3NXZA

Crystal structure of uree from helicobacter pylori (cu2+ bound form)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
total genus 38
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3nxzA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3nxzA02
3TJAA 2B26A 1EB0A 4J80A 3TJ9A 1EARA 3AGXA 4L3KA 3L9ZA 1XAOA 3NXZA 2Q2GA 1GMWA 3LZ8A 3I38A 3LA0A 3TJ8A 2HFVA 3NY0A 1C3GA 3AGZA 1NLTA 2QLDA 1GMUA 1GMVA 3AGYA 1GMWD
chains in the Genus database with same CATH superfamily
4OI4A 4ZVPB 5KG7A 3OLAA 2B5JB 3VHQA 2YNHA 2RS2A 1CULB 1FI4A 5DJBA 2HHXA 2XS7A 4F3MA 4X4UA 3AGZA 2QL9B 1MWYA 2RE1A 1RLDA 5IOLA 2AGPA 1OY6A 1Q95G 5IM0B 1KC8T 5D3GB 4QQBA 3CDWA 5HI7A 2HRTA 4DLEA 2GZOA 4ZMMA 2ZOMA 1IQTA 2WSFC 2UVVA 4ES1A 2Y1IA 4EO8A 4NOHA 3J7A1 5C25B 2JLEA 5JVHQ 1X9MA 4RNHA 2ZZNA 2KVQE 3O3LA 4IQXA 1ROFA 5HLFB 3BKTA 3CTRA 3TA2A 2LDYA 2H5JB 3IRWP 2HZCA 1Q53A 4KGKA 2DNMA 4LSZB 1RCOB 5DQHA 1R7IA 1IBMJ 4FS1A 2VQEJ 2CZ4A 2ZKTA 5E3RA 5A8RA 3OJSA 3N6LA 3TUIC 2AJ1A 2RQ4A 3UN5A 1N33F 5KFBA 1HYSA 5KFKA 4WFZA 3Q89A 1FWKA 2PC6A 1HBUB 2B26A 4FYDA 5A0YB 4F4AA 4I6WA 1RU1A 4MKBA 5DRKA 1UEKA 4OZJA 2UV8G 2NQPA 4DV3F 1L3KA 2DGQA 2HG4A 5GVQA 2W01A 3N28A 4JV1A 1XR5A 4IDKA 1KFSA 3N79A 2W8KA 3RBZA 3DLJA 4ANDA 2C2KB 4NI2A 3EGNA 2VG5B 2UVWA 3Q0AA 1B3TA 2GHWA 4ED3A 3GE9A 5L8RC 2N7CA 3SDEA 3KLIA 1GX5A 5C7PA 4QU7A 3DHWC 3CD0A 4C98A 3ENQA 3R8YA 5CZVA 2G4BA 1XNRJ 3MOZA 3R5GA 3QO9A 1HW9A 1OYDA 3RZAA 3PFEA 2VPYB 2AX0A 2DGWA 1TV6A 2RRAA 4JI6F 3UD5A 4Z2XA 3PG9A 3DRYA 4M63A 1N5SA 1JNZB 3S7RA 1ZZNA 3JQKA 5H9EK 2YKPA 1ZA2B 1DJ0A 3CD6S 2UXCJ 3VV2B 1IN0A 2IMWP 3H90A 3SMZA 2GMHA 3NNHA 1EETB 6FD1A 1KOOA 2V2KA 3EICA 5K8MA 1RTIB 4DUZF 2AJQA 5GAHI 1S1WB 6FDRA 2ZHOA 1KTVA 4FF3A 4IG3B 1T9YA 4ED4A 1J5EJ 4ZPVR 2X1BA 5HQ8A 4WK3A 4CLUA 4XAKA 3QGHA 1VBXA 1DAXA 1FKPA 3LP0A 1VQKS 4WXOA 1FDAA 3NS5A 3VAKA 3N01A 2WHOA 1S0NA 3VAJA 5D8HB 2LDIA 4RW4B 2JVOA 5ETMA 1DTQB 2CPZA 3MUMP 4I4BA 1GEHA 1ZBTA 1Q79A 3PYGA 3IS9B 2APOA 3FZ2A 