEEA 1WNEA 3ZZ0A 3L09A 3CC7S 1TL7A 3JQKA 3S01A 4PWDB 4DEZA 4HLBA 3M1VB 5KG2A 3KLEA 3NRBA 1KQSR 3P96A 5AXLA 1FRJA 3R9LA 2NPIA 4GMKA 2B9EA 4OHVA 2IYIA 5E3RA 2CNNB 5HMWA 2KYXA 2WW8A 3MUMP 2ZBCA 4K4TA 1RDRA 2AD9A 2XI2A 4ED8A 3Q8QB 4KH0B 2AGOA 4JI5F 2WSEC 4CI0B 2ZH1A 1DRZA 1GX6A 4RW9B 3GIKA 4ZITA 4ES3A 1VRUB 1Y9OA 2AT1B 1RT6A 4A8XA 3ZZZA 1CJKA 2DT9A 4JV1A 2XMVA 2R7XA 1TU0B 4LBIA 1UJ5A 2G2ZA 3S1TA 2LDYA 4N77A 5HAOA 3HXMA 1KQKA 1CEZA 2AEJA 3ITHA 1X5PA 3A8KA 1SUQA 2G0JA 3N5BA 2MQOA 1VRTA 3KDNA 1VYAA 2OAUA 3QJJA 2J7KA 2JHEA 3BBBA 4ENOA 1T9VA 1NPPA 2VPYB 3GU0A 4PG5A 4RL1A 2QA4G 1S1XA 4Q0BA 1WELA 3PX4A 2BJDA 5KFUA 1WHXA 1UEUA 1TL1B 3CD5A 4I56A 2GV1A 2YQ0A 5L1LA 4MJKA 1JLQB 3IWLA 1E6VA 2FHMA 1ZZNA 1X4GA 1RT5B 5CA5A 3MCOA 4CLYA 2HWIA 4ED4A 2R7WA 3M30B 4DUYJ 3FZ2A 1N5YB 3BM7A 3GE9A 1TVRA 1REGX 3EDQB 1CVJA 4HHUA 3RBEA 4MK7A 3SCJE 4NOHA 3NCQA 2HRYA 2QMWA 1OWXA 1SH0A 5JVHQ 2E5IA 4PXEA 4UUWA 3W1YC 4DCPB 3BSNA 2AU0A 1YBUA 4HTJA 3GZ7A 3I96A 3OXLA 4I6WA 2O01C 1NCLA 1D9FA 1RT2A 5I3PA 2YXLA 4GVLA 4ECTA 3RW6A 1YG0A 4IDKA 2ZNYA 5L1KA 4J9PA 3IFEA 3KNGA 5KFXA 4ZMMA 3QRPA 1FXLA 1PBAA 2PE8A 2XG8A 1I94J 2YKMA 3WZ0A 3AOCA 2YKMB 3W61A 3M8PB 4ANEA 1U2CA 2QGFB 4QWCA 1OYEA 4DFPA 2JEIA 3D54A 4OZ5A 4O0IA 1AB8A 3MDFA 1JIHA 2JFDA 3AA9A 1AROP 3IWXA 4QW8A 2YNIA 1RAOA 3V5RA 1B3TA 2K06A 2U1AA 4O4RA 2F3JA 4OYWA 1U6BA 2BKPA 1B0VA 4NLOA 2WTFA 4F7VA 3TUZC 3OVAA 2VKZG 3H42A 4RBVA 4DFMA 1JLBA 2GMJA 4B9LA 2J9DE 2B5JA 3UN5A 2RDJA 1YIJS 1NLTA 3PIOQ 2DHHA 2OJ3A 2GS8A 4ZPDA 2WB1D 3EZOA 3QGPA 3FUYA 1XK8A 2RQCA 1WUUA 1KRPA 2OH2A 5F3TA 2UXBF 2GJIA 3GJQB 4LF8J 1HWKA 2W01A 4R5PB 4KSEB 4J9UE 3EDRB 4IH5A 4NLUA 4P73A 1J27A 2XYGB 1GTEA 1O51A 5LM7E 1S59A 4FDFA 2OPRB 2ZBIA 3C15B 5KT5A 4EZ9A 2ZH6A 2DRDA 4XAKA 1ICEB 1YWXA 2B9XA 4OLOA 2ATLA 2PMWA 4J9QA 3DLGB 1W7WA 2G0CA 1H73A 4FKXA 2V2VA 4I68A 4QJVA 1SUQB 1NJYA 1YTYA 3DFEA 2FLOA 2JL9A 3ITHB 3LGHA 1AUSL 3UI3A 2KL8A 3G6XA 4RR5A 2LQ9A 3QQCD 1XQIA 3BKUA 5K14B 3D2WA 1HR0F 2XSJA 5C42B 1RWXB 3ZNUA 2HIYA 4MIWA 3CGIA 3ZTOA 1S99A 3CW2C 3MAQA 2RRBA 4HYKA 1N6QA 1WOPA 4JV0A 4Y2IA 4NXMF 3M2VA 2ATCB 3DHWC 1HNXJ 4EO8A 3NL0A 1WC0A 3VGTA 2GO9A 3FDSA 5MAOA 4CIOA 4F50A 2Z2LA 1R0AA 5C7PA 2CZ4A 3H40A 1N4LA 5DG9A 2HS0A 1JWWA 2FUG9 4YDDB 3G86A 3W2WA 2WHOA 4I2QA 4OV1A 4URQU 1EARA 5KTQA 2E5LF 2POKA 4FF3A 2IPOB 2ZD1B 2Z58B 3VGVA 2Q79A 3QFHA 3RJMB 1VBZA 3HVAA 3PFOA 1Y00A 4A47A 4F25A 3KLEB 3M1VA 4OJ3A 1Q53A 2EXUA 3VVUA 2W2QP 4IQXA 2J0SD 2M0GB 4CH7A 1H7XA 2DCLA 4L6V3 2FJEB 1GXTA 4DV4J 1T05A 1UVJA 2OFGX 1S9EA 1KHVA 3TAMB 3M8YA 5IFMA 2FQQB 4V19J 3LGNA 4MIAA 4JI3J 1TKZA 2R8HA 3BDEA 4H4MA 4WE1B 1NPKA 2KYZA 2EFPA 3DLJA 1HBMB 3MECA 2EBEA 2HHXA 1FKPA 5KG0A 4DZDA 4QR2A 4LSZB 3DOLA 3MPDA 4QIVA 3W9HA 3MFHA 2R9LA 2EFQA 1P9QC 2X7IA 3K5MA 5KT2A 1UEKA 4CP5A 1JX4A 2BDPA 1HD1A 2CPZA 3EGWB 1HHSA 4QIEA 3PW2A 4LFBF 1LW0B 1HHQA 1Y7PA 2QSWA 3EWGA 3T3FA 1AYEA 2WVEA 2BANA 4Y0FA 4M5JA 1TK5A 3PNIA 1RP5A 1XAOA 4AL6A 3M8QA 1FX4A 5B0FA 2LP4A 2VL1A 1X4FA 1VQOS 1IBKJ 5G0RA 3VTIA 1M5VC 5GADU 4MKYA 2HQFA 3MOZA 4K2JA 5E3AA 3W65A 4X4UA 5KFWA 1QAIA 2OPQA 3HKZD 2LYVA 2KTQA 4PG4A 1N34F 3GIJA 4B9UA 2RQ4A 1PJ5A 3ET6A 3G96A 2VF3A 1QAJA 2DNNA 4CM2A 3DLHA 2X3GA 1Q8KA 1X5TA 1WC4A 2RF2B 4KO0A 2JLGA 4P7VA 2VG6B 1EAYC 3MFIA 1S0VA 1IJFB 4ECXA 3BZQA 1HA1A 1SBRA 2KO1A 2KZZA 3I9V9 3OR1B 2IJRA 2RSQA 4E98A 5HQLA 5ETLA 4F0MA 2YNFB 3BSCA 4FNIA 2Y1LB 1U4BA 4C8LA 3JS9A 5LSLA 3PO4A 2DNPA 4DR4F 2GQQA 2JSXA 4PKDB 1TMJA 2V5HG 4QWAA 1YJUA 1N56A 1X5OA 2R7TA 5T7LB 2C2DA 1U1MA 3GTYX 4CLSA 3C6UA 4TYBA 4GVBB 3GIMA 3NG8A 1KR4A 4FYWB 4WKYA 2Y0BB 5J2NB 4DV3J 2KHCA 5E3QA 3KG4A 4O3NA 4JI8J 3IG1A 1EX8A 1JLEB 3GJSB 3I0RA 4J91A 4LF1A 4C97A 4U7CA 2Q2GA 2A1BA 1HI0P 4B9VA 2ZZNA 3QNWB 1SQEA 1FJEB 2M8DB 4C0BA 3LWMA 4QWDA 1S9FA 4DPYA 5FJ4A 2KXFA 3GONA 1KN6A 2QL7B 2H9ZA 3NLCA 4TY9A 2ASDA 4X4QA 3NCPA 3D5MA 1SC3B 1VCTA 5D4NA 1HWIA 4OYBA 2L9DA 5H1SV 3TVKA 3RAQA 4RNFA 1ZPWX 2OPSB 2CQHA 1SJ4P 3A1YG 4NI2B 4C8OA 2XM3A 1RHQB 1VQPS 4F3MA 1APSA 1H2TZ 2MGZB 2ASYA 4ED2A 1HQEA 4FYXB 1BHNA 3BBFA 1IXKA 1UVIA 1M1GA 1CSJA 1RBAA 3BGOP 1JLFB 2YNHA 5D77A 2J7WA 3V6JA 3GV7B 3V2UC 2B6AB 2DR7A 1N8RT 4KJIA 5HQMA 1FKAF 3AQOA 2CG4A 5ETOA 4O3QA 4ZVPB 1XEZA 3UCZP 1H6KX 5THWA 1C0TB 4ZJLA 2M5YA 4DX7A 3JB9k 1B7FA 5FLXY 2KVIA 3OFGA 3BB5A 4ATNA 3LP2A 3NBPA 2FZCB 5DDRC 4CO3A 4YHHJ 2X1AA 3LF0A 2GW8A 3MGJA 3MR5A 2WB4A 1BD6A 2E7XA 3R27A 2I9SA 5FDLB 1GXUA 3ET6B 3WC0A 3CCJS 2HNYB 3VAHA 1N48A 5LL6d 2MXYA 1Z1ZA 2R2SA 2QLDA 2UVVA 1NNDA 3KFWX 2ODXA 3QFWA 4DR6J 1JNZB 2BJ1A 3FK4A 1U25A 2W8KA 3TX8A 1S76D 1G2EA 2QN6B 3DU5A 3OXFA 3HHLC 3SQGA 1F2GA 2WONB 1YGYA 1O5JA 1C1BA 2MZSA 2FHKA 3MCMA 1PJ7A 2OEJA 4V19X 3WIVA 3OHAA 4FKYA 3CJTA 4F3QA 1Q79A 4C11B 3R7SB 2V6AA 2A10A 2HEKA 1N0VC 1RHJB 2X3DA 4USVA 2W9CB 1HPZB 4PYDA 1R8BA 1VMBA 4ZVTB 2V4JB 3CMAS 3ILIA 3LTOA 3HSDA 3K89A 1VQMS 2JFKA 1KVKA 4M1KA 3LWLA 4FPIA 4NLDA 3T1YJ 4DR1J 4DQQA 4WU3A 1XERA 2XWYA 1FFGB 3UD3P 4DSIA 1Y0HA 3VZIA 3V81A 3ISND 4FS1A 1D09B 3E01A 2Y1RI 1SC4B 5D78A 1FCAA 4JV5J 1S9EB 4PAAA 1PCAA 3DLKB 1FRXA 4PXCA 4PZVA 4PUOB 1D8YA 1UJ6A 2YKNA 1WHYA 4P52A 3GIIA 4AL7A 3DHXA 4BS2A 4F3OA 2YWHA 3AD7C 4R0EA 1RB0A 2BW7A 2CPXA 4JOUA 4C3MA 1X9SA 2PI5A 4B3MF 2KFYA 1K47A 5DQIA 4LFCF 3IA0A 5DM6Q 2DRAA 2HQIA 5IOLA 3K17A 2HWHA 3RZAA 4WFAQ 5CZXA 4KR0B 4J5OA 3T5LA 1O8BA 2GQCA 2XY6A 1NAQA 3Q8VA 1LOUA 4ED1A 5F9NA 2FPHX 5KFGA 3VR1A 3VV2B 4CLWA 3SI8A 4ALZA 3CD6S 3V4MA 3M2VB 3MZIA 3FRYA 2ZITA 4ZS6A 3DRYA 5IQQA 4EMDA 4WFBQ 1V3ZA 2JEJA 4FXDA 4RW4B 1RTIB 2YTCA 2XSJB 4ES1A 1MW7A 5C42A 3CUNA 2E9TA 3KK2A 4K4UA 4G65A 1RT7B 4R8UB 5L1IA 4O3SA 2XO7A 1R8PA 2E9RX 1DFDA 3FQKA 5KFIA 2RDIA 1SVDA 3VAGA 3DLGA 1UKUA 3PJXA 4EBDA 4GKKF 2BW2A 2F40A 4FVCA 4OLPA 2OTLS 4NASA 3CCQS 2NSBA 2QLFB 5IS2A 4TLRA 1SQFA 4RW6B 2GMHA 2HHPA 1VQNS 2B7CB 1Q1KA 1HIYA 3EVWA 2E29A 3ULHA 4B3RF 2GHWA 4LSLB 4IG0B 4DG1A 3TNVA 5EHHA 3ZTPA 4B3SJ 1HL6A 2EG2A 1PJ6A 2IIHA 1KC8T 2N82B 3LUYA 2C22A 1RTDA 2DNGA 1S12A 3PYGA 5E7OB 2B5JB 2YWEA 3TEGA 3GYGA 3HHKA 2KB2A 2R7QA 3AGYA 4M63A 5JVGQ 4K4WA 4S0MA 2EKNA 2C2EA 4W90B 1UWAA 3CNQP 1RTJB 2VIHA 3IRXA 1F0XA 1WDTA 3HJVA 3QYYA 1TV6A 2V8DA 4ECQA 3UD4P 2FJWA 5J2QB 1BQXA 1C0UA 2CPDA 1XR6A 4C0HA 2DK2A 3GFYA 3PR5B 1T9UA 3FC9A 1DTTB 2E7WA 4EYHB 1R8HA 2C2ZB 2XHWA 4OI1A 5C24B 1XMOJ 3MXHP 1S6PB 3BO4A 1S10A 1HBUA 1XR7A 3THPA 3K7RA 3AB4B 3US5A 3RBDA 3C14B 1UFKA 3TVZA 1H7WA 5HANA 1VHFA 2DH9A 3Q8PB 5B0GA 1SKRA 1S0MA 3BR8A 3SSSA 1BUXA 3CC4S 1NKBA 2HLTA 1SXLA 3KKFA 4NYOA 2W7AA 2FHJA 1S1TB 3PEJA 4Z37A 3NNHA 2WRMA 4IG0A 3HULA 1U48A 4AUKA 4TN2A 4DJBA 3PO5A 3C6EC 2E1MC 2UUBJ 2HVDA 3B54A 4N56A 1JLQA 2BXJA 2LFVA 2IAJB 2W8LA 4DLEA 2CQ0A 2IMOA 2BE2B 3KHLA 2E1AA 3CTRA 4CLZA 2MZJA 1Z4UA 3MUTP 2C2KB 4X2BA 3PFEA 1R7IA 1S1XB 4ZCIA 3VGUA 2IJFA 3PCOB 1KQFB 3RB3A 3W9IA 4N76A 2N4DA 5BR8J 2DR8A 2BABA 5K5MA 2CNLB 3CIMA 4RW7B 2V50A 2UXBJ 2E1CA 3HK2A 3J7AN 1H2VZ 1MWZA 4YB1P 3HD2A 5HVFA 2V0NA 2V69A 3FMWA 1ZZFA 3GG0A 1VC6A 2M9KA 2I5JA 1MMDA 2A6MA 4DS4A 4ZPAA 4QCLA 4ZHRA 1U8SA 2MY7A 5KG5A 4I6YA 1FKOA 1HKAA 4OV6A 4D3HA 2AZ1A 1TMMA 3QATA 2GAHC 4DV2J 4FYDA 5KG3A 2WW4A 3SMZA 2VBXA 3H5XA 2DGXA 1NBEB 4G1PA 5LMNJ 3PRDA 4DV4F 4LREA 4O4GB 4RWXA 1T03A 2MMYA 2CA9A 1XMQJ 3BJYA 3HHEA 8ATCB 3MUVP 1N32F 3ZZRA 1OIAA 4EGLA 1QSSA 2ZVSA 3TR5A 1WC6A 5RUBA 4RLEA 2M7SA 4RJVA 2ZH8A 4IFYA 1IWGA 1JMTA 4DN0A 4IRDA 3Q0AA 2E9ZA 2IRYA 3Q8YA 4YR0A 1EZZB 3B4DA 3GYNA 3MMBA 1UL3A 2QO3A 4FPRA 4MK8A 2DH8A 4QQBA 4Z7CA 2J6TA 3H2VE 1SJ3P 1FT8A 1T02A 4AFFA 2VFTA 5J2MA 2E5HA 2MLYA 2YWFA 3KG1A 2ZJPQ 3J7A1 2UZAA 1NHVA 3LP0A 4DSEA 1NJIT 1O0PA 1RWKB 3DOMA 5KT7A 3P6YC 4L3NA 4X66F 3ETOA 1HPZA 4F04B 2XS5A 1ULRA 1TUVA 3D66A 3GG1A 4ECVA 3T5JA 2JEGA 1RACB 2G4BA 2X1BA 1PIEA 1X4HA 1GTHA 3DKDA 2XCPA 5KT6A 2W4CA 2ALZA 1LV5A 4B3TJ 1KOHA 4LIRA 4JI6J 2MPUA 1JXVA 1RHRB 2B3TB 3BV8A 4TXSA 4V1Ak 2JVMA 1RHMB 4X84A 1NSQA 3AODA 1RT1B 3Q22A 3R5CA 5KFPA 1F3VA 1KQGB 2I5JB 1E6YA 1UVKA 2ZHOA 4U8VA 3UN3A 4NCBA 1Y3KA 3CD0A 5CYMA 2HG4A 2CQ4A 2VC1A 2V8VA 2XMKA 4OZNA 3GFZA 1RE1B 3AOBA 3EXCX 1X9WA 3R6LB 4OI6A 4Y2KA 5KT3A 3OPKA 2WBRA 3DRXA 3IM8A 1G6BA 1C1CB 4QWEA 3GLJA 3KLHB 2HYIB 4CTAA 2ZKUA 1XNQJ 2ZE2B 1RAAB 3F44A 3EM1A 4WTYA 3R5DA 4LBHA 1Z2LA 3GB0A 4A8KA 4X64J 5KFMA 3CCES 5I3QA 2AJFE 1FTCA 1FVSA 5K8NA 1K73T 1N36J 4ED6A 1MN9A 3QLHB 1EETB 3QIPB 2L9NA 2W2PP 1L3UA 5I42B 4ZVQB 2B7BB 2XQCA 4CQ1A 2DNQA 5KOWA 2DGWA 4OZLA 3S8SA 3MAHA 4F0HA 3UR0A 4F02A 4OX6A 4CRJA 1EKSA 2AMCB 2C2OB 3IC1A 4O23A 1RWNB 2DGSA 4CO4A 1NJZA 4CCHA 2RQKA 3N6MA 4HT7A 4FZVA 3DGPB 3TA2A 3Q24A 2N7CA 1HBUB 3MM9A 3B4MA 3ZZTA 1IUJA 4UZCA 2UUBF 2EK6A 4F2RA 3QJPA 4QU6A 1FJGJ 2K2PA 1WSVA 3TZXA 1T9YA 2AWZA 4WBFA 2DVIA 2KT3A 1DTTA 5B09A 2XC9A 5L9XA 1QM9A 1NB7A 1NU4A 2J5AA 2J8SA 3IO1A 3FSXA 4AXJA 3TI0A 2JRRA 1JLEA 3I0RB 4EI2A 1PKUA 2CWKA 4PWUA 2RU3A 1SI9A 3H2LA 2IVYA 4BBYA 1R89A 3I87A 1LXJA 1CJTB 5I3UA 3CCUS 1NK8A 1C4CA 3WX4A 1IKWA 2DXEA 4YR3A 2ZDOA 4DWIA 2QRRA 3VAIA 3IM9A 3MCNA 4UOHA 1D8ZA 5L8RC 2AYBA 1H72C 4RBUA 3KMQA 4GC7A 5D3GA 2DNKA 2JJ4D 1VDHA 3FSYA 3ONQA 3OL9A 4NPOA 2RUSA 3AFGA 3I32A 3DRSA 4DG1B 1C1CA 2B4OA 1Y3JA 2HS3A 5FIIA 5CD4H 2VQFJ 3Q86A 2HZAA 4F4AA 2VG6A 1U02A 2AX0A 5K8MA 2P9EA 3D6FB 4RW6A 5KFRA 1SV5B 3D6HB 3GMGA 3IBFB 4PG7A 5IT0A 1FRIA 1HNWJ 2MY8A 3L4BC 2QLBB 1ZH5A 2LU1A 1NO8A 5SZTA 1WWHA 4B3TF 2CADA 2A18A 1M5HA 1T3OA 2QFIA 3T9ZA 2UU9J 3HKWA 3PJ9A 5GMKa 3GJTB 3PV8A 3QBCA 2AJQA 4GRSA 2W25A 4USIA 3FBCA 3NWRA 1L3VA 3D1HA 3M8QB 1FJCA 1FDNA 1RTIA 2QLWA 3E8OA 1IKYB 3DRRB 4Q5VA 3MPWA 2LECA 3MR6A 4HKQA 4ELVA 4O44A 3OL8A 3DDIA 3H8YA 5BYRA 1IVZA 1QD1A 2PC6A 2EFVA 3SXLA 5DM7Q 4IOAQ 1RYSA 1HWLA 1FD2A 4RPFA 3IGNA 2OD6A 1NB2A 4Q8EA 5EWFA 4K5SA 