1GMVA

Structure of uree
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
138
Chain Sequence
MLYLTQRLEIPAAATASVTLPIDVRVKSRVKVTLNDGRDAGLLLPRGLLLRGGDVLSNEEGTEFVQVIAADEEVSVVRCDDPFMLAKACYHLGNRHVPLQIMPGELRYHADHVLDDMLRQFGLTVTFGQLPFEPEAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metallochaperone
molecule keywords UREE
publication title Crystal Structure of Klebsiella Aerogenes Uree, a Nickel-Binding Metallochaperone for Urease Activation.
pubmed doi rcsb
source organism Klebsiella aerogenes
total genus 26
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 1gmvA02
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 1gmvA01
1EARA 3L9ZA 3AGYA 1EB0A 3I38A 1C3GA 1GMWD 2B26A 3LZ8A 1NLTA 3TJAA 4J80A 3TJ8A 3LA0A 2Q2GA 4L3KA 1GMUA 3AGXA 1GMWA 3TJ9A 3AGZA 3NXZA 2HFVA 1XAOA 3NY0A 1GMVA 2QLDA
chains in the Genus database with same CATH superfamily
1YSJA 3KLFA 1EHWA 2GS8A 1LWXA 3TZWA 3H2UB 1TK0A 5FD1A 1TL7B 3C6TB 2ZZMA 1JLEB 3QQCD 2X3GA 4X4PA 3GJRB 2G4BA 3AODA 3R2DJ 3GFYA 2QZ8A 1DRZA 2Y0BB 3P45B 3EX7B 3RTVA 1DURA 4DR3J 3DLGB 2RIJA 1UW4A 5J2MB 4BDPA 9ATCB 2YPZA 1R7IA 2AWZA 3J7YU 2N7CA 2HFOA 1IKXB 5BYQA 1TMMA 2E7XA 2KYZA 1HBMA 3HZEA 2VKZG 4LF4J 2M3DA 3KLHB 1FCAA 2H4YB 4JI1J 2XY7A 3D4JA 2RUGA 1HNZJ 2VFTA 3KMQA 1HPZA 2CJBA 2V5HG 1U2RA 5ETNA 4DFMA 5F8NA 4OHYA 3UQSA 1RTDA 3ITHA 1RWNB 5KT6A 4AQYF 4IFYA 2QRRA 4OI6A 4KHMA 2ZH9A 1CJTA 2FY8A 4TN2A 3NGRA 2LP4A 3MECB 1O5JA 2J9CA 1AUDA 2NYIA 3I5CA 3N6MA 3BGRB 4HI1A 1REGX 2L9DA 1RTZA 4NXNF 1L3VA 2V9WA 2Z0GA 1ZZNA 4L76A 1H72C 2LEAA 3G6ES 1MMLA 1QUPA 4LMZA 1FKPA 5M2UA 1GEHA 2V34A 3BKFA 3GIIA 4QPTA 3NCRA 4LRCA 4ZVPB 3M8PA 4OIXA 2OH2A 1SQEA 1RI7A 4ZPTR 3H5XA 2E7VA 3OR2A 4C4WA 2KM8B 2CWKA 2IM2A 1FDDA 3RB3A 2EC0A 4PUOA 3TA2A 4FN5A 2F4FA 3K7RA 5U47A 1YRXA 3DRPB 2HQFA 4ZOSA 3UDVA 5LSLA 2UUBJ 3OTOF 1NK7A 2HK2A 4KQZA 4GVLA 3PVXA 1N4LA 4LF6J 4NLSA 1IWGA 2FHOB 4NA3A 2IVMA 3G6VA 2VB6A 3IR7B 2W25A 4KFBB 2MQMA 4N8OA 1WNEA 3CCZA 1FJEB 5F8JA 2A3JA 5KG4A 1RHUB 1S6QB 3UD4P 2V8GA 2I6WA 3RAMA 2Z8QA 3PXGa 5J2QA 4X4UA 3AD9C 1HHQA 1HBNA 1BXNA 3ET6B 3D0IE 3TOQA 2C3YA 3KDNA 3MMCB 3OW2R 2YNFA 1H7WA 1KNZA 4DV3F 2YNHB 1CJVB 3IA0A 1FTCA 5LJ5Y 1OSCA 3GIMA 3ZZOA 2E29A 1T03A 4DU7A 3H25A 2FLLA 2B43A 2J9DA 3IAS9 4WFXA 1XR6A 1DTTA 4F2SA 4DPWA 4J7CA 1KC8T 2XY6A 1S48A 4OZNA 3FEXB 3HVWA 3R97A 1H38A 3GJSB 2JVOA 5F3ZA 2X1AA 4P2FA 4EZ6A 2LU2A 2YPYA 1WHVA 3F56A 4NLWA 4UOGA 3EWGA 2AZ3A 3N6NA 3BGOP 5A8WA 3G82B 1VJWA 5F0UA 1RT1B 3HKWA 4DR6J 1FFGB 4DF8A 1WTFA 2QO3A 2L9WA 3NMRA 1LEOA 1MLAA 1RQ0A 2N82B 2J9DE 1ITPA 2U1AA 5LL6d 2OSRA 1CJUB 4OI4A 2J6UA 2WOMA 1AFIA 3SMZA 1ACMB 5RUBA 2P8IA 3KWMA 4JOUA 3Q8RB 2R42A 3H20A 4I2QB 2CQIA 2ZH3A 4OYIA 1VC6A 2MGZA 2NSCA 4PPZA 1U1LA 2DNYA 2VDIA 1EP4A 3N9UC 4U95A 2OELA 2R2RA 2ROGA 1C1CA 3D7SB 4DL5A 2GHPA 1FWLA 2Z56B 4FBUA 2V9KA 2RRBA 4P9SA 3AJ1A 3HHLD 5D78A 4YHHF 2KDOA 1SC6A 2K1RB 4HDGA 3W2VB 2L48A 2HNZB 1A9NB 3FQLA 1N34J 2QG9B 3BO3A 3UE2A 1S6PB 3PEJA 4P7TA 4DUZJ 2RS8A 1ELOA 3IO1A 2CZ4A 2OPRB 3IBWA 1WKJA 3J7ZT 2DY9A 2VG6A 1EQ0A 4DV1F 4KIAA 2XO6A 3C16A 2VQEF 1X4GA 1TV6B 3BN4A 1KS2A 1HA1A 3IGNA 2OP5A 3M2RA 1JXVA 3I87A 1FJCA 3DI6B 2VL1A 3EZOA 4LSNB 1K0VA 3FCWA 2I9SA 3MMJA 2CQPA 5ETOA 4USMA 2DT9A 2KVIA 5C24A 4IH6A 2DNZA 2XNQA 1EQMA 4CLKA 3WDOA 3PW0A 4ZVRB 2YKAA 4ZVUB 2AF6A 3J81U 3DM2A 2KH9A 3L4BC 2IHR1 1RAIB 1WDTA 3J80Y 4K0KF 4ZJOA 3Q8YA 5JVGQ 1RT3B 2C2KB 2K8GA 4J9KA 3ILJA 3LZ8A 2WTFA 3MI7X 3N01A 5IC6B 2WSCC 4OYOA 1N33J 4DV2J 4IFVB 1IM4A 2C2MB 2ZHOA 3D1OA 1UFKA 2N3LA 2LXIA 4OZ1A 3IRXB 5KG3A 4L73A 3SQGB 1VQNS 1LK7A 3DYAA 4IG3A 4ECVA 3R6LB 4DR7J 2JVMA 1XR5A 3CW2C 3M9MB 2GQQA 1A7GE 1FTRA 1XTZA 1AROP 3PO4A 3L9ZA 1VBKA 4O3PA 2VPYB 1U1NA 3DKDA 2EFOA 1SIWB 2VONA 2WVBA 2D3OR 1S7HA 3JQMA 1VLYA 2OMOA 2MZRA 2Z58B 5HROB 4TLQA 2BE2B 2FYXA 2BANB 4ZN3A 4B3SF 2R2UA 1ZTTA 4A48A 4ZVSB 2JEFA 3NGUA 1RTDB 3PTWA 4IFYB 5DDRC 2HHHJ 1WKLA 2VC0A 3J81Y 2DGOA 1TKTB 2BOAA 1JJ4A 4ECYA 1LXJA 1SC3B 4OMFG 2ZH6A 1LWEA 1WHYA 4FYDA 3OXLA 1V3ZA 4ANCA 4IUFA 1U6BA 4OX6A 1X31C 2I2YA 3FSYA 4J9OA 4F02A 1VQOS 2QMXA 2AP6A 1YRUA 4LF9J 3GPAA 5B0GA 3AXKA 1X5PA 1U0HA 2FC9A 3CC7S 2VV5A 1XJWB 1Y0HA 2AIRB 5KFCA 1FKPB 1S99A 3OHAA 3MM5A 3HI9A 4DF4A 5DDOC 1HNXF 2VG7A 2AYEA 2KM8C 5KFQA 2J0WA 3H4BA 2BJ7A 2UXCJ 1BQXA 3Q23A 1UCNA 1S9EA 1G3OA 4GKJJ 1QY7A 1CPZA 1PYSB 3ELHA 4R5PB 1X9WA 1GMWD 3DOKA 2CQ4A 4OYPA 3VHQA 3IGVA 3J7Z5 2UVWA 2PDAA 4H4OA 1SL2A 2GVDB 3CJ8A 4QR1A 3N6LA 4NXMF 2KHDA 2A6MA 1HNWJ 1LKZA 3CT9A 5KFFA 1TQLA 3W62A 3G8SA 2B4UA 1ZM3A 2R7QA 4PXDA 1HBNB 2WVCA 4OYZA 1APSA 3SZ2A 1CC8A 2Q6CA 3RAXA 3BYPA 3QO9A 4LRFA 2HFUA 2HVDA 3KXDA 4LQ9A 2CJYB 3CEDA 4IDKA 4RKUC 4LR9A 5IM0A 1W25A 1KONA 4H54A 5KFWA 3PFOA 1ZH5A 2AJ0A 2GVZB 4JV2A 2I5JB 1TK5A 4QWCA 3MCSA 1GXLA 3U1NA 1SH3A 1LV5A 3M30A 2W8LA 3H40A 4F04B 2ZD1B 3T1AA 1MWQA 3L09A 1SJ3P 5CD4H 2EK6A 1X4AA 2JSXA 2PEBA 5HSPA 1JJCB 1Q95G 1Q7YT 3NBPA 2K7KA 3OL7A 1FK9B 5A8WB 1T9VA 3EDQB 1KHVA 3QIDA 1RA6A 1WELA 4P6QA 4CT9A 4DV4J 1NH7A 3JS9A 5G0RA 1B3TA 2E5LF 3DGPB 3H90A 1IKVA 3CIZA 4PXBA 3HD1A 1WI8A 3MMAA 2KO1A 3TQEA 3M6VA 1FERA 4IG0B 4M5DA 3V6DA 4ITSA 5KFZA 4DL7A 3MM8B 3MMBB 5HK4A 3KJVA 4DV6J 4GVBA 2J8SA 3EPIA 2PEHA 1I94F 2WVEA 4ZCIA 3MFHA 1ICEB 4RW7A 4U67Q 2OPQA 4QWAA 2R8IA 3DRRA 4OI0A 5L1IA 2QLXA 3M1VA 4DPXA 3OPKA 2BQ3A 5CYMA 1AYEA 1NO8A 1EX8A 3CGIA 4QR2A 3BH7B 3M6UA 3AGXA 2ZH4A 1Y10A 2R7OA 1JLQB 4BBYA 2PI4A 3AGYA 3GQCA 3MR7A 2ZBCA 1KQSR 3R7NB 2H5EA 2JFKA 1T0TV 4OZLA 5HVHA 2CZVC 2PFDA 4CWBA 2D9PA 2IC3A 4PEOA 4RWXA 3PNIA 4O3NA 4QW9A 2K06A 2CPHA 4OZ2A 5ETQA 3C5XC 3F0NA 3MPWA 3NWGA 2VG6B 3WIVA 2XNRA 4B9TA 3C16B 3UDCA 5JUMA 5HATA 2JDJA 1Q4RA 2V8PA 2W7PA 1GQEA 5K8MA 3T5KA 1IBLJ 3I0RB 4WKYA 3VCDA 2XS7A 4ZPWR 3M2VA 5L39A 2AJFE 3PYFA 3PM9A 3DRSB 4M5KA 2AEMA 3MFIA 2C2DA 2VKRA 1T02A 3BEGB 4WP8A 1RCXB 2MJUA 5CYQB 1I51B 2R8JA 4USWA 3CD7A 3W64A 1XMOF 4ID5B 4DV5F 1PBAA 2UXDF 5J2NA 2M2BA 4B9LA 4FF1A 1VR6A 8AT1B 1KD1T 5IWAF 2HIQA 4NA1A 5HMYA 3PKYA 2X1FA 1M5PC 2NXNA 3MCMA 4LFCJ 1J2VA 4B3TF 4F36A 5H9FJ 3QJPA 3QLHB 2VASA 5C7PA 2YKMA 4ZHRA 3P5BP 5AXMA 3LPEA 2KZMA 3BR9A 5DG8A 4PQAA 1Q8KA 3CCES 4NRTA 5KOXA 4YP3A 5E3QA 3EVWA 2RQMA 3VQTA 4ZLLA 3L7PA 1A6LA 1G1XA 1B0TA 3D6HB 5J1NA 2ZWOA 1RT6A 2BKNA 3CJSA 2VPWB 4ZP9A 2LDIA 2F3JA 2JC0A 4ECSA 3T9ZA 3NOGA 1E6YB 4H4MB 2UV8A 1UWBB 1LW2B 3VGVA 1RWWB 2QA4G 2FLNA 4DV0F 1GH8A 2ACMA 2B51A 2NXEA 5BYSA 2RT3A 5DG9A 4Q7AA 3GB0A 5GAEI 2KJVA 2W8KA 1XMQF 3SCKE 1LWEB 3LANA 2GFFA 3TUPA 4FKYA 3DC2A 2QLFB 1MW7A 1U26A 3VTIA 5I3QA 2VDHA 1NJZA 4NZ7A 3MXHP 1HW9A 2ZUGA 1FNMA 4LF4F 4JI1F 1ZZFA 2EG2A 4NMLA 3KHRA 3FZ2A 1TFWA 2J0XA 2CPFA 3TUIC 2HQCA 4ZCLA 3UD3P 1IR2A 3JB9k 1IKWA 2QSWA 2EEYA 2VG7B 3ISND 1NJWA 5FDLA 2OD6A 2CQGA 5F8MA 2AU0A 2W9AA 3I4HX 2J7UA 3LGHA 2HNDB 4PYDA 2IA0A 3D66A 3CCJS 1U1MA 1Q16B 3GSDA 4C98A 4BCAA 2RILA 2MKCA 2A6OA 2C28A 1K9MT 2M8DB 3DOKB 3GJTB 1TKDA 4CO0A 4NYZA 4YDDB 4FXDA 2PGCA 1I5OB 4KKOB 4E2FB 3QMQA 2CPIA 1N0VC 1JQGA 2J6TA 1WJ9A 3BN7A 4Z37A 5SZTA 4RUCA 1FRKA 2OTJS 3FQKA 4LBIA 4FDFA 3T6BA 3FCVA 3UCZP 4FNHA 3W5ZA 4QR0A 2J76E 1WEZA 2DNOA 1NPRA 1H73A 3X3UA 4NLVA 4JI8J 1K1QA 3QGGA 2QA1A 4NLPA 4RL1A 1T9TA 1TL4A 4R25A 4IDKB 4CYUA 2UUBF 2HVIA 1TL1B 3EXYA 3MM6A 4LF6F 4YS2A 2XCPA 1RT4B 5ETTA 1YZ6A 4EYHB 1FX2A 3M30B 2G2ZA 3MAHA 4HEA9 2GGPA 3NAHA 2JLFA 4DMZA 3KLEA 4LF7F 4ZVHA 2WBMA 3EGWB 1VISA 4KHPJ 2M9KA 1BD6A 1PG5B 4CO2A 2ZZNA 1UVIA 2VH7A 2RU9A 2RJZA 4QIEA 3AH6A 2LYVA 4NYPA 2AX0A 1IXKA 3QWUA 3SYZA 4WZMA 1X60A 2FGCA 5B7WA 4QIWD 3OV7A 4C6AA 1HMVA 2LLZA 2FDNA 1P9YA 2GHVC 4NEYA 1JLAB 1LQ9A 4X65J 1KOOA 1QLNA 3MMAB 4WYLA 4V19X 1NB2A 2XBPA 1F0XA 3EXCX 4IOCQ 3MM7B 5DZ6A 4P74A 1DLOA 1Y3JA 4OYAA 5AE3A 4LF1A 2C22A 1VQMS 3OSPA 4PXCA 4I2PA 4PWDB 4DZ6A 1T95A 6FDRA 4WFAQ 4K4VA 3K58A 4MIBA 1RT5B 3QT5A 4HVZA 1URRA 1F9EB 4GO5X 4DR6F 2NXJA 2XMWA 4JI0F 2RRAA 2IY5B 2OO4A 1EJ7L 3G9CA 2WSFC 1UL3A 4DPOA 2PA3A 2ILYA 1H74A 4X4TA 3B54A 1KFDA 3QZ8A 2DNLA 3VZHA 1NHUA 2XGPA 2FLOA 5E5NA 1S9FA 1XNQF 2QE5A 1V9OA 1VRTA 1H0HB 2YWWA 4DUYF 4OYMA 3W9IA 5H9FK 1T3OA 4YN3B 2B6AA 2XYHB 1B0VA 2QA2A 3VAHA 4DQRA 1RLCL 2DISA 1IN0A 1TVRA 2HFSA 3HF5A 2YNIB 4OI1A 3Q8SB 3HX9A 4CRJA 4J9LA 3ZTOA 4EYIB 4A8SA 4B3RF 3DLKA 1N34F 1OY8A 1AUSL 4DUZF 1RXOB 2M0GB 5KFNA 1EETA 1MU2B 4KGKA 2AJ1A 1RT2A 3SFUA 2E66A 1HR0F 3Q0AA 2BJDA 4NI2B 2JJ4D 2VPZB 4MKAA 2MKHA 2RSQA 2U2FA 4C48A 4ZP6A 4OHWA 4A8YA 1PCAA 3BV8A 4RBVA 1X4FA 1K73T 1HKAA 3QT6A 4CLTA 3HCXA 4MYTA 2XG8A 4JI5J 2XSJA 5KFLA 4FYXB 4I1TA 2OPPA 4URQU 3DNCA 2LEBA 3BPDA 3J7AN 3D0GE 3CJ5A 3MCNA 3N28A 1E6VA 2ZUAA 5EHHA 5JXSA 1R8BA 4G65A 3MUVP 3CC4S 1TP7A 3I31A 2E5IA 1XMBA 2A1BA 3KHLA 4O44A 4NLOA 5EWEA 4WP3A 1U2FA 3BBBA 1C0UA 3TEGA 4TLRA 2HHVA 1VQSA 1MSWD 5IXUA 4YR2A 1Y4ZB 1CEZA 5KFXA 5KFDA 3G6XA 5DQHA 3N0VA 4HLBA 2QL7B 3WC2A 1FJ7A 3QIPB 4ETXA 1HD0A 4DR7F 3OTCA 2J0SD 1F2HA 4PG7A 2H48B 5KG5A 2H9ZA 3PFEA 1N5QA 2ZKTA 2MKYA 1SCJB 2IJRA 3MR3A 4C8LA 3THTA 2V4JB 2DR7A 4Y6IA 3GLJA 4F4KA 2HGMA 3D54A 3OFEA 3RYLA 2XLIA 5DJBA 3E8OA 1IKWB 4EMDA 5GMKa 3MHYA 2HZVA 1BMQB 4DV7J 1V3SA 2LXUA 2HEKA 3ENQA 1YVFA 4DPUA 1QSYA 3UN5A 1AZSB 2XWYA 2ZKUA 2W1BA 4NCAA 5HQMA 2ZDPA 4F0MA 3BQ2A 1WC5A 3EYZA 1GT8A 1WACA 1RT7A 3M8SA 2L41A 2X1GA 1U25A 5AT1B 4I68A 5HBMA 1HNVB 4LF9F 5B09A 3W66A 5KAKA 1HNIA 2B9YA 3C15A 2F9DA 3CCUS 2LXFA 2AYMA 4LR8A 3OL8A 1N5VA 1U24A 3QATA 1QVGR 2UXCF 1OY6A 4FS2A 2V4QA 3I0SB 1IQZA 3B8HA 4JV0A 1U8WA 2QLDA 4K5SA 4TU7A 3SSSA 3T5JA 3QSYB 2D7SA 5I3UB 4J9SA 1HBUB 1FJGJ 4BC9A 3IN5A 4KPYA 3MM6B 1TELA 1SKSA 4DSLA 1N32F 3E01A 2QN6B 1KQKA 2B7BB 3SI8A 5ETLA 2CQHA 2DH7A 4OV6A 3TO8A 2Z2YB 3M9OB 3KLEB 2R2SA 2M88A 3GU0A 1GXUA 2DGQA 4XK8C 1PC4A 3NMAA 1ZTWA 3K89A 2G0JA 3FRZA 3I9ZA 1L3KA 1S5ZA 3AGZA 2BQRA 3AA9A 4LREA 4TY9A 4YY3F 2V94A 4FPRA 2WONB 3RBXA 3CDEA 2N7YA 3ILIA 1RGVA 3PYDA 1OYDA 1JLFA 1GMUA 3DOLB 4MIAA 3QRRA 1LWFB 1VYAA 2B3TB 1VQPS 1F5AA 1U02A 1KR4A 2Y3YA 4C8KA 4QIGA 1JLGB 1AW0A 3R7SB 3MTKA 3GG1A 3L7OA 1S79A 2WRMA 1VDHA 3KNGA 2YKNA 4MH8A 1N0UA 4F3QA 2YX4A 3W63A 3NGKA 1NK6A 3U1MA 4DV4F 1RACB 2B4OA 3MD3A 2MQLA 2CRLA 1G7CB 2DY1A 2ASLA 2LA4A 4RW6B 2R7SA 2DR5A 4ELTA 2F65A 2J7KA 4QU6A 