4DBQA 3CCES 2YKQA 3ET6A 4A8WA 2B6AA 2B9WA 1S6PB 1UEVA 4IR9A 4ZOSA 3G82B 5F9NA 4MAKA 3UN3A 1KVJA 1M1HA 4I67A 4YB5A 1R3NA 2VL1A 3SSRA 3CDUA 1V9OA 2XMVA 4ZPCA 2QSWA 4O44A 1JKHB 2GGPB 4USMA 2CA9A 3NGUA 5J2NA 4OI0A 3HHNB 4ZP7A 3H5YA 2UUBF 3MD1A 2VC1A 3IAS9 4R5PB 2IVMA 3ZZZA 1WC5A 4LF4J 4LBPA 1R0CB 1URNA 2ERRA 3UR3C 2Y1LB 3ISNC 4F4KA 1EJ7L 1T9XA 1RHRB 4DFKA 4K4SA 3R9LA 2KFZA 1O5JA 2ZH1A 4WXWA 3BSAA 5DDRC 4NA3A 2E5LF 4F50A 3NXZA 2KFNA 5LMNJ 4DPUA 2IAJA 3W2WB 3I0SA 1VISA 1VBKA 3UFCX 2RB7A 4C0HA 1M90T 3TP2A 3NGTA 2O66A 3Q8RB 4DV6F 1PC5A 4GKJJ 2B56A 3TR5A 2ZH9A 4JI4F 4MIBA 2FZCB 4KIAA 2KZZA 3UI3A 3AKOB 5L39A 1PAEX 1MMDA 2CJBA 2AGOA 5IT0A 3B8HA 2ZD1A 4NLTA 2CJAA 3NP5A 3MXHP 2D74B 2AP6A 1F0XA 1S72S 1OJ4A 5DM6Q 2PEBA 2FPHX 1P9YA 4C3LA 2UUAF 5GAGI 2ACMA 1SKSA 2FY8A 3EMTA 4ZVEA 1QUPA 4WFYA 4IQMA 4P10A 2YBVA 1M5VC 4YR2A 3H4BA 3MCSA 1WOSA 2J6SA 3CCWA 2E1RA 1V6HA 4A8MP 1W7WA 2LECA 3NBPA 5KT6A 1NK4A 5F0UA 4AUKA 3JSMB 3LTOA 5D0EA 1R43A 2UXDF 3ZC4A 3D5MA 1LKZA 2H1YA 3HHLD 3CC2S 1MSWD 2GHVC 1EAYC 1X4EA 5G4DA 4KKOB 1U09A 4X4PA 3UCZP 2GO8A 4ALZA 5J2PB 2H4YB 3MM9A 4UY8T 2Q6BA 4OX9J 4OX7A 4NEZA 3QZ8A 1Y00A 4HHHA 3J7YI 2QFJA 3VAHA 3C16A 4F26A 1KP6A 3MI7X 4GKKF 4L72B 1LFWA 5ETRA 1NNDA 1VGYA 2GJ2A 1RSCA 2OAUA 4WZMA 2LCWA 2GC8A 2D3OR 2K1RB 2QTWA 2MQPA 4DSEA 1IKXA 3SQGB 1LWEA 3Q8PB 5IV3A 4EZ6A 1CQNA 3KLGB 3POTB 2CPFA 2FGOA 3UN2A 4LSNA 2RDDA 2XHWA 5ETKA 4X65J 4CM2A 2Z58B 1RGVA 1FX2A 2KO1A 3AT1B 2MY7A 4DF4A 2KVIA 3HVRA 1HNXF 3KHRA 1ZS6A 3CJ5A 2E66A 4RJVA 4DPYA 3AGYA 3TJAA 3D1QA 3DU6A 4L3KA 2CRLA 1R8HA 3LGMA 4UQGA 4X62F 4XO0A 4JYAJ 2E7VA 2YKNB 4AFFA 2AJ4A 3MCMA 4N47A 3PR5B 1BHNA 3HSDA 2CQCA 1WEYA 2HURA 2F9DA 3J81Y 3PYEA 3C6UA 4LR9A 1T03B 4ED8A 2NXCA 4DX8H 2HHPA 2VF3A 4OFZA 3A8EA 3KJNB 1UJ4A 1VQ9S 1TAUA 1Y10A 2QV6A 2FJAB 3NCRA 3W8GA 2OH2A 1K1QA 1S4FA 2GQQA 3QRPA 1KFDA 2RT3A 2J7UA 2BW7A 4Q43A 3NOGA 3I82A 2VA3A 1KQFB 2CQDA 1JX4A 5K8OA 3KTQA 2R2SA 3WIVA 5U47A 2YNFB 2SXLA 3ZZYA 1CQMA 3BB5A 5HP1B 