3NCRA 3G6ES 4Q2MA 3I6PA 3ZZUA 1MMNA 1F60B 4J7CA 4A8WA 5KFEA 3LH2S 1A0OB 1B4SA 2VBZA 1ZA2B 2KN4A 2Y3YA 3DI6B 1Q82T 4IR9A 4H4MB 1CJVB 2FHOB 1TKZB 2PA3A 3RTVA 1S77D 3KNAA 2ZNZA 2J7UA 1KDNA 3BGFA 3RR8A 1T7PA 2EPIA 1VIXA 2A0FB 2KFZA 3FBFA 1FVQA 3ZZOA 4PQAA 1V9OA 2CAJA 2H65B 2V2QA 2Q1LA 3W63A 3CPWR 1FDBA 1FNMA 1YZ7A 2JOQA 1J5EJ 5CZVA 2ZZTA 3VHQA 5HBMB 5KFSA 4B9TA 1T9WA 5CQGA 5JMNA 4PRFA 2ZD1A 3A3PB 3CDWA 2DTJA 4O3OA 4PPDA 2NPFA 2B4VA 4P74A 3W60A 3BPSP 1U45A 4NA2A 5GAHU 2J0QD 5F8JA 3KWMA 4OX8A 3LOUA 4UF4A 4LR7A 4DBQA 4LRAA 2V4JA 3DXSX 3ENQA 2V68A 4I1TA 1F6TA 1FRKA 4ZHRB 1K0TA 5HATA 4O44B 4RBTA 1R8CA 2LMIA 4DR1F 1JJCB 4CDIA 1VQ5S 2X1FA 2P6TA 1TFWA 1JLGB 5DDQC 2M88A 4U67Q 1TUWA 1JKHA 2W2OP 3CEDA 5HP1A 3CCWA 3FGVA 1U09A 5T41A 4NYPA 1VBYA 2I1RA 2C3OA 3C16A 3L95X 3SQGB 3TAQA 5F3ZA 2D1CA 1X0PA 1K8AT 5G4DA 5ETRA 9RUBA 1WC5A 4F4XA 2ZVIA 2O3DA 1VBKA 2DHXA 5FDLA 4I0WA 2AYEA 3G82B 5KT4A 4QYZJ 1QE1A 5L38A 1IQTA 3OL7A 4ZCLA 2ZH3A 2CJKA 1Q5YA 3FVYA 2J8AA 2E44A 2HBZB 4DL5A 3QAEA 2R42A 4KGVB 3M8RA 4ZLLA 1S1TA 2RE1A 1A7GE 3CO0P 3H25A 4F2SA 5IT9Y 5D3GB 2UUAJ 1YZ6A 2BYCA 2XMAA 2GJ2A 2UUCF 1M5SA 5L1JA 4FXWA 1XJWB 3BO3A 1PC4A 3FFIA 4C4WA 3FQLA 3C14A 4WP9A 2P9CA 3Q2SC 3RYLA 4A4JA 2CG8A 4RUAA 2J6UA 4YHHF 4ZPBA 3JSRA 2BKOA 4PPZA 2EC2A 4JI8F 4M5IA 4DV3F 1Q5VA 1HBNB 2BKNA 1UTAA 3BREA 4HL9A 3M8PA 2OSQA 4IYQA 4NI2A 3BEGB 5BXIA 4MFBA 2QG9B 2FVPA 2HQDA 1UA0A 3BO2A 3MM6B 3MR2A 1YRUA 2VA2A 2RHSB 1OSDA 2ROPA 1SIWB 2IRUA 3KG0A 2RS2A 1OMSA 1CLFA 2Z8QA 1DHMA 2HK3A 3SFUA 2QIFA 2Z2YB 5KFVA 1SKSA 2IVFB 2DGTA 4NCGA 4AD6A 1MNEA 4M94A 2B4UA 4MTPA 1WI8A 4WXOA 4U95A 1HW8A 2GMLA 3KK3B 3JTNA 1R31A 4P2XA 4B3RJ 2FLLA 1V3SA 2B9YA 3IG1B 3QGGA 2CRLA 2YH1A 1JXLA 3MM5B 4LF2A 4NZ6A 1Y10A 3D9BA 1UJ4A 3E3XA 3MPYA 3N4WA 1CQNA 3C6UB 2ZC4A 2DB1A 4CM0A 4P71A 5T7LA 3TZZA 4LUBA 1GEHA 1VRQC 4OJHA 4EYIB 4YP3A 3PW4A 5JUMA 4N41A 3V6HA 3G2XA 1Q78A 1IQZA 3MD1A 4OYIA 1FJ7A 5KFAA 4KT0C 1MMLA 2W9BB 2MKSA 3O8WA 4B3OB 4UY8T 3BYPA 1HQ2A 4CTAB 3GFXA 3KLFA 3KLHA 5C5JA 1RWMB 2BM1A 3I31A 3QWPA 1BMQB 2CQDA 3DDKA 3GSDA 1I3OB 4LFAJ 1LXNA 2HNDA 2OI2A 4H4OB 1RT4B 4HEA9 3J81j 1PSDA 2W2NP 3KK2B 1HD0A 2FD2A 2RVJA 3CCSS 2PN6A 2HSEB 1YVFA 3CSKA 4EEYA 2YWGA 2DHAA 2HBQB 3A3OB 1NK9A 3HJFA 4X4VA 4JI2F 2G9OA 5B0AA 2CXEA 1LWXA 2O66A 2V9WA 3EGZA 4DS5A 4PEOA 5G0RB 4NLWA 4DX5A 1XC9A 2OPPA 1HNWF 2N7YA 4M95A 3M7VA 4WJBA 3UR3C 4ECRA 1UCNA 2M3DA 2CJAA 4ZVRB 3GJRB 1P1TA 2YWKA 1S1WA 4DI6A 4A8SA 3L3CA 1U26A 4YUDA 2CPEA 1RADB 4RNNA 2B26A 4JI7F 2APOA 2Q3PA 2ASLA 4ECSA 1TELA 4X62J 4PUOA 1HQUA 2IY5B 2M8HA 5J2MB 5AJ3F 4EK2A 1RSCA 1U7LA 1FFWB 1HBMA 1JQGA 3MECB 4WE1A 4M5GA 1RISA 1EHWA 2CFXA 2MKCA 1KLNA 1JLAA 2GVZB 3W8GA 1RAJA 2FJBB 3C19A 4MKBA 3OTOF 1R0BG 3ICLA 2D69A 3UW1A 2VODA 5A8RB 2QMUB 2XS2A 3DLEB 1KLMB 4B17A 2DKOB 2L9WA 3CMES 4JI3F 4ED5A 2MKKA 2PDAA 4PCQA 1S1WB 3Q2TC 1Z2ZA 4CO5A 4M5NA 1GMWA 1IJEB 4UOFA 4X4TA 5IWAF 4J9MA 2C28A 2VFVA 2HW3A 5HMYA 4ZVGA 2C3UA 2WBMA 4A8FA 2OPPB 2QFJA 4X62F 1B70B 2BOPA 2V4RA 1FKOB 4C98A 3WIUA 1SL1A 3C8YA 3C66A 4DMZA 3IS9A 5AXMA 4OZJA 5MLCV 2G0IA 2EC0A 1F3FA 1NXIA 1S5ZA 5LSOA 2JZ5A 3BGRB 4LF8F 3OJUA 4B08A 4ZLPA 3HHNB 3L7PA 1LWEA 2VD3A 3HFZB 5K14A 3OR2A 4NLPA 2UVUA 5LOQA 4DSJA 1RT4A 1N33F 2ZWPA 2HNDB 4H4OA 1UAWA 4KQZA 2P8IA 2VQEF 1UA1A 4NXNF 3Q23A 3CDBA 4MT1A 1S0OA 1Q81T 1OPIA 5F8LA 3HF5A 3DMJA 3FCHA 3NGSA 3M8SA 1GQEA 3Q83A 3EYZA 3DDNA 2ALYB 2IM0A 2BE2A 1R6VA 2H5IB 3U02A 4QBUA 4F4KA 1RLDA 2MQ8A 4RU9A 2LXUA 2JZ8A 4FN5A 4QPTA 5JXSA 5IT4A 1KHWA 1X4BA 3GCXP 4DU7A 1G1XA 1SKWA 5B7WA 4RUCA 2HAIA 1HI1A 1N5VA 2GIQA 1GMUA 1RBOB 2RIJA 2QTWA 5BR8F 3MM5A 2B0GA 1HQEB 3EMTA 1FJGF 2PT0A 5M2RA 4DL6A 4QYRA 4OL8A 5SUHA 1VC0A 1H3DA 1JLBB 4WP3A 3KJFB 5F0WA 1VQYA 2YX4A 2DNYA 1IM4A 4NWBA 1VQLS 4HI1A 2DO0A 3B82A 3GFHA 4HR2A 5C24A 3R2CJ 3CJSA 4CLUA 3G6VA 5LMUF 4NLSA 1LQ9A 3OV7A 4DV2F 4B9MA 2VPXB 4JV2A 4P9SA 4MFBB 1LEOA 2Y0SD 1C0UB 4O0NA 4ZVHA 3PRVA 5E0OA 2XI3A 3UD5A 2CQBA 2RB7A 3EUNA 1BQNB 1P6TA 3T1AA 4I6AA 3EXYA 1EQMA 1RTJA 3BS9A 4GVBA 4NMXA 5IC6B 5BJRA 2ZH2A 1NK4A 1RWVB 4OX7A 1DQ8A 3K59A 3FFIB 2JWNA 3T1HJ 4DL7A 2F5GA 2DHSA 1S72S 2UXCF 1YJ7A 3QZ7A 4DF4A 3V6KA 1PC5A 2KU7A 3NOCA 4ETXA 2YKPA 5IXUA 1M0SA 4LVNP 1RHUB 2HK2A 3CE8A 1FK9B 3DLBA 2DYAA 2MZRA 5GAGU 4DF8A 3T1YF 5DGAA 2C3PA 1D9AA 2ROEA 1SJFA 2AX1A 1XWLA 1E6VB 2RKIA 4OZ1A 4NE9C 1BQMB 3UVJA 4QWBA 2FJVA 2AP6A 2HAFA 2RF2A 1QE1B 3R5AA 2IMWP 1I51B 1LW2A 4DSFA 4AYBD 4N8NA 5F41A 3KYLA 4JYAF 2C1EB 4C8ZA 3EJMA 5KFFA 1RGVA 1HHTP 1VK8A 4AXIA 1NKEA 2YBVA 3F73A 4Q45A 2EFGA 1Q4RA 1M5KC 1RT7A 4R8UA 2R7RA 4ECUA 3C3LA 1WSRA 4LF9F 1UVNA 4C8NA 2HMIA 5HP1B 1RYRA 5KG7A 3QWUA 5DO2A 4DCOB 3F41A 2WVFA 2AYMA 2F1FA 2RT3A 2MQNA 4C48A 4HT5A 4LF4F 3GP9A 1CJKB 1WF1A 4MH8A 1RT6B 8RUCA 1VRUA 2CDRB 3D3BJ 2MQQA 4N7TA 2BJ3A 4DR7F 1F5AA 2BMBA 1VFJA 2WVDA 3M6WA 1JJ4A 3MTKA 3BYRA 3PYFA 5E41A 4OX9J 4HACA 2HKEA 5IM0B 1UEVA 3DOLB 2ZM6F 3D6TB 3MMCA 1RXOB 2A2DA 2VZ9A 3UNGC 3M9NB 1UPMB 1U6ZA 1WG4A 5KFYA 4TKTA 1K1QA 1UFWA 4XIUA 4W92B 3TUPA 5F8GA 3TAMA 1ROFA 2CQ3A 2FJDB 1GH8A 1U47A 1TL3B 1GK8A 2YKNB 3AJ2A 2Q66A 2DY9A 5D15A 4Z7YA 3ZXWA 2LEPA 2EEYA 7FDRA 3PJWA 1RZMA 3BF4A 1HLWA 1WOOA 1ZM2A 3E01B 3AKOB 2CZ9A 4KPYA 3V81B 1J5OB 2MHNA 3AQPA 3CD7A 4K0KF 1VJQA 1ZAVA 3UWTA 3DI6A 4OMFG 3HMJG 4ED0A 2MKIA 2WZ1A 4FYYB 4I2QB 2I2YA 1MWYA 1TL5A 4HACB 2IA0A 2VU5A 4EBCA 1H2UX 2J0WA 2DNHA 2FGCA 2OELA 1R0AB 1IBMF 1GMWD 4DR6F 1IKXB 1H74A 3OLAA 2NXCA 3DU6A 2D3O1 2AGQA 2PEHA 3CJ8A 2W9CA 4KHPF 4C8KA 1IWAA 1Q8BA 4X4OA 1ZTWA 3U27A 3E51A 3LAKA 3J7YI 1B7YB 1GX5A 3HVTA 2AF6A 3VZHA 1IBCB 3D28A 2AW0A 2VUGA 4I4BA 2Z2ZA 4IOBA 1ZBTA 4NYZA 5K9FA 2HVZA 5C2GA 3SV3A 1UP1A 2GAGC 4A8QA 2CPJA 4USHA 2R2RA 3NAIA 3PHEA 3QSIA 2XB2D 1XN9A 4DR4J 4K50A 3OFEA 5ETVA 1SCJB 4ECYA 1TKTB 2BQRA 2KJWA 3M2RA 3JTPA 2OPRA 3JSBA 2B9WA 2KHDA 4KRWA 3MM8A 4NA1A 1S7IA 2KVQE 4NXMJ 3N6NA 4RW8B 1MROB 3DYAB 2ASJA 2IA6A 4ZA1A 1EQ0A 4DCJB 2K1RA 4KKOB 4QZVB 2AQ4A 2JC1A 1RAIB 1RCXB 5HI7A 2GNKA 2XLKA 3SDEA 1U24A 2H48B 1HI8A 4GC6A 2RMLA 3POTB 1FI4A 5EWEA 1VR6A 2RS8A 4O3PA 2FHJD 2VV5A 2MZQA 4LT6A 4OI0A 5DQGA 1U6FA 1GXLA 2B6AA 4YS2A 3IR5B 5CD4A 2HHTA 5HLFB 4PG8A 4CYUB 2CJYB 3K8WA 4LRFA 3IGVA 4ZKAA 5L39A 5I3UB 1CJTA 3N28A 1UW4A 2YNIB 2W1BA 4XDCA 2RAQA 3WBZA 1P1LA 4DX6A 4L3KA 2V63A 4DOZA 5IWAJ 2LDIA 2V8PA 4YDXA 3NGTA 3J80Y 4N5SA 2CPHA 4MK9A 1CJUA 1K44A 3RRKA 2OPSA 2U2FA 3NS6A 3OT9A 3D4JA 3GQCA 3EPGA 3H5YA 3JQJA 4KPCA 4OX9F 2UUCJ 1XNRJ 1ELOA 2DGQA 2LQ8A 1HNVA 3AJDA 3EGNA 3EICA 1ZETA 2I38A 4OZ0A 1KONA 2KT2A 4FS2A 3TVYA 2VH7A 3CDUA 4KTQA 2XMJA 3DC2A 1D3WA 4IH7A 1FXRA 3OLBA 1Q16B 4YY3F 5J2NA 3SV4A 2OD4A 2OTJS 1AW0A 3C6TA 2GC8A 2MHEA 3B8HA 3FMBA 3QIPA 4WYWA 1EETA 2B8QA 1N5YA 4IH6A 5C2CA 2HBRB 2W24A 3TWZA 2VPWB 3EX7B 2CPYA 1BWVA 3TA1A 2F9DA 3GSIA 1EP4A 5DS7A 4K4YA 1VIOA 3MWBA 3N79A 2HFSA 2HS4A 4GO5X 1OY6A 1KP6A 2YQ3A 4DR7J 1LWCB 3UCGA 2QYGA 3AT1B 3AXMA 4MMOA 2N3LA 2DNZA 4USTA 4LR8A 1NDLA 4LSNA 2C2RA 1PYSB 1JK9B 1SC1B 3P49B 3OR2B 4KO0B 4A8YA 1ACMB 2M4MA 2I0XA 3I0SB 4ZN3A 2HHQA 3PW7A 1GAOA 2ZUGA 1DQ9A 1RWUA 1E6YB 3R6GB 3VALA 2LU2A 1VQKS 1RUSA 4DPUA 4QR1A 5H9FJ 4CWBA 4IRCA 2HBYB 3JTOA 5KFKA 2MDAA 4H4KC 3MAAA 2D9PA 1JXEA 4TU9A 5D8HB 1UFLA 2KG1A 2JLEA 2VASA 4Y6IA 3D0GE 3G6YA 4LIWA 1WTBA 3BH7B 1OQ6A 2YKQA 1CULB 5BYSA 3AY0A 2FDNA 1M5PC 1N34J 2CUYA 4LR9A 3K5OA 5KFBA 5A2QU 3W3SA 3QMQA 1L3SA 3A13A 1ZPVA 2NXNA 4DFKA 2UP1A 4PWDA 4JI1F 1XR5A 3RU0A 3UE2A 1X31C 1RAHB 1XIQA 1S79A 4M5DA 3ZZYA 2KM8C 3THVA 1U1QA 4DZ6A 2GX8A 4Q8FA 3N9UC 2R8KA 3V4IA 3V4IB 2IC3B 2ACMA 4U96A 2YVSA 3DCAA 3T6JA 4QW9A 2C2NA 2V67A 4IFYB 4UOCA 2WAQD 3CJ2A 3CCMS 1N54B 2VG7A 3OTDA 4P2SA 2D7SA 4FP9A 2Y1JA 4ZCKA 1R8AA 4ZOSA 1LFPA 3KHRA 1T03B 4ELUA 2ABYA 1CULA 4KHMA 3AJ1A 3CJKA 4ECZA 5GAGI 5A8KA 4ED7A 1H38A 1UPPA 3QRRA 4PABA 3HCXA 2YNGA 3QSYB 4L73A 1YX2A 4FYVB 3U7JA 3MAAB 4TNOA 2PSZA 1NDCA 3SQOP 2DR5A 1N5SA 3M2UB 1CBKA 3KJNB 3NS7B 4MYUA 4IUFA 4DL3A 5EUHA 5EN1A 2XMTA 2ZBPA 5ITHA 3HHLA 1NDKA 3KJQB 3MF5A 4K2XA 4P2MA 1FRMA 4NLRA 4BLGA 5IV3A 3CULA 3MEDB 1G7CB 1LK5A 1YJRA 5KG4A 2NUUG 3O3LA 4OQJA 5EX3A 4F26A 3J81U 2ZHBA 3RB0A 4CLKA 3KLGA 4LSNB 3M8WA 2XO6A 1WKKA 4GKJJ 3FCWA 2DH7A 4J9KA 1SH3A 2NSCA 2LLZA 1NEEA 1R43A 3RUBL 5B0CA 4RNOA 4EBEA 2UVWA 3M05A 2HNZA 2AEFA 2VC0A 4DV0F 3OVBA 3C15A 4WYLA 2FJXA 5IZHA 1UW9A 3I5BA 2VICA 5KAKA 1N0UA 4GKKJ 4AQYF 1F1BB 1GFWB 4R5PA 4HTIA 2BE9B 5C25B 4NCAA 4WFZA 1SJQA 3KXDA 3NGRA 4HHJA 4JP8A 3MM7A 4RNMA 3Q8RB 3MOJB 1S6UA 4P75A 3LGMA 3EVMA 1RKIA 4BDPA 3TJ8A 5GMEA 4F8RA 3R2DJ 1TAUA 5J1EA 4ER8A 5HL7Q 3KK3A 3H4BA 4ILLA 1UZDA 4LRCA 4ZP7A 4ILMA 5M2PA 1HNVB 3KJVB 1Q8IA 4WFNQ 1S1UA 1S1VA 1TP7A 3WX8A 3M9OB 1D9DA 1PG5B 1JLCA 3DRPB 4RX6A 3SIPB 3OSNA 3ILLA 4IG3B 4OHZA 4UW2A 5HROA 4HI2A 3EGVA 4YB6A 4DV7J 1CJUB 2MEWA 3OFHA 2N4CA 5F0UA 1HBNA 4ZPVR 3A8EA 4NZ0A 4UZBA 2BOAA 1MU2A 1VOMA 2GGPB 4PG6A 3NY0A 1S57A 1YRXA 2XEXA 3ISZA 4IDKB 4Y28C 3VF0B 3SSRA 5A6PA 3H4DA 2ZOFA 2ZOMA 3NGUA 3PHTA 2CQIA 2WOMB 1WG5A 4XPEA 2AYGA 2DGUA 2FY8A 4PR6A 2G1DA 2DNOA 4Q44A 2HFNA 1U2RA 1ZM9A 2OMLA 2OUGA 5LMUJ 2C3YA 1HMVA 4DPOA 4JBCA 4I2PB 3ELHA 2UXDF 2K1RB 4KKOA 4DV5F 4JYAJ 3D1QA 3M30A 5D0HA 1WKJA 2FVRA 1GT8A 1NHKL 1T95A 3P8BB 5DG7A 2RU9A 3FKBA 4DDFA 2R7UA 3MM8B 1LWFB 5JJBA 1NDPA 1TL1A 2XZDB 1R27B 3G82A 4LF6J 4JI6F 3K0JA 1M90T 2KI2A 3HZEA 4K7QA 1R0CB 1VGYA 5D4OA 1VRTB 1S9GA 2IFXA 3PR4A 3M6UA 3C16B 1G4CA 3TANA 3W66A 5KFQA 2UVRA 1T9XA 3K2YA 1EKRA 5D0GA 3HVTB 5CYJA 5HSPA 4QIFA 5HK4A 1JLGA 1MSWD 4DUTA 2Y1IA 2V8GA 4C9DA 1BC6A 2DR6A 3ZTQA 2QA4S 4DQRA 1RKJA 1IKXA 4RKUC 2AHOB 2IM3A 3VAJA 2CPIA 3MEGB 1Q0NA 3BKTA 4OFZA 3OUYA 2HQCA 4ID5B 2Z56B 3FRZA 4Q43A 1FWLA 4MIBA 2KDOA 2E5GA 2FTRA 2LA4A 3WQPA 