2E44A 4ZPCA 4Q43A 1FWKA 2B4PA 3IS9A 3M32A 1Q5YA 4IH7A 4DV6F 4L74A 2DNRA 1IBKJ 1VRTB 5KFUA 3W8GA 1C0TB 4TNOA 1OPIA 4DHVA 5DDPC 2NS1B 5HVFA 4EEYA 4LFBJ 3FBCA 1B0PA 4A8FA 4LBPA 2ZC4A 1TKXA 1S77D 4O3RA 2XHWA 2D74B 2YNGA 4I64A 1MROB 2V2ZA 1KSPA 4WFBQ 3PJ9A 4ZVFA 3V81A 3KLGA 4XO0A 2RDIA 4R8UB 3FSXA 3JTPA 5T7LB 2BQUA 3BO4A 2RDJA 3DLKB 3CD0A 4DJBA 4X4NA 4OHXA 5H1SV 4TY8B 1EETB 1CS4B 1NDLA 4DL3A 1RTHA 2L08A 2OAUA 2D3O1 1TZ0A 2QT7A 1M1GA 3H2VE 3EZUA 5IT9U 4D3HA 3VAKA 1ZM2A 3T9NA 1O51A 1X5SA 2E5JA 2FB0A 3MGJA 4HT5A 4C8NA 3RBEA 1QAJA 3GSIA 4LF5F 3RB4A 4M95A 3GZ7A 3OR1B 4Z2XA 1V5IB 2QSFA 3HJFA 5HLFA 1NK8A 3NNCA 2HSEB 1S1XA 3W5XA 3BS9A 3GP9A 1MN9A 4H4KC 1WG4A 5KT7A 3GR1A 3RW7A 4O44B 4ES3A 1NKCA 3GV5B 2JZ8A 2HURA 3TX0A 1D3WA 4ZN1A 3BSAA 1DQAA 4E0DA 1RISA 2V8HA 2ZJQQ 3IFEA 1PKUA 2BKOA 2Y1IA 2DRBA 2Q3PA 3CMES 1B4SA 4NLYA 4L75A 2NUHA 3TANA 1RLDA 2B7CB 2IM3A 1YJ9S 4OZJA 4DSJA 2XYGB 4PQUB 3P6YC 1J27A 5IZHA 3QT7A 4FVCA 5IT9Y 1U1PA 1F1BB 4ZKAA 1YDLA 2RF2B 3L3CA 3UW1A 4IOBA 1MG7A 3CSKA 1VC0A 4QBUA 3HVTA 4QZVB 2UXBF 3CJKB 3RRKA 2KG1A 1R8CA 2FJBB 5CZXA 1R6YA 4PCQA 1BE4A 1FHTA 1H2UX 3MWBA 3QRQA 2OHDA 3TAMB 3CJ3A 4USIA 1U47A 3PRDA 1M5KC 3CJ4A 1BHNA 3OL9A 3IRWP 2HAFA 2I0XA 3CMQA 4NCGB 3CCSS 4RNNA 2OEJA 2IBOA 1WC6A 1OYEA 1DAXA 1WSVA 4QOTA 4UZCA 4X4OA 4G1QA 2RB7A 3ONQA 2R4FA 2AGPA 5F8LA 2MQQA 3VF0B 4Q2LA 5HANA 4RJVA 2FJWA 1UA0A 2DPIA 3OTEA 2OI2A 3AB4B 1XERA 4NZ6A 2CQ2A 4ED0A 4P7VA 2EFQA 1LWCB 2D1CA 5B0FA 3QJLA 3M8YA 2CXEA 3SCLE 3DGVA 3NKYA 3ZO7A 1KQGB 1EKSA 2J5AA 4FP9A 1GMWA 1Q7LB 3K8WA 3HJVA 1T9WA 2P9CA 5LM7E 3R2CJ 4QWDA 5EUHA 4TVAB 3EE3A 5D3GA 3CDWA 4ZVOB 2BACA 4L3NA 3RRHA 3HZGA 4X64F 1WDDA 1IWAA 2HVHA 2DO0A 2ZM6F 4O0IA 1OQ6A 2IDLA 1JLEA 2EK1A 3BDEA 5F41A 3LA0A 1TKZB 3QGHA 2J9EA 4ZLPA 3S01A 3RR8A 1F3VA 2R8GA 3DLGA 5J2MA 1S0MA 2XLKA 4F26A 4KJIA 1PO6A 1IKXA 2CA9A 1D09B 2CG4A 4EU0A 3D6FB 1Y3KA 1S59A 2Q43A 2YVSA 1SKUB 2HVEA 2W4DA 2Y1JA 1GK8A 5JVHQ 3H98A 2C2EA 1BUXA 4W98A 2VU5A 3KLHA 2B0GA 2RQ4A 4LVNP 2ZH7A 4FZVA 4BC7A 3KYLA 2DD8S 2VUGA 4I67A 1RBLA 5G4DA 2J7WA 3P49B 2ZC3A 1RHKB 4KHPF 1FRLA 4WZQA 3UNYA 1XC9A 4DX8H 2AEJA 5A2QY 2DPJA 2W01A 3JTOA 3MPVA 3MECA 3D3CJ 1BQNB 3C6UB 1WUUA 3VAIA 5EWFA 1UPMB 3BGRA 4X65F 1REVB 2LMIA 3KG0A 3TRGA 1TUGB 4MFBA 3CVKA 5E3PA 2EKNA 4JI4J 2JEJA 3QGPA 5GVQA 4MKBA 3R3TA 1VQ6S 5IT0A 2IMOA 2R8KA 2OEKA 3H5YA 4QPXA 4RR5A 4DR2J 2KFZA 2ZHBA 4KAIA 2MQOA 4PG4A 1FRJA 4CO5A 2IVFB 5ETKA 1JK9B 3ZZRA 4CDIA 1M1HA 3VVTA 1FXDA 3K5OA 3TW0A 3DRPA 3R5DA 3H5UA 2MSSA 4XDDA 2RAQA 2X3DA 5C42B 3P8BB 4NX9A 1JMTA 2G2OA 2ZZTA 5FIIA 2FVSA 4HHJA 3HHLB 5KFIA 4OFZA 1XNRF 1L3UA 3MAAB 3FMWA 1YI2S 2EBGA 1P27B 2P9GA 1S6QA 2R8HA 2POKA 4KGXB 1RTHB 5BJRA 3R6GB 4OYWA 4USHA 3C46A 1TUVA 2LKZA 2JEGA 1Z4UA 2JOQA 2ASYA 1FO1A 4E98A 3UN3A 3ET6A 3P5TL 3MMCA 3MR6A 2Z2MA 2F7VA 1VHFA 2CJ9A 1RTIB 2YNHA 1CJVA 3BM7A 3AJDA 1MNEA 2Y9HA 4DZDA 2ZOGA 3Q8VA 5IV4A 2RS2A 1N6QB 4DU8A 4A8WA 4NLTA 5K5MA 2NZCA 4F3MA 2QYGA 4X84A 3DLHA 2CNLB 4IR9A 2RU3A 4DN0A 4YOEA 3MOJB 2ZH5A 1R8HA 1LK5A 2Z2LA 3AA8A 1HD1A 3KJNB 4M5GA 4F50A 5DS7A 2B9EA 1U48A 4HH0A 4FPIA 2DYAA 2FGOA 3J7A1 4DPYA 3GG0A 3FBFA 2MHEA 4Z7YA 3D67A 4JI5F 5KG7A 1Y5LB 3MM9A 2MZQA 2W2OP 4KT0C 5F8HA 3ZNUA 1D1UA 1QM9A 3T1YF 4NASA 2G0CA 1RAOA 4J80A 5E33A 3V6JA 2B5JB 5EX3A 1CJUA 3L95X 5HJYA 2DTJA 3JSYA 1LW0B 4K2JA 4C11B 2PIIA 1I1GA 2RVJA 2RH3A 2FZKB 3CDBA 2ZH8A 4KO0B 4ZA1A 5HQLA 3FBEA 3FFIB 2A2DA 2B9XA 2HFVA 1BGXT 4DFPA 4LF8F 1S12A 2CPZA 2BX6A 3SFGA 2H1YA 3M8WA 1SI9A 1YJTA 4PKDB 2QL5B 4ZDNA 4MJKA 4G6VB 4K7QA 4W4MA 3KUEA 3KLVA 2V50A 3D1HA 1YJWS 1UPPA 2YQ1A 3QBCA 5LSRA 1S0NA 2K1RA 2AJ2A 4M5MA 2GJIA 2HNZA 4RWWA 1WF2A 1FNOA 4YB1P 2HGNA 5KT3A 2OPRA 1NRKA 2AKWB 4X66J 4YUDA 3SCIE 1RWPB 3W3SA 4EO6A 1S1TB 4HR2A 3FVYA 3EGNA 2MZJA 3CCQS 2HS0A 1TV6A 1N88A 1WD6A 2QLJB 3DI6A 2R3VA 3O8WA 1KN6A 2AMCB 4LSNA 1WI6A 1TAUA 3HVAA 3CJTA 5A76A 5D77A 4AL7A 5E0OA 2Z57B 2DITA 1QVFR 3GCWP 3FC9A 4Q2MA 4HH1A 3NGDA 4GC7A 2UP1A 2MLXA 5BXIA 5DETA 1LOUA 5D3GB 3R9LA 3MEEB 1KTVA 1VIOA 2JL9A 2VG5B 3FMBA 1FWPA 2XM3A 1RT3A 2GMLA 2KKHA 3U27A 3QAEA 3OJSA 4IFVA 4XIUA 2LQ9A 1J5EJ 2LU1A 3W2WB 3MEDB 4LF2A 5HQ8A 1CVJA 4UT4A 2W9BB 1EIYB 3SDEB 3IRXA 3RUBL 3LAKA 3U02A 3SQGA 4JUZA 2H4WB 2IPOB 2GW8A 4NL5A 3BSOA 3HPOA 1W26A 4N5SA 3VVUA 2BR0A 5THWA 4B08A 1VCTA 1FRHA 2EFGA 2CFXA 3SV3A 5D4OA 4F4XA 3FBBA 5K14B 4F67A 5HROA 2BE2A 4RW8B 2ROEA 1S4EA 4F0KA 5B0CA 2BANA 5GAEU 1GTHA 4LFAF 3OLAA 4I6AA 4P73A 2LVWA 3RGIA 1VHIA 2DNNA 5L8RC 1WOPA 3PX4A 1B7YB 1TKTA 2GO8A 4CLUA 2C3UA 3FK4A 1BC6A 4F4YA 2RHSB 3HHDA 3DRXA 3GJQB 2BJ3A 4AQYJ 2F63A 4OYXA 3N5FA 4F25A 4MFBB 3TA0A 4PG8A 4F8RA 5KFAA 2ZITA 4FYWB 2G0IA 3H2LA 1VBYA 3ZTQA 5AXKA 3AOAA 2DXEA 3W8PA 4J9VA 1S6UA 1S97A 3JQKA 3PACA 1JNRB 1YBAA 1EAYC 3NGTA 2VQFF 1NMEB 1UA1A 1T9UA 3OVBA 4ED6A 4FYVB 1WF1A 1KLMB 5KTQA 2H65B 1TL5A 4R5PA 1VFJA 1NDPA 3FZBA 3HHLC 9RUBA 4RO0A 4I6YA 2JLGA 4KY3A 3UPFA 1SH0A 2GVDA 1QUVA 4RNMA 2EXUA 4AYBD 3HT3A 5IFMA 1X0PA 2HMIA 3OTOJ 4ICLB 5ETVA 2VBWA 4R0JA 1KP6A 5HP1B 2FZCB 3KKFA 1S9GA 4LFBF 3AQPA 2DHXA 1QE1B 3G8QA 4TQSA 2OFGX 4DR5F 4WTYA 4ZPAA 1M5VC 4ZJLA 2FHKA 3HKZD 4NYOA 4JYAF 1UVKA 2IFXA 5I3PA 1VQ7S 3ETMA 4M63A 5HO4A 4Y2KA 3DXSX 2L3MA 3THPA 3G96A 1MWZA 2I8EA 3TZXA 2GVZA 3GV7B 1FRXA 2I5JA 4DEZA 5A8RB 4WU2A 4DV3J 1KDNA 3MEGB 4NRUA 3HHEA 2XHCA 2ZD1A 4YR0A 4PXEA 1DFDA 2CJXB 3G2XA 3LGNA 3D9BA 3ILLA 2NQPA 2NXUA 1QTMA 5KG2A 4X4SA 1OS5A 1FK9A 2CQ3A 3GFHA 2Y0SD 1LXNA 4OX7A 2XMMA 3MM9B 3CJ0A 2HNYB 3RZAA 3PR5B 3DGPA 4DCOB 3AKOB 2ATCB 4K4UA 4OJ1A 2FVQA 5F8IA 3BPSP 3IWNC 3UDLA 1FRMA 4CNZA 4IG0A 3W65A 3BQ0A 4ZS6A 2BJ1A 3BSNA 2XYPB 4F7VA 3MM8A 3KK1B 1S72S 1YRTA 3VAGA 3MMBA 4RZRA 4C3LA 2YQ0A 3FSIA 2M8HA 4KBIA 1OWXA 1UW9A 2UVVA 3VGUA 3O1LA 1MWYA 3R5AA 3HO1A 3HDSA 4OI2A 1UVLA 2DRAA 3VAFA 3W1YC 4BHQA 3WBZA 1EZZB 3J80U 4YR3A 5CD4A 1TR0A 1OMSA 4NLXA 2MQPA 5F0WA 4DL2A 2DGWA 1T3NA 2KI2A 1Q8LA 1JLQA 4FYYB 1GMVA 3C14A 3EJMA 3PIPQ 3WHIA 8RUCA 3BBCA 2HBYB 3W7BA 2FJEB 2CG8A 4K4SA 4N7TA 5B0BA 1X5TA 2QTWA 4YDXA 4A47A 1FKOB 1I6JA 2KG0A 2VFVA 4DBQA 4F4AA 3P4UB 3H0PA 4BWJA 1UEVA 4UY8T 1HI0P 4DX7A 3UVJA 1RHQB 3I0RA 1YBUA 3PCOB 4PWUA 4O3OA 1TL3B 4QYZJ 2VJUA 3BREA 3DRSA 2F4VJ 4DV1J 4IH5A 3CCTA 1YLXA 5CYQA 5LMNF 1PSDA 5M2PA 5KT4A 4YEAA 1DHMA 1NSPA 4ID5A 3KK2B 5CA5A 3D6TB 5IT4A 2ZVIA 3ZTPA 2WZ1A 1MMDA 2MB0B 5ADZA 3K0JA 1NSKL 2DHGA 2LQ5A 3JTNA 2MQNA 4O4RA 2ZBQA 2D3UA 3FJ2A 4KV8B 5D15A 4K4TA 2CQ1A 3QLHA 1Q86T 3MF5A 1TAQA 2QL9B 5L38A 3LP2B 3FUYA 3FDSA 2HQDA 1U1OA 1FESA 2MJNA 3O2IA 2AYBA 1G2EA 1K47A 4NE9C 2XWXA 2DGUA 1RABB 4ZP8A 4OHZA 3Q8UA 2R9LA 5GAHI 4L3KA 1PBUA 2IAJA 4F4WA 5C2GA 3F73A 2EG1A 1TUWA 3RB0A 1E6YA 4JI7J 4H4MA 4ED1A 1U6FA 4ATNA 3Q89A 1YHQS 5T14A 1UWBA 1LW2A 4ECZA 2B56A 2PFFB 3QFHA 2HFZA 2XB2D 3V2UC 4IRCA 3PW2A 3MURP 1SJRA 3V4IB 4CI0B 3TVKA 4DSFA 4OYBA 2IM0A 1SXLA 4B3SJ 4OJHA 1DQ8A 2CQDA 5LT5A 1UJ5A 4ZCKA 4K8RA 3QZ7A 4B3OB 1HWLA 3DDNA 4ILRA 3DHXA 2GIFA 2XULA 3CCLS 4P10A 3K8VA 1IBMF 1IKYB 2YTCA 5K8PA 2BJ8A 4F0HA 1TFYA 2CDQA 3LW5C 3EVMA 5HL7Q 3N5BA 4P2XA 2C42A 2HRTA 2Z4PA 1GNKA 3OXGA 1H2VZ 3DDKA 2QA4S 2E1AA 2HNDA 4OZ5A 5LMUJ 3JSRA 4C8MA 1N5TA 3PX6A 1D9FA 3Q8PB 3GYNA 5CCLA 2DJWA 1JNZB 4HTJA 2HHUA 2N3OA 2AGOA 4RNOA 5F9NA 2WB1D 3PZPA 2O1PA 3P3DA 4LJMA 4DG1B 4KKOA 2DRDA 4OZ3A 3PW5A 4MTPA 3BYRA 1PJ7A 1SPBP 3IR5B 5KFOA 1HIYA 1ZOTA 4M5LA 2HMIB 1NBEB 4LR7A 3M8RA 4DR2F 2K7JA 3BKUA 2BJ9A 3DLEB 5DM7Q 3EVOA 2FVPA 4F3OA 1S9GB 2KZZA 2XMTA 1VQ9S 1JLBB 3VALA 4OLPA 3POTB 3UO0A 2LQJA 3GYGA 4NXMJ 1NK0A 4M5JA 3OFGA 5J1EA 1TL1A 1K1SA 2DCLA 3OUYB 4B9UA 4C97A 2HS4A 2XI2A 2LEPA 1HFEL 2B26A 1U7LA 4I7FB 4NOHA 2CPEA 1RT4A 1UEKA 3VQSA 3RG6A 3NWRA 5K20B 1U2CA 2VD3A 4ED3A 3LP1B 3AD7C 2HHWA 1Y5NB 4EGLA 4CO4A 3A3NB 3TVYA 3OHBA 1YGYA 1FDAA 4NLUA 1BY9A 4DX6A 4NCBA 2K3KA 2YX1A 4J91A 3C66A 4USUA 2KT3A 5DM6Q 1FI4A 3G4SS 4IQXA 3C6EC 4ZVGA 2XMJA 4L72B 5L9XA 1SKRA 1JLAA 2B4VA 5IV3A 4FKXA 4QQBA 2W24A 6AT1B 5EWGA 5ETMA 3MM7A 1HHSA 4LRDA 3HHKA 1T05B 2E5LJ 1RKJA 1IR1A 1XWLA 2V69A 4O0NA 4PWDA 5KFMA 4EBCA 4DFKA 3W60A 4UZBA 4HYKA 1NUEA 4GC6A 4A8MP 2ATLA 3U7JA 5K8OA 1DARA 1RT5A 3VAJA 2EWHA 5C25B 2DCUB 4V19J 4Q44A 4QYZK 2VF3A 3DOMB 5AJ3F 2J0QD 2CUYA 2CJKA 1KKHA 2QMUB 1I94J 1HI1A 4DPTA 2PC6A 2AD9A 2G1HA 3H7HB 4QWBA 1S1WA 2DXFA 4J90A 4DL4A 1KHWA 3RRGA 2XMAA 3C19A 4ZP7A 4M8LA 2Y1RI 1OSDA 4KGZB 3C14B 1Q5VA 4WFYA 3FCHA 1RU1A 2M5YA 4FXWA 3S6EA 1J5OB 2FHJD 2ZJRQ 2Z30B 5DGAA 3PR4A 2QX0A 2ZOMA 2DBBA 3ISNC 1N5YB 3KNAA 3DFEA 4GKKF 4J5OA 2XMVA 5HN0A 2CJAA 4B3MJ 2VFSA 2YNIA 2E5GA 2E9RX 4JV5J 4UTGA 3UVJB 1FFSB 5L46A 2EVZA 2V2VA 2UUAJ 4IOAQ 3ENWA 1TK8A 2ZFHA 2VA2A 4WIIA 1NSQA 4UQTA 4JI6F 5ITHA 2YBVA 4JP8A 3QJJA 4Q0BB 1YTYA 5KFBA 1MU2A 3EMTA 3TI0A 2BOPA 1Q78A 3CJRA 2OPSB 2P5VA 3TZZA 4NI2A 2GJFA 5D0GA 1HQUB 5F9LA 1SB6A 2YKOA 3BZQA 1Y7PA 3UCGA 1UVNA 3FEZA 3GV8B 5GAGI 4AE5A 2R7RA 1RUSA 4DV5J 3FGVA 3LH2S 2H54B 5MAOA 3LWMA 3T3FA 2AX1A 3QFWA 4EUVA 3KK3B 2X7IA 2RUSA 3R5CA 1MMNA 2Z2ZA 2FD2A 4ERDA 2XMUA 2WSEC 2MZ1A 3B4DA 5KFGA 1YWXA 1EKRA 2YWHA 4B3TJ 3IG1A 2EFVA 2HYIB 5KT2A 4H4KA 1RAAB 1HW8A 2IAJB 1BWEA 3OQ2A 3HSZA 3OVSA 1Y11A 2XS2A 2RNEA 2BE9B 3VV2B 1X4BA 2RMLA 2DK2A 5B0DA 4U8YA 4LVOP 2MPUA 8ATCB 2FJVA 5ETSA 4QCLA 1L3TA 3M6WA 3QIPA 1JXEA 4DR3F 3CDUA 4NMXA 3CXCR 3KJQB 1GAOA 4YB5A 3CF5Q 2ADCA 1Q82T 4DV0J 3I32A 5CH7B 2V4JA 5L1KA 2DR8A 2OFHX 1HNZF 3V6KA 1XMQJ 4NLQA 1DBDA 3TAQA 1RWUA 2QV6A 1AXQA 1ZBTA 1G4CA 3S8SA 2R2TA 1SUQB 1YZ7A 1RDRA 1M5SA 3H42A 5J1PA 5K9FA 4O3SA 4NZ0A 2HG4A 4ECUA 2M70A 2RRNA 1F3FA 1FDNA 3M9NB 4URSA 3EGZA 3NAIA 3OTDA 3JYTB 3Q83A 2MY8A 1AZSA 5KFJA 2H51B 3LP0B 3MTJA 1HQEA 5I4MA 2FVCA 2IRYA 1JKHB 3O5TB 3KHGA 3SV4A 3TWZA 1HLWA 2OLWA 1P6TA 1HNVA 4P2MA 4DSIA 4QWEA 2BV3A 2YWFA 3KLIB 1QAYA 3NRBA 1CJKB 5GADU 4QIFA 4HKQA 1RAHB 1KLNA 2WHOA 2CNNB 1HWUA 3UFCX 4LIWA 4RW4B 2DGTA 4KH1B 2BE7D 5I42B 3OD2A 1UJ6A 1HBOB 1VOMA 1WORA 3I0SA 3IM8A 4WE1B 4EBDA 4HT7A 2GQ2A 3QPIA 1NLKL 5I3UA 2RQCA 5J1EB 4ECRA 4LRBA 2LECA 1HBUA 3HT0A 1Q79A 2I1RA 3VGTA 3KMSA 3V5RA 2NSBA 4DR4J 3W9HA 2JNJA 4EK2A 1JJ2R 1S4FA 4DCJB 1U4BA 4K59A 4PRFA 3B4MA 3M6XA 1RWMB 2VZ9A 4ANDA 3CO9A 4C9DA 5FLXU 4TYBA 4U7UK 1S1VB 