2DR7A 5LMUJ 1XBWA 2MKKA 2QJ3A 5I3UB 1WC4A 3WZ0A 1NB7A 2HAFA 2WAQD 2HNYA 3OUYA 2K8GA 1K44A 2ZBIA 3D54A 3EVMA 4RZRA 3FCVA 3B54A 1REGX 3MAAB 4QBUA 3RG6A 3VAMA 2Q2GA 1BQNB 4B08A 4J9OA 3QT8A 1SQGA 1KONA 3R2CJ 3JTNA 5D15A 3PDNA 2ZKUA 3T3FA 1G3OA 1U25A 4DV1F 4FYVB 3R5BA 3DFEA 2HBZB 2YNIB 4DLGA 4NL5A 2QC3A 4BHQA 3G6XA 2CPHA 3A12A 3J7AN 4FVMA 1HR0J 5LL6d 4DFJA 2UVRA 1FWPA 1Z1ZA 2BRLA 1TZ0A 2XO7A 1H6KX 4ID5A 4OHYA 2QN6B 3MM5B 3BBFA 4CLYA 4JV5J 4ANCA 4WE1A 4EU0A 2AYGA 2MEWA 3PNIA 3WIUA 3BR9A 2BDPA 3CE8A 2IFXA 2KJVA 1RWUA 4FZVA 1X9WA 4I0WA 2V8HA 3ZZ0A 2DEIA 2HS3A 1XR7A 1U1LA 4EGLA 1IWGA 2V67A 2Z2ZA 4DG1B 4LSLB 2PO4A 1YG0A 2OTLS 2FZGB 4NZ6A 2U1AA 3MM7A 4M5IA 1T9WA 3E01A 1MMLA 1N6QB 2B8QA 1I94J 4QPTA 2JRSA 3CD5A 1FK9B 3J7ZT 4B9VA 2F9JA 1OPZA 2DXFA 5HVGA 3MECB 1NJXA 3MDFA 2R8HA 2B7BB 1VS3A 1TL1B 4KSEB 2RILA 4RL1A 1XQIA 4P52A 1WELA 2CDQA 1JLCB 1CS4B 3AXMA 4WFXA 4MJKA 1RADB 3FGVA 2F63A 3LWMA 1U26A 1VRUB 1RBLA 3OT9A 5HVHA 4DL3A 1G1XA 2CFXA 2LMIA 4DQQA 4ED6A 4A4JA 2CPEA 3RB0A 3JAMY 4G6VB 2XI3A 3S8SA 2G1HA 1N52B 2KXHA 4ZVSB 3ZTPA 2FLNA 2Q43A 1K9MT 4EBEA 2V4JB 2GIQA 3CPWR 3V81A 2RRBA 1S1TB 2WSEC 2K06A 4YB1P 2R7OA 1LXJA 3DRSB 1WF1A 3NCQA 3QRQA 1TMMA 2VUGA 1NJYA 2NSCA 1H38A 1BC6A 5LSLA 1KQSR 3DLKA 3FBEA 4JI1J 2OPRA 1VQ7S 2Y8YA 1U2FA 3GSIA 2I0XA 3M8RA 4YB7A 3UVJB 3L3CA 1NH7A 2CG8A 3QJLA 2VG6A 3DLBA 4CT8A 2DGSA 4NLSA 2PEHA 5F3ZA 1ULRA 2CG4A 3H20A 2UVUA 4CH0S 2RS8A 4EWTA 4ECRA 4U7UD 2AYBA 5CCMA 4P2FA 1RWNB 2IC3A 1RT7A 1IBMF 2PMHA 4WYLA 4D3GA 5D0GA 4ITSA 2VQEF 3H25A 3A8IA 2QA4S 3W7BA 4A8OA 2I5JA 1MU2B 3AGXA 2EW9A 1CJUA 2IDLA 1TAQA 2MY8A 3IGVA 3PY8A 1AZSB 5ETPA 1WC0A 3G6VA 2Y0SD 1RU2A 2R8KA 3SSQA 4MFBB 1RKJA 4DV7J 5J2QA 2CUYA 3IP0A 3V6HA 2AF6A 5HBMA 2JC1A 4NXMJ 2M9KA 2DRAA 3LPYA 1FRMA 1X0FA 3PKMA 5D78A 4UF4A 4M5MA 3HXMA 1JLEB 2KHCA 5I3QA 1S1XB 1OS5A 2XYHB 2NPIA 2GVDB 5KFXA 2LQ8A 2J0XA 3JTOA 3AOBA 1N88A 2L9DA 4FNIA 5KG1A 4ZPTR 4ZVGA 4ZHRA 3GONA 3BQ0A 4UQTA 4F4WA 3MEDB 3W64A 1XNRF 4ECZA 