4RUBA 3VQTA 4IQMA 5EGYA 3G8SA 4WZQA 5HJYA 5GAEI 4J80A 2H5JB 1AXQA 2K7JA 2RDDA 1T9TA 4YB7A 2R7VA 1YQHA 3TO8A 2HHUA 3NNCA 4K59A 1H98A 3PTWA 4YFUA 4U8YA 3J81Y 1NK0A 2ZOGA 2DR9A 1RBLA 1TL3A 3DLKA 1SPBP 2C42A 1QDUB 3DXBA 3OBIA 3VGSA 1Q7LB 5A8WB 4TU7A 2D3OR 1VQSA 2FVSA 1B64A 3R7BB 3TJAA 4LJMA 1Y4ZB 5LT5A 3J80U 4OYPA 2R4FA 4ZPCA 3GPAA 4F36A 4CT9A 2Z0GA 3MMCB 4BHQA 1ZTTA 4EZ6A 1U0HB 4C0OC 2YPZA 1X8DA 2PIIA 2ZKTA 3AOAA 4Y2CA 3VQSA 3IRWP 4LF7J 3IWNC 2DGVA 2HVIA 1DY3A 2F63A 1X7VA 3HSZA 4XTTA 4AL5A 2BJ9A 2DCUB 4L72B 2B43A 5KG1A 2NYIA 4DQSA 1IBLJ 2IHR1 2NLWA 1KVJA 3FBBA 2R7OA 5ETKA 4FNHA 2IVMA 2R8GA 1AZSA 2QA2A 3BN7A 3H5UA 1ZM3A 3W5YA 4C11A 4B9SA 3GCWP 4IFVA 2NZ4A 3D1OA 3SYZA 4OYXA 2VPZB 3H59A 4KV8A 2DRBA 1RI7A 5E2QA 3PKMA 1NUEA 2WONA 4M5LA 2W9AA 1RTHA 4OI4A 2FIUA 4USKA 3ZNJ1 4KY3A 5AE3A 1N36F 5K8OA 1OS5A 1RWPB 2IBOA 1NK7A 2HNYA 4FBTA 2DPJA 1WEZA 2QC3A 2UXCJ 4UT4A 5M2UA 3Q8SB 4KHPJ 1LW2B 1WOSA 4NZ7A 3S6EA 4X66J 2BRKA 1JB0C 3NOGA 1NM2A 1DTQB 2YPYA 3KUGA 1TUGB 5B0DA 4C3KA 3I5AA 1GMVA 1FK9A 4DV6F 1S49A 2ZH9A 2WSCC 4ZK7M 1X4DA 4DR5F 2UU9F 4P10A 1FEHA 1B99A 3QPIA 4HDGA 3T6BA 1HMVB 2XCAA 3KK1A 4F4WA 3RRHA 1D0EA 5LJ3Y 2JEFA 2FVCA 2DISA 1ZA1B 1WHWA 3CJ5A 5AXKA 1NH8A 3OD2A 2RRAA 3MMAB 2QL9B 2GVDA 2ZFHA 4KAIA 5CCLA 2LQJA 1NZAA 3W2VA 5KOXA 1RT3A 5CYQA 1KVIA 3DOKA 2JDJA 2WVBA 4IR1A 2MYFA 4PWWA 2DHGA 2EG1A 3UN2A 3ENVA 2BBEA 1FERA 3KOAA 1NSAA 2XTJP 3QO9B 3RAMA 4X65F 2G2OA 3FNNA 1JLCB 3DRPA 4HH0A 4KFBB 4CH1A 5H9FK 4RNHA 1VQ8S 4Y34A 4HVZA 1T11A 3ADAC 3T9NA 2BZ2A 1FDAA 3DGPA 3EVOA 4DQIA 2ZUAA 5J1NA 2ZHAA 4X4NA 5DGBA 3JQMA 4OZ2A 2MB0B 5DG8A 6FDRA 3BR9A 2MQPA 1FF2A 2ZJRQ 5KG6A 4G3IA 1HR0J 2MKYA 1TL4A 4K5RA 1DBDA 2FYXA 2CZVC 2ROGA 4ZN1A 3K5LA 2NR0A 1PAEX 3BSAA 2UV8A 2VKRA 2EK1A 4K8RA 2HZCA 2KXHA 1VHIA 3R5BA 2DNMA 4IO1A 4W4MA 2BJEA 3G8TA 2BUNA 2KXNB 4ICLA 1JJHA 5GMDA 2ZM6J 3CIZA 1X5SA 2GIRA 3LANA 4EUVA 1U1NA 2ZE2A 4DR2J 2XULA 3PW5A 1HYSA 3QT5A 1IKVB 5GAHI 3B6BA 1ZAXA 2FGOA 1YRTA 2H5EA 2BM0A 4KH1B 3VWSA 3LP1B 5U47A 3CC2S 1S0NA 4LQ3A 1KTQA 1SJRA 4UOGA 2VG5A 1QJHA 5GVQA 1NPRA 4A48A 5ETSA 2IYGA 3BGRA 4CO2A 4ID8A 4OJGA 2BR0A 1NK5A 3W8PA 1RJJA 1NRKA 2QMXA 4LF5J 3QZ8A 3MPUB 4NLQA 2ZZMA 1QTNB 5KFZA 3H5SA 4RO0A 1HNZJ 4M5MA 2JVRA 3PDNA 1MLAA 2YNGB 1N5TA 1S4FA 2AZ3A 2CJ9A 2BJ7A 2BANB 1S48A 2R2UA 4AE5A 3CXCR 2QZ8A 2Y9HA 5D6GA 4YR2A 3BBCA 3LPYA 1T8EA 4KHRA 3AH6A 1ZYQA 3D0IE 2Z30B 1YJVA 3CB4A 4WIIA 1KLMA 4IOCQ 3J7ZT 1N5QA 4ZCMA 7FD1A 1K0VA 1X4EA 3ZTRA 1OO0B 2H54B 3LP0B 4FF1A 5E3PA 2W2MP 4USJC 1FKPB 2CNOB 2VA3A 1HNIA 3PKYA 2COLA 2EKYA 2MKHA 1HBOB 3Q8UA 1JLAB 3LZ8A 4K4SA 1GNKA 2XMMA 3FJ2A 4WWSA 1KKHA 5D4LA 4TY8A 4M5DB 3JYTA 4CH0S 3PX6A 3UCUP 1XTZA 1SJ1A 2KT5A 1FRHA 1HQUB 3AB2B 3KHGA 5DLFA 5J2PB 3TJ9A 1S6OA 4YOEA 2FB0A 2OFHX 4FVMA 2XLIA 2PA8D 1CPZA 3N01A 1TKXB 4KIAA 1UWBA 3G8QA 1MWQA 4O4GA 3Q89A 4L75A 1F9FA 4PQUA 2VFUA 1HW9A 3W2WB 2VJVA 4DV7F 1YSJA 2HGNA 4HH1A 3B78A 2XLJA 2K3KA 2SXLA 4YN3B 5HQ8A 4WF9Q 5ETPA 2RJZA 1V3RA 1ZM4A 3ZZPA 2D74B 3QJLA 5A0YA 3R8YA 1S6QB 3UNYA 2DPIA 4G1QA 4OHYA 2CWXA 4U7UD 3NP5A 4WFYA 2DJWA 5L9NA 4DL4A 1WACA 1FRLA 2IM1A 4DL0C 5F9LA 3A4TA 2CJXB 2UUWA 1ZOTA 3R5GA 4Y00A 2YY3A 4WP8A 2DBBA 4RW7A 2XZWA 3IP0A 4I7FB 4P72A 2PO4A 3QIDA 2PFDA 1DJ0A 3GR1A 3F0NA 2GIFA 3L7OA 4LVOP 2A3JA 4YMEA 4AQYJ 3KLFB 1QAXA 3F56A 2HHHF 4R25A 4ES2A 2G13A 4KGKA 4DUZF 1HYSB 4OYMA 1XBWA 2DNRA 4NX9A 1U2FA 1L5UA 1N33J 1FNOA 3U1NA 4C2MA 3NKYA 1DURA 1EJ7L 4NXNJ 5KFOA 4G6VB 1YK9A 2X51A 3AA8A 3PEHA 3UFCX 2DNLA 5AE1A 1SL0A 2Y8YA 2JC0A 3BKFA 3GYXB 3JSYA 4Q7AA 2YX7A 1Q86T 1AT1B 1WI6A 4NLYA 3R5JB 5DQHA 2PI4A 5B0BA 2CPFA 3EZUA 1DQAA 2E7VA 3CO9A 3EE3A 6AT1B 3QGIA 4NCGB 3RW7A 1B0TA 1S6PA 2OMOA 3UDEA 3TARA 2CQ1A 2IM2A 5L46A 2B4PA 2ZH7A 2ZH4A 2UUTA 3QO9A 3MM6A 3PRBA 3AXKA 2DO4A 3M4XA 3T19A 5LXYA 1M1HA 3OTEA 4C7QA 3LAMA 3KLVA 2QE5A 3JSMA 2HFOA 1UMJA 4I64A 1ZS6A 3IRXB 5CYQB 1V5IB 4MAKA 3UQSA 1Y5LB 3CDEA 9ATCB 3NGKA 2F8MA 2BX6A 3ISNC 1RT2B 1B0PA 3L7UA 4P2FA 4J90A 1VJWA 2YH0A 2VOPA 1P27B 3MR7A 3BQ1A 3I55S 4J9VA 4X65J 5D4PA 2QLJB 2HFVA 1CC7A 3I4PA 3TW0A 4RUHA 2BQ3A 4KGZB 4NRTA 2V2KA 4IKAA 3QGHA 4JB8B 3TP2A 2XGQA 2D9OA 2HHVA 4LSLA 4Y2MA 2IJNA 2KH9A 2JVOA 1REVA 4RW8A 1RT5A 3WHIA 1SC6A 2HGMA 4URSA 1UVMA 4RZRA 3QRQA 2AJ1A 4X4SA 3FZBA 4U7UK 2XMUA 1VLYA 2H4YB 3M2RB 1VQ9S 1TKTA 2O67A 1RAGB 2XWXA 5DDOC 3IBWA 5GAEU 1W2BR 4RU2A 4A8MP 4Q0BB 4GO7X 3FCVA 4J9LA 4IO9Q 3ENAA 2RD5C 4ELTA 2QYCA 4RWWA 2D3UA 2KRRA 2E1PA 4H4KA 1TTHB 3IXQA 4UTGA 3UDCA 2YX1A 1JKHB 5CABA 1XNQF 2ACYA 1KS2A 4RW4A 4DR3F 4ZP6A 4ECWA 2WSFC 3SCIE 2DGOA 1U49A 2JX2A 3DLLQ 4EO6A 1BE4A 2DY1A 2MKJA 4UY85 3HO1A 2NCKL 1Q7YT 2VBYA 3C5XC 1TFYA 2LVWA 4NRUA 1M1KT 1KSPA 3HHDA 5HMZA 2F4VJ 2EFOA 1U0HA 1DLOB 2QSFA 2ILZA 2HURA 3GIRA 4PQUB 2XY7A 3P4UB 2XMWA 3RR7A 2DXFA 5HBMA 1CC8A 1N32J 1PILA 1YBAA 1T94A 2BV3A 2KM8B 2V34A 3HDSA 4NEZA 5A76A 5A8WA 2JH3A 1KOOA 1TL7B 4DPXA 2MZ1A 4N8OA 3CCTA 3M6VA 3CVKA 1QLNA 1PYTA 3E2EA 4LF7F 4URGA 4TY8B 3JYTB 3T41A 1HWUA 3ZC4A 1U1RA 4L76A 2M70A 4H54A 3SSQA 1UVLA 1CJVA 2XBPA 3DM2B 1W2IA 4TQSA 3D0HE 1XMOF 3SCKE 4DU8A 3G87A 5IM0A 4M5HA 3EPIA 1X60A 3RG6A 1YITS 3D67A 3R1LA 3OQ2A 4DUZJ 3HSJA 3O1LA 3TQEA 1JJ2R 1V6HA 2V94A 4LRDA 1U1LA 4ZLJA 4JV5F 3I82A 4ZLNA 2MSSA 4DV1F 2MJUA 2ERRA 3IAM9 2KFNA 1Y11A 3DRRA 2BQUA 1QAYA 2PMHA 3DNCA 2DXDA 2YKOA 2HMIB 6FD1A 1L3TA 2F4VF 1NH7A 4P7TA 3AGZA 1WG1A 1S9GB 5ETTA 3MI7X 3R7NB 5LMNF 1WC3A 2OEMA 1TK0A 3MEEA 2FJAB 2HRTA 3PM9A 1PO6A 2GA7A 2FZKB 3K5NA 4QPXA 1IR1A 2VG5B 4XDDA 3UDVA 1FE0A 3N5FA 4BC9A 3J7YU 2GHPA 4UUXA 3ZO7A 1BQMA 2XHCA 2MQMA 4ZVFA 2R2TA 1IR0A 1HNXF 3TEHB 4B3SF 2NZCA 1REVB 3BH6B 5F8HA 2HLUA 2AKWB 1N88A 1IKVA 3LP2B 3NBPB 2OO4A 3W5ZA 4Q2LA 3TX0A 1OY9A 1F2HA 2AIRB 1S4EA 2AV5A 3M8ZA 3TQ1A 1KNZA 5H9EK 2VQEJ 1J2VA 2OIHA 4ANCA 2CJBA 1YBTA 4LF6F 4JI4F 2QL5B 3W5XA 1NK6A 1P8GA 1FNXH 1PGZA 2KKHA 2HHWA 1IKWB 5GADI 5KFJA 3D68A 4NLVA 1KTVA 5IT9U 2H1YA 1JLFA 2BJ8A 2YNHB 4D3GA 1BXNA 2YWWA 4C6AA 2UV8G 4CLFA 1BQNA 4E2FB 1XMQF 3NMRA 2EWHA 1DARA 1YJ9S 4HHHA 3BDPA 4J9NA 5CCMA 4DPTA 2AEMA 2LXFA 1QUPA 2GZOA 3GR0A 1W26A 2F8EX 2L41A 3V6DB 1IBMJ 1W25A 3D6MB 1NJXA 4WPAA 1S1VB 3R97A 1WORA 1S1UB 1K9MT 4LMZA 1NHUA 4KFBA 1M5OC 1FXDA 4XPCA 4F4ZA 2NQPA 4OJ1A 2VBWA 3KMSA 4K4ZA 3WC2A 3MCSA 4WTOB 1KD1T 4BWMA 2HWTA 5J1EB 4DV0J 1F9HA 4USUA 4DR5J 2QEXS 3K8VA 2VONA 4TLQA 2DD8S 3OTBA 3VAMA 3KLIA 3D3CJ 5I42A 1EB0A 4CLTA 1V5VA 4KBIA 5C25A 3IMQJ 3MMAA 2K7KA 4U6PA 1OPZA 3RGIA 1X4AA 3RAXA 2IBKA 5EWGA 2R8JA 2OKQA 1BWEA 1RAEB 2DIVA 1A6LA 2YNFA 1WEYA 3DMJB 3LQVA 1PBUA 3NEKA 3I38A 2DEIA 1AFIA 2XZTB 3UPFA 4QIWD 5EDWA 1WF2A 2VDIA 3KDOA 4OHWA 1QSLA 3RRGA 3KLGB 4ZJQA 1DTQA 2LEBA 3ILOA 1CS4B 3RBXA 3BGUA 3JAMY 2BACA 5CYMB 4ZVEA 2B56A 4NL5A 3TYTA 4AT1B 1HNZF 3NMAA 5F8NA 1U1OA 2YKAA 2D41A 3HHLB 1FO1A 4EWTA 1RABB 2DEJA 3OFFA 2WCXA 5A0YB 5K20B 3M32B 3T1HF 4OYZA 3DGVA 1RT1A 2HIQA 2MLZA 3P5BP 3P5TL 4JI2J 1WKLA 4USWA 2J9DA 5K8PA 1CQMA 2AJ4A 5I4MA 2L3MA 2AGPA 4C8MA 4C8YA 1J5EF 1RWOB 4B9NA 3THTA 3K58A 2VOOA 2QV6A 4K4XA 1YJTA 3MHYA 3CJKB 1AZSB 1P9YA 3UO0A 1XNRF 3AD8C 3FEXB 2J76E 1C4AA 3HI9A 1Q95G 1OQ3A 1PAUB 1WJ9A 4CZCA 4CLPA 3O2IA 4DSKA 1AA1B 3VCDA 1OY8A 2P5VA 2VG7B 3OVSA 3M6XA 4WIQA 5DRKA 1XMBA 5A8RA 4JI7J 2NXJA 4J37A 3BN4A 3BSOA 3IR7B 5ETQA 3VAFA 3DM2A 2IC3A 1VK3A 3HFKA 3JXOA 1G3OA 5AT1B 1OJ4A 5KFLA 2QA1A 1WC1A 3A8IA 4NA3A 4UQGA 1HNIB 1YDLA 4O3RA 1YJWS 3FEZA 1T05B 1VQ6S 2OEKA 2FC9A 1UZHA 2E1RA 5CHCB 3BQ2A 4QYZK 4OI3A 5D0RA 4ZVSB 2ZDPA 1WHVA 3PXGa 3HM9A 2Y8WA 1RA6A 2CKWA 3MMJA 1TK8A 1QVGR 3HFVA 4N47A 2B8PA 1QVFR 3S7RA 4FF2A 5LJ5Y 3NWGA 2CQGA 5EX0A 4OHXA 2RRNA 1DLOA 1RWWB 5B0EA 2V9KA 1NSPA 3K57A 2PEBA 1FX2A 4ID5A 1ITPA 5HJXA 3MEGA 3OUYB 3OSPA 1QUVA 1CG2A 1SQGA 3AAWB 1BLUA 2H4WB 3X3UA 3CCRS 4CO0A 3LALA 3TAPA 1VLOA 1Q8LA 5ADZA 2R3VA 2NXEA 2ADCA 1N6QB 2H51B 2VFSA 2BE7D 2ZBRA 3QT7A 3LPEA 3MEKA 2VQFF 2HRUA 5BYQA 3UDLA 3KUHA 1VQ4S 3AGXA 1N52B 3I0SA 4J9SA 3HT0A 4B02A 4MKAA 2I6WA 4K4VA 1WEXA 2FVQA 4FF4A 1OSCA 4DV1J 2D3ZA 1YLXA 4J9RA 2M2BA 2L08A 3H98A 3H90A 4FXVA 4MKVA 1SH2A 4EU0A 5DJBA 2W7PA 1A9NB 3HD1A 4LBPA 1S97A 4B3OA 2W9BA 4ICLB 2A2CA 3CJQA 5KFCA 5KFHA 1U8WA 2F65A 2P9GA 3SZ2A 2IAJA 2RNEA 1DZ5A 1LK7A 1U0SA 2V2ZA 3FSIA 3G71S 1FE4A 3PX0A 3BPDA 3FEYB 4WK3A 1U1KA 3PIPQ 4ZP9A 2NXUA 5AE2A 2XNRA 2Z4PA 2LKZA 5IV4A 3VAKA 3PACA 4JUZA 2AJ2A 3KTQA 3O44A 4PXDA 4DR2F 5HVHA 4WKRA 4JI0F 3W62A 3OTCA 2XYHB 4YB5A 5T14A 3D7SB 3FBEA 3BQ0A 1I1GA 2C3MA 2MQLA 3LO3A 1RK8A 3VVTA 3JSMB 4P6QA 2K3IA 3C2PA 4LFBJ 2HZVA 2HFUA 1WDDA 1RA7A 5HN0A 3JAMU 4DL2A 2ZC3A 5J2QA 2BRLA 3OXGA 1X9MA 1TV6B 1RU1A 2QX0A 2ZBQA 4Y65A 5D0EA 3K5PA 2V4QA 1WD6A 2F7VA 3OHBA 2L48A 3N6LA 2BA9A 2J9CA 2GVDB 2GJFA 3SEOA 5HLFA 2H3EB 4WFXA 4DV6J 2VFRA 3TRGA 2CQCA 4BWJA 3HP6A 4IRKA 5DLGA 3H0PA 5KFNA 1FTRA 2HQGA 4ZDNA 1QTMA 2O1PA 1RTDB 1LFWA 2E5JA 3KK1B 2HPUA 3SDEB 4A46A 2R7SA 4GKJF 1TVRB 2P6SA 2F4FA 3MM7B 1F5CA 4MYTA 2CNKB 3P45B 1T3NA 3O5TB 3CCLS 1NMEB 2C2MB 2MSTA 2VB6A 3TOQA 4ZIVA 3H20A 3HVWA 2MLXA 3ILJA 3N0VA 2NYHA 3CF5Q 4J9OA 1SL2A 1AUDA 2EW9A 1SB6A 2CDQA 1D1UA 1KFSA 3LW5C 2EI5A 4CNZA 3TZWA 2JNJA 1FWKA 4DV5J 3OJSA 2RHQB 3IR6B 4E8UA 5AXNA 2ZJQQ 4I67A 2UXDJ 3SFGA 1FA0A 2GO8A 5E33A 5B08A 2ZWOA 2Q43A 1URRA 1L3KA 2J9EA 3PW0A 1RTHB 3PG9A 4I7FA 2OLWA 3A12A 4KB7A 4YY3J 3HZGA 1PYOB 1QY7A 3I4HX 3MEDA 4KC5A 1K1SA 1HFEL 2I8EA 2ZEJA 4IFVB 3W7BA 4OYOA 3R1HA 3HPOA 4G1QB 4WU2A 1S6QA 5KFTA 5FD1A 2OSRA 3ENWA 1YJNS 3M2UA 2E66A 4RW9A 2A6OA 1RQ0A 3I5CA 3G9CA 3A3NB 4QR0A 1I94F 2Q6CA 2RH3A 4LQ9A 3IAS9 3MTJA 4WK1A 2CJQA 4E0DA 2PFFB 3O6QA 1R6YA 3PYEA 4ZVOB 5A8KB 4TVAB 4CLLA
chains in the Genus database with same CATH topology