2CAJA 2RKIB 2ZBPA 3DU6A 1VQKS 4DFJA 3D5MA 7FDRA 3VZIA 2AZ1A 1U49A 1R27B 4W92B 4I4BA 4X4RA 1TTHB 2H5IB 3ULHA 1BWVA 1HHTP 4CM2A 3EPGA 4LF7J 4C0HA 2FJDB 4UUWA 4OL8A 2DR6A 2WONA 3I55S 2PE8A 4UOFA 3ILOA 3JXOA 1UFLA 1FXRA 1UP1A 4ECXA 1GFWB 3DOLA 1NB7A 1N48A 1LWFA 2O5DA 1RAJA 4TQRA 1R0BG 1XK8A 1T9XA 3PYEA 4WXOA 1JLGA 3AJ2A 3BGUA 3I5AA 5D4LA 1KBRA 4CH0S 4UOCA 3H4DA 3KTQA 1CQMA 1S7IA 3UDEA 3PV8A 3PJWA 5AXLA 3ISZA 2PMWA 1SV5B 3GIKA 3Q2TC 3HSGA 4AL6A 5FLXY 2M7SA 3FEYB 2KB2A 4RW6A 3OFHA 3M05A 1S1WB 2W2MP 2YXLA 2C2ZB 1YKWA 2KXFA 1SJ1A 2EKYA 2HAIA 2WCXA 1SQFA 4TYAA 1VRUB 4N47A 4JI0J 4YB7A 2NYHA 1WEYA 3EDRB 1CG2A 1DQ9A 1WOOA 4ER8A 2XS5A 1C0TA 3A1YG 3UCUP 1NJXA 2ERRA 3R1HA 4WTOB 2AJQA 3R8YA 1ROFA 5IS2A 2HW3A 4CQ1A 4LSLA 4ZVQB 1YJ7A 2AEFA 1RYRA 1XNQJ 2K2PA 3BKTA 1MROA 3RU0A 4WYWA 1U6ZA 4DUYJ 3RR7A 4MK7A 3MAQA 2VFRA 2VOPA 4R8UA 1N36J 5A0YB 2P6SA 2P9EA 5T7LA 4U9RA 1NK9A 3LO3A 1R0AB 2W9CB 3HSJA 4WWSA 1XEZA 4TY8A 1CS4A 3GE9A 1ZM9A 2HRYA 4Y2MA 4U7UD 2O67A 3LOUA 4BWMA 2VOOA 4IRDA 4B3RJ 4OJGA 1FA0A 1CQNA 3C8YA 2YY3A 2NZ4A 1U09A 2E1PA 2RD5C 2XLJA 2FQQB 2HQ3A 3HVRA 1RTJB 2XC9A 3A4TA 1HR0J 2JRSA 2F8HA 2KFYA 2HZAA 3CDAA 1CBKA 1UMJA 1NM2A 3GILA 2E1MC 2HBZB 4GRSA 1NKEA 1EB0A 3OR1A 2HZCA 2HQGA 2F4VF 1NK4A 3SEOA 2QGFB 4PAAA 1X0FA 2ASDA 2FY1A 3D3BJ 3IG1B 3NLCA 1RWVB 4ED8A 4AT1B 1CULA 2C1EB 1RWKB 4ANEA 3ZTSA 4P52A 3PRVA 3MPUB 2CKWA 2EFPA 2LA6A 4K4YA 4GMKA 1S0OA 1N33F 4DV2F 2DNKA 3KG1A 4PPDA 1XQIA 3M8QB 5E3CA 3CC2S 3Q2SC 2N4CA 1PIEA 2JHEA 3MR5A 4ILLA 4EO8A 3KLFB 3TA1A 2WVDA 2CVIA 2XQCA 1UWAA 4OLOA 1FE0A 2A18A 5B0EA 1OIAA 2DNPA 4PQUA 2HLUA 2AQ4A 3DDIA 2UV8G 4TXSA 3R7BB 3Q22A 5KFRA 2DNGA 2H3EB 2QIFA 2RF2A 4PG5A 2BUNA 3PRBA 4TU9A 3WC0A 2RQKA 1VJQA 2ASJA 4JI7F 1Z1ZA 3CJKA 4DCPB 4DR1J 1YQHA 3LUYA 2D41A 1HBMB 2YWEA 2HFNA 2HHHF 3I96A 5IQ6A 3KG4A 1WKKA 4KGVB 4P2SA 2KJWA 1O8BA 3CTRA 1HPZB 1IVZA 3TAMA 2GJ2A 3ZXWA 1FD2A 2XZDB 1RA7A 3ITHB 4HACA 1HQEB 4NCGA 4DWIA 2CWXA 3JSMA 1X4EA 1CJTB 1V3RA 4LRAA 1WTBA 2VIHA 3WX4A 2OEMA 1RP5A 3L7UA 3LPYA 4JBCA 4MIWA 3GIRA 2IM1A 3UR3C 2ZDOA 5DZ7A 4J9UE 1FF2A 3JAMU 2MDAA 5CHCB 1LWCA 5HAOA 1RSCA 2G1DA 3M8PB 5LMUF 4GKJF 2IA6A 5CAAA 2QFIA 3UR0A 2MKIA 1AB8A 1P9QC 3ZC4A 1UJ4A 4CLFA 3I6PA 1U1QA 1AT1B 3OR2B 2V8DA 3LALA 4PUOB 2AHOB 3BO2A 1S10A 2EPIA 1BQMA 3ZZUA 3V4MA 4DQPA 5KG6A 1OPZA 1R89A 1UKUA 2MXYA 3IBFB 1HNWF 4NLDA 4Y34A 2ZBRA 4MYUA 1T8EA 1P1LA 1N32J 2MZTA 3TARA 3RAQA 2F5GA 3PG9A 4DQSA 2DKOB 4X62J 1TKZA 1H7XA 5T41A 4J9PA 1FVSA 2CPDA 3LTOA 1LNQA 5DG7A 5J2QB 4K2XA 1NDKA 1IBCB 4A8QA 2HBRB 2GIRA 2NXCA 1D8YA 1WF0A 2UUCJ 2JC1A 5KG0A 2OUGA 3JAMY 1RBAA 2YNFB 4CH1A 1SJFA 4RW9A 2CNOB 2BDPA 3OFFA 3BQ1A 2PMHA 4YY3J 2OGUA 1T03B 1OO0B 5HVGA 4RNFA 1PJ6A 1NLTA 5D4NA 2MY7A 4WFZA 3THVA 2VC1A 1DTTB 4A8OA 4IO1A 3TR5A 4RNHA 1Y00A 4P75A 2KRBA 2KFNA 1BQNA 3C6UA 2BZ2A 5EGYA 1JIHA 1REVA 1N52B 2GAGC 3K57A 1QSLA 5GMEA 1C4AA 1YG0A 4C2MA 1JXLA 2G2YA 3NCPA 2VICA 1U45A 1NJIT 1PAEX 3NS6A 4CNYA 4JB8B 3BDPA 1S76D 2ACYA 2IIHA 3LQVA 1O0PA 3K5LA 4WPAA 1DTQA 2MQ8A 4RPFA 3TUJC 2WOMB 2ZVSA 1RWXB 2YX7A 4LSLB 5A8KA 2OMLA 1X5OA 1IJEB 5DQIA 3I5BA 2MGZB 1VQ4S 1EP4B 2RDDA 1UEUA 2PT0A 2E9ZA 2F1FA 4Q8EA 5C42A 1F6TA 4PWWA 2IMWP 2W4CA 1T11A 3CIMA 3HHLA 1U8SA 1C1CB 1RAGB 1KVKA 4RLEA 3DMJA 3MAAA 2DGSA 3FNNA 4D3GA 4B9NA 1W2BR 2GO9A 4FF2A 2FZGB 2C2NA 2WK4A 3DN9A 2BABA 1QSSA 3HMJG 4I6WA 3QNWB 1XIQA 1R43A 1X9MA 3K17A 4CLSA 3A8IA 3KFWX 1UVJA 4B3MF 2K3IA 1UZHA 3MCOA 2DO4A 4EFAC 3DXBA 1D9AA 4K4WA 4JV5F 2OIHA 4G1PA 4K5RA 1RTIA 1IBLF 5KFTA 5HJXA 2CIMA 2UUAF 2WBRA 1N6QA 2B8QA 2Y8YA 4ECQA 4MKYA 5FJ4A 2FPHX 3BH6B 4TU8A 2W2QP 1RAEB 3M2RB 1QTNB 3AQOA 3MD1A 1CULB 1C3GA 4JV1A 4DQQA 3NGSA 4K50A 3UWTA 3K5MA 4LF5J 1RCOB 5C24B 3A3PB 4DUTA 4E8UA 4RUAA 3W9JA 2QJ3A 4ETZA 3DLBA 2UUWA 3UNGC 2WB4A 2HVZA 5LOQA 2BYCA 3EM1A 4LFCF 3HP6A 3DM2B 1U1RA 4QU7A 2J8AA 4GO7X 2R7VA 3LF0A 2HHTA 2JWNA 3CO0P 3LWLA 2E7WA 2XY5A 4ENOA 2JZ5A 5KFEA 4AFFA 3CE8A 1F5BA 5L9NA 3MUMP 3PIOQ 2B5JA 2DB1A 4ES1A 2KYXA 7AT1B 4NEZA 1LW0A 3WZ0A 4C11A 4JI2J 3DYAB 4IG3B 1L3SA 2IBKA 3C3LA 4ALZA 2CDRB 1X4DA 4WKRA 4KO0A 1HYSA 2MLZA 3T19A 3FFIA 3BGLA 3IR6B 5B0AA 2AV5A 3OT9A 3GFZA 1WC4A 4HL9A 3ZZYA 5AE1A 4A8KA 1PAUB 2HWHA 3US5A 3Q8QB 1Y5IB 2QC3A 3J7YI 2BRLA 1RZMA 2HHXA 2V63A 4LT6A 4XPCA 4JI3J 1F60B 1YJNS 1ZS6A 1FEHA 3MR2A 2UXBJ 2M4MA 4HACB 2O66A 4Q45A 2NPFA 1RK8A 1YIJS 4Y3CA 1S0VA 2UVUA 3JSMB 3OVAA 4RBTA 4OX8A 3T5LA 3B78A 1FE4A 4OQJA 1T9YA 3ZFVA 2WW8A 1Q8BA 4KYZA 4OX9J 2ZE2A 4QW8A 2EW9A 4F4ZA 3F41A 1Q0NA 4W90B 1S1TA 1H3DA 1U0HB 2Q6BA 1RAFB 3NG8A 4LBHA 3KUGA 3M4XA 3MM5B 4CP5A 3DRYA 4C7QA 3Q24A 2LQBA 4ZVTB 3WQPA 4KPCA 4CO3A 3F44A 1K44A 3HULA 4M5IA 2XCAA 1FNXH 1IR0A 3GONA 1NNDA 1S9EB 2GMJA 3H59A 3RJMB 4ZJQA 1BQMB 1WOSA 1NXIA 3MEEA 2V8VA 5EX0A 5A2QU 2EI5A 4AD6A 3EICA 3G71S 2VG5A 2DHSA 1C4CA 1VMBA 2BXJA 2KT2A 3OXFA 4F2RA 3ZZZA 1RADB 1S6OA 4FBTA 1RB0A 1PYOB 4H4OB 3W2WA 3DLLQ 1M90T 3MEDA 4DLGA 2OSQA 2HWIA 4JI8F 2VBXA 1LFPA 3A8KA 2IJFA 2W9BA 1B64A 1T94A 4R0EA 3SDEA 3CD5A 4X64J 1RBOB 2GV1A 2KT5A 4DSKA 2HBQB 5GAHU 4HTIA 2ZM6J 4DR4F 4Y65A 4DN9A 3QO9B 2G13A 2VA3A 2HKEA 2O01C 5KT5A 5M2RA 1WC3A 5J2PA 4K4XA 3PYGA 3NCQA 3CMAS 4USVA 3BF4A 4RW9B 4ZVEA 3HK2A 5IM0B 5K14A 3TUZC 5CQGA 4RW8A 1ZPVA 1KQFB 2HPUA 5DO2A 4IKAA 1R31A 4ZCMA 4CT8A 3RW6A 1R3NA 4DLEA 1N56A 4N8NA 4PG6A 1RHJB 1DZ5A 3I9V9 2FJXA 3A13A 3BGFA 1MN7A 2YKQA 4CLZA 2CQCA 3DLJA 2FLPA 3NBPB 1YITS 2HK3A 4LUBA 4YB6A 4HHUA 4CTAA 3AOBA 3AFGA 1C1BA 2OKQA 5G0RB 5MLCV 2NLWA 2VBZA 5LXYA 1DJ0A 3U1LA 1IKVB 1X8DA 3QGIA 1D0EA 3AB2B 2R7UA 4CLYA 1L5UA 4M5DB 1DTQB 3V6DB 2OTLS 2YKPA 4TKTA 4FF4A 2V2QA 4UW2A 5L1JA 5DRKA 4XDCA 1ZYQA 3KJVB 2C3OA 5A8KB 3IAM9 4GVBB 3PW4A 3OL6A 3IWLA 1NJYA 1KLMA 1N8RT 2KXHA 3NEKA 3SCJE 5DLGA 4IRKA 5BR8J 5JJBA 1D8ZA 1LFWA 4RW7B 3SBMA 1HL6A 2OPQB 5H9EJ 3DRRB 2FC8A 3M1VB 5EDWA 1ZETA 2GIQA 5CYMB 3SQOP 2D3ZA 3DMJB 1WC1A 2KL8A 4U7CA 1KVJA 4ICLA 3N4WA 3SIPB 2R7WA 3MPDA 1SJQA 2FHJA 5HP1A 5A6PA 1XNRJ 1QE1A 2BW2A 1F9FA 1P8GA 1YBTA 3J81j 4WBFA 1NDCA 1K8AT 2CYYA 2UU9J 2FVRA 3HLUA 3A3OB 4U96A 1VQ5S 2IC3B 4N41A 2FUG9 1M5HA 1UETA 1Z2ZA 4DDFA 2ILZA 2XGQA 1IJFB 1N36F 3D28A 3M2UA 2P6TA 5A6WA 2ZH2A 1QD1A 4WU3A 2NREA 1XBWA 4ZIWA 4PR6A 3PDNA 2BEFA 5A8RA 1K0TA 2BBEA 2HIYA 3MEGA 2OJ3A 3MOZA 2MKKA 2FJAB 1ZM4A 3M2VB 2GZOA 3T1HJ 2HLTA 1NZ8A 3PY8A 2A10A 2L9NA 3TAPA 1WSRA 3R5BA 3AOCA 3HSDA 5J2NB 1FXLA 1NHKL 4PABA 2HNYA 4XTTA 1NZAA 2H5JB 4CIOA 3AAWB 2VFUA 4NA2A 4EWTA 1BLUA 4CZCA 3R5JB 3PW7A 3E3XA 4OI3A 4YFUA 4CLPA 3BBFA 7FD1A 3MPYA 4URGA 3H5SA 4O4GA 3TP2A 5ETPA 2YKMB 4RUBA 4ZHRB 3NS5A 3KK1A 2ZBIA 1VBXA 1F9HA 1VS3A 3WX8A 3IBCB 3T1YJ 1HYSB 3DCAA 2HS3A 3CB4A 4C0OC 2GA7A 5CZVA 2XO7A 2BM0A 1RT6B 5D8HB 3SXLA 2O3DA 4Y28C 3QWPA 4I56A 4AXJA 4C3KA 3X1LB 3RB6A 2YQ3A 3K2YA 1H98A 3I4PA 4QIVA 4ZLNA 5C5JA 2DHAA 5E7OB 4ELUA 2MKJA 1JWWA 4LF8J 2DEIA 2VODA 2I38A 3IM9A 1WEXA 5LXRA 5KFVA 2F8MA 1NU4A 4DL6A 1Q53A 2XTJP 4HHHA 2ZE2B 4QYRA 5KG1A 2PO4A 3VR1A 1KVIA 2XI3A 4DR1F 1FKOA 2AW0A 3T5HA 2CPYA 2N4DA 4DV7F 1KEKA 3DHWC 4J9MA 2D9OA 1NKBA 2YH0A 5KOWA 3PJXA 1NHVA 3S7RA 2F40A 2Q1LA 3UI3A 4B9SA 3KUHA 2A2CA 1TL3A 5FDLB 3TJ9A 1TU0B 5D0HA 1ZAVA 3E51A 2CQ0A 4RU9A 2XZWA 4WXWA 3NNAA 5DQGA 1C2PA 4IYQA 2MSTA 3IP0A 4MMOA 3S1TA 4OHVA 5GAGU 3IC1A 3GWCA 3PHEA 1S57A 3KK2A 1FD8A 4ELVA 3ADAC 5D0RA 4WIQA 4P71A 2XEXA 3QT8A 4ED5A 4MT1A 4YMEA 4CO1A 2V4RA 2B8PA 4EZ9A 3O6QA 5E3AA 3HD2A 4KV8A 2JEIA 1ULRA 4ZLJA 2AJ4A 3LP2A 4M5HA 2DR9A 3ENVA 2ZEJA 1FJGF 3LGMA 3QAUA 3ETOA 2HHPA 4BS2A 5HI7A 2IYGA 5CCMA 5HMWA 5E2QA 2FHMA 2AT1B 1RHRB 1M1KT 1SL1A 5J2PB 1SL0A 3G87A 4CYUB 1N54B 1R8AA 4C0BA 4IR1A 2ODXA 4X2BA 4USJC 2DGVA 2V68A 3TVZA 5L1LA 3OJUA 1YK9A 2Y8WA 4A4JA 1URNA 1FRIA 1CSJA 2CJQA 3TX8A 4ZMMA 1X4HA 4X62F 4DS5A 1FFWB 2GGPB 3GYXB 3V4IA 5EN1A 3K59A 5H9EK 3CWJA 2ADBA 1YJUA 3EZ5A 3NOCA 4LFAJ 3I38A 2BRKA 3OBIA 2UUCF 5GMDA 1R8PA 1UZDA 2ZJPQ 1B99A 4NWBA 4CTAB 1FKAF 1C1BB 2MKSA 1HMVB 1HARA 4B3OA 4EBEA 1SC1B 1UAWA 4J9QA 2KVQE 3KHHA 1IKYA 4C8ZA 3E2EA 4NXNJ 5K8NA 1VI7A 3PX0A 1DLOB 3SSQA 3N79A 4LIRA 2PMZD 4ED2A 3O3LA 4I2PB 2IDEA 1F5CA 3TEHB 4X4QA 3CCVS 1Q1KA 2DIVA 4A46A 2BKPA 3ENAA 4WCEQ 4DG1A 2VQFJ 1X4CA 3O44A 4O23A 5HMXA 1NCLA 1FEEA 1WHXA 2QLWA 3TZYA 1IBKF 3CULA 3QYYA 1S1UA 2DNQA 3DLEA 3G86A 2QLBB 4MKVA 3ICLA 1PGZA 1JLBA 4X4VA 2HGLA 2CVEA 3MDFA 2VPXB 4P72A 2KRRA 2BM1A 3W5YA 3POTA 1B70B 1JLCA 1VQLS 1NSAA 1YX2A 1IM6A 2C2OB 2BW7A 2B6AB 4MK9A 2HWTA 4DR5J 3OUYA 1HWKA 3M2UB 2ALZA 4I7FA 1TVRB 4KE5A 2ROPA 1GX5A 1RE1B 3G6YA 4JYAJ 1VC5A 4ZPVR 3LP1A 3D2WA 5SUHA 2YH1A 3K5NA 2NCKL 3D0HE 4MK8A 3NP5A 4O3QA 2C2RA 3I56S 4DI6A 4WJBA 1RT2B 3BJYA 4AXIA 1VK8A 3NY0A 1GTEA 2CADA 2NPIA 1FVQA 1Q81T 1GXTA 3AT1B 2XMKA 3CCMS 1X7VA 3JSBA 1Y9OA 2UVRA 6FD1A 4M1KA 4WP9A 2XSJB 4O4GB 5E41A 2P2CB 1T05A 2OPPB 2E5HA 5AXNA 2GCFA 4UF4A 4UUXA 4CLWA 4BLGA 4AUKA 1E6VB 3SSRA 3VWSA 5LJ3Y 1CC7A 1RWOB 1KFSA 2C3MA 3VGSA 1JJHA 2JVRA 2KHCA 1ZAWA 1PC5A 4KC5A 5C25A 2J6SA 1RJJA 1VGYA 3DOMA 1AFJA 2DNMA 2JX2A 4EI2A 2V6AA 2F8EX 2MLYA 1C0UB 2EBEA 3LAMA 3IWXA 2PN6A 1NPPA 2LDYA 1T7PA 2BVZA 4ZIVA 5KFSA 4V1Ak 4JI2F 5JMNA 3ZZ0A 4DX5A 2NUUG 1SBRA 2X51A 4ILMA 1XN9A 1ZA1B 5HMZA 1WHWA 3W61A 2WVFA 1J5OA 1KTQA 2CPXA 2BA9A 4YHHJ 3FKBA 4CM0A 3KOAA 1N5YA 3NXZA 1N5SA 1RKIA 2DH9A 3T41A 4C3MA 2CNKB 4JI3F 2EC2A 1PJ5A 1SC4B 1HWIA 5LSOA 2DXDA 4RBUA 4ED7A 2PSZA 3CUNA 4KTQA 2W7OA 4IQMA 1NH8A 1NPKA 2VQEJ 3OTBA 3V6HA 4C8OA 1QJHA 4NLRA 5CXTA 4Q0BA 2E1RA 2X1BA 2YWGA 4RUHA 3BB5A 1SJ4P 4OX9F 2BJEA 2OPSA 1Q8IA 4KGMA 3PO5A 1RT7B 1HQUA 3OSNA 4ES2A 5HBMB 2G9OA 1P1TA 3CPWR 1HNIB 5LMNJ 4RX6A 3UN2A 3C15B 2ZNZA 1IQTA 4K0KJ 2XZTB 3D68A 1U0SA 1HI8A 2QMWA 3KK3A 5KFHA 2LFVA 2GAHC 2COLA 5GADI 3M8ZA 4B9VA 2GX8A 4OZ0A 4KB7A 2V0NA 1A0OB 5E3RA 2APOA 2KXNB 4N77A 4CH7A 3CJQA 4FNIA 2DH8A 3E01B 5IC4B 2W4PA 4Y2AA 3AHPA 1JX4A 1Z2LA 2WAQD 4ED4A 4CCHA 2KU7A 3R5GA 4ECTA 1KOHA 2MYFA 2YWKA 3HFZB 5B08A 3FRYA 1H2TZ 4UOHA 1TL7A 5IQQA 3C6TA 1X9SA 3RBDA 1AA1B 2PA8D 2MMYA 2W2PP 4LSZB 3M7VA 2IYIA 1IUJA 2ALYB 2V2KA 3HM9A 1O6XA 2C3PA 4DXLA 3MEKA 1SUQA 1KRPA 2CQBA 1NAQA 5DGBA 2Q79A 4DQIA 1VBZA 1JLFB 1HWJA 2E1CA 3D6MB 4G3IA 2RHQB 4Y2IA 4L6V3 4USKA 3NL0A 4G1IA 