1Q5VA 4J9NA 1D9AA 2E5IA 1KR4A 3TJ9A 1HPZB 1DRZA 3ULHA 2BANA 3TNVA 1C4CA 2CQHA 4G1IA 3W9IA 2NREA 3OBIA 3D2WA 2DRDA 2GQCA 2HFSA 3ITHA 3ZO7A 1SQFA 1T02A 5E3PA 5KOWA 1HWUA 3MTJA 2UXCF 2KL8A 3EXCX 1DQAA 4ECUA 4LF8J 1QAJA 4EFAC 2PIIA 2UUWA 3ZZUA 4Q0BB 5KFHA 2KXNB 4KTQA 3O1LA 2VFUA 2OKQA 1Q0NA 5BR8J 1LW2A 5E0OA 2Z8QA 1J5EF 3TUZC 4RW7B 4RNFA 1JMTA 1DQ9A 5GADU 2QEXS 1HBOA 4ZIVA 2ZJPQ 4QW9A 1N32J 2DH9A 4I69A 1VCTA 3P3DA 4O3PA 3HPOA 3LF0A 4OI1A 2O3DA 1SV5B 3OTBA 3CCLS 1QDUB 3BKUA 1REVB 2E1PA 5E3QA 4WIIA 4QJVA 3VAGA 2D3O1 2Z2YB 2XGQA 4ELTA 1F60B 2NZCA 2AW0A 2J0QD 4NA1A 1K47A 2CNNB 1T11A 1QD1A 3TX8A 3LP1B 1B99A 3R5AA 4NCGA 4JI7J 1RTHA 2W7OA 1RWXB 4B3OB 1SJFA 2M3DA 1YBUA 3OTCA 1X4DA 4UY85 4A8XA 2RF2B 1JLFB 5BJRA 1BQMA 1C0UB 4WPAA 1FE0A 2HQCA 2KT5A 4LF4F 4XPCA 3NWGA 4KQZA 3EJMA 2IJRA 4HACA 2DGVA 4ICLB 3Q8YA 2JVRA 3QQCD 3D28A 4H4KC 2R8GA 2AV5A 5LMNF 3PV8A 1HQUB 4XTTA 1EIYB 2GW8A 1Q82T 2GAHC 2DR5A 1H7WA 2HNZA 3MTKA 4N77A 1FXRA 3HHLB 4GKJF 5CXTA 2HVHA 1WOPA 1FESA 2V68A 2JNJA 3TUPA 1S77D 2R7RA 2POKA 4OZ0A 4BC7A 4IFVB 4NMXA 2WVEA 2ZM6J 4K4VA 4QYRA 1LQ9A 3CB4A 5HMZA 4RR5A 4CP5A 4LFBJ 2L41A 2W9AA 2YKOA 1B70B 1NSPA 2KDOA 1V5VA 3PYDA 4J37A 4L3NA 4KGZB 4I6YA 1VYAA 3SCLE 2IBOA 3RB6A 1GMWD 2BKOA 2MLYA 1G6BA 2HHHJ 2GHPA 2EK6A 3KG4A 4LMZA 2DY9A 1N48A 3HK2A 1MLAA 1XEZA 4TNOA 4PG4A 1L5UA 2AIRB 3MD3A 1QTMA 3PRDA 3IG1B 4OI2A 3FMWA 2LVWA 1CULA 3GP9A 5ITHA 2CPIA 3I6PA 3PACA 4XDCA 4H4OA 1RHMB 4KR0B 2WK4A 4WFNQ 2MZ1A 2PE8A 3TW0A 3RTVA 4OX9F 1I51B 1TKTB 4OYIA 4BDPA 1UA1A 4KV8A 2XCAA 2VG7B 1VQYA 3H0PA 2BJ7A 2RDIA 5SZTA 4WU3A 1C2PA 3ICLA 5KFMA 4K4TA 1SQEA 4QZVB 2WVCA 4Z7YA 2W2NP 3QLHA 4U7UK 5HMYA 1JXLA 4RW9A 2B8PA 1FKOA 4IFYB 4YEAA 1L3SA 4DV4J 1GK8A 4EK2A 1NXIA 3MEGB 1DY3A 3HCXA 3Q8SB 3V4MA 1OY8A 3IGNA 4CTAB 2VDIA 2YNGB 3MAHA 4X65F 2LXIA 4I2PA 2HQGA 2NLWA 2M8DB 2M4MA 1VLYA 5LOQA 2DPJA 2VODA 2YPYA 1TU0B 3CW2C 3BF4A 4FVCA 3MMBB 1HBUA 1Y5LB 4DS4A 3NOCA 5A6WA 4JYAF 4IO1A 3KK3A 3TZZA 3HDSA 3CCSS 