3I38A 2QLDA 1XAOA 4L3KA 3L9ZA 3AGYA 1C3GA 1NLTA 1GMVA 2Q2GA 4J80A 1GMWD 3LA0A 3AGXA 3LZ8A 3NXZA 1GMWA 1EB0A 3NY0A 3AGZA 2B26A 2HFVA 1EARA 3TJ8A 3TJ9A 1GMUA 3TJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I38 A;  2QLD A;  1XAO A;  4L3K A;  3L9Z A;  3AGY A;  1C3G A;  1NLT A;  1GMV A;  2Q2G A;  4J80 A;  1GMW D;  3LA0 A;  3AGX A;  3LZ8 A;  3NXZ A;  1GMW A;  1EB0 A;  3NY0 A;  3AGZ A;  2B26 A;  2HFV A;  1EAR A;  3TJ8 A;  3TJ9 A;  1GMU A;  3TJA A; 
#chains in the Genus database with same CATH topology
 3CJ0 A;  5F8M A;  1UWB B;  4QIG A;  2ILY A;  1TKX A;  5IQ6 A;  5F8I A;  2G1H A;  1J5O A;  5IC4 B;  1IR2 A;  3TUI C;  1RHK B;  4NLG A;  2MZT A;  3U1L A;  4X4P A;  4QU7 A;  4XK8 C;  2OGU A;  2O5D A;  1VI7 A;  3OL6 A;  5J2P A;  2LA6 A;  2E5L J;  1NKC A;  3ZTS A;  5DZ7 A;  3GV5 B;  3H7H B;  1FWP A;  3GWC A;  4X4R A;  3SCL E;  2EBG A;  2CYY A;  1RAF B;  2DIU A;  4DUY F;  1HAR A;  2CQ2 A;  3GV8 B;  5DDP C;  4LFC J;  1HBO A;  2CVE A;  2ZH5 A;  2N3O A;  1UET A;  4M5K A;  1LNQ A;  3MPV A;  3QAU A;  5E3C A;  5HVG A;  1TR0 A;  1RTZ A;  2G2Y A;  4ZIW A;  3T5K A;  3HLU A;  1KBR A;  5DZ6 A;  2W4D A;  2XGP A;  2QJ3 A;  2X1G A;  2RIL A;  3ETM A;  2GHV C;  4PYA A;  4DX8 H;  4ZVU B;  3QT6 A;  3WDO A;  2EFN A;  2HGL A;  3DN9 A;  4JI1 J;  4NML A;  1HWJ A;  3J7Z 5;  3IBC B;  1IKY A;  4WXW A;  1KFD A;  1O6X A;  2JLF A;  2HFZ A;  4AND A;  1C3G A;  1C1B B;  4G1I A;  1WF0 A;  3HVR A;  1FES A;  2FLP A;  4WZM A;  1YKW A;  4ZPW R;  3P3D A;  1VC5 A;  2NUH A;  2Z2M A;  3M32 A;  5KFD A;  4LRB A;  3TZY A;  2OHD A;  4DLG A;  2J0X A;  4TYA A;  1RCO B;  1LKZ A;  2CVI A;  3W64 A;  7AT1 B;  3MR3 A;  2FLN A;  1IBK F;  4OZ3 A;  5HO4 A;  2RQM A;  4DFJ A;  2LXI A;  3G4S S;  1Y5I B;  3HHL D;  4ZPT R;  1TZ0 A;  1LWF A;  1SV5 A;  2HQ3 A;  2W4P A;  3MD3 A;  1CS4 A;  2Z57 B;  2XYP B;  4L74 A;  5A6W A;  4CO1 A;  3LP1 A;  2RKI B;  1S7H A;  3UVJ B;  4DXL A;  4X64 F;  3GIL A;  4DQP A;  2QT7 A;  3CJR A;  3DRS B;  4I69 A;  1LWC A;  3CCZ A;  5J1P A;  4NLX A;  4I2P A;  4B3M J;  1X0F A;  1C0T A;  1H0H B;  4LF4 J;  2JRS A;  3RB4 A;  1YI2 S;  1EP4 B;  4TQR A;  4ZP8 A;  1SKU B;  2XSF A;  1NZ8 A;  4TU8 A;  3OTO J;  2W7O A;  1T0T V;  1C2P A;  4KE5 A;  3RBZ A;  3TUJ C;  2WOM A;  2LQB A;  1TAQ A;  3KUE A;  4ETZ A;  5DET A;  2GFF A;  5ETM A;  4XO0 A;  2FY1 A;  2OP5 A;  2PGC A;  3C6T B;  2BVZ A;  1U1P A;  1AFJ A;  2IRX A;  3KLI B;  2GGP A;  4C3L A;  4HDH A;  3HT3 A;  2WVC A;  1MU2 B;  3NAH A;  2XY5 A;  1Y5N B;  3NXZ A;  4CT8 A;  2MGZ A;  2IDL A;  2KG0 A;  1TKD A;  2PD1 A;  1TQL A;  3HSG A;  4ED3 A;  4QOT A;  1JNR B;  4F0K A;  3X1L B;  3CJ3 A;  4CNY A;  2YQ1 A;  5HRO B;  5LSR A;  3I56 S;  4IG3 A;  1IBL F;  4PXB A;  4BCA A;  4YQW A;  4F4Y A;  1YHQ S;  2UUA F;  4JI5 J;  1OYD A;  3MM9 B;  3V6D A;  3KJV A;  5CXT A;  2F8H A;  2LEA A;  2HHS A;  1BY9 A;  1URN A;  3C46 A;  4KGX B;  3TA0 A;  4DR3 J;  2LCW A;  2AJ0 A;  4OYA A;  2Q6B A;  4KGM A;  4LF5 F;  2ADB A;  3DOK B;  3W9J A;  1RT3 B;  2GQ2 A;  3AHP A;  2P2C B;  2VJU A;  3W2V B;  1VQ7 S;  4LF9 J;  3T5H A;  1FFS B;  1WTF A;  2IDE A;  3QLH A;  4CYU A;  1QSY A;  3RB6 A;  2XNQ A;  3QT8 A;  3CCV S;  2J6S A;  3LA0 A;  4ITS A;  3M9M B;  5ETN A;  2HVH A;  3CDA A;  3NS5 A;  2VDH A;  1VS3 A;  1KEK A;  2WK4 A;  3CMQ A;  3POT A;  4LFA F;  1RLC L;  2FC8 A;  2V8H A;  4Y3C A;  5HMX A;  2HNZ B;  3EZ5 A;  1VIS A;  5CH7 B;  1FD8 A;  4Z2X A;  1VBX A;  1X4C A;  1FHT A;  3OR1 A;  5FLX U;  2BEF A;  1MRO A;  1R3N A;  3DYA A;  4DPW A;  4NEY A;  3PY8 A;  2KJV A;  1LWE B;  4USM A;  5CAA A;  5E5N A;  1F5B A;  3IN5 A;  4Y2A A;  4DSL A;  3MEE B;  3L9Z A;  1FDD A;  3HX9 A;  1DAX A;  3OW2 R;  2QLX A;  1I5O B;  2FZG B;  2OPQ B;  1EIY B;  3IS9 B;  3R3T A;  3SBM A;  3PVX A;  1I6J A;  1MG7 A;  4UQT A;  3A8J A;  3CWJ A;  1MN7 A;  4DHV A;  2K8G A;  3NGD A;  3H2U B;  4ERD A;  2KZM A;  4YEA A;  4KV8 B;  3CT9 A;  2HHH J;  2MJN A;  2B51 A;  2M52 A;  1SIZ A;  3BGL A;  3PYD A;  2PMZ D;  4ZJO A;  3U1M A;  1BGX T;  4JI0 J;  4K0K J;  2KRB A;  1NLK L;  4NLT A;  1ZAW A;  2RUG A;  2DIT A;  5LXR A;  3PZP A;  1LW0 A;  3CJ4 A;  1KWM A;  3AD9 C;  2LQ5 A;  3MUR P;  2XS7 A;  4BC7 A;  5AJ3 J;  3I9Z A;  4OIX A;  3DLE A;  4EFA C;  3DOM B;  4FBU A;  4R0J A;  4F67 A;  2VHG A;  4U9R A;  2CIM A;  4M8L A;  2R8I A;  2HVE A;  5H9E J;  4W98 A;  4A8O A;  1IN0 A;  2EVZ A;  1RU2 A;  2GCF A;  4WCE Q;  4OI2 A;  2GVZ A;  5A2Q Y;  2F9J A;  3KHH A;  1NSK L;  2NS1 B;  8AT1 B;  3NNA A;  3MMB B;  1NJW A;  4DN9 A;  1F9E B;  2CQP A;  4KYZ A;  2MTL A;  2NRE A;  4JI4 J;  3ZFV A;  4ILR A;  1IM6 A;  1FEE A;  1WNE A;  3ZZ0 A;  3L09 A;  3CC7 S;  1TL7 A;  3JQK A;  3S01 A;  4PWD B;  4DEZ A;  4HLB A;  3M1V B;  5KG2 A;  3KLE A;  3NRB A;  1KQS R;  3P96 A;  5AXL A;  1FRJ A;  3R9L A;  2NPI A;  4GMK A;  2B9E A;  4OHV A;  2IYI A;  5E3R A;  2CNN B;  5HMW A;  2KYX A;  2WW8 A;  3MUM P;  2ZBC A;  4K4T A;  1RDR A;  2AD9 A;  2XI2 A;  4ED8 A;  3Q8Q B;  4KH0 B;  2AGO A;  4JI5 F;  2WSE C;  4CI0 B;  2ZH1 A;  1DRZ A;  1GX6 A;  4RW9 B;  3GIK A;  4ZIT A;  4ES3 A;  1VRU B;  1Y9O A;  2AT1 B;  1RT6 A;  4A8X A;  3ZZZ A;  1CJK A;  2DT9 A;  4JV1 A;  2XMV A;  2R7X A;  1TU0 B;  4LBI A;  1UJ5 A;  2G2Z A;  3S1T A;  2LDY A;  4N77 A;  5HAO A;  3HXM A;  1KQK A;  1CEZ A;  2AEJ A;  3ITH A;  1X5P A;  3A8K A;  1SUQ A;  2G0J A;  3N5B A;  2MQO A;  1VRT A;  3KDN A;  1VYA A;  2OAU A;  3QJJ A;  2J7K A;  2JHE A;  3BBB A;  4ENO A;  1T9V A;  1NPP A;  2VPY B;  3GU0 A;  4PG5 A;  4RL1 A;  2QA4 G;  1S1X A;  4Q0B A;  1WEL A;  3PX4 A;  2BJD A;  5KFU A;  1WHX A;  1UEU A;  1TL1 B;  3CD5 A;  4I56 A;  2GV1 A;  2YQ0 A;  5L1L A;  4MJK A;  1JLQ B;  3IWL A;  1E6V A;  2FHM A;  1ZZN A;  1X4G A;  1RT5 B;  5CA5 A;  3MCO A;  4CLY A;  2HWI A;  4ED4 A;  2R7W A;  3M30 B;  4DUY J;  3FZ2 A;  1N5Y B;  3BM7 A;  3GE9 A;  1TVR A;  1REG X;  3EDQ B;  1CVJ A;  4HHU A;  3RBE A;  4MK7 A;  3SCJ E;  4NOH A;  3NCQ A;  2HRY A;  2QMW A;  1OWX A;  1SH0 A;  5JVH Q;  2E5I A;  4PXE A;  4UUW A;  3W1Y C;  4DCP B;  3BSN A;  2AU0 A;  1YBU A;  4HTJ A;  3GZ7 A;  3I96 A;  3OXL A;  4I6W A;  2O01 C;  1NCL A;  1D9F A;  1RT2 A;  5I3P A;  2YXL A;  4GVL A;  4ECT A;  3RW6 A;  1YG0 A;  4IDK A;  2ZNY A;  5L1K A;  4J9P A;  3IFE A;  3KNG A;  5KFX A;  4ZMM A;  3QRP A;  1FXL A;  1PBA A;  2PE8 A;  2XG8 A;  1I94 J;  2YKM A;  3WZ0 A;  3AOC A;  2YKM B;  3W61 A;  3M8P B;  4ANE A;  1U2C A;  2QGF B;  4QWC A;  1OYE A;  4DFP A;  2JEI A;  3D54 A;  4OZ5 A;  4O0I A;  1AB8 A;  3MDF A;  1JIH A;  2JFD A;  3AA9 A;  1ARO P;  3IWX A;  4QW8 A;  2YNI A;  1RAO A;  3V5R A;  1B3T A;  2K06 A;  2U1A A;  4O4R A;  2F3J A;  4OYW A;  1U6B A;  2BKP A;  1B0V A;  4NLO A;  2WTF A;  4F7V A;  3TUZ C;  3OVA A;  2VKZ G;  3H42 A;  4RBV A;  4DFM A;  1JLB A;  2GMJ A;  4B9L A;  2J9D E;  2B5J A;  3UN5 A;  2RDJ A;  1YIJ S;  1NLT A;  3PIO Q;  2DHH A;  2OJ3 A;  2GS8 A;  4ZPD A;  2WB1 D;  3EZO A;  3QGP A;  3FUY A;  1XK8 A;  2RQC A;  1WUU A;  1KRP A;  2OH2 A;  5F3T A;  2UXB F;  2GJI A;  3GJQ B;  4LF8 J;  1HWK A;  2W01 A;  4R5P B;  4KSE B;  4J9U E;  3EDR B;  4IH5 A;  4NLU A;  4P73 A;  1J27 A;  2XYG B;  1GTE A;  1O51 A;  5LM7 E;  1S59 A;  4FDF A;  2OPR B;  2ZBI A;  3C15 B;  5KT5 A;  4EZ9 A;  2ZH6 A;  2DRD A;  4XAK A;  1ICE B;  1YWX A;  2B9X A;  4OLO A;  2ATL A;  2PMW A;  4J9Q A;  3DLG B;  1W7W A;  2G0C A;  1H73 A;  4FKX A;  2V2V A;  4I68 A;  4QJV A;  1SUQ B;  1NJY A;  1YTY A;  3DFE A;  2FLO A;  2JL9 A;  3ITH B;  3LGH A;  1AUS L;  3UI3 A;  2KL8 A;  3G6X A;  4RR5 A;  2LQ9 A;  3QQC D;  1XQI A;  3BKU A;  5K14 B;  3D2W A;  1HR0 F;  2XSJ A;  5C42 B;  1RWX B;  3ZNU A;  2HIY A;  4MIW A;  3CGI A;  3ZTO A;  1S99 A;  3CW2 C;  3MAQ A;  2RRB A;  4HYK A;  1N6Q A;  1WOP A;  4JV0 A;  4Y2I A;  4NXM F;  3M2V A;  2ATC B;  3DHW C;  1HNX J;  4EO8 A;  3NL0 A;  1WC0 A;  3VGT A;  2GO9 A;  3FDS A;  5MAO A;  4CIO A;  4F50 A;  2Z2L A;  1R0A A;  5C7P A;  2CZ4 A;  3H40 A;  1N4L A;  5DG9 A;  2HS0 A;  1JWW A;  2FUG 9;  4YDD B;  3G86 A;  3W2W A;  2WHO A;  4I2Q A;  4OV1 A;  4URQ U;  1EAR A;  5KTQ A;  2E5L F;  2POK A;  4FF3 A;  2IPO B;  2ZD1 B;  2Z58 B;  3VGV A;  2Q79 A;  3QFH A;  3RJM B;  1VBZ A;  3HVA A;  3PFO A;  1Y00 A;  4A47 A;  4F25 A;  3KLE B;  3M1V A;  4OJ3 A;  1Q53 A;  2EXU A;  3VVU A;  2W2Q P;  4IQX A;  2J0S D;  2M0G B;  4CH7 A;  1H7X A;  2DCL A;  4L6V 3;  2FJE B;  1GXT A;  4DV4 J;  1T05 A;  1UVJ A;  2OFG X;  1S9E A;  1KHV A;  3TAM B;  3M8Y A;  5IFM A;  2FQQ B;  4V19 J;  3LGN A;  4MIA A;  4JI3 J;  1TKZ A;  2R8H A;  3BDE A;  4H4M A;  4WE1 B;  1NPK A;  2KYZ A;  2EFP A;  3DLJ A;  1HBM B;  3MEC A;  2EBE A;  2HHX A;  1FKP A;  5KG0 A;  4DZD A;  4QR2 A;  4LSZ B;  3DOL A;  3MPD A;  4QIV A;  3W9H A;  3MFH A;  2R9L A;  2EFQ A;  1P9Q C;  2X7I A;  3K5M A;  5KT2 A;  1UEK A;  4CP5 A;  1JX4 A;  2BDP A;  1HD1 A;  2CPZ A;  3EGW B;  1HHS A;  4QIE A;  3PW2 A;  4LFB F;  1LW0 B;  1HHQ A;  1Y7P A;  2QSW A;  3EWG A;  3T3F A;  1AYE A;  2WVE A;  2BAN A;  4Y0F A;  4M5J A;  1TK5 A;  3PNI A;  1RP5 A;  1XAO A;  4AL6 A;  3M8Q A;  1FX4 A;  5B0F A;  2LP4 A;  2VL1 A;  1X4F A;  1VQO S;  1IBK J;  5G0R A;  3VTI A;  1M5V C;  5GAD U;  4MKY A;  2HQF A;  3MOZ A;  4K2J A;  5E3A A;  3W65 A;  4X4U A;  5KFW A;  1QAI A;  2OPQ A;  3HKZ D;  2LYV A;  2KTQ A;  4PG4 A;  1N34 F;  3GIJ A;  4B9U A;  2RQ4 A;  1PJ5 A;  3ET6 A;  3G96 A;  2VF3 A;  1QAJ A;  2DNN A;  4CM2 A;  3DLH A;  2X3G A;  1Q8K A;  1X5T A;  1WC4 A;  2RF2 B;  4KO0 A;  2JLG A;  4P7V A;  2VG6 B;  1EAY C;  3MFI A;  1S0V A;  1IJF B;  4ECX A;  3BZQ A;  1HA1 A;  1SBR A;  2KO1 A;  2KZZ A;  3I9V 9;  3OR1 B;  2IJR A;  2RSQ A;  4E98 A;  5HQL A;  5ETL