3JYTA 4DSEA 1IBMJ 2Q66A 1SH2A 2VHGA 4C8YA 1W2IA 3LP0A 3P96A 1HNXJ 5C2CA 2HQIA 4KR0B 2YKNB 1JKHA 4Y00A 4QJVA 1QAXA 4JI4F 3ZZPA 2E9TA 5CYJA 3KLIA 1CJKA 3A8JA 3GIJA 3AY0A 3KJFB 4UY85 3R1LA 1DY3A 3PHTA 1S1UB 1VRQC 4RW4A 1HQ2A 5D6GA 5BYRA 3MZIA 1F2GA 5I42A 4KRWA 3NS7B 4YQWA 3IS9B 3M32B 3A8EA 1HBOA 2PI5A 4U8VA 5ETRA 2VJVA 4ID8A 1UTAA 3HFKA 4WE1A 1D9DA 3AD8C 4HDHA 1KWMA 3TJAA 1JLCB 5BR8F 2FTRA 3EGVA 1WC0A 2XSFA 1XAOA 3NNHA 3WIUA 2DEJA 1TMJA 2UZAA 3A12A 3H8YA 4N76A 2WW4A 1W7WA 2KN4A 1FX4A 3GR0A 1TKXB 4LQ3A 3EUNA 2YNGB 3OLBA 2HRUA 4M5NA 2V67A 3V81B 2IJNA 3KLGB 2JLEA 4PZVA 4KH0B 2IVYA 2UUTA 4A8XA 2QFJA 2W7AA 1S1VA 1VK3A 1M5OC 4NLGA 4KFBA 1I3OB 4MAKA 1VLOA 2R7XA 2RKIA 1NEEA 2UU9F 1RHMB 1UVMA 4WF9Q 1U1KA 1OJ4A 4XAKA 1ZA2B 1V5VA 3TQ1A 3HFVA 2AGQA 2Y1LB 5KFYA 3CCWA 1JB0C 2OD4A 1SVDA 2RE1A 3BR8A 1R6VA 2FIUA 2LCWA 2KTQA 4KHRA 2MTLA 1QDUB 1RYSA 5AE2A 3QRPA 5KFKA 4FXVA 1G6BA 3T1HF 4B17A 3HXMA 2ZNYA 3IXQA 4FVMA 5HLFB 4J9NA 1OY9A 3CNQP 2DVIA 3TYTA 1S1XB 1YJVA 2GHWA 5D4PA 1VQ8S 2DIUA 4OV1A 1PYTA 1S49A 4IO9Q 4WFNQ 1SV5A 1QAIA 2AYGA 3DU5A 4DS4A 1XR7A 4I69A 3Q86A 3GCXP 1ZPWX 1R0CB 3GMGA 3TNVA 4Y0FA 4J37A 4USTA 4J9RA 5DLFA 4DOZA 4FS1A 4Y2CA 3MUTP 3G82A 2GNKA 5F3TA 3CD6S 2PD1A 1RT1A 2JRRA 5AJ3J 3ZZTA 1VRUA 2VBYA 3BSCA 4KSEB 4WK1A 5D0EA 3IMQJ 1RU2A 1WWHA 3CCRS 1ZAXA 3UD5A 5KFPA 1VIXA 2D69A 4ZITA 1SQGA 2A0FB 3D1QA 3R27A 2GQCA 4I2QA 1NK5A 3HVTB 3G8TA 1B7FA 2HHQA 2QYCA 2DHHA 4ECWA 2JFDA 4OJ3A 3RBZA 4N56A 1FDBA 5IOLA 3VAMA 3CJ2A 4GKKJ 2ABYA 2JH3A 2M52A 5A0YA 2SXLA 1UFWA 2F9JA 4AL5A 3B6BA 2GMHA 3PEHA 2R7TA 1R0AA 5F8GA 2W9CA 4Z7CA 2LQ8A 2IRUA 2QEXS 4U6PA 2DGXA 3GTYX 3HHNB 1EARA 2NR0A 1SIZA 1WG1A 4PYAA 2IRXA 4X66F 1V6HA 3W2VA 1FT8A 2GC8A 2HHSA 2ZH1A 3JQJA 3K5PA 4NPOA 3QSIA 3TJ8A 3T6JA 2Q2GA 5DDQC 1WG5A 1YJRA 1VQYA 3KDOA 4B02A 2EFNA 4JI6J 4G1QB 1S6PA 2B9WA 1SKWA 4HI2A 2DNHA 4FF3A 1OQ3A 2BMBA 4M94A 4ZPDA 1RTJA 3I82A 1XMOJ 2UXDJ 2MHNA 3ZNJ1 4UQGA 4Q5VA 4S0MA 4K4ZA 5IWAJ 3AXMA 1H6KX 2CPJA 4XPEA 4I0WA 1CLFA 3ZTRA 2ZWPA 4RU2A 4ZK7M 4B9MA 5CABA 2ZHAA 4CLLA 4Q8FA 3PKMA 1M0SA 2MZSA 1J5EF 2CZ9A 3GFXA 4WK3A 4ZPBA 3C2PA 3M8QA 1GX6A 4DL0C 2W2NP 2MEWA 3B82A 1PILA 2ZOFA
chains in the Genus database with same CATH topology
1EARA 3L9ZA 3AGYA 1EB0A 3I38A 1C3GA 1GMWD 2B26A 3LZ8A 1NLTA 3TJAA 4J80A 3TJ8A 3LA0A 2Q2GA 4L3KA 1GMUA 3AGXA 1GMWA 3TJ9A 3AGZA 3NXZA 2HFVA 1XAOA 3NY0A 1GMVA 2QLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAR A;  3L9Z A;  3AGY A;  1EB0 A;  3I38 A;  1C3G A;  1GMW D;  2B26 A;  3LZ8 A;  1NLT A;  3TJA A;  4J80 A;  3TJ8 A;  3LA0 A;  2Q2G A;  4L3K A;  1GMU A;  3AGX A;  1GMW A;  3TJ9 A;  3AGZ A;  3NXZ A;  2HFV A;  1XAO A;  3NY0 A;  1GMV A;  2QLD A; 
#chains in the Genus database with same CATH topology
 1YSJ A;  3KLF A;  1EHW A;  2GS8 A;  1LWX A;  3TZW A;  3H2U B;  1TK0 A;  5FD1 A;  1TL7 B;  3C6T B;  2ZZM A;  1JLE B;  3QQC D;  2X3G A;  4X4P A;  3GJR B;  2G4B A;  3AOD A;  3R2D J;  3GFY A;  2QZ8 A;  1DRZ A;  2Y0B B;  3P45 B;  3EX7 B;  3RTV A;  1DUR A;  4DR3 J;  3DLG B;  2RIJ A;  1UW4 A;  5J2M B;  4BDP A;  9ATC B;  2YPZ A;  1R7I A;  2AWZ A;  3J7Y U;  2N7C A;  2HFO A;  1IKX B;  5BYQ A;  1TMM A;  2E7X A;  2KYZ A;  1HBM A;  3HZE A;  2VKZ G;  4LF4 J;  2M3D A;  3KLH B;  1FCA A;  2H4Y B;  4JI1 J;  2XY7 A;  3D4J A;  2RUG A;  1HNZ J;  2VFT A;  3KMQ A;  1HPZ A;  2CJB A;  2V5H G;  1U2R A;  5ETN A;  4DFM A;  5F8N A;  4OHY A;  3UQS A;  1RTD A;  3ITH A;  1RWN B;  5KT6 A;  4AQY F;  4IFY A;  2QRR A;  4OI6 A;  4KHM A;  2ZH9 A;  1CJT A;  2FY8 A;  4TN2 A;  3NGR A;  2LP4 A;  3MEC B;  1O5J A;  2J9C A;  1AUD A;  2NYI A;  3I5C A;  3N6M A;  3BGR B;  4HI1 A;  1REG X;  2L9D A;  1RTZ A;  4NXN F;  1L3V A;  2V9W A;  2Z0G A;  1ZZN A;  4L76 A;  1H72 C;  2LEA A;  3G6E S;  1MML A;  1QUP A;  4LMZ A;  1FKP A;  5M2U A;  1GEH A;  2V34 A;  3BKF A;  3GII A;  4QPT A;  3NCR A;  4LRC A;  4ZVP B;  3M8P A;  4OIX A;  2OH2 A;  1SQE A;  1RI7 A;  4ZPT R;  3H5X A;  2E7V A;  3OR2 A;  4C4W A;  2KM8 B;  2CWK A;  2IM2 A;  1FDD A;  3RB3 A;  2EC0 A;  4PUO A;  3TA2 A;  4FN5 A;  2F4F A;  3K7R A;  5U47 A;  1YRX A;  3DRP B;  2HQF A;  4ZOS A;  3UDV A;  5LSL A;  2UUB J;  3OTO F;  1NK7 A;  2HK2 A;  4KQZ A;  4GVL A;  3PVX A;  1N4L A;  4LF6 J;  4NLS A;  1IWG A;  2FHO B;  4NA3 A;  2IVM A;  3G6V A;  2VB6 A;  3IR7 B;  2W25 A;  4KFB B;  2MQM A;  4N8O A;  1WNE A;  3CCZ A;  1FJE B;  5F8J A;  2A3J A;  5KG4 A;  1RHU B;  1S6Q B;  3UD4 P;  2V8G A;  2I6W A;  3RAM A;  2Z8Q A;  3PXG a;  5J2Q A;  4X4U A;  3AD9 C;  1HHQ A;  1HBN A;  1BXN A;  3ET6 B;  3D0I E;  3TOQ A;  2C3Y A;  3KDN A;  3MMC B;  3OW2 R;  2YNF A;  1H7W A;  1KNZ A;  4DV3 F;  2YNH B;  1CJV B;  3IA0 A;  1FTC A;  5LJ5 Y;  1OSC A;  3GIM A;  3ZZO A;  2E29 A;  1T03 A;  4DU7 A;  3H25 A;  2FLL A;  2B43 A;  2J9D A;  3IAS 9;  4WFX A;  1XR6 A;  1DTT A;  4F2S A;  4DPW A;  4J7C A;  1KC8 T;  2XY6 A;  1S48 A;  4OZN A;  3FEX B;  3HVW A;  3R97 A;  1H38 A;  3GJS B;  2JVO A;  5F3Z A;  2X1A A;  4P2F A;  4EZ6 A;  2LU2 A;  2YPY A;  1WHV A;  3F56 A;  4NLW A;  4UOG A;  3EWG A;  2AZ3 A;  3N6N A;  3BGO P;  5A8W A;  3G82 B;  1VJW A;  5F0U A;  1RT1 B;  3HKW A;  4DR6 J;  1FFG B;  4DF8 A;  1WTF A;  2QO3 A;  2L9W A;  3NMR A;  1LEO A;  1MLA A;  1RQ0 A;  2N82 B;  2J9D E;  1ITP A;  2U1A A;  5LL6 d;  2OSR A;  1CJU B;  4OI4 A;  2J6U A;  2WOM A;  1AFI A;  3SMZ A;  1ACM B;  5RUB A;  2P8I A;  3KWM A;  4JOU A;  3Q8R B;  2R42 A;  3H20 A;  4I2Q B;  2CQI A;  2ZH3 A;  4OYI A;  1VC6 A;  2MGZ A;  2NSC A;  4PPZ A;  1U1L A;  2DNY A;  2VDI A;  1EP4 A;  3N9U C;  4U95 A;  2OEL A;  2R2R A;  2ROG A;  1C1C A;  3D7S B;  4DL5 A;  2GHP A;  1FWL A;  2Z56 B;  4FBU A;  2V9K A;  2RRB A;  4P9S A;  3AJ1 A;  3HHL D;  5D78 A;  4YHH F;  2KDO A;  1SC6 A;  2K1R B;  4HDG A;  3W2V B;  2L48 A;  2HNZ B;  1A9N B;  3FQL A;  1N34 J;  2QG9 B;  3BO3 A;  3UE2 A;  1S6P B;  3PEJ A;  4P7T A;  4DUZ J;  2RS8 A;  1ELO A;  3IO1 A;  2CZ4 A;  2OPR B;  3IBW A;  1WKJ A;  3J7Z T;  2DY9 A;  2VG6 A;  1EQ0 A;  4DV1 F;  4KIA A;  2XO6 A;  3C16 A;  2VQE F;  1X4G A;  1TV6 B;  3BN4 A;  1KS2 A;  1HA1 A;  3IGN A;  2OP5 A;  3M2R A;  1JXV A;  3I87 A;  1FJC A;  3DI6 B;  2VL1 A;  3EZO A;  4LSN B;  1K0V A;  3FCW A;  2I9S A;  3MMJ A;  2CQP A;  5ETO A;  4USM A;  2DT9 A;  2KVI A;  5C24 A;  4IH6 A;  2DNZ A;  2XNQ A;  1EQM A;  4CLK A;  3WDO A;  3PW0 A;  4ZVR B;  2YKA A;  4ZVU B;  2AF6 A;  3J81 U;  3DM2 A;  2KH9 A;  3L4B C;  2IHR 1;  1RAI B;  1WDT A;  3J80 Y;  4K0K F;  4ZJO A;  3Q8Y A;  5JVG Q;  1RT3 B;  2C2K B;  2K8G A;  4J9K A;  3ILJ A;  3LZ8 A;  2WTF A;  3MI7 X;  3N01 A;  5IC6 B;  2WSC C;  4OYO A;  1N33 J;  4DV2 J;  4IFV B;  1IM4 A;  2C2M B;  2ZHO A;  3D1O A;  1UFK A;  2N3L A;  2LXI A;  4OZ1 A;  3IRX B;  5KG3 A;  4L73 A;  3SQG B;  1VQN S;  1LK7 A;  3DYA A;  4IG3 A;  4ECV A;  3R6L B;  4DR7 J;  2JVM A;  1XR5 A;  3CW2 C;  3M9M B;  2GQQ A;  1A7G E;  1FTR A;  1XTZ A;  1ARO P;  3PO4 A;  3L9Z A;  1VBK A;  4O3P A;  2VPY B;  1U1N A;  3DKD A;  2EFO A;  1SIW B;  2VON A;  2WVB A;  2D3O R;  1S7H A;  3JQM A;  1VLY A;  2OMO A;  2MZR A;  2Z58 B;  5HRO B;  4TLQ A;  2BE2 B;  2FYX A;  2BAN B;  4ZN3 A;  4B3S F;  2R2U A;  1ZTT A;  4A48 A;  4ZVS B;  2JEF A;  3NGU A;  1RTD B;  3PTW A;  4IFY B;  5DDR C;  2HHH J;  1WKL A;  2VC0 A;  3J81 Y;  2DGO A;  1TKT B;  2BOA A;  1JJ4 A;  4ECY A;  1LXJ A;  1SC3 B;  4OMF G;  2ZH6 A;  1LWE A;  1WHY A;  4FYD A;  3OXL A;  1V3Z A;  4ANC A;  4IUF A;  1U6B A;  4OX6 A;  1X31 C;  2I2Y A;  3FSY A;  4J9O A;  4F02 A;  1VQO S;  2QMX A;  2AP6 A;  1YRU A;  4LF9 J;  3GPA A;  5B0G A;  3AXK A;  1X5P A;  1U0H A;  2FC9 A;  3CC7 S;  2VV5 A;  1XJW B;  1Y0H A;  2AIR B;  5KFC A;  1FKP B;  1S99 A;  3OHA A;  3MM5 A;  3HI9 A;  4DF4 A;  5DDO C;  1HNX F;  2VG7 A;  2AYE A;  2KM8 C;  5KFQ A;  2J0W A;  3H4B A;  2BJ7 A;  2UXC J;  1BQX A;  3Q23 A;  1UCN A;  1S9E A;  1G3O A;  4GKJ J;  1QY7 A;  1CPZ A;  1PYS B;  3ELH A;  4R5P B;  1X9W A;  1GMW D;  3DOK A;  2CQ4 A;  4OYP A;  3VHQ A;  3IGV A;  3J7Z 5;  2UVW A;  2PDA A;  4H4O A;  1SL2 A;  2GVD B;  3CJ8 A;  4QR1 A;  3N6L A;  4NXM F;  2KHD A;  2A6M A;  1HNW J;  1LKZ A;  3CT9 A;  5KFF A;  1TQL A;  3W62 A;  3G8S A;  2B4U A;  1ZM3 A;  2R7Q A;  4PXD A;  1HBN B;  2WVC A;  4OYZ A;  1APS A;  3SZ2 A;  1CC8 A;  2Q6C A;  3RAX A;  3BYP A;  3QO9 A;  4LRF A;  2HFU A;  2HVD A;  3KXD A;  4LQ9 A;  2CJY B;  3CED A;  4IDK A;  4RKU C;  4LR9 A;  5IM0 A;  1W25 A;  1KON A;  4H54 A;  5KFW A;  3PFO A;  1ZH5 A;  2AJ0 A;  2GVZ B;  4JV2 A;  2I5J B;  1TK5 A;  4QWC A;  3MCS A;  1GXL A;  3U1N A;  1SH3 A;  1LV5 A;  3M30 A;  2W8L A;  3H40 A;  4F04 B;  2ZD1 B;  3T1A A;  1MWQ A;  3L09 A;  1SJ3 P;  5CD4 H;  2EK6 A;  1X4A A;  2JSX A;  2PEB A;  5HSP A;  1JJC B;  1Q95 G;  1Q7Y T;  3NBP A;  2K7K A;  3OL7 A;  1FK9 B;  5A8W B;  1T9V A;  3EDQ B;  1KHV A;  3QID A;  1RA6 A;  1WEL A;  4P6Q A;  4CT9 A;  4DV4 J;  1NH7 A;  3JS9 A;  5G0R A;  1B3T A;  2E5L F;  3DGP B;  3H90 A;  1IKV A;  3CIZ A;  4PXB A;  3HD1 A;  1WI8 A;  3MMA A;  2KO1 A;  3TQE A;  3M6V A;  1FER A;  4IG0 B;  4M5D A;  3V6D A;  4ITS A;  5KFZ A;  4DL7 A;  3MM8 B;  3MMB B;  5HK4 A;  3KJV A;  4DV6 J;  4GVB A;  2J8S A;  3EPI A;  2PEH A;  1I94 F;  2WVE A;  4ZCI A;  3MFH A;  1ICE B;  4RW7 A;  4U67 Q;  2OPQ A;  4QWA A;  2R8I A;  3DRR A;  4OI0 A;  5L1I A;  2QLX A;  3M1V A;  4DPX A;  3OPK A;  2BQ3 A;  5CYM A;  1AYE A;  1NO8 A;  1EX8 A;  3CGI A;  4QR2 A;  3BH7 B;  3M6U A;  3AGX A;  2ZH4 A;  1Y10 A;  2R7O A;  1JLQ B;  4BBY A;  2PI4 A;  3AGY A;  3GQC A;  3MR7 A;  2ZBC A;  1KQS R;  3R7N B;  2H5E A;  2JFK A;  1T0T V;  4OZL A;  5HVH A;  2CZV C;  2PFD A;  4CWB A;  2D9P A;  2IC3 A;  4PEO A;  4RWX A;  3PNI A;  4O3N A;  4QW9 A;  2K06 A;  2CPH A;  4OZ2 A;  5ETQ A;  3C5X C;  3F0N A;  3MPW A;  3NWG A;  2VG6 B;  3WIV A;  2XNR A;  4B9T A;  3C16 B;  3UDC A;  5JUM A;  5HAT A;  2JDJ A;  1Q4R A;  2V8P A;  2W7P A;  1GQE A;  5K8M A;  3T5K A;  1IBL J;  3I0R B;  4WKY A;  3VCD A;  2XS7 A;  4ZPW R;  3M2V A;  5L39 A;  2AJF E;  3PYF A;  3PM9 A;  3DRS B;  4M5K A;  2AEM A;  3MFI A;  2C2D A;  2VKR A;  1T02 A;  3BEG B;  4WP8 A;  1RCX B;  2MJU A;  5CYQ B;  1I51 B;  2R8J A;  4USW A;  3CD7 A;  3W64 A;  1XMO F;  4ID5 B;  4DV5 F;  1PBA A;  2UXD F;  5J2N A;  2M2B A;  4B9L A;  4FF1 A;  1VR6 A;  8AT1 B;  1KD1 T;  5IWA F;  2HIQ A;  4NA1 A;  5HMY A;  3PKY A;  2X1F A;  1M5P C;  2NXN A;  3MCM A;  4LFC J;  1J2V A;  4B3T F;  4F36 A;  5H9F J;  3QJP A;  3QLH B;  2VAS A;  5C7P A;  2YKM A;  4ZHR A;  3P5B P;  5AXM A;  3LPE A;  2KZM A;  3BR9 A;  5DG8 A;  4PQA A;  1Q8K A;  3CCE S;  4NRT A;  5KOX A;  4YP3 A;  5E3Q A;  3EVW A;  2RQM A;  3VQT A;  4ZLL A;  3L7P A;  1A6L A;  1G1X A;  1B0T A;  3D6H B;  5J1N A;  2ZWO A;  1RT6 A;  2BKN A;  3CJS A;  2VPW B;  4ZP9 A;  2LDI A;  2F3J A;  2JC0 A;  4ECS A;  3T9Z A;  3NOG A;  1E6Y B;  4H4M B;  2UV8 A;  1UWB B;  1LW2 B;  3VGV A;  1RWW B;  2QA4 G;  2FLN A;  4DV0 F;  1GH8 A;  2ACM A;  2B51 A;  2NXE A;  5BYS A;  2RT3 A;  5DG9 A;  4Q7A A;  3GB0 A;  5GAE I;  2KJV A;  2W8K A;  1XMQ F;  3SCK E;  1LWE B;  3LAN A;  2GFF A;  3TUP A;  4FKY A;  3DC2 A;  2QLF B;  1MW7 A;  1U26 A;  3VTI A;  5I3Q A;  2VDH A;  1NJZ A;  4NZ7 A;  3MXH P;  1HW9 A;  2ZUG A;  1FNM A;  4LF4 F;  4JI1 F;  1ZZF A;  2EG2 A;  4NML A;  3KHR A;  3FZ2 A;  1TFW A;  2J0X A;  2CPF A;  3TUI C;  2HQC A;  4ZCL A;  3UD3 P;  1IR2 A;  3JB9 k;  1IKW A;  2QSW A;  2EEY A;  2VG7 B;  3ISN D;  1NJW A;  5FDL A;  2OD6 A;  2CQG A;  5F8M A;  2AU0 A;  2W9A A;  3I4H X;  2J7U A;  3LGH A;  2HND B;  4PYD A;  2IA0 A;  3D66 A;  3CCJ S;  1U1M A;  1Q16 B;  3GSD A;  4C98 A;  4BCA A;  2RIL A;  2MKC A;  2A6O A;  2C28 A;  1K9M T;  2M8D B;  3DOK B;  3GJT B;  1TKD A;  4CO0 A;  4NYZ A;  4YDD B;  4FXD A;  2PGC A;  1I5O B;  4KKO B;  4E2F B;  3QMQ A;  2CPI A;  1N0V C;  1JQG A;  2J6T A;  1WJ9 A;  3BN7 A;  4Z37 A;  5SZT A;  4RUC A;  1FRK A;  2OTJ S;  3FQK A;  4LBI A;  4FDF A;  3T6B A;  3FCV A;  3UCZ P;  4FNH A;  3W5Z A;  4QR0 A;  2J76 E;  1WEZ A;  2DNO A;  1NPR A;  1H73 A;  3X3U A;  4NLV A;  4JI8 J;  1K1Q A;  3QGG A;  2QA1 A;  4NLP A;  4RL1 A;  1T9T A;  1TL4 A;  4R25 A;  4IDK B;  4CYU A;  2UUB F;  2HVI A;  1TL1 B;  3EXY A;  3MM6 A;  4LF6 F;  4YS2 A;  2XCP A;  1RT4 B;  5ETT A;  1YZ6 A;  4EYH B;  1FX2 A;  3M30 B;  2G2Z A;  3MAH A;  4HEA 9;  2GGP A;  3NAH A;  2JLF A;  4DMZ A;  3KLE A;  4LF7 F;  4ZVH A;  2WBM A;  3EGW B;  1VIS A;  4KHP J;  2M9K A;  1BD6 A;  1PG5 B;  4CO2 A;  2ZZN A;  1UVI A;  2VH7 A;  2RU9 A;  2RJZ A;  4QIE A;  3AH6 A;  2LYV A;  4NYP A;  2AX0 A;  1IXK A;  3QWU A;  3SYZ A;  4WZM A;  1X60 A;  2FGC A;  5B7W A;  4QIW D;  3OV7 A;  4C6A A;  1HMV A;  2LLZ A;  2FDN A;  1P9Y A;  2GHV C;  4NEY A;  1JLA B;  1LQ9 A;  4X65 J;  1KOO A;  1QLN A;  3MMA B;  4WYL A;  4V19 X;  1NB2 A;  2XBP A;  1F0X A;  3EXC X;  4IOC Q;  3MM7 B;  5DZ6 A;  4P74 A;  1DLO A;  1Y3J A;  4OYA A;  5AE3 A;  4LF1 A;  2C22 A;  1VQM S;  3OSP A;  4PXC A;  4I2P A;  4PWD B;  4DZ6 A;  1T95 A;  6FDR A;  4WFA Q;  4K4V A;  3K58 A;  4MIB A;  1RT5 B;  3QT5 A;  4HVZ A;  1URR A;  1F9E B;  4GO5 X;  4DR6 F;  2NXJ A;  2XMW A;  4JI0 F;  2RRA A;  2IY5 B;  2OO4 A;  1EJ7 L;  3G9C A;  2WSF C;  1UL3 A;  4DPO A;  2PA3 A;  2ILY A;  1H74 A;  4X4T A;  3B54 A;  1KFD A;  3QZ8 A;  2DNL A;  3VZH A;  1NHU A;  2XGP A;  2FLO A;  5E5N A;  1S9F A;  1XNQ F;  2QE5 A;  1V9O A;  1VRT A;  1H0H B;  2YWW A;  4DUY F;  4OYM A;  3W9I A;  5H9F K;  1T3O A;  4YN3 B;  2B6A A;  2XYH B;  1B0V A;  2QA2 A;  3VAH A;  4DQR A;  1RLC L;  2DIS A;  1IN0 A;  1TVR A;  2HFS A;  3HF5 A;  2YNI B;  4OI1 A;  3Q8S B;  3HX9 A;  4CRJ A;  4J9L A;  3ZTO A;  4EYI B;  4A8S A;  4B3R F;  3DLK A;  1N34 F;  1OY8 A;  1AUS L;  4DUZ F;  1RXO B;  2M0G B;  5KFN A;  1EET A;  1MU2 B;  4KGK A;  2AJ1 A;  1RT2 A;  3SFU A;  2E66 A;  1HR0 F;  3Q0A A;  2BJD A;  4NI2 B;  2JJ4 D;  2VPZ B;  4MKA A;  2MKH A;  2RSQ A;  2U2F A;  4C48 A;  4ZP6 A;  4OHW A;  4A8Y A;  1PCA A;  3BV8 A;  4RBV A;  1X4F A;  1K73 T;  1HKA A;  3QT6 A;  4CLT A;  3HCX A;  4MYT A;  2XG8 A;  4JI5 J;  2XSJ A;  5KFL A;  4FYX B;  4I1T A;  2OPP A;  4URQ U;  3DNC A;  2LEB A;  3BPD A;  3J7A N;  3D0G E;  3CJ5 A;  3MCN A;  3N28 A;  1E6V A;  2ZUA A;  5EHH A;  5JXS A;  1R8B A;  4G65 A;  3MUV P;  3CC4 S;  1TP7 A;  3I31 A;  2E5I A;  1XMB A;  2A1B A;  3KHL A;  4O44 A;  4NLO A;  5EWE A;  4WP3 A;  1U2F A;  3BBB A;  1C0U A;  3TEG A;  4TLR A;  2HHV A;  1VQS A;  1MSW D;  5IXU A;  4YR2 A;  1Y4Z B;  1CEZ A;  5KFX A;  5KFD A;  3G6X A;  5DQH A;  3N0V A;  4HLB A;  2QL7 B;  3WC2 A;  1FJ7 A;  3QIP B;  4ETX A;  1HD0 A;  4DR7 F;  3OTC A;  2J0S D;  1F2H A;  4PG7 A;  2H48 B;  5KG5 A;  2H9Z A;  3PFE A;  1N5Q A;  2ZKT A;  2MKY A;  1SCJ B;  2IJR A;  3MR3 A;  4C8L A;  3THT A;  2V4J B;  2DR7 A;  4Y6I A;  3GLJ A;  4F4K A;  2HGM A;  3D54 A;  3OFE A;  3RYL A;  2XLI A;  5DJB A;  3E8O A;  1IKW B;  4EMD A;  5GMK a;  3MHY A;  2HZV A;  1BMQ B;  4DV7 J;  1V3S A;  2LXU A;  2HEK A;  3ENQ A;  1YVF A;  4DPU A;  1QSY A;  3UN5 A;  1AZS B;  2XWY A;  2ZKU A;  2W1B A;  4NCA A;  5HQM A;  2ZDP A;  4F0M A;  3BQ2 A;  1WC5 A;  3EYZ A;  1GT8 A;  1WAC A;  1RT7 A;  3M8S A;  2L41 A;  2X1G A;  1U25 A;  5AT1 B;  4I68 A;  5HBM A;  1HNV B;  4LF9 F;  5B09 A;  3W66 A;  5KAK A;  1HNI A;  2B9Y A;  3C15 A;  2F9D A;  3CCU S;  2LXF A;  2AYM A;  4LR8 A;  3OL8 A;  1N5V A;  1U24 A;  3QAT A;  1QVG R;  2UXC F;  1OY6 A;  4FS2 A;  2V4Q A;  3I0S B;  1IQZ A;  3B8H A;  4JV0 A;  1U8W A;  2QLD A;  4K5S A;  4TU7 A;  3SSS A;  3T5J A;  3QSY B;  2D7S A;  5I3U B;  4J9S A;  1HBU B;  1FJG J;  4BC9 A;  3IN5 A;  4KPY A;  3MM6 B;  1TEL A;  1SKS A;  4DSL A;  1N32 F;  3E01 A;  2QN6 B;  1KQK A;  2B7B B;  3SI8 A;  5ETL A;  2CQH A;  2DH7 A;  4OV6 A;  3TO8 A;  2Z2Y B;  3M9O B;  3KLE B;  2R2S A;  2M88 A;  3GU0 A;  1GXU A;  2DGQ A;  4XK8 C;  1PC4 A;  3NMA A;  1ZTW A;  3K89 A;  2G0J A;  3FRZ A;  3I9Z A;  1L3K A;  1S5Z A;  3AGZ A;  2BQR A;  3AA9 A;  4LRE A;  4TY9 A;  4YY3 F;  2V94 A;  4FPR A;  2WON B;  3RBX A;  3CDE A;  2N7Y A;  3ILI A;  1RGV A;  3PYD A;  1OYD A;  1JLF A;  1GMU A;  3DOL B;  4MIA A;  3QRR A;  1LWF B;  1VYA A;  2B3T B;  1VQP S;  1F5A A;  1U02 A;  1KR4 A;  2Y3Y A;  4C8K A;  4QIG A;  1JLG B;  1AW0 A;  3R7S B;  3MTK A;  3GG1 A;  3L7O A;  1S79 A;  2WRM A;  1VDH A;  3KNG A;  2YKN A;  4MH8 A;  1N0U A;  4F3Q A;  2YX4 A;  3W63 A;  3NGK A;  1NK6 A;  3U1M A;  4DV4 F;  1RAC B;  2B4O A;  3MD3 A;  2MQL A;  2CRL A;  1G7C B;  2DY1 A;  2ASL A;  2LA4 A;  4RW6 B;  2R7S A;  2DR5 A;  4ELT A;  2F65 A;  2J7K A;  4QU6 A;  2E44 A;  4ZPC A;  4Q43 A;  1FWK A;  2B4P A;  3IS9 A;  3M32 A;  1Q5Y A;  4IH7 A;  4DV6 F;  4L74 A;  2DNR A;  1IBK J;  1VRT B;  5KFU A;  3W8G A;  1C0T B;  4TNO A;  1OPI A;  4DHV A;  5DDP C;  2NS1 B;  5HVF A;  4EEY A;  4LFB J;  3FBC A;  1B0P A;  4A8F A;  4LBP A;  2ZC4 A;  1TKX A;  1S77 D;  4O3R A;  2XHW A;  2D74 B;  2YNG A;  4I64 A;  1MRO B;  2V2Z A;  1KSP A;  4WFB Q;  3PJ9 A;  4ZVF A;  3V81 A;  3KLG A;  4XO0 A;  2RDI A;  4R8U B;  3FSX A;  3JTP A;  5T7L B;  2BQU A;  3BO4 A;  2RDJ A;  3DLK B;  3CD0 A;  4DJB A;  4X4N A;  4OHX A;  5H1S V;  4TY8 B;  1EET B;  1CS4 B;  1NDL A;  4DL3 A;  1RTH A;  2L08 A;  2OAU A;  2D3O 1;  1TZ0 A;  2QT7 A;  1M1G A;  3H2V E;  3EZU A;  5IT9 U;  4D3H A;  3VAK A;  1ZM2 A;  3T9N A;  1O51 A;  1X5S A;  2E5J A;  2FB0 A;  3MGJ A;  4HT5 A;  4C8N A;  3RBE A;  1QAJ A;  3GSI A;  4LF5 F;  3RB4 A;  4M95 A;  3GZ7 A;  3OR1 B;  4Z2X A;  1V5I B;  2QSF A;  3HJF A;  5HLF A;  1NK8 A;  3NNC A;  2HSE B;  1S1X A;  3W5X A;  3BS9 A;  3GP9 A;  1MN9 A;  4H4K C;  1WG4 A;  5KT7 A;  3GR1 A;  3RW7 A;  4O44 B;  4ES3 A;  1NKC A;  3GV5 B;  2JZ8 A;  2HUR A;  3TX0 A;  1D3W A;  4ZN1 A;  3BSA A;  1DQA A;  4E0D A;  1RIS A;  2V8H A;  2ZJQ Q;  3IFE A;  1PKU A;  2BKO A;  2Y1I A;  2DRB A;  2Q3P A;  3CME S;  1B4S A;  4NLY A;  4L75 A;  2NUH A;  3TAN A;  1RLD A;  2B7C B;  2IM3 A;  1YJ9 S;  4OZJ A;  4DSJ A;  2XYG B;  4PQU B;  3P6Y C;  1J27 A;  5IZH A;  3QT7 A;  4FVC A;  5IT9 Y;  1U1P A;  1F1B B;  4ZKA A;  1YDL A;  2RF2 B;  3L3C A;  3UW1 A;  4IOB A;  1MG7 A;  3CSK A;  1VC0 A;  4QBU A;  3HVT A;  4QZV B;  2UXB F;  3CJK B;  3RRK A;  2KG1 A;  1R8C A;  2FJB B;  5CZX A;  1R6Y A;  4PCQ A;  1BE4 A;  1FHT A;  1H2U X;  3MWB A;  3QRQ A;  2OHD A;  3TAM B;  3CJ3 A;  4USI A;  1U47 A;  3PRD A;  1M5K C;  3CJ4 A;  1BHN A;  3OL9 A;  3IRW P;  2HAF A;  2I0X A;  3CMQ A;  4NCG B;  3CCS S;  4RNN A;  2OEJ A;  2IBO A;  1WC6 A;  1OYE A;  1DAX A;  1WSV A;  4QOT A;  4UZC A;  4X4O A;  4G1Q A;  2RB7 A;  3ONQ A;  2R4F A;  2AGP A;  5F8L A;  2MQQ A;  3VF0 B;  4Q2L A;  5HAN A;  4RJV A;  2FJW A;  1UA0 A;  2DPI A;  3OTE A;  2OI2 A;  3AB4 B;  1XER A;  4NZ6 A;  2CQ2 A;  4ED0 A;  4P7V A;  2EFQ A;  1LWC B;  2D1C A;  5B0F A;  3QJL A;  3M8Y A;  2CXE A;  3SCL E;  3DGV A;  3NKY A;  3ZO7 A;  1KQG B;  1EKS A;  2J5A A;  4FP9 A;  1GMW A;  1Q7L B;  3K8W A;  3HJV A;  1T9W A;  2P9C A;  5LM7 E;  3R2C J;  4QWD A;  5EUH A;  4TVA B;  3EE3 A;  5D3G A;  3CDW A;  4ZVO B;  2BAC A;  4L3N A;  3RRH A;  3HZG A;  4X64 F;  1WDD A;  1IWA A;  2HVH A;  2DO0 A;  2ZM6 F;  4O0I A;  1OQ6 A;  2IDL A;  1JLE A;  2EK1 A;  3BDE A;  5F41 A;  3LA0 A;  1TKZ B;  3QGH A;  2J9E A;  4ZLP A;  3S01 A;  3RR8 A;  1F3V A;  2R8G A;  3DLG A;  5J2M A;  1S0M A;  2XLK A;  4F26 A;  4KJI A;  1PO6 A;  1IKX A;  2CA9 A;  1D09 B;  2CG4 A;  4EU0 A;  3D6F B;  1Y3K A;  1S59 A;  2Q43 A;  2YVS A;  1SKU B;  2HVE A;  2W4D A;  2Y1J A;  1GK8 A;  5JVH Q;  3H98 A;  2C2E A;  1BUX A;  4W98 A;  2VU5 A;  3KLH A;  2B0G A;  2RQ4 A;  4LVN P;  2ZH7 A;  4FZV A;  4BC7 A;  3KYL A;  2DD8 S;  2VUG A;  4I67 A;  1RBL A;  5G4D A;  2J7W A;  3P49 B;  2ZC3 A;  1RHK B;  4KHP F;  1FRL A;  4WZQ A;  3UNY A;  1XC9 A;  4DX8 H;  2AEJ A;  5A2Q Y;  2DPJ A;  2W01 A;  3JTO A;  3MPV A;  3MEC A;  3D3C J;  1BQN B;  3C6U B;  1WUU A;  3VAI A;  5EWF A;  1UPM B;  3BGR A;  4X65 F;  1REV B;  2LMI A;  3KG0 A;  3TRG A;  1TUG B;  4MFB A;  3CVK A;  5E3P A;  2EKN A;  4JI4 J;  2JEJ A;  3QGP A;  5GVQ A;  4MKB A;  3R3T A;  1VQ6 S;  5IT0 A;  2IMO A;  2R8K A;  2OEK A;  3H5Y A;  4QPX A;  4RR5 A;  4DR2 J;  2KFZ A;  2ZHB A;  4KAI A;  2MQO A;  4PG4 A;  1FRJ A;  4CO5 A;  2IVF B;  5ETK A;  1JK9 B;  3ZZR A;  4CDI A;  1M1H A;  3VVT A;  1FXD A;  3K5O A;  3TW0 A;  3DRP A;  3R5D A;  3H5U A;  2MSS A;  4XDD A;  2RAQ A;  2X3D A;  5C42 B;  3P8B B;  4NX9 A;  1JMT A;  2G2O A;  2ZZT A;  5FII A;  2FVS A;  4HHJ A;  3HHL B;  5KFI A;  4OFZ A;  1XNR F;  1L3U A;  3MAA B;  3FMW A;  1YI2 S;  2EBG A;  1P27 B;  2P9G A;  1S6Q A;  2R8H A;  2POK A;  4KGX B;  1RTH B;  5BJR A;  3R6G B;  4OYW A;  4USH A;  3C46 A;  1TUV A;  2LKZ A;  2JEG A;  1Z4U A;  2JOQ A;  2ASY A;  1FO1 A;  4E98 A;  3UN3 A;  3ET6 A;  3P5T L;  3MMC A;  3MR6 A;  2Z2M A;  2F7V A;  1VHF A;  2CJ9 A;  1RTI B;  2YNH A;  1CJV A;  3BM7 A;  3AJD A;  1MNE A;  2Y9H A;  4DZD A;  2ZOG A;  3Q8V A;  5IV4 A;  2RS2 A;  1N6Q B;  4DU8 A;  4A8W A;  4NLT A;  5K5M A;  2NZC A;  4F3M A;  2QYG A;  4X84 A;  3DLH A;  2CNL B;  4IR9 A;  2RU3 A;  4DN0 A;  4YOE A;  3MOJ B;  2ZH5 A;  1R8H A;  1LK5 A;  2Z2L A;  3AA8 A;  1HD1 A;  3KJN B;  4M5G A;  4F50 A;  5DS7 A;  2B9E A;  1U48 A;  4HH0 A;  4FPI A;  2DYA A;  2FGO A;  3J7A 1;  4DPY A;  3GG0 A;  3FBF A;  2MHE A;  4Z7Y A;  3D67 A;  4JI5 F;  5KG7 A;  1Y5L B;  3MM9 A;  2MZQ A;  2W2O P;  4KT0 C;  5F8H A;  3ZNU A;  1D1U A;  1QM9 A;  3T1Y F;  4NAS A;  2G0C A;  1RAO A;  4J80 A;  5E33 A;  3V6J A;  2B5J B;  5EX3 A;  1CJU A;  3L95 X;  5HJY A;  2DTJ A;  3JSY A;  1LW0 B;  4K2J A;  4C11 B;  2PII A;  1I1G A;  2RVJ A;  2RH3 A;  2FZK B;  3CDB A;  2ZH8 A;  4KO0 B;  4ZA1 A;  5HQL A;  3FBE A;  3FFI B;  2A2D A;  2B9X A;  2HFV A;  1BGX T;  4DFP A;  4LF8 F;  1S12 A;  2CPZ A;  2BX6 A;  3SFG A;  2H1Y A;  3M8W A;  1SI9 A;  1YJT A;  4PKD B;  2QL5 B;  4ZDN A;  4MJK A;  4G6V B;  4K7Q A;  4W4M A;  3KUE A;  3KLV A;  2V50 A;  3D1H A;  1YJW S;  1UPP A;  2YQ1 A;  3QBC A;  5LSR A;  1S0N A;  2K1R A;  2AJ2 A;  4M5M A;  2GJI A;  2HNZ A;  4RWW A;  1WF2 A;  1FNO A;  4YB1 P;  2HGN A;  5KT3 A;  2OPR A;  1NRK A;  2AKW B;  4X66 J;  4YUD A;  3SCI E;  1RWP B;  3W3S A;  4EO6 A;  1S1T B;  4HR2 A;  3FVY A;  3EGN A;  2MZJ A;  3CCQ S;  2HS0 A;  1TV6 A;  1N88 A;  1WD6 A;  2QLJ B;  3DI6 A;  2R3V A;  3O8W A;  1KN6 A;  2AMC B;  4LSN A;  1WI6 A;  1TAU A;  3HVA A;  3CJT A;  5A76 A;  5D77 A;  4AL7 A;  5E0O A;  2Z57 B;  2DIT A;  1QVF R;  3GCW P;  3FC9 A;  4Q2M A;  4HH1 A;  3NGD A;  4GC7 A;  2UP1 A;  2MLX A;  5BXI A;  5DET A;  1LOU A;  5D3G B;  3R9L A;  3MEE B;  1KTV A;  1VIO A;  2JL9 A;  2VG5 B;  3FMB A;  1FWP A;  2XM3 A;  1RT3 A;  2GML A;  2KKH A;  3U27 A;  3QAE A;  3OJS A;  4IFV A;  4XIU A;  2LQ9 A;  1J5E J;  2LU1 A;  3W2W B;  3MED B;  4LF2 A;  5HQ8 A;  1CVJ A;  4UT4 A;  2W9B B;  1EIY B;  3SDE B;  3IRX A;  3RUB L;  3LAK A;  3U02 A;  3SQG A;  4JUZ A;  2H4W B;  2IPO B;  2GW8 A;  4NL5 A;  3BSO A;  3HPO A;  1W26 A;  4N5S A;  3VVU A;  2BR0 A;  5THW A;  4B08 A;  1VCT A;  1FRH A;  2EFG A;  2CFX A;  3SV3 A;  5D4O A;  4F4X A;  3FBB A;  5K14 B;  4F67 A;  5HRO A;  2BE2 A;  4RW8 B;  2ROE A;  1S4E A;  4F0K A;  5B0C A;  2BAN A;  5GAE U;  1GTH A;  4LFA F;  3OLA A;  4I6A A;  4P73 A;  2LVW A;  3RGI A;  1VHI A;  2DNN A;  5L8R C;  1WOP A;  3PX4 A;  1B7Y B;  1TKT A;  2GO8 A;  4CLU A;  2C3U A;  3FK4 A;  1BC6 A;  4F4Y A;  2RHS B;  3HHD A;  3DRX A;  3GJQ B;  2BJ3 A;  4AQY J;  2F63 A;  4OYX A;  3N5F A;  4F25 A;  4MFB B;  3TA0 A;  4PG8 A;  4F8R A;  5KFA A;  2ZIT A;  4FYW B;  2G0I A;  3H2L A;  1VBY A;  3ZTQ A;  5AXK A;  3AOA A;  2DXE A;  3W8P A;  4J9V A;  1S6U A;  1S97 A;  3JQK A;  3PAC A;  1JNR B;  1YBA A;  1EAY C;  3NGT A;  2VQF F;  1NME B;  1UA1 A;  1T9U A;  3OVB A;  4ED6 A;  4FYV B;  1WF1 A;  1KLM B;  5KTQ A;  2H65 B;  1TL5 A;  4R5P A;  1VFJ A;  1NDP A;  3FZB A;  3HHL C;  9RUB A;  4RO0 A;  4I6Y A;  2JLG A;  4KY3 A;  3UPF A;  1SH0 A;  2GVD A;  1QUV A;  4RNM A;  2EXU A;  4AYB D;  3HT3 A;  5IFM A;  1X0P A;  2HMI A;  3OTO J;  4ICL B;  5ETV A;  2VBW A;  4R0J A;  1KP6 A;  5HP1 B;  2FZC B;  3KKF A;  1S9G A;  4LFB F;  3AQP A;  2DHX A;  1QE1 B;  3G8Q A;  4TQS A;  2OFG X;  4DR5 F;  4WTY A;  4ZPA A;  1M5V C;  4ZJL A;  2FHK A;  3HKZ D;  4NYO A;  4JYA F;  1UVK A;  2IFX A;  5I3P A;  1VQ7 S;  3ETM A;  4M63 A;  5HO4 A;  4Y2K A;  3DXS X;  2L3M A;  3THP A;  3G96 A;  1MWZ A;  2I8E A;  3TZX A;  2GVZ A;  3GV7 B;  1FRX A;  2I5J A;  4DEZ A;  5A8R B;  4WU2 A;  4DV3 J;  1KDN A;  3MEG B;  4NRU A;  3HHE A;  2XHC A;  2ZD1 A;  4YR0 A;  4PXE A;  1DFD A;  2CJX B;  3G2X A;  3LGN A;  3D9B A;  3ILL A;  2NQP A;  2NXU A;  1QTM A;  5KG2 A;  4X4S A;  1OS5 A;  1FK9 A;  2CQ3 A;  3GFH A;  2Y0S D;  1LXN A;  4OX7 A;  2XMM A;  3MM9 B;  3CJ0 A;  2HNY B;  3RZA A;  3PR5 B;  3DGP A;  4DCO B;  3AKO B;  2ATC B;  4K4U A;  4OJ1 A;  2FVQ A;  5F8I A;  3BPS P;  3IWN C;  3UDL A;  1FRM A;  4CNZ A;  4IG0 A;  3W65 A;  3BQ0 A;  4ZS6 A;  2BJ1 A;  3BSN A;  2XYP B;  4F7V A;  3MM8 A;  3KK1 B;  1S72 S;  1YRT A;  3VAG A;  3MMB A;  4RZR A;  4C3L A;  2YQ0 A;  3FSI A;  2M8H A;  4KBI A;  1OWX A;  1UW9 A;  2UVV A;  3VGU A;  3O1L A;  1MWY A;  3R5A A;  3HO1 A;  3HDS A;  4OI2 A;  1UVL A;  2DRA A;  3VAF A;  3W1Y C;  4BHQ A;  3WBZ A;  1EZZ B;  3J80 U;  4YR3 A;  5CD4 A;  1TR0 A;  1OMS A;  4NLX A;  2MQP A;  5F0W A;  4DL2 A;  2DGW A;  1T3N A;  2KI2 A;  1Q8L A;  1JLQ A;  4FYY B;  1GMV A;  3C14 A;  3EJM A;  3PIP Q;  3WHI A;  8RUC A;  3BBC A;  2HBY B;  3W7B A;  2FJE B;  2CG8 A;  4K4S A;  4N7T A;  5B0B A;  1X5T A;  2QTW A;  4YDX A;  4A47 A;  1FKO B;  1I6J A;  2KG0 A;  2VFV A;  4DBQ A;  4F4A A;  3P4U B;  3H0P A;  4BWJ A;  1UEV A;  4UY8 T;  1HI0 P;  4DX7 A;  3UVJ A;  1RHQ B;  3I0R A;  1YBU A;  3PCO B;  4PWU A;  4O3O A;  1TL3 B;  4QYZ J;  2VJU A;  3BRE A;  3DRS A;  2F4V J;  4DV1 J;  4IH5 A;  3CCT A;  1YLX A;  5CYQ A;  5LMN F;  1PSD A;  5M2P A;  5KT4 A;  4YEA A;  1DHM A;  1NSP A;  4ID5 A;  3KK2 B;  5CA5 A;  3D6T B;  5IT4 A;  2ZVI A;  3ZTP A;  2WZ1 A;  1MMD A;  2MB0 B;  5ADZ A;  3K0J A;  1NSK L;  2DHG A;  2LQ5 A;  3JTN A;  2MQN A;  4O4R A;  2ZBQ A;  2D3U A;  3FJ2 A;  4KV8 B;  5D15 A;  4K4T A;  2CQ1 A;  3QLH A;  1Q86 T;  3MF5 A;  1TAQ A;  2QL9 B;  5L38 A;  3LP2 B;  3FUY A;  3FDS A;  2HQD A;  1U1O A;  1FES A;  2MJN A;  3O2I A;  2AYB A;  1G2E A;  1K47 A;  4NE9 C;  2XWX A;  2DGU A;  1RAB B;  4ZP8 A;  4OHZ A;  3Q8U A;  2R9L A;  5GAH I;  4L3K A;  1PBU A;  2IAJ A;  4F4W A;  5C2G A;  3F73 A;  2EG1 A;  1TUW A;  3RB0 A;  1E6Y A;  4JI7 J;  4H4M A;  4ED1 A;  1U6F A;  4ATN A;  3Q89 A;  1YHQ S;  5T14 A;  1UWB A;  1LW2 A;  4ECZ A;  2B56 A;  2PFF B;  3QFH A;  2HFZ A;  2XB2 D;  3V2U C;  4IRC A;  3PW2 A;  3MUR P;  1SJR A;  3V4I B;  4CI0 B;  3TVK A;  4DSF A;  4OYB A;  2IM0 A;  1SXL A;  4B3S J;  4OJH A;  1DQ8 A;  2CQD A;  5LT5 A;  1UJ5 A;  4ZCK A;  4K8R A;  3QZ7 A;  4B3O B;  1HWL A;  3DDN A;  4ILR A;  3DHX A;  2GIF A;  2XUL A;  3CCL S;  4P10 A;  3K8V A;  1IBM F;  1IKY B;  2YTC A;  5K8P A;  2BJ8 A;  4F0H A;  1TFY A;  2CDQ A;  3LW5 C;  3EVM A;  5HL7 Q;  3N5B A;  4P2X A;  2C42 A;  2HRT A;  2Z4P A;  1GNK A;  3OXG A;  1H2V Z;  3DDK A;  2QA4 S;  2E1A A;  2HND A;  4OZ5 A;  5LMU J;  3JSR A;  4C8M A;  1N5T A;  3PX6 A;  1D9F A;  3Q8P B;  3GYN A;  5CCL A;  2DJW A;  1JNZ B;  4HTJ A;  2HHU A;  2N3O A;  2AGO A;  4RNO A;  5F9N A;  2WB1 D;  3PZP A;  2O1P A;  3P3D A;  4LJM A;  4DG1 B;  4KKO A;  2DRD A;  4OZ3 A;  3PW5 A;  4MTP A;  3BYR A;  1PJ7 A;  1SPB P;  3IR5 B;  5KFO A;  1HIY A;  1ZOT A;  4M5L A;  2HMI B;  1NBE B;  4LR7 A;  3M8R A;  4DR2 F;  2K7J A;  3BKU A;  2BJ9 A;  3DLE B;  5DM7 Q;  3EVO A;  2FVP A;  4F3O A;  1S9G B;  2KZZ A;  2XMT A;  1VQ9 S;  1JLB B;  3VAL A;  4OLP A;  3POT B;  3UO0 A;  2LQJ A;  3GYG A;  4NXM J;  1NK0 A;  4M5J A;  3OFG A;  5J1E A;  1TL1 A;  1K1S A;  2DCL A;  3OUY B;  4B9U A;  4C97 A;  2HS4 A;  2XI2 A;  2LEP A;  1HFE L;  2B26 A;  1U7L A;  4I7F B;  4NOH A;  2CPE A;  1RT4 A;  1UEK A;  3VQS A;  3RG6 A;  3NWR A;  5K20 B;  1U2C A;  2VD3 A;  4ED3 A;  3LP1 B;  3AD7 C;  2HHW A;  1Y5N B;  4EGL A;  4CO4 A;  3A3N B;  3TVY A;  3OHB A;  1YGY A;  1FDA A;  4NLU A;  1BY9 A;  4DX6 A;  4NCB A;  2K3K A;  2YX1 A;  4J91 A;  3C66 A;  4USU A;  2KT3 A;  5DM6 Q;  1FI4 A;  3G4S S;  4IQX A;  3C6E C;  4ZVG A;  2XMJ A;  4L72 B;  5L9X A;  1SKR A;  1JLA A;  2B4V A;  5IV3 A;  4FKX A;  4QQB A;  2W24 A;  6AT1 B;  5EWG A;  5ETM A;  3MM7 A;  1HHS A;  4LRD A;  3HHK A;  1T05 B;  2E5L J;  1RKJ A;  1IR1 A;  1XWL A;  2V69 A;  4O0N A;  4PWD A;  5KFM A;  4EBC A;  4DFK A;  3W60 A;  4UZB A;  4HYK A;  1NUE A;  4GC6 A;  4A8M P;  2ATL A;  3U7J A;  5K8O A;  1DAR A;  1RT5 A;  3VAJ A;  2EWH A;  5C25 B;  2DCU B;  4V19 J;  4Q44 A;  4QYZ K;  2VF3 A;  3DOM B;  5AJ3 F;  2J0Q D;  2CUY A;  2CJK A;  1KKH A;  2QMU B;  1I94 J;  1HI1 A;  4DPT A;  2PC6 A;  2AD9 A;  2G1H A;  3H7H B;  4QWB A;  1S1W A;  2DXF A;  4J90 A;  4DL4 A;  1KHW A;  3RRG A;  2XMA A;  3C19 A;  4ZP7 A;  4M8L A;  2Y1R I;  1OSD A;  4KGZ B;  3C14 B;  1Q5V A;  4WFY A;  3FCH A;  1RU1 A;  2M5Y A;  4FXW A;  3S6E A;  1J5O B;  2FHJ D;  2ZJR Q;  2Z30 B;  5DGA A;  3PR4 A;  2QX0 A;  2ZOM A;  2DBB A;  3ISN C;  1N5Y B;  3KNA A;  3DFE A;  4GKK F;  4J5O A;  2XMV A;  5HN0 A;  2CJA A;  4B3M J;  2VFS A;  2YNI A;  2E5G A;  2E9R X;  4JV5 J;  4UTG A;  3UVJ B;  1FFS B;  5L46 A;  2EVZ A;  2V2V A;  2UUA J;  4IOA Q;  3ENW A;  1TK8 A;  2ZFH A;  2VA2 A;  4WII A;  1NSQ A;  4UQT A;  4JI6 F;  5ITH A;  2YBV A;  4JP8 A;  3QJJ A;  4Q0B B;  1YTY A;  5KFB A;  1MU2 A;  3EMT A;  3TI0 A;  2BOP A;  1Q78 A;  3CJR A;  2OPS B;  2P5V A;  3TZZ A;  4NI2 A;  2GJF A;  5D0G A;  1HQU B;  5F9L A;  1SB6 A;  2YKO A;  3BZQ A;  1Y7P A;  3UCG A;  1UVN A;  3FEZ A;  3GV8 B;  5GAG I;  4AE5 A;  2R7R A;  1RUS A;  4DV5 J;  3FGV A;  3LH2 S;  2H54 B;  5MAO A;  3LWM A;  3T3F A;  2AX1 A;  3QFW A;  4EUV A;  3KK3 B;  2X7I A;  2RUS A;  3R5C A;  1MMN A;  2Z2Z A;  2FD2 A;  4ERD A;  2XMU A;  2WSE C;  2MZ1 A;  3B4D A;  5KFG A;  1YWX A;  1EKR A;  2YWH A;  4B3T J;  3IG1 A;  2EFV A;  2HYI B;  5KT2 A;  4H4K A;  1RAA B;  1HW8 A;  2IAJ B;  1BWE A;  3OQ2 A;  3HSZ A;  3OVS A;  1Y11 A;  2XS2 A;  2RNE A;  2BE9 B;  3VV2 B;  1X4B A;  2RML A;  2DK2 A;  5B0D A;  4U8Y A;  4LVO P;  2MPU A;  8ATC B;  2FJV A;  5ETS A;  