A;  4F0M A;  2YNF B;  3BSC A;  4FNI A;  2Y1L B;  1U4B A;  4C8L A;  3JS9 A;  5LSL A;  3PO4 A;  2DNP A;  4DR4 F;  2GQQ A;  2JSX A;  4PKD B;  1TMJ A;  2V5H G;  4QWA A;  1YJU A;  1N56 A;  1X5O A;  2R7T A;  5T7L B;  2C2D A;  1U1M A;  3GTY X;  4CLS A;  3C6U A;  4TYB A;  4GVB B;  3GIM A;  3NG8 A;  1KR4 A;  4FYW B;  4WKY A;  2Y0B B;  5J2N B;  4DV3 J;  2KHC A;  5E3Q A;  3KG4 A;  4O3N A;  4JI8 J;  3IG1 A;  1EX8 A;  1JLE B;  3GJS B;  3I0R A;  4J91 A;  4LF1 A;  4C97 A;  4U7C A;  2Q2G A;  2A1B A;  1HI0 P;  4B9V A;  2ZZN A;  3QNW B;  1SQE A;  1FJE B;  2M8D B;  4C0B A;  3LWM A;  4QWD A;  1S9F A;  4DPY A;  5FJ4 A;  2KXF A;  3GON A;  1KN6 A;  2QL7 B;  2H9Z A;  3NLC A;  4TY9 A;  2ASD A;  4X4Q A;  3NCP A;  3D5M A;  1SC3 B;  1VCT A;  5D4N A;  1HWI A;  4OYB A;  2L9D A;  5H1S V;  3TVK A;  3RAQ A;  4RNF A;  1ZPW X;  2OPS B;  2CQH A;  1SJ4 P;  3A1Y G;  4NI2 B;  4C8O A;  2XM3 A;  1RHQ B;  1VQP S;  4F3M A;  1APS A;  1H2T Z;  2MGZ B;  2ASY A;  4ED2 A;  1HQE A;  4FYX B;  1BHN A;  3BBF A;  1IXK A;  1UVI A;  1M1G A;  1CSJ A;  1RBA A;  3BGO P;  1JLF B;  2YNH A;  5D77 A;  2J7W A;  3V6J A;  3GV7 B;  3V2U C;  2B6A B;  2DR7 A;  1N8R T;  4KJI A;  5HQM A;  1FKA F;  3AQO A;  2CG4 A;  5ETO A;  4O3Q A;  4ZVP B;  1XEZ A;  3UCZ P;  1H6K X;  5THW A;  1C0T B;  4ZJL A;  2M5Y A;  4DX7 A;  3JB9 k;  1B7F A;  5FLX Y;  2KVI A;  3OFG A;  3BB5 A;  4ATN A;  3LP2 A;  3NBP A;  2FZC B;  5DDR C;  4CO3 A;  4YHH J;  2X1A A;  3LF0 A;  2GW8 A;  3MGJ A;  3MR5 A;  2WB4 A;  1BD6 A;  2E7X A;  3R27 A;  2I9S A;  5FDL B;  1GXU A;  3ET6 B;  3WC0 A;  3CCJ S;  2HNY B;  3VAH A;  1N48 A;  5LL6 d;  2MXY A;  1Z1Z A;  2R2S A;  2QLD A;  2UVV A;  1NND A;  3KFW X;  2ODX A;  3QFW A;  4DR6 J;  1JNZ B;  2BJ1 A;  3FK4 A;  1U25 A;  2W8K A;  3TX8 A;  1S76 D;  1G2E A;  2QN6 B;  3DU5 A;  3OXF A;  3HHL C;  3SQG A;  1F2G A;  2WON B;  1YGY A;  1O5J A;  1C1B A;  2MZS A;  2FHK A;  3MCM A;  1PJ7 A;  2OEJ A;  4V19 X;  3WIV A;  3OHA A;  4FKY A;  3CJT A;  4F3Q A;  1Q79 A;  4C11 B;  3R7S B;  2V6A A;  2A10 A;  2HEK A;  1N0V C;  1RHJ B;  2X3D A;  4USV A;  2W9C B;  1HPZ B;  4PYD A;  1R8B A;  1VMB A;  4ZVT B;  2V4J B;  3CMA S;  3ILI A;  3LTO A;  3HSD A;  3K89 A;  1VQM S;  2JFK A;  1KVK A;  4M1K A;  3LWL A;  4FPI A;  4NLD A;  3T1Y J;  4DR1 J;  4DQQ A;  4WU3 A;  1XER A;  2XWY A;  1FFG B;  3UD3 P;  4DSI A;  1Y0H A;  3VZI A;  3V81 A;  3ISN D;  4FS1 A;  1D09 B;  3E01 A;  2Y1R I;  1SC4 B;  5D78 A;  1FCA A;  4JV5 J;  1S9E B;  4PAA A;  1PCA A;  3DLK B;  1FRX A;  4PXC A;  4PZV A;  4PUO B;  1D8Y A;  1UJ6 A;  2YKN A;  1WHY A;  4P52 A;  3GII A;  4AL7 A;  3DHX A;  4BS2 A;  4F3O A;  2YWH A;  3AD7 C;  4R0E A;  1RB0 A;  2BW7 A;  2CPX A;  4JOU A;  4C3M A;  1X9S A;  2PI5 A;  4B3M F;  2KFY A;  1K47 A;  5DQI A;  4LFC F;  3IA0 A;  5DM6 Q;  2DRA A;  2HQI A;  5IOL A;  3K17 A;  2HWH A;  3RZA A;  4WFA Q;  5CZX A;  4KR0 B;  4J5O A;  3T5L A;  1O8B A;  2GQC A;  2XY6 A;  1NAQ A;  3Q8V A;  1LOU A;  4ED1 A;  5F9N A;  2FPH X;  5KFG A;  3VR1 A;  3VV2 B;  4CLW A;  3SI8 A;  4ALZ A;  3CD6 S;  3V4M A;  3M2V B;  3MZI A;  3FRY A;  2ZIT A;  4ZS6 A;  3DRY A;  5IQQ A;  4EMD A;  4WFB Q;  1V3Z A;  2JEJ A;  4FXD A;  4RW4 B;  1RTI B;  2YTC A;  2XSJ B;  4ES1 A;  1MW7 A;  5C42 A;  3CUN A;  2E9T A;  3KK2 A;  4K4U A;  4G65 A;  1RT7 B;  4R8U B;  5L1I A;  4O3S A;  2XO7 A;  1R8P A;  2E9R X;  1DFD A;  3FQK A;  5KFI A;  2RDI A;  1SVD A;  3VAG A;  3DLG A;  1UKU A;  3PJX A;  4EBD A;  4GKK F;  2BW2 A;  2F40 A;  4FVC A;  4OLP A;  2OTL S;  4NAS A;  3CCQ S;  2NSB A;  2QLF B;  5IS2 A;  4TLR A;  1SQF A;  4RW6 B;  2GMH A;  2HHP A;  1VQN S;  2B7C B;  1Q1K A;  1HIY A;  3EVW A;  2E29 A;  3ULH A;  4B3R F;  2GHW A;  4LSL B;  4IG0 B;  4DG1 A;  3TNV A;  5EHH A;  3ZTP A;  4B3S J;  1HL6 A;  2EG2 A;  1PJ6 A;  2IIH A;  1KC8 T;  2N82 B;  3LUY A;  2C22 A;  1RTD A;  2DNG A;  1S12 A;  3PYG A;  5E7O B;  2B5J B;  2YWE A;  3TEG A;  3GYG A;  3HHK A;  2KB2 A;  2R7Q A;  3AGY A;  4M63 A;  5JVG Q;  4K4W A;  4S0M A;  2EKN A;  2C2E A;  4W90 B;  1UWA A;  3CNQ P;  1RTJ B;  2VIH A;  3IRX A;  1F0X A;  1WDT A;  3HJV A;  3QYY A;  1TV6 A;  2V8D A;  4ECQ A;  3UD4 P;  2FJW A;  5J2Q B;  1BQX A;  1C0U A;  2CPD A;  1XR6 A;  4C0H A;  2DK2 A;  3GFY A;  3PR5 B;  1T9U A;  3FC9 A;  1DTT B;  2E7W A;  4EYH B;  1R8H A;  2C2Z B;  2XHW A;  4OI1 A;  5C24 B;  1XMO J;  3MXH P;  1S6P B;  3BO4 A;  1S10 A;  1HBU A;  1XR7 A;  3THP A;  3K7R A;  3AB4 B;  3US5 A;  3RBD A;  3C14 B;  1UFK A;  3TVZ A;  1H7W A;  5HAN A;  1VHF A;  2DH9 A;  3Q8P B;  5B0G A;  1SKR A;  1S0M A;  3BR8 A;  3SSS A;  1BUX A;  3CC4 S;  1NKB A;  2HLT A;  1SXL A;  3KKF A;  4NYO A;  2W7A A;  2FHJ A;  1S1T B;  3PEJ A;  4Z37 A;  3NNH A;  2WRM A;  4IG0 A;  3HUL A;  1U48 A;  4AUK A;  4TN2 A;  4DJB A;  3PO5 A;  3C6E C;  2E1M C;  2UUB J;  2HVD A;  3B54 A;  4N56 A;  1JLQ A;  2BXJ A;  2LFV A;  2IAJ B;  2W8L A;  4DLE A;  2CQ0 A;  2IMO A;  2BE2 B;  3KHL A;  2E1A A;  3CTR A;  4CLZ A;  2MZJ A;  1Z4U A;  3MUT P;  2C2K B;  4X2B A;  3PFE A;  1R7I A;  1S1X B;  4ZCI A;  3VGU A;  2IJF A;  3PCO B;  1KQF B;  3RB3 A;  3W9I A;  4N76 A;  2N4D A;  5BR8 J;  2DR8 A;  2BAB A;  5K5M A;  2CNL B;  3CIM A;  4RW7 B;  2V50 A;  2UXB J;  2E1C A;  3HK2 A;  3J7A N;  1H2V Z;  1MWZ A;  4YB1 P;  3HD2 A;  5HVF A;  2V0N A;  2V69 A;  3FMW A;  1ZZF A;  3GG0 A;  1VC6 A;  2M9K A;  2I5J A;  1MMD A;  2A6M A;  4DS4 A;  4ZPA A;  4QCL A;  4ZHR A;  1U8S A;  2MY7 A;  5KG5 A;  4I6Y A;  1FKO A;  1HKA A;  4OV6 A;  4D3H A;  2AZ1 A;  1TMM A;  3QAT A;  2GAH C;  4DV2 J;  4FYD A;  5KG3 A;  2WW4 A;  3SMZ A;  2VBX A;  3H5X A;  2DGX A;  1NBE B;  4G1P A;  5LMN J;  3PRD A;  4DV4 F;  4LRE A;  4O4G B;  4RWX A;  1T03 A;  2MMY A;  2CA9 A;  1XMQ J;  3BJY A;  3HHE A;  8ATC B;  3MUV P;  1N32 F;  3ZZR A;  1OIA A;  4EGL A;  1QSS A;  2ZVS A;  3TR5 A;  1WC6 A;  5RUB A;  4RLE A;  2M7S A;  4RJV A;  2ZH8 A;  4IFY A;  1IWG A;  1JMT A;  4DN0 A;  4IRD A;  3Q0A A;  2E9Z A;  2IRY A;  3Q8Y A;  4YR0 A;  1EZZ B;  3B4D A;  3GYN A;  3MMB A;  1UL3 A;  2QO3 A;  4FPR A;  4MK8 A;  2DH8 A;  4QQB A;  4Z7C A;  2J6T A;  3H2V E;  1SJ3 P;  1FT8 A;  1T02 A;  4AFF A;  2VFT A;  5J2M A;  2E5H A;  2MLY A;  2YWF A;  3KG1 A;  2ZJP Q;  3J7A 1;  2UZA A;  1NHV A;  3LP0 A;  4DSE A;  1NJI T;  1O0P A;  1RWK B;  3DOM A;  5KT7 A;  3P6Y C;  4L3N A;  4X66 F;  3ETO A;  1HPZ A;  4F04 B;  2XS5 A;  1ULR A;  1TUV A;  3D66 A;  3GG1 A;  4ECV A;  3T5J A;  2JEG A;  1RAC B;  2G4B A;  2X1B A;  1PIE A;  1X4H A;  1GTH A;  3DKD A;  2XCP A;  5KT6 A;  2W4C A;  2ALZ A;  1LV5 A;  4B3T J;  1KOH A;  4LIR A;  4JI6 J;  2MPU A;  1JXV A;  1RHR B;  2B3T B;  3BV8 A;  4TXS A;  4V1A k;  2JVM A;  1RHM B;  4X84 A;  1NSQ A;  3AOD A;  1RT1 B;  3Q22 A;  3R5C A;  5KFP A;  1F3V A;  1KQG B;  2I5J B;  1E6Y A;  1UVK A;  2ZHO A;  4U8V A;  3UN3 A;  4NCB A;  1Y3K A;  3CD0 A;  5CYM A;  2HG4 A;  2CQ4 A;  2VC1 A;  2V8V A;  2XMK A;  4OZN A;  3GFZ A;  1RE1 B;  3AOB A;  3EXC X;  1X9W A;  3R6L B;  4OI6 A;  4Y2K A;  5KT3 A;  3OPK A;  2WBR A;  3DRX A;  3IM8 A;  1G6B A;  1C1C B;  4QWE A;  3GLJ A;  3KLH B;  2HYI B;  4CTA A;  2ZKU A;  1XNQ J;  2ZE2 B;  1RAA B;  3F44 A;  3EM1 A;  4WTY A;  3R5D A;  4LBH A;  1Z2L A;  3GB0 A;  4A8K A;  4X64 J;  5KFM A;  3CCE S;  5I3Q A;  2AJF E;  1FTC A;  1FVS A;  5K8N A;  1K73 T;  1N36 J;  4ED6 A;  1MN9 A;  3QLH B;  1EET B;  3QIP B;  2L9N A;  2W2P P;  1L3U A;  5I42 B;  4ZVQ B;  2B7B B;  2XQC A;  4CQ1 A;  2DNQ A;  5KOW A;  2DGW A;  4OZL A;  3S8S A;  3MAH A;  4F0H A;  3UR0 A;  4F02 A;  4OX6 A;  4CRJ A;  1EKS A;  2AMC B;  2C2O B;  3IC1 A;  4O23 A;  1RWN B;  2DGS A;  4CO4 A;  1NJZ A;  4CCH A;  2RQK A;  3N6M A;  4HT7 A;  4FZV A;  3DGP B;  3TA2 A;  3Q24 A;  2N7C A;  1HBU B;  3MM9 A;  3B4M A;  3ZZT A;  1IUJ A;  4UZC A;  2UUB F;  2EK6 A;  4F2R A;  3QJP A;  4QU6 A;  1FJG J;  2K2P A;  1WSV A;  3TZX A;  1T9Y A;  2AWZ A;  4WBF A;  2DVI A;  2KT3 A;  1DTT A;  5B09 A;  2XC9 A;  5L9X A;  1QM9 A;  1NB7 A;  1NU4 A;  2J5A A;  2J8S A;  3IO1 A;  3FSX A;  4AXJ A;  3TI0 A;  2JRR A;  1JLE A;  3I0R B;  4EI2 A;  1PKU A;  2CWK A;  4PWU A;  2RU3 A;  1SI9 A;  3H2L A;  2IVY A;  4BBY A;  1R89 A;  3I87 A;  1LXJ A;  1CJT B;  5I3U A;  3CCU S;  1NK8 A;  1C4C A;  3WX4 A;  1IKW A;  2DXE A;  4YR3 A;  2ZDO A;  4DWI A;  2QRR A;  3VAI A;  3IM9 A;  3MCN A;  4UOH A;  1D8Z A;  5L8R C;  2AYB A;  1H72 C;  4RBU A;  3KMQ A;  4GC7 A;  5D3G A;  2DNK A;  2JJ4 D;  1VDH A;  3FSY A;  3ONQ A;  3OL9 A;  4NPO A;  2RUS A;  3AFG A;  3I32 A;  3DRS A;  4DG1 B;  1C1C A;  2B4O A;  1Y3J A;  2HS3 A;  5FII A;  5CD4 H;  2VQF J;  3Q86 A;  2HZA A;  4F4A A;  2VG6 A;  1U02 A;  2AX0 A;  5K8M A;  2P9E A;  3D6F B;  4RW6 A;  5KFR A;  1SV5 B;  3D6H B;  3GMG A;  3IBF B;  4PG7 A;  5IT0 A;  1FRI A;  1HNW J;  2MY8 A;  3L4B C;  2QLB B;  1ZH5 A;  2LU1 A;  1NO8 A;  5SZT A;  1WWH A;  4B3T F;  2CAD A;  2A18 A;  1M5H A;  1T3O A;  2QFI A;  3T9Z A;  2UU9 J;  3HKW A;  3PJ9 A;  5GMK a;  3GJT B;  3PV8 A;  3QBC A;  2AJQ A;  4GRS A;  2W25 A;  4USI A;  3FBC A;  3NWR A;  1L3V A;  3D1H A;  3M8Q B;  1FJC A;  1FDN A;  1RTI A;  2QLW A;  3E8O A;  1IKY B;  3DRR B;  4Q5V A;  3MPW A;  2LEC A;  3MR6 A;  4HKQ A;  4ELV A;  4O44 A;  3OL8 A;  3DDI A;  3H8Y A;  5BYR A;  1IVZ A;  1QD1 A;  2PC6 A;  2EFV A;  3SXL A;  5DM7 Q;  4IOA Q;  1RYS A;  1HWL A;  1FD2 A;  4RPF A;  3IGN A;  2OD6 A;  1NB2 A;  4Q8E A;  5EWF A;  4K5S A;  3NCR A;  3G6E S;  4Q2M A;  3I6P A;  3ZZU A;  1MMN A;  1F60 B;  4J7C A;  4A8W A;  5KFE A;  3LH2 S;  1A0O B;  1B4S A;  2VBZ A;  1ZA2 B;  2KN4 A;  2Y3Y A;  3DI6 B;  1Q82 T;  4IR9 A;  4H4M B;  1CJV B;  2FHO B;  1TKZ B;  2PA3 A;  3RTV A;  1S77 D;  3KNA A;  2ZNZ A;  2J7U A;  1KDN A;  3BGF A;  3RR8 A;  1T7P A;  2EPI A;  1VIX A;  2A0F B;  2KFZ A;  3FBF A;  1FVQ A;  3ZZO A;  4PQA A;  1V9O A;  2CAJ A;  2H65 B;  2V2Q A;  2Q1L A;  3W63 A;  3CPW R;  1FDB A;  1FNM A;  1YZ7 A;  2JOQ A;  1J5E J;  5CZV A;  2ZZT A;  3VHQ A;  5HBM B;  5KFS A;  4B9T A;  1T9W A;  5CQG A;  5JMN A;  4PRF A;  2ZD1 A;  3A3P B;  3CDW A;  2DTJ A;  4O3O A;  4PPD A;  2NPF A;  2B4V A;  4P74 A;  3W60 A;  3BPS P;  1U45 A;  4NA2 A;  5GAH U;  2J0Q D;  5F8J A;  3KWM A;  4OX8 A;  3LOU A;  4UF4 A;  4LR7 A;  4DBQ A;  4LRA A;  2V4J A;  3DXS X;  3ENQ A;  2V68 A;  4I1T A;  1F6T A;  1FRK A;  4ZHR B;  1K0T A;  5HAT A;  4O44 B;  4RBT A;  1R8C A;  2LMI A;  4DR1 F;  1JJC B;  4CDI A;  1VQ5 S;  2X1F A;  2P6T A;  1TFW A;  1JLG B;  5DDQ C;  2M88 A;  4U67 Q;  1TUW A;  1JKH A;  2W2O P;  3CED A;  5HP1 A;  3CCW A;  3FGV A;  1U09 A;  5T41 A;  4NYP A;  1VBY A;  2I1R A;  2C3O A;  3C16 A;  3L95 X;  3SQG B;  3TAQ A;  5F3Z A;  2D1C A;  1X0P A;  1K8A T;  5G4D A;  5ETR A;  9RUB A;  1WC5 A;  4F4X A;  2ZVI A;  2O3D A;  1VBK A;  2DHX A;  5FDL A;  4I0W A;  2AYE A;  3G82 B;  5KT4 A;  4QYZ J;  1QE1 A;  5L38 A;  1IQT A;  3OL7 A;  4ZCL A;  2ZH3 A;  2CJK A;  1Q5Y A;  3FVY A;  2J8A A;  2E44 A;  2HBZ B;  4DL5 A;  3QAE A;  2R42 A;  4KGV B;  3M8R A;  4ZLL A;  1S1T A;  2RE1 A;  1A7G E;  3CO0 P;  3H25 A;  4F2S A;  5IT9 Y;  5D3G B;  2UUA J;  1YZ6 A;  2BYC A;  2XMA A;  2GJ2 A;  2UUC F;  1M5S A;  5L1J A;  4FXW A;  1XJW B;  3BO3 A;  1PC4 A;  3FFI A;  4C4W A;  3FQL A;  3C14 A;  4WP9 A;  2P9C A;  3Q2S C;  3RYL A;  4A4J A;  2CG8 A;  4RUA A;  2J6U A;  4YHH F;  4ZPB A;  3JSR A;  2BKO A;  4PPZ A;  2EC2 A;  4JI8 F;  4M5I A;  4DV3 F;  1Q5V A;  1HBN B;  2BKN A;  1UTA A;  3BRE A;  4HL9 A;  3M8P A;  2OSQ A;  4IYQ A;  4NI2 A;  3BEG B;  5BXI A;  4MFB A;  2QG9 B;  2FVP A;  2HQD A;  1UA0 A;  3BO2 A;  3MM6 B;  3MR2 A;  1YRU A;  2VA2 A;  2RHS B;  1OSD A;  2ROP A;  1SIW B;  2IRU A;  3KG0 A;  2RS2 A;  1OMS A;  1CLF A;  2Z8Q A;  1DHM A;  2HK3 A;  3SFU A;  2QIF A;  2Z2Y B;  5KFV A;  1SKS A;  2IVF B;  2DGT A;  4NCG A;  4AD6 A;  1MNE A;  4M94 A;  2B4U A;  4MTP A;  1WI8 A;  4WXO A;  4U95 A;  1HW8 A;  2GML A;  3KK3 B;  3JTN A;  1R31 A;  4P2X A;  4B3R J;  2FLL A;  1V3S A;  2B9Y A;  3IG1 B;  3QGG A;  2CRL A;  2YH1 A;  1JXL A;  3MM5 B;  4LF2 A;  4NZ6 A;  1Y10 A;  3D9B A;  1UJ4 A;  3E3X A;  3MPY A;  3N4W A;  1CQN A;  3C6U B;  2ZC4 A;  2DB1 A;  4CM0 A;  4P71 A;  5T7L A;  3TZZ A;  4LUB A;  1GEH A;  1VRQ C;  4OJH A;  4EYI B;  4YP3 A;  3PW4 A;  5JUM A;  4N41 A;  3V6H A;  3G2X A;  1Q78 A;  1IQZ A;  3MD1 A;  4OYI A;  1FJ7 A;  5KFA A;  4KT0 C;  1MML A;  2W9B B;  2MKS A;  3O8W A;  4B3O B;  4UY8 T;  3BYP A;  1HQ2 A;  4CTA B;  3GFX A;  3KLF A;  3KLH A;  5C5J A;  1RWM B;  2BM1 A;  3I31 A;  3QWP A;  1BMQ B;  2CQD A;  3DDK A;  3GSD A;  1I3O B;  4LFA J;  1LXN A;  2HND A;  2OI2 A;  4H4O B;  1RT4 B;  4HEA 9;  3J81 j;  1PSD A;  2W2N P;  3KK2 B;  1HD0 A;  2FD2 A;  2RVJ A;  3CCS S;  2PN6 A;  2HSE B;  1YVF A;  3CSK A;  4EEY A;  2YWG A;  2DHA A;  2HBQ B;  3A3O B;  1NK9 A;  3HJF A;  4X4V A;  4JI2 F;  2G9O A;  5B0A A;  2CXE A;  1LWX A;  2O66 A;  2V9W A;  3EGZ A;  4DS5 A;  4PEO A;  5G0R B;  4NLW A;  4DX5 A;  1XC9 A;  2OPP A;  1HNW F;  2N7Y A;  4M95 A;  3M7V A;  4WJB A;  3UR3 C;  4ECR A;  1UCN A;  2M3D A;  2CJA A;  4ZVR B;  3GJR B;  1P1T A;  2YWK A;  1S1W A;  4DI6 A;  4A8S A;  3L3C A;  1U26 A;  4YUD A;  2CPE A;  1RAD B;  4RNN A;  2B26 A;  4JI7 F;  2APO A;  2Q3P A;  2ASL A;  4ECS A;  1TEL A;  4X62 J;  4PUO A;  1HQU A;  2IY5 B;  2M8H A;  5J2M B;  5AJ3 F;  4EK2 A;  1RSC A;  1U7L A;  1FFW B;  1HBM A;  1JQG A;  3MEC B;  4WE1 A;  4M5G A;  1RIS A;  1EHW A;  2CFX A;  2MKC A;  1KLN A;  1JLA A;  2GVZ B;  3W8G A;  1RAJ A;  2FJB B;  3C19 A;  4MKB A;  3OTO F;  1R0B G;  3ICL A;  2D69 A;  3UW1 A;  2VOD A;  5A8R B;  2QMU B;  2XS2 A;  3DLE B;  1KLM B;  4B17 A;  2DKO B;  2L9W A;  3CME S;  4JI3 F;  4ED5 A;  2MKK A;  2PDA A;  4PCQ A;  1S1W B;  3Q2T C;  1Z2Z A;  4CO5 A;  4M5N A;  1GMW A;  1IJE B;  4UOF A;  4X4T A;  5IWA F;  4J9M A;  2C28 A;  2VFV A;  2HW3 A;  5HMY A;  4ZVG A;  2C3U A;  2WBM A;  4A8F A;  2OPP B;  2QFJ A;  4X62 F;  1B70 B;  2BOP A;  2V4R A;  1FKO B;  4C98 A;  3WIU A;  1SL1 A;  3C8Y A;  3C66 A;  4DMZ A;  3IS9 A;  5AXM A;  4OZJ A;  5MLC V;  2G0I A;  2EC0 A;  1F3F A;  1NXI A;  1S5Z A;  5LSO A;  2JZ5 A;  3BGR B;  4LF8 F;  3OJU A;  4B08 A;  4ZLP A;  3HHN B;  3L7P A;  1LWE A;  2VD3 A;  3HFZ B;  5K14 A;  3OR2 A;  4NLP A;  2UVU A;  5LOQ A;  4DSJ A;  1RT4 A;  1N33 F;  2ZWP A;  2HND B;  4H4O A;  1UAW A;  4KQZ A;  2P8I A;  2VQE F;  1UA1 A;  4NXN F;  3Q23 A;  3CDB A;  4MT1 A;  1S0O A;  1Q81 T;  1OPI A;  5F8L A;  3HF5 A;  3DMJ A;  3FCH A;  3NGS A;  3M8S A;  1GQE A;  3Q83 A;  3EYZ A;  3DDN A;  2ALY B;  2IM0 A;  2BE2 A;  1R6V A;  2H5I B;  3U02 A;  4QBU A;  4F4K A;  1RLD A;  2MQ8 A;  4RU9 A;  2LXU A;  2JZ8 A;  4FN5 A;  4QPT A;  5JXS A;  5IT4 A;  1KHW A;  1X4B A;  3GCX P;  4DU7 A;  1G1X A;  1SKW A;  5B7W A;  4RUC A;  2HAI A;  1HI1 A;  1N5V A;  2GIQ A;  1GMU A;  1RBO B;  2RIJ A;  2QTW A;  5BR8 F;  3MM5 A;  2B0G A;  1HQE B;  3EMT A;  1FJG F;  2PT0 A;  5M2R A;  4DL6 A;  4QYR A;  4OL8 A;  5SUH A;  1VC0 A;  1H3D A;  1JLB B;  4WP3 A;  3KJF B;  5F0W A;  1VQY A;  2YX4 A;  2DNY A;  1IM4 A;  4NWB A;  1VQL S;  4HI1 A;  2DO0 A;  3B82 A;  3GFH A;  4HR2 A;  5C24 A;  3R2C J;  3CJS A;  4CLU A;  3G6V A;  5LMU F;  4NLS A;  1LQ9 A;  3OV7 A;  4DV2 F;  4B9M A;  2VPX B;  4JV2 A;  4P9S A;  4MFB B;  1LEO A;  2Y0S D;  1C0U B;  4O0N A;  4ZVH A;  3PRV A;  5E0O A;  2XI3 A;  3UD5 A;  2CQB A;  2RB7 A;  3EUN A;  1BQN B;  1P6T A;  3T1A A;  4I6A A;  3EXY A;  1EQM A;  1RTJ A;  3BS9 A;  4GVB A;  4NMX A;  5IC6 B;  5BJR A;  2ZH2 A;  1NK4 A;  1RWV B;  4OX7 A;  1DQ8 A;  3K59 A;  3FFI B;  2JWN A;  3T1H J;  4DL7 A;  2F5G A;  2DHS A;  1S72 S;  2UXC F;  1YJ7 A;  3QZ7 A;  4DF4 A;  3V6K A;  1PC5 A;  2KU7 A;  3NOC A;  4ETX A;  2YKP A;  5IXU A;  1M0S A;  4LVN P;  1RHU B;  2HK2 A;  3CE8 A;  1FK9 B;  3DLB A;  2DYA A;  2MZR A;  5GAG U;  4DF8 A;  3T1Y F;  5DGA A;  2C3P A;  1D9A A;  2ROE A;  1SJF A;  2AX1 A;  1XWL A;  1E6V B;  2RKI A;  4OZ1 A;  4NE9 C;  1BQM B;  3UVJ A;  4QWB A;  2FJV A;  2AP6 A;  2HAF A;  2RF2 A;  1QE1 B;  3R5A A;  2IMW P;  1I51 B;  1LW2 A;  4DSF A;  4AYB D;  4N8N A;  5F41 A;  3KYL A;  4JYA F;  2C1E B;  4C8Z A;  3EJM A;  5KFF A;  1RGV A;  1HHT P;  1VK8 A;  4AXI A;  1NKE A;  2YBV A;  3F73 A;  4Q45 A;  2EFG A;  1Q4R A;  1M5K C;  1RT7 A;  4R8U A;  2R7R A;  4ECU A;  3C3L A;  1WSR A;  4LF9 F;  1UVN A;  4C8N A;  2HMI A;  5HP1 B;  1RYR A;  5KG7 A;  3QWU A;  5DO2 A;  4DCO B;  3F41 A;  2WVF A;  2AYM A;  2F1F A;  2RT3 A;  2MQN A;  4C48 A;  4HT5 A;  4LF4 F;  3GP9 A;  1CJK B;  1WF1 A;  4MH8 A;  1RT6 B;  8RUC A;  1VRU A;  2CDR B;  3D3B J;  2MQQ A;  4N7T A;  2BJ3 A;  4DR7 F;  1F5A A;  2BMB A;  1VFJ A;  2WVD A;  3M6W A;  1JJ4 A;  3MTK A;  3BYR A;  3PYF A;  5E41 A;  4OX9 J;  4HAC A;  2HKE A;  5IM0 B;  1UEV A;  3DOL B;  2ZM6 F;  3D6T B;  3MMC A;  1RXO B;  2A2D A;  2VZ9 A;  3UNG C;  3M9N B;  1UPM B;  1U6Z A;  1WG4 A;  5KFY A;  4TKT A;  1K1Q A;  1UFW A;  4XIU A;  4W92 B;  3TUP A;  5F8G A;  3TAM A;  1ROF A;  2CQ3 A;  2FJD B;  1GH8 A;  1U47 A;  1TL3 B;  1GK8 A;  2YKN B;  3AJ2 A;  2Q66 A;  2DY9 A;  5D15 A;  4Z7Y A;  3ZXW A;  2LEP A;  2EEY A;  7FDR A;  3PJW A;  1RZM A;  3BF4 A;  1HLW A;  1WOO A;  1ZM2 A;  3E01 B;  3AKO B;  2CZ9 A;  4KPY A;  3V81 B;  1J5O B;  2MHN A;  3AQP A;  3CD7 A;  4K0K F;  1VJQ A;  1ZAV A;  3UWT A;  3DI6 A;  4OMF G;  3HMJ G;  4ED0 A;  2MKI A;  2WZ1 A;  4FYY B;  4I2Q B;  2I2Y A;  1MWY A;  1TL5 A;  4HAC B;  2IA0 A;  2VU5 A;  4EBC A;  1H2U X;  2J0W A;  2DNH A;  2FGC A;  2OEL A;  1R0A B;  1IBM F;  1GMW D;  4DR6 F;  1IKX B;  1H74 A;  3OLA A;  2NXC A;  3DU6 A;  2D3O 1;  2AGQ A;  2PEH A;  3CJ8 A;  2W9C A;  4KHP F;  4C8K A;  1IWA A;  1Q8B A;  4X4O A;  1ZTW A;  3U27 A;  3E51 A;  3LAK A;  3J7Y I;  1B7Y B;  1GX5 A;  3HVT A;  2AF6 A;  3VZH A;  1IBC B;  3D28 A;  2AW0 A;  2VUG A;  4I4B A;  2Z2Z A;  4IOB A;  1ZBT A;  4NYZ A;  5K9F A;  2HVZ A;  5C2G A;  3SV3 A;  1UP1 A;  2GAG C;  4A8Q A;  2CPJ A;  4USH A;  2R2R A;  3NAI A;  3PHE A;  3QSI A;  2XB2 D;  1XN9 A;  4DR4 J;  4K50 A;  3OFE A;  5ETV A;  1SCJ B;  4ECY A;  1TKT B;  2BQR A;  2KJW A;  3M2R A;  3JTP A;  2OPR A;  3JSB A;  2B9W A;  2KHD A;  4KRW A;  3MM8 A;  4NA1 A;  1S7I A;  2KVQ E;  4NXM J;  3N6N A;  4RW8 B;  1MRO B;  3DYA B;  2ASJ A;  2IA6 A;  4ZA1 A;  1EQ0 A;  4DCJ B;  2K1R A;  4KKO B;  4QZV B;  2AQ4 A;  2JC1 A;  1RAI B;  1RCX B;  5HI7 A;  2GNK A;  2XLK A;  3SDE A;  1U24 A;  2H48 B;  1HI8 A;  4GC6 A;  2RML A;  3POT B;  1FI4 A;  5EWE A;  1VR6 A;  2RS8 A;  4O3P A;  2FHJ D;  2VV5 A;  2MZQ A;  4LT6 A;  4OI0 A;  5DQG A;  1U6F A;  1GXL A;  2B6A A;  4YS2 A;  3IR5 B;  5CD4 A;  2HHT A;  5HLF B;  4PG8 A;  4CYU B;  2CJY B;  3K8W A;  4LRF A;  3IGV A;  4ZKA A;  5L39 A;  5I3U B;  1CJT A;  3N28 A;  1UW4 A;  2YNI B;  2W1B A;  4XDC A;  2RAQ A;  3WBZ A;  1P1L A;  4DX6 A;  4L3K A;  2V63 A;  4DOZ A;  5IWA J;  2LDI A;  2V8P A;  4YDX A;  3NGT A;  3J80 Y;  4N5S A;  2CPH A;  4MK9 A;  1CJU A;  1K44 A;  3RRK A;  2OPS A;  2U2F A;  3NS6 A;  3OT9 A;  3D4J A;  3GQC A;  3EPG A;  3H5Y A;  3JQJ A;  4KPC A;  4OX9 F;  2UUC J;  1XNR J;  1ELO A;  2DGQ A;  2LQ8 A;  1HNV A;  3AJD A;  3EGN A;  3EIC A;  1ZET A;  2I38 A;  4OZ0 A;  1KON A;  2KT2 A;  4FS2 A;  3TVY A;  2VH7 A;  3CDU A;  4KTQ A;  2XMJ A;  3DC2 A;  1D3W A;  4IH7 A;  1FXR A;  3OLB A;  1Q16 