4QCL A;  1L3T A;  3M6W A;  3QIP A;  1JXE A;  4DR3 F;  3CDU A;  4NMX A;  3CXC R;  3KJQ B;  1GAO A;  4YB5 A;  3CF5 Q;  2ADC A;  1Q82 T;  4DV0 J;  3I32 A;  5CH7 B;  2V4J A;  5L1K A;  2DR8 A;  2OFH X;  1HNZ F;  3V6K A;  1XMQ J;  4NLQ A;  1DBD A;  3TAQ A;  1RWU A;  2QV6 A;  1AXQ A;  1ZBT A;  1G4C A;  3S8S A;  2R2T A;  1SUQ B;  1YZ7 A;  1RDR A;  1M5S A;  3H42 A;  5J1P A;  5K9F A;  4O3S A;  4NZ0 A;  2HG4 A;  4ECU A;  2M70 A;  2RRN A;  1F3F A;  1FDN A;  3M9N B;  4URS A;  3EGZ A;  3NAI A;  3OTD A;  3JYT B;  3Q83 A;  2MY8 A;  1AZS A;  5KFJ A;  2H51 B;  3LP0 B;  3MTJ A;  1HQE A;  5I4M A;  2FVC A;  2IRY A;  1JKH B;  3O5T B;  3KHG A;  3SV4 A;  3TWZ A;  1HLW A;  2OLW A;  1P6T A;  1HNV A;  4P2M A;  4DSI A;  4QWE A;  2BV3 A;  2YWF A;  3KLI B;  1QAY A;  3NRB A;  1CJK B;  5GAD U;  4QIF A;  4HKQ A;  1RAH B;  1KLN A;  2WHO A;  2CNN B;  1HWU A;  3UFC X;  4LIW A;  4RW4 B;  2DGT A;  4KH1 B;  2BE7 D;  5I42 B;  3OD2 A;  1UJ6 A;  1HBO B;  1VOM A;  1WOR A;  3I0S A;  3IM8 A;  4WE1 B;  4EBD A;  4HT7 A;  2GQ2 A;  3QPI A;  1NLK L;  5I3U A;  2RQC A;  5J1E B;  4ECR A;  4LRB A;  2LEC A;  1HBU A;  3HT0 A;  1Q79 A;  2I1R A;  3VGT A;  3KMS A;  3V5R A;  2NSB A;  4DR4 J;  3W9H A;  2JNJ A;  4EK2 A;  1JJ2 R;  1S4F A;  4DCJ B;  1U4B A;  4K59 A;  4PRF A;  3B4M A;  3M6X A;  1RWM B;  2VZ9 A;  4AND A;  3CO9 A;  4C9D A;  5FLX U;  4TYB A;  4U7U K;  1S1V B;  2CAJ A;  2RKI B;  2ZBP A;  3DU6 A;  1VQK S;  4DFJ A;  3D5M A;  7FDR A;  3VZI A;  2AZ1 A;  1U49 A;  1R27 B;  4W92 B;  4I4B A;  4X4R A;  1TTH B;  2H5I B;  3ULH A;  1BWV A;  1HHT P;  4CM2 A;  3EPG A;  4LF7 J;  4C0H A;  2FJD B;  4UUW A;  4OL8 A;  2DR6 A;  2WON A;  3I55 S;  2PE8 A;  4UOF A;  3ILO A;  3JXO A;  1UFL A;  1FXR A;  1UP1 A;  4ECX A;  1GFW B;  3DOL A;  1NB7 A;  1N48 A;  1LWF A;  2O5D A;  1RAJ A;  4TQR A;  1R0B G;  1XK8 A;  1T9X A;  3PYE A;  4WXO A;  1JLG A;  3AJ2 A;  3BGU A;  3I5A A;  5D4L A;  1KBR A;  4CH0 S;  4UOC A;  3H4D A;  3KTQ A;  1CQM A;  1S7I A;  3UDE A;  3PV8 A;  3PJW A;  5AXL A;  3ISZ A;  2PMW A;  1SV5 B;  3GIK A;  3Q2T C;  3HSG A;  4AL6 A;  5FLX Y;  2M7S A;  3FEY B;  2KB2 A;  4RW6 A;  3OFH A;  3M05 A;  1S1W B;  2W2M P;  2YXL A;  2C2Z B;  1YKW A;  2KXF A;  1SJ1 A;  2EKY A;  2HAI A;  2WCX A;  1SQF A;  4TYA A;  1VRU B;  4N47 A;  4JI0 J;  4YB7 A;  2NYH A;  1WEY A;  3EDR B;  1CG2 A;  1DQ9 A;  1WOO A;  4ER8 A;  2XS5 A;  1C0T A;  3A1Y G;  3UCU P;  1NJX A;  2ERR A;  3R1H A;  4WTO B;  2AJQ A;  3R8Y A;  1ROF A;  5IS2 A;  2HW3 A;  4CQ1 A;  4LSL A;  4ZVQ B;  1YJ7 A;  2AEF A;  1RYR A;  1XNQ J;  2K2P A;  3BKT A;  1MRO A;  3RU0 A;  4WYW A;  1U6Z A;  4DUY J;  3RR7 A;  4MK7 A;  3MAQ A;  2VFR A;  2VOP A;  4R8U A;  1N36 J;  5A0Y B;  2P6S A;  2P9E A;  5T7L A;  4U9R A;  1NK9 A;  3LO3 A;  1R0A B;  2W9C B;  3HSJ A;  4WWS A;  1XEZ A;  4TY8 A;  1CS4 A;  3GE9 A;  1ZM9 A;  2HRY A;  4Y2M A;  4U7U D;  2O67 A;  3LOU A;  4BWM A;  2VOO A;  4IRD A;  4B3R J;  4OJG A;  1FA0 A;  1CQN A;  3C8Y A;  2YY3 A;  2NZ4 A;  1U09 A;  2E1P A;  2RD5 C;  2XLJ A;  2FQQ B;  2HQ3 A;  3HVR A;  1RTJ B;  2XC9 A;  3A4T A;  1HR0 J;  2JRS A;  2F8H A;  2KFY A;  2HZA A;  3CDA A;  1CBK A;  1UMJ A;  1NM2 A;  3GIL A;  2E1M C;  2HBZ B;  4GRS A;  1NKE A;  1EB0 A;  3OR1 A;  2HZC A;  2HQG A;  2F4V F;  1NK4 A;  3SEO A;  2QGF B;  4PAA A;  1X0F A;  2ASD A;  2FY1 A;  3D3B J;  3IG1 B;  3NLC A;  1RWV B;  4ED8 A;  4AT1 B;  1CUL A;  2C1E B;  1RWK B;  4ANE A;  3ZTS A;  4P52 A;  3PRV A;  3MPU B;  2CKW A;  2EFP A;  2LA6 A;  4K4Y A;  4GMK A;  1S0O A;  1N33 F;  4DV2 F;  2DNK A;  3KG1 A;  4PPD A;  1XQI A;  3M8Q B;  5E3C A;  3CC2 S;  3Q2S C;  2N4C A;  1PIE A;  2JHE A;  3MR5 A;  4ILL A;  4EO8 A;  3KLF B;  3TA1 A;  2WVD A;  2CVI A;  2XQC A;  1UWA A;  4OLO A;  1FE0 A;  2A18 A;  5B0E A;  1OIA A;  2DNP A;  4PQU A;  2HLU A;  2AQ4 A;  3DDI A;  2UV8 G;  4TXS A;  3R7B B;  3Q22 A;  5KFR A;  2DNG A;  2H3E B;  2QIF A;  2RF2 A;  4PG5 A;  2BUN A;  3PRB A;  4TU9 A;  3WC0 A;  2RQK A;  1VJQ A;  2ASJ A;  4JI7 F;  1Z1Z A;  3CJK A;  4DCP B;  4DR1 J;  1YQH A;  3LUY A;  2D41 A;  1HBM B;  2YWE A;  2HFN A;  2HHH F;  3I96 A;  5IQ6 A;  3KG4 A;  1WKK A;  4KGV B;  4P2S A;  2KJW A;  1O8B A;  3CTR A;  1HPZ B;  1IVZ A;  3TAM A;  2GJ2 A;  3ZXW A;  1FD2 A;  2XZD B;  1RA7 A;  3ITH B;  4HAC A;  1HQE B;  4NCG A;  4DWI A;  2CWX A;  3JSM A;  1X4E A;  1CJT B;  1V3R A;  4LRA A;  1WTB A;  2VIH A;  3WX4 A;  2OEM A;  1RP5 A;  3L7U A;  3LPY A;  4JBC A;  4MIW A;  3GIR A;  2IM1 A;  3UR3 C;  2ZDO A;  5DZ7 A;  4J9U E;  1FF2 A;  3JAM U;  2MDA A;  5CHC B;  1LWC A;  5HAO A;  1RSC A;  2G1D A;  3M8P B;  5LMU F;  4GKJ F;  2IA6 A;  5CAA A;  2QFI A;  3UR0 A;  2MKI A;  1AB8 A;  1P9Q C;  3ZC4 A;  1UJ4 A;  4CLF A;  3I6P A;  1U1Q A;  1AT1 B;  3OR2 B;  2V8D A;  3LAL A;  4PUO B;  2AHO B;  3BO2 A;  1S10 A;  2EPI A;  1BQM A;  3ZZU A;  3V4M A;  4DQP A;  5KG6 A;  1OPZ A;  1R89 A;  1UKU A;  2MXY A;  3IBF B;  1HNW F;  4NLD A;  4Y34 A;  2ZBR A;  4MYU A;  1T8E A;  1P1L A;  1N32 J;  2MZT A;  3TAR A;  3RAQ A;  2F5G A;  3PG9 A;  4DQS A;  2DKO B;  4X62 J;  1TKZ A;  1H7X A;  5T41 A;  4J9P A;  1FVS A;  2CPD A;  3LTO A;  1LNQ A;  5DG7 A;  5J2Q B;  4K2X A;  1NDK A;  1IBC B;  4A8Q A;  2HBR B;  2GIR A;  2NXC A;  1D8Y A;  1WF0 A;  2UUC J;  2JC1 A;  5KG0 A;  2OUG A;  3JAM Y;  1RBA A;  2YNF B;  4CH1 A;  1SJF A;  4RW9 A;  2CNO B;  2BDP A;  3OFF A;  3BQ1 A;  2PMH A;  4YY3 J;  2OGU A;  1T03 B;  1OO0 B;  5HVG A;  4RNF A;  1PJ6 A;  1NLT A;  5D4N A;  2MY7 A;  4WFZ A;  3THV A;  2VC1 A;  1DTT B;  4A8O A;  4IO1 A;  3TR5 A;  4RNH A;  1Y00 A;  4P75 A;  2KRB A;  2KFN A;  1BQN A;  3C6U A;  2BZ2 A;  5EGY A;  1JIH A;  1REV A;  1N52 B;  2GAG C;  3K57 A;  1QSL A;  5GME A;  1C4A A;  1YG0 A;  4C2M A;  1JXL A;  2G2Y A;  3NCP A;  2VIC A;  1U45 A;  1NJI T;  1PAE X;  3NS6 A;  4CNY A;  4JB8 B;  3BDP A;  1S76 D;  2ACY A;  2IIH A;  3LQV A;  1O0P A;  3K5L A;  4WPA A;  1DTQ A;  2MQ8 A;  4RPF A;  3TUJ C;  2WOM B;  2ZVS A;  1RWX B;  2YX7 A;  4LSL B;  5A8K A;  2OML A;  1X5O A;  1IJE B;  5DQI A;  3I5B A;  2MGZ B;  1VQ4 S;  1EP4 B;  2RDD A;  1UEU A;  2PT0 A;  2E9Z A;  2F1F A;  4Q8E A;  5C42 A;  1F6T A;  4PWW A;  2IMW P;  2W4C A;  1T11 A;  3CIM A;  3HHL A;  1U8S A;  1C1C B;  1RAG B;  1KVK A;  4RLE A;  3DMJ A;  3MAA A;  2DGS A;  3FNN A;  4D3G A;  4B9N A;  1W2B R;  2GO9 A;  4FF2 A;  2FZG B;  2C2N A;  2WK4 A;  3DN9 A;  2BAB A;  1QSS A;  3HMJ G;  4I6W A;  3QNW B;  1XIQ A;  1R43 A;  1X9M A;  3K17 A;  4CLS A;  3A8I A;  3KFW X;  1UVJ A;  4B3M F;  2K3I A;  1UZH A;  3MCO A;  2DO4 A;  4EFA C;  3DXB A;  1D9A A;  4K4W A;  4JV5 F;  2OIH A;  4G1P A;  4K5R A;  1RTI A;  1IBL F;  5KFT A;  5HJX A;  2CIM A;  2UUA F;  2WBR A;  1N6Q A;  2B8Q A;  2Y8Y A;  4ECQ A;  4MKY A;  5FJ4 A;  2FPH X;  3BH6 B;  4TU8 A;  2W2Q P;  1RAE B;  3M2R B;  1QTN B;  3AQO A;  3MD1 A;  1CUL B;  1C3G A;  4JV1 A;  4DQQ A;  3NGS A;  4K50 A;  3UWT A;  3K5M A;  4LF5 J;  1RCO B;  5C24 B;  3A3P B;  4DUT A;  4E8U A;  4RUA A;  3W9J A;  2QJ3 A;  4ETZ A;  3DLB A;  2UUW A;  3UNG C;  2WB4 A;  2HVZ A;  5LOQ A;  2BYC A;  3EM1 A;  4LFC F;  3HP6 A;  3DM2 B;  1U1R A;  4QU7 A;  2J8A A;  4GO7 X;  2R7V A;  3LF0 A;  2HHT A;  2JWN A;  3CO0 P;  3LWL A;  2E7W A;  2XY5 A;  4ENO A;  2JZ5 A;  5KFE A;  4AFF A;  3CE8 A;  1F5B A;  5L9N A;  3MUM P;  3PIO Q;  2B5J A;  2DB1 A;  4ES1 A;  2KYX A;  7AT1 B;  4NEZ A;  1LW0 A;  3WZ0 A;  4C11 A;  4JI2 J;  3DYA B;  4IG3 B;  1L3S A;  2IBK A;  3C3L A;  4ALZ A;  2CDR B;  1X4D A;  4WKR A;  4KO0 A;  1HYS A;  2MLZ A;  3T19 A;  3FFI A;  3BGL A;  3IR6 B;  5B0A A;  2AV5 A;  3OT9 A;  3GFZ A;  1WC4 A;  4HL9 A;  3ZZY A;  5AE1 A;  4A8K A;  1PAU B;  2HWH A;  3US5 A;  3Q8Q B;  1Y5I B;  2QC3 A;  3J7Y I;  2BRL A;  1RZM A;  2HHX A;  2V63 A;  4LT6 A;  4XPC A;  4JI3 J;  1F60 B;  1YJN S;  1ZS6 A;  1FEH A;  3MR2 A;  2UXB J;  2M4M A;  4HAC B;  2O66 A;  4Q45 A;  2NPF A;  1RK8 A;  1YIJ S;  4Y3C A;  1S0V A;  2UVU A;  3JSM B;  3OVA A;  4RBT A;  4OX8 A;  3T5L A;  3B78 A;  1FE4 A;  4OQJ A;  1T9Y A;  3ZFV A;  2WW8 A;  1Q8B A;  4KYZ A;  4OX9 J;  2ZE2 A;  4QW8 A;  2EW9 A;  4F4Z A;  3F41 A;  1Q0N A;  4W90 B;  1S1T A;  1H3D A;  1U0H B;  2Q6B A;  1RAF B;  3NG8 A;  4LBH A;  3KUG A;  3M4X A;  3MM5 B;  4CP5 A;  3DRY A;  4C7Q A;  3Q24 A;  2LQB A;  4ZVT B;  3WQP A;  4KPC A;  4CO3 A;  3F44 A;  1K44 A;  3HUL A;  4M5I A;  2XCA A;  1FNX H;  1IR0 A;  3GON A;  1NND A;  1S9E B;  2GMJ A;  3H59 A;  3RJM B;  4ZJQ A;  1BQM B;  1WOS A;  1NXI A;  3MEE A;  2V8V A;  5EX0 A;  5A2Q U;  2EI5 A;  4AD6 A;  3EIC A;  3G71 S;  2VG5 A;  2DHS A;  1C4C A;  1VMB A;  2BXJ A;  2KT2 A;  3OXF A;  4F2R A;  3ZZZ A;  1RAD B;  1S6O A;  4FBT A;  1RB0 A;  1PYO B;  4H4O B;  3W2W A;  3DLL Q;  1M90 T;  3MED A;  4DLG A;  2OSQ A;  2HWI A;  4JI8 F;  2VBX A;  1LFP A;  3A8K A;  2IJF A;  2W9B A;  1B64 A;  1T94 A;  4R0E A;  3SDE A;  3CD5 A;  4X64 J;  1RBO B;  2GV1 A;  2KT5 A;  4DSK A;  2HBQ B;  5GAH U;  4HTI A;  2ZM6 J;  4DR4 F;  4Y65 A;  4DN9 A;  3QO9 B;  2G13 A;  2VA3 A;  2HKE A;  2O01 C;  5KT5 A;  5M2R A;  1WC3 A;  5J2P A;  4K4X A;  3PYG A;  3NCQ A;  3CMA S;  4USV A;  3BF4 A;  4RW9 B;  4ZVE A;  3HK2 A;  5IM0 B;  5K14 A;  3TUZ C;  5CQG A;  4RW8 A;  1ZPV A;  1KQF B;  2HPU A;  5DO2 A;  4IKA A;  1R31 A;  4ZCM A;  4CT8 A;  3RW6 A;  1R3N A;  4DLE A;  1N56 A;  4N8N A;  4PG6 A;  1RHJ B;  1DZ5 A;  3I9V 9;  2FJX A;  3A13 A;  3BGF A;  1MN7 A;  2YKQ A;  4CLZ A;  2CQC A;  3DLJ A;  2FLP A;  3NBP B;  1YIT S;  2HK3 A;  4LUB A;  4YB6 A;  4HHU A;  4CTA A;  3AOB A;  3AFG A;  1C1B A;  2OKQ A;  5G0R B;  5MLC V;  2NLW A;  2VBZ A;  5LXY A;  1DJ0 A;  3U1L A;  1IKV B;  1X8D A;  3QGI A;  1D0E A;  3AB2 B;  2R7U A;  4CLY A;  1L5U A;  4M5D B;  1DTQ B;  3V6D B;  2OTL S;  2YKP A;  4TKT A;  4FF4 A;  2V2Q A;  4UW2 A;  5L1J A;  5DRK A;  4XDC A;  1ZYQ A;  3KJV B;  2C3O A;  5A8K B;  3IAM 9;  4GVB B;  3PW4 A;  3OL6 A;  3IWL A;  1NJY A;  1KLM A;  1N8R T;  2KXH A;  3NEK A;  3SCJ E;  5DLG A;  4IRK A;  5BR8 J;  5JJB A;  1D8Z A;  1LFW A;  4RW7 B;  3SBM A;  1HL6 A;  2OPQ B;  5H9E J;  3DRR B;  