B;  4YY3 F;  5J2N A;  3SV4 A;  2OD4 A;  2OTJ S;  1AW0 A;  3C6T A;  2GC8 A;  2MHE A;  3B8H A;  3FMB A;  3QIP A;  4WYW A;  1EET A;  2B8Q A;  1N5Y A;  4IH6 A;  5C2C A;  2HBR B;  2W24 A;  3TWZ A;  2VPW B;  3EX7 B;  2CPY A;  1BWV A;  3TA1 A;  2F9D A;  3GSI A;  1EP4 A;  5DS7 A;  4K4Y A;  1VIO A;  3MWB A;  3N79 A;  2HFS A;  2HS4 A;  4GO5 X;  1OY6 A;  1KP6 A;  2YQ3 A;  4DR7 J;  1LWC B;  3UCG A;  2QYG A;  3AT1 B;  3AXM A;  4MMO A;  2N3L A;  2DNZ A;  4UST A;  4LR8 A;  1NDL A;  4LSN A;  2C2R A;  1PYS B;  1JK9 B;  1SC1 B;  3P49 B;  3OR2 B;  4KO0 B;  4A8Y A;  1ACM B;  2M4M A;  2I0X A;  3I0S B;  4ZN3 A;  2HHQ A;  3PW7 A;  1GAO A;  2ZUG A;  1DQ9 A;  1RWU A;  1E6Y B;  3R6G B;  3VAL A;  2LU2 A;  1VQK S;  1RUS A;  4DPU A;  4QR1 A;  5H9F J;  4CWB A;  4IRC A;  2HBY B;  3JTO A;  5KFK A;  2MDA A;  4H4K C;  3MAA A;  2D9P A;  1JXE A;  4TU9 A;  5D8H B;  1UFL A;  2KG1 A;  2JLE A;  2VAS A;  4Y6I A;  3D0G E;  3G6Y A;  4LIW A;  1WTB A;  3BH7 B;  1OQ6 A;  2YKQ A;  1CUL B;  5BYS A;  3AY0 A;  2FDN A;  1M5P C;  1N34 J;  2CUY A;  4LR9 A;  3K5O A;  5KFB A;  5A2Q U;  3W3S A;  3QMQ A;  1L3S A;  3A13 A;  1ZPV A;  2NXN A;  4DFK A;  2UP1 A;  4PWD A;  4JI1 F;  1XR5 A;  3RU0 A;  3UE2 A;  1X31 C;  1RAH B;  1XIQ A;  1S79 A;  4M5D A;  3ZZY A;  2KM8 C;  3THV A;  1U1Q A;  4DZ6 A;  2GX8 A;  4Q8F A;  3N9U C;  2R8K A;  3V4I A;  3V4I B;  2IC3 B;  2ACM A;  4U96 A;  2YVS A;  3DCA A;  3T6J A;  4QW9 A;  2C2N A;  2V67 A;  4IFY B;  4UOC A;  2WAQ D;  3CJ2 A;  3CCM S;  1N54 B;  2VG7 A;  3OTD A;  4P2S A;  2D7S A;  4FP9 A;  2Y1J A;  4ZCK A;  1R8A A;  4ZOS A;  1LFP A;  3KHR A;  1T03 B;  4ELU A;  2ABY A;  1CUL A;  4KHM A;  3AJ1 A;  3CJK A;  4ECZ A;  5GAG I;  5A8K A;  4ED7 A;  1H38 A;  1UPP A;  3QRR A;  4PAB A;  3HCX A;  2YNG A;  3QSY B;  4L73 A;  1YX2 A;  4FYV B;  3U7J A;  3MAA B;  4TNO A;  2PSZ A;  1NDC A;  3SQO P;  2DR5 A;  1N5S A;  3M2U B;  1CBK A;  3KJN B;  3NS7 B;  4MYU A;  4IUF A;  4DL3 A;  5EUH A;  5EN1 A;  2XMT A;  2ZBP A;  5ITH A;  3HHL A;  1NDK A;  3KJQ B;  3MF5 A;  4K2X A;  4P2M A;  1FRM A;  4NLR A;  4BLG A;  5IV3 A;  3CUL A;  3MED B;  1G7C B;  1LK5 A;  1YJR A;  5KG4 A;  2NUU G;  3O3L A;  4OQJ A;  5EX3 A;  4F26 A;  3J81 U;  2ZHB A;  3RB0 A;  4CLK A;  3KLG A;  4LSN B;  3M8W A;  2XO6 A;  1WKK A;  4GKJ J;  3FCW A;  2DH7 A;  4J9K A;  1SH3 A;  2NSC A;  2LLZ A;  1NEE A;  1R43 A;  3RUB L;  5B0C A;  4RNO A;  4EBE A;  2UVW A;  3M05 A;  2HNZ A;  2AEF A;  2VC0 A;  4DV0 F;  3OVB A;  3C15 A;  4WYL A;  2FJX A;  5IZH A;  1UW9 A;  3I5B A;  2VIC A;  5KAK A;  1N0U A;  4GKK J;  4AQY F;  1F1B B;  1GFW B;  4R5P A;  4HTI A;  2BE9 B;  5C25 B;  4NCA A;  4WFZ A;  1SJQ A;  3KXD A;  3NGR A;  4HHJ A;  4JP8 A;  3MM7 A;  4RNM A;  3Q8R B;  3MOJ B;  1S6U A;  4P75 A;  3LGM A;  3EVM A;  1RKI A;  4BDP A;  3TJ8 A;  5GME A;  4F8R A;  3R2D J;  1TAU A;  5J1E A;  4ER8 A;  5HL7 Q;  3KK3 A;  3H4B A;  4ILL A;  1UZD A;  4LRC A;  4ZP7 A;  4ILM A;  5M2P A;  1HNV B;  3KJV B;  1Q8I A;  4WFN Q;  1S1U A;  1S1V A;  1TP7 A;  3WX8 A;  3M9O B;  1D9D A;  1PG5 B;  1JLC A;  3DRP B;  4RX6 A;  3SIP B;  3OSN A;  3ILL A;  4IG3 B;  4OHZ A;  4UW2 A;  5HRO A;  4HI2 A;  3EGV A;  4YB6 A;  4DV7 J;  1CJU B;  2MEW A;  3OFH A;  2N4C A;  5F0U A;  1HBN A;  4ZPV R;  3A8E A;  4NZ0 A;  4UZB A;  2BOA A;  1MU2 A;  1VOM A;  2GGP B;  4PG6 A;  3NY0 A;  1S57 A;  1YRX A;  2XEX A;  3ISZ A;  4IDK B;  4Y28 C;  3VF0 B;  3SSR A;  5A6P A;  3H4D A;  2ZOF A;  2ZOM A;  3NGU A;  3PHT A;  2CQI A;  2WOM B;  1WG5 A;  4XPE A;  2AYG A;  2DGU A;  2FY8 A;  4PR6 A;  2G1D A;  2DNO A;  4Q44 A;  2HFN A;  1U2R A;  1ZM9 A;  2OML A;  2OUG A;  5LMU J;  2C3Y A;  1HMV A;  4DPO A;  4JBC A;  4I2P B;  3ELH A;  2UXD F;  2K1R B;  4KKO A;  4DV5 F;  4JYA J;  3D1Q A;  3M30 A;  5D0H A;  1WKJ A;  2FVR A;  1GT8 A;  1NHK L;  1T95 A;  3P8B B;  5DG7 A;  2RU9 A;  3FKB A;  4DDF A;  2R7U A;  3MM8 B;  1LWF B;  5JJB A;  1NDP A;  1TL1 A;  2XZD B;  1R27 B;  3G82 A;  4LF6 J;  4JI6 F;  3K0J A;  1M90 T;  2KI2 A;  3HZE A;  4K7Q A;  1R0C B;  1VGY A;  5D4O A;  1VRT B;  1S9G A;  2IFX A;  3PR4 A;  3M6U A;  3C16 B;  1G4C A;  3TAN A;  3W66 A;  5KFQ A;  2UVR A;  1T9X A;  3K2Y A;  1EKR A;  5D0G A;  3HVT B;  5CYJ A;  5HSP A;  4QIF A;  5HK4 A;  1JLG A;  1MSW D;  4DUT A;  2Y1I A;  2V8G A;  4C9D A;  1BC6 A;  2DR6 A;  3ZTQ A;  2QA4 S;  4DQR A;  1RKJ A;  1IKX A;  4RKU C;  2AHO B;  2IM3 A;  3VAJ A;  2CPI A;  3MEG B;  1Q0N A;  3BKT A;  4OFZ A;  3OUY A;  2HQC A;  4ID5 B;  2Z56 B;  3FRZ A;  4Q43 A;  1FWL A;  4MIB A;  2KDO A;  2E5G A;  2FTR A;  2LA4 A;  3WQP A;  4RUB A;  3VQT A;  4IQM A;  5EGY A;  3G8S A;  4WZQ A;  5HJY A;  5GAE I;  4J80 A;  2H5J B;  1AXQ A;  2K7J A;  2RDD A;  1T9T A;  4YB7 A;  2R7V A;  1YQH A;  3TO8 A;  2HHU A;  3NNC A;  4K59 A;  1H98 A;  3PTW A;  4YFU A;  4U8Y A;  3J81 Y;  1NK0 A;  2ZOG A;  2DR9 A;  1RBL A;  1TL3 A;  3DLK A;  1SPB P;  2C42 A;  1QDU B;  3DXB A;  3OBI A;  3VGS A;  1Q7L B;  5A8W B;  4TU7 A;  2D3O R;  1VQS A;  2FVS A;  1B64 A;  3R7B B;  3TJA A;  4LJM A;  1Y4Z B;  5LT5 A;  3J80 U;  4OYP A;  2R4F A;  4ZPC A;  3GPA A;  4F36 A;  4CT9 A;  2Z0G A;  3MMC B;  4BHQ A;  1ZTT A;  4EZ6 A;  1U0H B;  4C0O C;  2YPZ A;  1X8D A;  2PII A;  2ZKT A;  3AOA A;  4Y2C A;  3VQS A;  3IRW P;  4LF7 J;  3IWN C;  2DGV A;  2HVI A;  1DY3 A;  2F63 A;  1X7V A;  3HSZ A;  4XTT A;  4AL5 A;  2BJ9 A;  2DCU B;  4L72 B;  2B43 A;  5KG1 A;  2NYI A;  4DQS A;  1IBL J;  2IHR 1;  2NLW A;  1KVJ A;  3FBB A;  2R7O A;  5ETK A;  4FNH A;  2IVM A;  2R8G A;  1AZS A;  2QA2 A;  3BN7 A;  3H5U A;  1ZM3 A;  3W5Y A;  4C11 A;  4B9S A;  3GCW P;  4IFV A;  2NZ4 A;  3D1O A;  3SYZ A;  4OYX A;  2VPZ B;  3H59 A;  4KV8 A;  2DRB A;  1RI7 A;  5E2Q A;  3PKM A;  1NUE A;  2WON A;  4M5L A;  2W9A A;  1RTH A;  4OI4 A;  2FIU A;  4USK A;  3ZNJ 1;  4KY3 A;  5AE3 A;  1N36 F;  5K8O A;  1OS5 A;  1RWP B;  2IBO A;  1NK7 A;  2HNY A;  4FBT A;  2DPJ A;  1WEZ A;  2QC3 A;  2UXC J;  4UT4 A;  5M2U A;  3Q8S B;  4KHP J;  1LW2 B;  1WOS A;  4NZ7 A;  3S6E A;  4X66 J;  2BRK A;  1JB0 C;  3NOG A;  1NM2 A;  1DTQ B;  2YPY A;  3KUG A;  1TUG B;  5B0D A;  4C3K A;  3I5A A;  1GMV A;  1FK9 A;  4DV6 F;  1S49 A;  2ZH9 A;  2WSC C;  4ZK7 M;  1X4D A;  4DR5 F;  2UU9 F;  4P10 A;  1FEH A;  1B99 A;  3QPI A;  4HDG A;  3T6B A;  1HMV B;  2XCA A;  3KK1 A;  4F4W A;  3RRH A;  1D0E A;  5LJ3 Y;  2JEF A;  2FVC A;  2DIS A;  1ZA1 B;  1WHW A;  3CJ5 A;  5AXK A;  1NH8 A;  3OD2 A;  2RRA A;  3MMA B;  2QL9 B;  2GVD A;  2ZFH A;  4KAI A;  5CCL A;  2LQJ A;  1NZA A;  3W2V A;  5KOX A;  1RT3 A;  5CYQ A;  1KVI A;  3DOK A;  2JDJ A;  2WVB A;  4IR1 A;  2MYF A;  4PWW A;  2DHG A;  2EG1 A;  3UN2 A;  3ENV A;  2BBE A;  1FER A;  3KOA A;  1NSA A;  2XTJ P;  3QO9 B;  3RAM A;  4X65 F;  2G2O A;  3FNN A;  1JLC B;  3DRP A;  4HH0 A;  4KFB B;  4CH1 A;  5H9F K;  4RNH A;  1VQ8 S;  4Y34 A;  4HVZ A;  1T11 A;  3ADA C;  3T9N A;  2BZ2 A;  1FDA A;  3DGP A;  3EVO A;  4DQI A;  2ZUA A;  5J1N A;  2ZHA A;  4X4N A;  5DGB A;  3JQM A;  4OZ2 A;  2MB0 B;  5DG8 A;  6FDR A;  3BR9 A;  2MQP A;  1FF2 A;  2ZJR Q;  5KG6 A;  4G3I A;  1HR0 J;  2MKY A;  1TL4 A;  4K5R A;  1DBD A;  2FYX A;  2CZV C;  2ROG A;  4ZN1 A;  3K5L A;  2NR0 A;  1PAE X;  3BSA A;  2UV8 A;  2VKR A;  2EK1 A;  4K8R A;  2HZC A;  2KXH A;  1VHI A;  3R5B A;  2DNM A;  4IO1 A;  4W4M A;  2BJE A;  3G8T A;  2BUN A;  2KXN B;  4ICL A;  1JJH A;  5GMD A;  2ZM6 J;  3CIZ A;  1X5S A;  2GIR A;  3LAN A;  4EUV A;  1U1N A;  2ZE2 A;  4DR2 J;  2XUL A;  3PW5 A;  1HYS A;  3QT5 A;  1IKV B;  5GAH I;  3B6B A;  1ZAX A;  2FGO A;  1YRT A;  2H5E A;  2BM0 A;  4KH1 B;  3VWS A;  3LP1 B;  5U47 A;  3CC2 S;  1S0N A;  4LQ3 A;  1KTQ A;  1SJR A;  4UOG A;  2VG5 A;  1QJH A;  5GVQ A;  1NPR A;  4A48 A;  5ETS A;  2IYG A;  3BGR A;  4CO2 A;  4ID8 A;  4OJG A;  2BR0 A;  1NK5 A;  3W8P A;  1RJJ A;  1NRK A;  2QMX A;  4LF5 J;  3QZ8 A;  3MPU B;  4NLQ A;  2ZZM A;  1QTN B;  5KFZ A;  3H5S A;  4RO0 A;  1HNZ J;  4M5M A;  2JVR A;  3PDN A;  1MLA A;  2YNG B;  1N5T A;  1S4F A;  2AZ3 A;  2CJ9 A;  2BJ7 A;  2BAN B;  1S48 A;  2R2U A;  4AE5 A;  3CXC R;  2QZ8 A;  2Y9H A;  5D6G A;  4YR2 A;  3BBC A;  3LPY A;  1T8E A;  4KHR A;  3AH6 A;  1ZYQ A;  3D0I E;  2Z30 B;  1YJV A;  3CB4 A;  4WII A;  1KLM A;  4IOC Q;  3J7Z T;  1N5Q A;  4ZCM A;  7FD1 A;  1K0V A;  1X4E A;  3ZTR A;  1OO0 B;  2H54 B;  3LP0 B;  4FF1 A;  5E3P A;  2W2M P;  4USJ C;  1FKP B;  2CNO B;  2VA3 A;  1HNI A;  3PKY A;  2COL A;  2EKY A;  2MKH A;  1HBO B;  3Q8U A;  1JLA B;  3LZ8 A;  4K4S A;  1GNK A;  2XMM A;  3FJ2 A;  4WWS A;  1KKH A;  5D4L A;  4TY8 A;  4M5D B;  3JYT A;  4CH0 S;  3PX6 A;  3UCU P;  1XTZ A;  1SJ1 A;  2KT5 A;  1FRH A;  1HQU B;  3AB2 B;  3KHG A;  5DLF A;  5J2P B;  3TJ9 A;  1S6O A;  4YOE A;  2FB0 A;  2OFH X;  4FVM A;  2XLI A;  2PA8 D;  1CPZ A;  3N01 A;  1TKX B;  4KIA A;  1UWB A;  3G8Q A;  1MWQ A;  4O4G A;  3Q89 A;  4L75 A;  1F9F A;  4PQU A;  2VFU A;  1HW9 A;  3W2W B;  2VJV A;  4DV7 F;  1YSJ A;  2HGN A;  4HH1 A;  3B78 A;  2XLJ A;  2K3K A;  2SXL A;  4YN3 B;  5HQ8 A;  4WF9 Q;  5ETP A;  2RJZ A;  1V3R A;  1ZM4 A;  3ZZP A;  2D74 B;  3QJL A;  5A0Y A;  3R8Y A;  1S6Q B;  3UNY A;  2DPI A;  4G1Q A;  4OHY A;  2CWX A;  4U7U D;  3NP5 A;  4WFY A;  2DJW A;  5L9N A;  4DL4 A;  1WAC A;  1FRL A;  2IM1 A;  4DL0 C;  5F9L A;  3A4T A;  2CJX B;  2UUW A;  1ZOT A;  3R5G A;  4Y00 A;  2YY3 A;  4WP8 A;  2DBB A;  4RW7 A;  2XZW A;  3IP0 A;  4I7F B;  4P72 A;  2PO4 A;  3QID A;  2PFD A;  1DJ0 A;  3GR1 A;  3F0N A;  2GIF A;  3L7O A;  4LVO P;  2A3J A;  4YME A;  4AQY J;  3KLF B;  1QAX A;  3F56 A;  2HHH F;  4R25 A;  4ES2 A;  2G13 A;  4KGK A;  4DUZ F;  1HYS B;  4OYM A;  1XBW A;  2DNR A;  4NX9 A;  1U2F A;  1L5U A;  1N33 J;  1FNO A;  3U1N A;  4C2M A;  3NKY A;  1DUR A;  1EJ7 L;  4NXN J;  5KFO A;  4G6V B;  1YK9 A;  2X51 A;  3AA8 A;  3PEH A;  3UFC X;  2DNL A;  5AE1 A;  1SL0 A;  2Y8Y A;  2JC0 A;  3BKF A;  3GYX B;  3JSY A;  4Q7A A;  2YX7 A;  1Q86 T;  1AT1 B;  1WI6 A;  4NLY A;  3R5J B;  5DQH A;  2PI4 A;  5B0B A;  2CPF A;  3EZU A;  1DQA A;  2E7V A;  3CO9 A;  3EE3 A;  6AT1 B;  3QGI A;  4NCG B;  3RW7 A;  1B0T A;  1S6P A;  2OMO A;  3UDE A;  3TAR A;  2CQ1 A;  2IM2 A;  5L46 A;  2B4P A;  2ZH7 A;  2ZH4 A;  2UUT A;  3QO9 A;  3MM6 A;  3PRB A;  3AXK A;  2DO4 A;  3M4X A;  3T19 A;  5LXY A;  1M1H A;  3OTE A;  4C7Q A;  3LAM A;  3KLV A;  2QE5 A;  3JSM A;  2HFO A;  1UMJ A;  4I64 A;  1ZS6 A;  3IRX B;  5CYQ B;  1V5I B;  4MAK A;  3UQS A;  1Y5L B;  3CDE A;  9ATC B;  3NGK A;  2F8M A;  2BX6 A;  3ISN C;  1RT2 B;  1B0P A;  3L7U A;  4P2F A;  4J90 A;  1VJW A;  2YH0 A;  2VOP A;  1P27 B;  3MR7 A;  3BQ1 A;  3I55 S;  4J9V A;  4X65 J;  5D4P A;  2QLJ B;  2HFV A;  1CC7 A;  3I4P A;  3TW0 A;  4RUH A;  2BQ3 A;  4KGZ B;  4NRT A;  2V2K A;  4IKA A;  3QGH A;  4JB8 B;  3TP2 A;  2XGQ A;  2D9O A;  2HHV A;  4LSL A;  4Y2M A;  2IJN A;  2KH9 A;  2JVO A;  1REV A;  4RW8 A;  1RT5 A;  3WHI A;  1SC6 A;  2HGM A;  4URS A;  1UVM A;  4RZR A;  3QRQ A;  2AJ1 A;  4X4S A;  3FZB A;  4U7U K;  2XMU A;  1VLY A;  2H4Y B;  3M2R B;  1VQ9 S;  1TKT A;  2O67 A;  1RAG B;  2XWX A;  5DDO C;  3IBW A;  5GAE U;  1W2B R;  4RU2 A;  4A8M P;  4Q0B B;  4GO7 X;  3FCV A;  4J9L A;  4IO9 Q;  3ENA A;  2RD5 C;  4ELT A;  2QYC A;  4RWW A;  2D3U A;  2KRR A;  2E1P A;  4H4K A;  1TTH B;  3IXQ A;  4UTG A;  3UDC A;  2YX1 A;  1JKH B;  5CAB A;  1XNQ F;  2ACY A;  1KS2 A;  4RW4 A;  4DR3 F;  4ZP6 A;  4ECW A;  2WSF C;  3SCI E;  2DGO A;  1U49 A;  2JX2 A;  3DLL Q;  4EO6 A;  1BE4 A;  2DY1 A;  2MKJ A;  4UY8 5;  3HO1 A;  2NCK L;  1Q7Y T;  2VBY A;  3C5X C;  1TFY A;  2LVW A;  4NRU A;  1M1K T;  1KSP A;  3HHD A;  5HMZ A;  2F4V J;  2EFO A;  1U0H A;  1DLO B;  2QSF A;  2ILZ A;  2HUR A;  3GIR A;  4PQU B;  2XY7 A;  3P4U B;  2XMW A;  3RR7 A;  2DXF A;  5HBM A;  1CC8 A;  1N32 J;  1PIL A;  1YBA A;  1T94 A;  2BV3 A;  2KM8 B;  2V34 A;  3HDS A;  4NEZ A;  5A76 A;  5A8W A;  2JH3 A;  1KOO A;  1TL7 B;  4DPX A;  2MZ1 A;  4N8O A;  3CCT A;  3M6V A;  3CVK A;  1QLN A;  1PYT A;  3E2E A;  4LF7 F;  4URG A;  4TY8 B;  3JYT B;  3T41 A;  1HWU A;  3ZC4 A;  1U1R A;  4L76 A;  2M70 A;  4H54 A;  3SSQ A;  1UVL A;  1CJV A;  2XBP A;  3DM2 B;  1W2I A;  4TQS A;  3D0H E;  1XMO F;  3SCK E;  4DU8 A;  3G87 A;  5IM0 A;  4M5H A;  3EPI A;  1X60 A;  3RG6 A;  1YIT S;  3D67 A;  3R1L A;  3OQ2 A;  4DUZ J;  3HSJ A;  3O1L A;  3TQE A;  1JJ2 R;  1V6H A;  2V94 A;  4LRD A;  1U1L A;  4ZLJ A;  4JV5 F;  3I82 A;  4ZLN A;  2MSS A;  4DV1 F;  2MJU A;  2ERR A;  3IAM 9;  2KFN A;  1Y11 A;  3DRR A;  2BQU A;  1QAY A;  2PMH A;  3DNC A;  2DXD A;  2YKO A;  2HMI B;  6FD1 A;  1L3T A;  2F4V F;  1NH7 A;  4P7T A;  3AGZ A;  1WG1 A;  1S9G B;  5ETT A;  3MI7 X;  3R7N B;  5LMN F;  1WC3 A;  2OEM A;  1TK0 A;  3MEE A;  2FJA B;  2HRT A;  3PM9 A;  1PO6 A;  2GA7 A;  2FZK B;  3K5N A;  4QPX A;  1IR1 A;  2VG5 B;  4XDD A;  3UDV A;  1FE0 A;  3N5F A;  4BC9 A;  3J7Y U;  2GHP A;  4UUX A;  3ZO7 A;  1BQM A;  2XHC A;  2MQM A;  4ZVF A;  2R2T A;  1IR0 A;  1HNX F;  3TEH B;  4B3S F;  2NZC A;  1REV B;  3BH6 B;  5F8H A;  2HLU A;  2AKW B;  1N88 A;  1IKV A;  3LP2 B;  3NBP B;  2OO4 A;  3W5Z A;  4Q2L A;  3TX0 A;  1OY9 A;  1F2H A;  2AIR B;  1S4E A;  2AV5 A;  3M8Z A;  3TQ1 A;  1KNZ A;  5H9E K;  2VQE J;  1J2V A;  2OIH A;  4ANC A;  2CJB A;  1YBT A;  4LF6 F;  4JI4 F;  2QL5 B;  3W5X A;  1NK6 A;  1P8G A;  1FNX H;  1PGZ A;  2KKH A;  2HHW A;  1IKW B;  5GAD I;  5KFJ A;  3D68 A;  4NLV A;  1KTV A;  5IT9 U;  2H1Y A;  1JLF A;  2BJ8 A;  2YNH B;  4D3G A;  1BXN A;  2YWW A;  4C6A A;  2UV8 G;  4CLF A;  1BQN A;  4E2F B;  1XMQ F;  3NMR A;  2EWH A;  1DAR A;  1YJ9 S;  4HHH A;  3BDP A;  4J9N A;  5CCM A;  4DPT A;  2AEM A;  2LXF A;  1QUP A;  2GZO A;  3GR0 A;  1W26 A;  2F8E X;  2L41 A;  3V6D B;  1IBM J;  1W25 A;  3D6M B;  1NJX A;  4WPA A;  1S1V B;  3R97 A;  1WOR A;  1S1U B;  1K9M T;  4LMZ A;  1NHU A;  4KFB A;  1M5O C;  1FXD A;  4XPC A;  4F4Z A;  2NQP A;  4OJ1 A;  2VBW A;  3KMS A;  4K4Z A;  3WC2 A;  3MCS A;  4WTO B;  1KD1 T;  4BWM A;  2HWT A;  5J1E B;  4DV0 J;  1F9H A;  4USU A;  4DR5 J;  2QEX S;  3K8V A;  2VON A;  4TLQ A;  2DD8 S;  3OTB A;  3VAM A;  3KLI A;  3D3C J;  5I42 A;  1EB0 A;  4CLT A;  1V5V A;  4KBI A;  5C25 A;  3IMQ J;  3MMA A;  2K7K A;  4U6P A;  1OPZ A;  3RGI A;  1X4A A;  3RAX A;  2IBK A;  5EWG A;  2R8J A;  2OKQ A;  1BWE A;  1RAE B;  2DIV A;  1A6L A;  2YNF A;  1WEY A;  3DMJ B;  3LQV A;  1PBU A;  3NEK A;  3I38 A;  2DEI A;  1AFI A;  2XZT B;  3UPF A;  4QIW D;  5EDW A;  1WF2 A;  2VDI A;  3KDO A;  4OHW A;  1QSL A;  3RRG A;  3KLG B;  4ZJQ A;  1DTQ A;  2LEB A;  3ILO A;  1CS4 B;  3RBX A;  3BGU A;  3JAM Y;  2BAC A;  5CYM B;  4ZVE A;  2B56 A;  4NL5 A;  3TYT A;  4AT1 B;  1HNZ F;  3NMA A;  5F8N A;  1U1O A;  2YKA A;  2D41 A;  3HHL B;  1FO1 A;  4EWT A;  1RAB B;  2DEJ A;  3OFF A;  2WCX A;  5A0Y B;  5K20 B;  3M32 B;  3T1H F;  4OYZ A;  3DGV A;  1RT1 A;  2HIQ A;  2MLZ A;  3P5B P;  3P5T L;  4JI2 J;  1WKL A;  4USW A;  2J9D A;  5K8P A;  1CQM A;  2AJ4 A;  5I4M A;  2L3M A;  2AGP A;  4C8M A;  4C8Y A;  1J5E F;  1RWO B;  4B9N A;  3THT A;  3K58 A;  2VOO A;  2QV6 A;  4K4X A;  1YJT A;  3MHY A;  3CJK B;  1AZS B;  1P9Y A;  3UO0 A;  1XNR F;  3AD8 C;  3FEX B;  2J76 E;  1C4A A;  3HI9 A;  1Q95 G;  1OQ3 A;  1PAU B;  1WJ9 A;  4CZC A;  4CLP A;  3O2I A;  4DSK A;  1AA1 B;  3VCD A;  1OY8 A;  2P5V A;  2VG7 B;  3OVS A;  3M6X A;  4WIQ A;  5DRK A;  1XMB A;  5A8R A;  4JI7 J;  2NXJ A;  4J37 A;  3BN4 A;  3BSO A;  3IR7 B;  5ETQ A;  3VAF A;  3DM2 A;  2IC3 A;  1VK3 A;  3HFK A;  3JXO A;  1G3O A;  5AT1 B;  1OJ4 A;  5KFL A;  2QA1 A;  1WC1 A;  3A8I A;  4NA3 A;  4UQG A;  1HNI B;  1YDL A;  4O3R A;  1YJW S;  3FEZ A;  1T05 B;  1VQ6 S;  2OEK A;  2FC9 A;  1UZH A;  2E1R A;  5CHC B;  3BQ2 A;  4QYZ K;  4OI3 A;  5D0R A;  4ZVS B;  2ZDP A;  1WHV A;  3PXG a;  3HM9 A;  2Y8W A;  1RA6 A;  2CKW A;  3MMJ A;  1TK8 A;  1QVG R;  3HFV A;  4N47 A;  2B8P A;  1QVF R;  3S7R A;  4FF2 A;  5LJ5 Y;  3NWG A;  2CQG A;  5EX0 A;  4OHX A;  2RRN A;  1DLO A;  1RWW B;  5B0E A;  2V9K A;  1NSP A;  3K57 A;  2PEB A;  1FX2 A;  4ID5 A;  1ITP A;  5HJX A;  3MEG A;  3OUY B;  3OSP A;  1QUV A;  1CG2 A;  1SQG A;  3AAW B;  1BLU A;  2H4W B;  3X3U A;  3CCR S;  4CO0 A;  3LAL A;  3TAP A;  1VLO A;  1Q8L A;  5ADZ A;  2R3V A;  2NXE A;  2ADC A;  1N6Q B;  2H51 B;  2VFS A;  2BE7 D;  2ZBR A;  3QT7 A;  3LPE A;  3MEK A;  2VQF F;  2HRU A;  5BYQ A;  3UDL A;  3KUH A;  1VQ4 S;  3AGX A;  1N52 B;  3I0S A;  4J9S A;  3HT0 A;  4B02 A;  4MKA A;  2I6W A;  4K4V A;  1WEX A;  2FVQ A;  4FF4 A;  1OSC A;  4DV1 J;  2D3Z A;  1YLX A;  4J9R A;  2M2B A;  2L08 A;  3H98 A;  3H90 A;  4FXV A;  4MKV A;  1SH2 A;  4EU0 A;  5DJB A;  2W7P A;  1A9N B;  3HD1 A;  4LBP A;  1S97 A;  4B3O A;  2W9B A;  4ICL B;  2A2C A;  3CJQ A;  5KFC A;  5KFH A;  1U8W A;  2F65 A;  2P9G A;  3SZ2 A;  2IAJ A;  2RNE A;  1DZ5 A;  1LK7 A;  1U0S A;  2V2Z A;  3FSI A;  3G71 S;  1FE4 A;  3PX0 A;  3BPD A;  3FEY B;  4WK3 A;  1U1K A;  3PIP Q;  4ZP9 A;  2NXU A;  5AE2 A;  2XNR A;  2Z4P A;  2LKZ A;  5IV4 A;  3VAK A;  3PAC A;  4JUZ A;  2AJ2 A;  3KTQ A;  3O44 A;  4PXD A;  4DR2 F;  5HVH A;  4WKR A;  4JI0 F;  3W62 A;  3OTC A;  2XYH B;  4YB5 A;  5T14 A;  3D7S B;  3FBE A;  3BQ0 A;  1I1G A;  2C3M A;  2MQL A;  3LO3 A;  1RK8 A;  3VVT A;  3JSM B;  4P6Q A;  2K3I A;  3C2P A;  4LFB J;  2HZV A;  2HFU A;  1WDD A;  1RA7 A;  5HN0 A;  3JAM U;  4DL2 A;  2ZC3 A;  5J2Q A;  2BRL A;  3OXG A;  1X9M A;  1TV6 B;  1RU1 A;  2QX0 A;  2ZBQ A;  4Y65 A;  5D0E A;  3K5P A;  2V4Q A;  1WD6 A;  2F7V A;  3OHB A;  2L48 A;  3N6L A;  2BA9 A;  2J9C A;  2GVD B;  2GJF A;  3SEO A;  5HLF A;  2H3E B;  4WFX A;  4DV6 J;  2VFR A;  3TRG A;  2CQC A;  4BWJ A;  3HP6 A;  4IRK A;  5DLG A;  3H0P A;  5KFN A;  1FTR A;  2HQG A;  4ZDN A;  1QTM A;  2O1P A;  1RTD B;  1LFW A;  2E5J A;  3KK1 B;  2HPU A;  3SDE B;  4A46 A;  2R7S A;  4GKJ F;  1TVR B;  2P6S A;  2F4F A;  3MM7 B;  1F5C A;  4MYT A;  2CNK B;  3P45 B;  1T3N A;  3O5T B;  3CCL S;  1NME B;  2C2M B;  2MST A;  2VB6 A;  3TOQ A;  4ZIV A;  3H20 A;  3HVW A;  2MLX A;  3ILJ A;  3N0V A;  2NYH A;  3CF5 Q;  4J9O A;  1SL2 A;  1AUD A;  2EW9 A;  1SB6 A;  2CDQ A;  1D1U A;  1KFS A;  3LW5 C;  2EI5 A;  4CNZ A;  3TZW A;  2JNJ A;  1FWK A;  4DV5 J;  3OJS A;  2RHQ B;  3IR6 B;  4E8U A;  5AXN A;  2ZJQ Q;  4I67 A;  2UXD J;  3SFG A;  1FA0 A;  2GO8 A;  5E33 A;  5B08 A;  2ZWO A;  2Q43 A;  1URR A;  1L3K A;  2J9E A;  3PW0 A;  1RTH B;  3PG9 A;  4I7F A;  2OLW A;  3A12 A;  4KB7 A;  4YY3 J;  3HZG A;  1PYO B;  1QY7 A;  3I4H X;  3MED A;  4KC5 A;  1K1S A;  1HFE L;  2I8E A;  2ZEJ A;  4IFV B;  3W7B A;  4OYO A;  3R1H A;  3HPO A;  4G1Q B;  4WU2 A;  1S6Q A;  5KFT A;  5FD1 A;  2OSR A;  3ENW A;  1YJN S;  3M2U A;  2E66 A;  4RW9 A;  2A6O A;  1RQ0 A;  3I5C A;  3G9C A;  3A3N B;  4QR0 A;  1I94 F;  2Q6C A;  2RH3 A;  4LQ9 A;  3IAS 9;  3MTJ A;  4WK1 A;  2CJQ A;  4E0D A;  2PFF B;  3O6Q A;  1R6Y A;  3PYE A;  4ZVO B;  5A8K B;  4TVA B;  4CLL A; 
#chains in the Genus database with same CATH homology
 3I38 A;  2QLD A;  1XAO A;  4L3K A;  3L9Z A;  3AGY A;  1C3G A;  1NLT A;  1GMV A;  2Q2G A;  4J80 A;  1GMW D;  3LA0 A;  3AGX A;  3LZ8 A;  3NXZ A;  1GMW A;  1EB0 A;  3NY0 A;  3AGZ A;  2B26 A;  2HFV A;  1EAR A;  3TJ8 A;  3TJ9 A;  1GMU A;  3TJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...