2FC8 A;  3M1V B;  5EDW A;  1ZET A;  2GIQ A;  5CYM B;  3SQO P;  2D3Z A;  3DMJ B;  1WC1 A;  2KL8 A;  4U7C A;  1KVJ A;  4ICL A;  3N4W A;  3SIP B;  2R7W A;  3MPD A;  1SJQ A;  2FHJ A;  5HP1 A;  5A6P A;  1XNR J;  1QE1 A;  2BW2 A;  1F9F A;  1P8G A;  1YBT A;  3J81 j;  4WBF A;  1NDC A;  1K8A T;  2CYY A;  2UU9 J;  2FVR A;  3HLU A;  3A3O B;  4U96 A;  1VQ5 S;  2IC3 B;  4N41 A;  2FUG 9;  1M5H A;  1UET A;  1Z2Z A;  4DDF A;  2ILZ A;  2XGQ A;  1IJF B;  1N36 F;  3D28 A;  3M2U A;  2P6T A;  5A6W A;  2ZH2 A;  1QD1 A;  4WU3 A;  2NRE A;  1XBW A;  4ZIW A;  4PR6 A;  3PDN A;  2BEF A;  5A8R A;  1K0T A;  2BBE A;  2HIY A;  3MEG A;  2OJ3 A;  3MOZ A;  2MKK A;  2FJA B;  1ZM4 A;  3M2V B;  2GZO A;  3T1H J;  2HLT A;  1NZ8 A;  3PY8 A;  2A10 A;  2L9N A;  3TAP A;  1WSR A;  3R5B A;  3AOC A;  3HSD A;  5J2N B;  1FXL A;  1NHK L;  4PAB A;  2HNY A;  4XTT A;  1NZA A;  2H5J B;  4CIO A;  3AAW B;  2VFU A;  4NA2 A;  4EWT A;  1BLU A;  4CZC A;  3R5J B;  3PW7 A;  3E3X A;  4OI3 A;  4YFU A;  4CLP A;  3BBF A;  7FD1 A;  3MPY A;  4URG A;  3H5S A;  4O4G A;  3TP2 A;  5ETP A;  2YKM B;  4RUB A;  4ZHR B;  3NS5 A;  3KK1 A;  2ZBI A;  1VBX A;  1F9H A;  1VS3 A;  3WX8 A;  3IBC B;  3T1Y J;  1HYS B;  3DCA A;  2HS3 A;  3CB4 A;  4C0O C;  2GA7 A;  5CZV A;  2XO7 A;  2BM0 A;  1RT6 B;  5D8H B;  3SXL A;  2O3D A;  4Y28 C;  3QWP A;  4I56 A;  4AXJ A;  4C3K A;  3X1L B;  3RB6 A;  2YQ3 A;  3K2Y A;  1H98 A;  3I4P A;  4QIV A;  4ZLN A;  5C5J A;  2DHA A;  5E7O B;  4ELU A;  2MKJ A;  1JWW A;  4LF8 J;  2DEI A;  2VOD A;  2I38 A;  3IM9 A;  1WEX A;  5LXR A;  5KFV A;  2F8M A;  1NU4 A;  4DL6 A;  1Q53 A;  2XTJ P;  4HHH A;  2ZE2 B;  4QYR A;  5KG1 A;  2PO4 A;  3VR1 A;  1KVI A;  2XI3 A;  4DR1 F;  1FKO A;  2AW0 A;  3T5H A;  2CPY A;  2N4D A;  4DV7 F;  1KEK A;  3DHW C;  4J9M A;  2D9O A;  1NKB A;  2YH0 A;  5KOW A;  3PJX A;  1NHV A;  3S7R A;  2F40 A;  2Q1L A;  3UI3 A;  4B9S A;  3KUH A;  2A2C A;  1TL3 A;  5FDL B;  3TJ9 A;  1TU0 B;  5D0H A;  1ZAV A;  3E51 A;  2CQ0 A;  4RU9 A;  2XZW A;  4WXW A;  3NNA A;  5DQG A;  1C2P A;  4IYQ A;  2MST A;  3IP0 A;  4MMO A;  3S1T A;  4OHV A;  5GAG U;  3IC1 A;  3GWC A;  3PHE A;  1S57 A;  3KK2 A;  1FD8 A;  4ELV A;  3ADA C;  5D0R A;  4WIQ A;  4P71 A;  2XEX A;  3QT8 A;  4ED5 A;  4MT1 A;  4YME A;  4CO1 A;  2V4R A;  2B8P A;  4EZ9 A;  3O6Q A;  5E3A A;  3HD2 A;  4KV8 A;  2JEI A;  1ULR A;  4ZLJ A;  2AJ4 A;  3LP2 A;  4M5H A;  2DR9 A;  3ENV A;  2ZEJ A;  1FJG F;  3LGM A;  3QAU A;  3ETO A;  2HHP A;  4BS2 A;  5HI7 A;  2IYG A;  5CCM A;  5HMW A;  5E2Q A;  2FHM A;  2AT1 B;  1RHR B;  1M1K T;  1SL1 A;  5J2P B;  1SL0 A;  3G87 A;  4CYU B;  1N54 B;  1R8A A;  4C0B A;  4IR1 A;  2ODX A;  4X2B A;  4USJ C;  2DGV A;  2V68 A;  3TVZ A;  5L1L A;  3OJU A;  1YK9 A;  2Y8W A;  4A4J A;  1URN A;  1FRI A;  1CSJ A;  2CJQ A;  3TX8 A;  4ZMM A;  1X4H A;  4X62 F;  4DS5 A;  1FFW B;  2GGP B;  3GYX B;  3V4I A;  5EN1 A;  3K59 A;  5H9E K;  3CWJ A;  2ADB A;  1YJU A;  3EZ5 A;  3NOC A;  4LFA J;  3I38 A;  2BRK A;  3OBI A;  2UUC F;  5GMD A;  1R8P A;  1UZD A;  2ZJP Q;  1B99 A;  4NWB A;  4CTA B;  1FKA F;  1C1B B;  2MKS A;  1HMV B;  1HAR A;  4B3O A;  4EBE A;  1SC1 B;  1UAW A;  4J9Q A;  2KVQ E;  3KHH A;  1IKY A;  4C8Z A;  3E2E A;  4NXN J;  5K8N A;  1VI7 A;  3PX0 A;  1DLO B;  3SSQ A;  3N79 A;  4LIR A;  2PMZ D;  4ED2 A;  3O3L A;  4I2P B;  2IDE A;  1F5C A;  3TEH B;  4X4Q A;  3CCV S;  1Q1K A;  2DIV A;  4A46 A;  2BKP A;  3ENA A;  4WCE Q;  4DG1 A;  2VQF J;  1X4C A;  3O44 A;  4O23 A;  5HMX A;  1NCL A;  1FEE A;  1WHX A;  2QLW A;  3TZY A;  1IBK F;  3CUL A;  3QYY A;  1S1U A;  2DNQ A;  3DLE A;  3G86 A;  2QLB B;  4MKV A;  3ICL A;  1PGZ A;  1JLB A;  4X4V A;  2HGL A;  2CVE A;  3MDF A;  2VPX B;  4P72 A;  2KRR A;  2BM1 A;  3W5Y A;  3POT A;  1B70 B;  1JLC A;  1VQL S;  1NSA A;  1YX2 A;  1IM6 A;  2C2O B;  2BW7 A;  2B6A B;  4MK9 A;  2HWT A;  4DR5 J;  3OUY A;  1HWK A;  3M2U B;  2ALZ A;  4I7F A;  1TVR B;  4KE5 A;  2ROP A;  1GX5 A;  1RE1 B;  3G6Y A;  4JYA J;  1VC5 A;  4ZPV R;  3LP1 A;  3D2W A;  5SUH A;  2YH1 A;  3K5N A;  2NCK L;  3D0H E;  4MK8 A;  3NP5 A;  4O3Q A;  2C2R A;  3I56 S;  4DI6 A;  4WJB A;  1RT2 B;  3BJY A;  4AXI A;  1VK8 A;  3NY0 A;  1GTE A;  2CAD A;  2NPI A;  1FVQ A;  1Q81 T;  1GXT A;  3AT1 B;  2XMK A;  3CCM S;  1X7V A;  3JSB A;  1Y9O A;  2UVR A;  6FD1 A;  4M1K A;  4WP9 A;  2XSJ B;  4O4G B;  5E41 A;  2P2C B;  1T05 A;  2OPP B;  2E5H A;  5AXN A;  2GCF A;  4UF4 A;  4UUX A;  4CLW A;  4BLG A;  4AUK A;  1E6V B;  3SSR A;  3VWS A;  5LJ3 Y;  1CC7 A;  1RWO B;  1KFS A;  2C3M A;  3VGS A;  1JJH A;  2JVR A;  2KHC A;  1ZAW A;  1PC5 A;  4KC5 A;  5C25 A;  2J6S A;  1RJJ A;  1VGY A;  3DOM A;  1AFJ A;  2DNM A;  2JX2 A;  4EI2 A;  2V6A A;  2F8E X;  2MLY A;  1C0U B;  2EBE A;  3LAM A;  3IWX A;  2PN6 A;  1NPP A;  2LDY A;  1T7P A;  2BVZ A;  4ZIV A;  5KFS A;  4V1A k;  4JI2 F;  5JMN A;  3ZZ0 A;  4DX5 A;  2NUU G;  1SBR A;  2X51 A;  4ILM A;  1XN9 A;  1ZA1 B;  5HMZ A;  1WHW A;  3W61 A;  2WVF A;  1J5O A;  1KTQ A;  2CPX A;  2BA9 A;  4YHH J;  3FKB A;  4CM0 A;  3KOA A;  1N5Y A;  3NXZ A;  1N5S A;  1RKI A;  2DH9 A;  3T41 A;  4C3M A;  2CNK B;  4JI3 F;  2EC2 A;  1PJ5 A;  1SC4 B;  1HWI A;  5LSO A;  2DXD A;  4RBU A;  4ED7 A;  2PSZ A;  3CUN A;  4KTQ A;  2W7O A;  4IQM A;  1NH8 A;  1NPK A;  2VQE J;  3OTB A;  3V6H A;  4C8O A;  1QJH A;  4NLR A;  5CXT A;  4Q0B A;  2E1R A;  2X1B A;  2YWG A;  4RUH A;  3BB5 A;  1SJ4 P;  4OX9 F;  2BJE A;  2OPS A;  1Q8I A;  4KGM A;  3PO5 A;  1RT7 B;  1HQU A;  3OSN A;  4ES2 A;  5HBM B;  2G9O A;  1P1T A;  3CPW R;  1HNI B;  5LMN J;  4RX6 A;  3UN2 A;  3C15 B;  2ZNZ A;  1IQT A;  4K0K J;  2XZT B;  3D68 A;  1U0S A;  1HI8 A;  2QMW A;  3KK3 A;  5KFH A;  2LFV A;  2GAH C;  2COL A;  5GAD I;  3M8Z A;  4B9V A;  2GX8 A;  4OZ0 A;  4KB7 A;  2V0N A;  1A0O B;  5E3R A;  2APO A;  2KXN B;  4N77 A;  4CH7 A;  3CJQ A;  4FNI A;  2DH8 A;  3E01 B;  5IC4 B;  2W4P A;  4Y2A A;  3AHP A;  1JX4 A;  1Z2L A;  2WAQ D;  4ED4 A;  4CCH A;  2KU7 A;  3R5G A;  4ECT A;  1KOH A;  2MYF A;  2YWK A;  3HFZ B;  5B08 A;  3FRY A;  1H2T Z;  4UOH A;  1TL7 A;  5IQQ A;  3C6T A;  1X9S A;  3RBD A;  1AA1 B;  2PA8 D;  2MMY A;  2W2P P;  4LSZ B;  3M7V A;  2IYI A;  1IUJ A;  2ALY B;  2V2K A;  3HM9 A;  1O6X A;  2C3P A;  4DXL A;  3MEK A;  1SUQ A;  1KRP A;  2CQB A;  1NAQ A;  5DGB A;  2Q79 A;  4DQI A;  1VBZ A;  1JLF B;  1HWJ A;  2E1C A;  3D6M B;  4G3I A;  2RHQ B;  4Y2I A;  4L6V 3;  4USK A;  3NL0 A;  4G1I A;  3JYT A;  4DSE A;  1IBM J;  2Q66 A;  1SH2 A;  2VHG A;  4C8Y A;  1W2I A;  3LP0 A;  3P96 A;  1HNX J;  5C2C A;  2HQI A;  4KR0 B;  2YKN B;  1JKH A;  4Y00 A;  4QJV A;  1QAX A;  4JI4 F;  3ZZP A;  2E9T A;  5CYJ A;  3KLI A;  1CJK A;  3A8J A;  3GIJ A;  3AY0 A;  3KJF B;  4UY8 5;  3R1L A;  1DY3 A;  3PHT A;  1S1U B;  1VRQ C;  4RW4 A;  1HQ2 A;  5D6G A;  5BYR A;  3MZI A;  1F2G A;  5I42 A;  4KRW A;  3NS7 B;  4YQW A;  3IS9 B;  3M32 B;  3A8E A;  1HBO A;  2PI5 A;  4U8V A;  5ETR A;  2VJV A;  4ID8 A;  1UTA A;  3HFK A;  4WE1 A;  1D9D A;  3AD8 C;  4HDH A;  1KWM A;  3TJA A;  1JLC B;  5BR8 F;  2FTR A;  3EGV A;  1WC0 A;  2XSF A;  1XAO A;  3NNH A;  3WIU A;  2DEJ A;  1TMJ A;  2UZA A;  3A12 A;  3H8Y A;  4N76 A;  2WW4 A;  1W7W A;  2KN4 A;  1FX4 A;  3GR0 A;  1TKX B;  4LQ3 A;  3EUN A;  2YNG B;  3OLB A;  2HRU A;  4M5N A;  2V67 A;  3V81 B;  2IJN A;  3KLG B;  2JLE A;  4PZV A;  4KH0 B;  2IVY A;  2UUT A;  4A8X A;  2QFJ A;  2W7A A;  1S1V A;  1VK3 A;  1M5O C;  4NLG A;  4KFB A;  1I3O B;  4MAK A;  1VLO A;  2R7X A;  2RKI A;  1NEE A;  2UU9 F;  1RHM B;  1UVM A;  4WF9 Q;  1U1K A;  1OJ4 A;  4XAK A;  1ZA2 B;  1V5V A;  3TQ1 A;  3HFV A;  2AGQ A;  2Y1L B;  5KFY A;  3CCW A;  1JB0 C;  2OD4 A;  1SVD A;  2RE1 A;  3BR8 A;  1R6V A;  2FIU A;  2LCW A;  2KTQ A;  4KHR A;  2MTL A;  1QDU B;  1RYS A;  5AE2 A;  3QRP A;  5KFK A;  4FXV A;  1G6B A;  3T1H F;  4B17 A;  3HXM A;  2ZNY A;  3IXQ A;  4FVM A;  5HLF B;  4J9N A;  1OY9 A;  3CNQ P;  2DVI A;  3TYT A;  1S1X B;  1YJV A;  2GHW A;  5D4P A;  1VQ8 S;  2DIU A;  4OV1 A;  1PYT A;  1S49 A;  4IO9 Q;  4WFN Q;  1SV5 A;  1QAI A;  2AYG A;  3DU5 A;  4DS4 A;  1XR7 A;  4I69 A;  3Q86 A;  3GCX P;  1ZPW X;  1R0C B;  3GMG A;  3TNV A;  4Y0F A;  4J37 A;  4UST A;  4J9R A;  5DLF A;  4DOZ A;  4FS1 A;  4Y2C A;  3MUT P;  3G82 A;  2GNK A;  5F3T A;  3CD6 S;  2PD1 A;  1RT1 A;  2JRR A;  5AJ3 J;  3ZZT A;  1VRU A;  2VBY A;  3BSC A;  4KSE B;  4WK1 A;  5D0E A;  3IMQ J;  1RU2 A;  1WWH A;  3CCR S;  1ZAX A;  3UD5 A;  5KFP A;  1VIX A;  2D69 A;  4ZIT A;  1SQG A;  2A0F B;  3D1Q A;  3R27 A;  2GQC A;  4I2Q A;  1NK5 A;  3HVT B;  3G8T A;  1B7F A;  2HHQ A;  2QYC A;  2DHH A;  4ECW A;  2JFD A;  4OJ3 A;  3RBZ A;  4N56 A;  1FDB A;  5IOL A;  3VAM A;  3CJ2 A;  4GKK J;  2ABY A;  2JH3 A;  2M52 A;  5A0Y A;  2SXL A;  1UFW A;  2F9J A;  4AL5 A;  3B6B A;  2GMH A;  3PEH A;  2R7T A;  1R0A A;  5F8G A;  2W9C A;  4Z7C A;  2LQ8 A;  2IRU A;  2QEX S;  4U6P A;  2DGX A;  3GTY X;  3HHN B;  1EAR A;  2NR0 A;  1SIZ A;  1WG1 A;  4PYA A;  2IRX A;  4X66 F;  1V6H A;  3W2V A;  1FT8 A;  2GC8 A;  2HHS A;  2ZH1 A;  3JQJ A;  3K5P A;  4NPO A;  3QSI A;  3TJ8 A;  3T6J A;  2Q2G A;  5DDQ C;  1WG5 A;  1YJR A;  1VQY A;  3KDO A;  4B02 A;  2EFN A;  4JI6 J;  4G1Q B;  1S6P A;  2B9W A;  1SKW A;  4HI2 A;  2DNH A;  4FF3 A;  1OQ3 A;  2BMB A;  4M94 A;  4ZPD A;  1RTJ A;  3I82 A;  1XMO J;  2UXD J;  2MHN A;  3ZNJ 1;  4UQG A;  4Q5V A;  4S0M A;  4K4Z A;  5IWA J;  3AXM A;  1H6K X;  2CPJ A;  4XPE A;  4I0W A;  1CLF A;  3ZTR A;  2ZWP A;  4RU2 A;  4ZK7 M;  4B9M A;  5CAB A;  2ZHA A;  4CLL A;  4Q8F A;  3PKM A;  1M0S A;  2MZS A;  1J5E F;  2CZ9 A;  3GFX A;  4WK3 A;  4ZPB A;  3C2P A;  3M8Q A;  1GX6 A;  4DL0 C;  2W2N P;  2MEW A;  3B82 A;  1PIL A;  2ZOF A; 
#chains in the Genus database with same CATH homology
 1EAR A;  3L9Z A;  3AGY A;  1EB0 A;  3I38 A;  1C3G A;  1GMW D;  2B26 A;  3LZ8 A;  1NLT A;  3TJA A;  4J80 A;  3TJ8 A;  3LA0 A;  2Q2G A;  4L3K A;  1GMU A;  3AGX A;  1GMW A;  3TJ9 A;  3AGZ A;  3NXZ A;  2HFV A;  1XAO A;  3NY0 A;  1GMV A;  2QLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...