2Z2LA 5KG5A 4Y2IA 4WZQA 3C19A 2A3JA 3V4IB 4TVAB 1VQ8S 3K5LA 2F4FA 4JB8B 3V6DB 2HVZA 3I31A 5KFQA 3W9HA 1RT6A 4DFMA 1FF2A 1N5VA 2IYGA 2DRBA 2IVYA 4P7VA 3R5CA 2J5AA 1RP5A 3PVXA 3VWSA 4ETZA 2DEJA 2Q3PA 4FPIA 3J7Z5 5KT5A 1YBTA 1C1BB 4A46A 2F7VA 2K7KA 4C0OC 4TQRA 1KHWA 5L1LA 4KO0A 5LMUF 4GRSA 3CMAS 5B7WA 1HBMA 4NLVA 1S7IA 4PXBA 4Q8FA 1HNVB 4P2SA 5E41A 3IWNC 2IDEA 4WFBQ 5C24A 2DHSA 2PI4A 1UWBB 1JLQA 4RW8B 3FSIA 2COLA 5LXRA 2G0IA 4ZVRB 1N5YA 2OD6A 3OLBA 1NRKA 1D0EA 3RAXA 1EETA 1KDNA 2QFIA 3RRHA 1Q5YA 1NZ8A 3HI9A 2BX6A 3JSRA 3DDNA 3FRZA 2IIHA 4C48A 2V6AA 1GH8A 3K89A 3DCAA 4IG0B 4C8YA 1HR0F 1VIXA 1Y11A 2MQMA 3PEJA 1NH8A 1HA1A 4B9LA 2LXFA 4HH1A 3MUVP 2FJXA 2R7VA 2BE7D 4FYYB 4NRUA 1OY9A 3M05A 4O3OA 4OYWA 4ZP6A 4JV5F 4RNOA 2OPPB 3GIIA 3VQSA 2NXJA 4YY3J 1SUQA 1X4HA 2XMMA 2W4CA 2KB2A 3MAQA 1D09B 2IVFB 1S0OA 1PAUB 1RK8A 2Y0BB 2GAGC 2KI2A 1FJGJ 1ZPVA 3CVKA 4C8NA 1DTTB 3UNGC 1TKZB 3P6YC 1BWVA 4CLLA 2Q79A 4PAAA 4KT0C 1CJVB 3RBXA 2QO3A 1TELA 4DMZA 1Y3KA 3OHBA 1RT2A 3NAHA 1T94A 3BO4A 1S6OA 4PEOA 2MTLA 4D3HA 2BOAA 3I5BA 1CJTA 2OUGA 3TQEA 4DL0C 2DVIA 2KZMA 2GGPA 3MR6A 4R25A 2AU0A 1I94F 4JV0A 5DZ6A 4K4YA 2FJBB 1WEXA 3KJVB 3M8YA 1LK7A 5CQGA 1SCJB 2PDAA 1WC6A 5KG0A 1VQSA 3RAQA 1JLGA 4ES3A 3CJ3A 2ZBRA 2M0GB 1S5ZA 3IWXA 4P71A 2J6UA 2PD1A 1WHYA 3GFZA 1LWXA 3OTEA 1WKJA 5JXSA 1Q4RA 2QA1A 4TY8B 3SCIE 5AE3A 3DU5A 2V9WA 3G6ES 4USVA 2FQQB 2CJ9A 5LM7E 4U7CA 4WTOB 4G1QB 2B4PA 5CABA 1LFPA 3OR2B 4ZVFA 1HBNA 1FDDA 3CJKA 2QG9B 1QSSA 3M30A 4GO7X 4EZ9A 1R6YA 2HHUA 2MQNA 1WD6A 4DQIA 1H2UX 2FTRA 3N6MA 1N5TA 1ZA1B 4MK8A 4PG6A 4F04B 2AJFE 2QYCA 2YY3A 4C8MA 4JI1F 3GPAA 4UT4A 4LQ9A 3O5TB 2YX4A 2BXJA 4NE9C 1SIZA 3M6WA 2MSSA 1A0OB 4USIA 3AODA 5JJBA 1S1VA 3GJSB 2XNRA 5F8JA 4CIOA 5K14A 4QWAA 4NLUA 4DL2A 3GWCA 1HARA 2A6MA 3EE3A 1Z4UA 4C8KA 2VKZG 3ELHA 2C22A 3MR7A 3AQOA 4RWXA 2B3TB 2J0SD 4X4TA 2XM3A 2W9BB 4IRKA 1W2IA 1VQNS 2W7PA 3RGIA 1U0SA 2Y3YA 2B4UA 2HPUA 2DR6A 2XG8A 2A2DA 1RA7A 4J9UE 1BD6A 3B78A 1UVLA 3HD1A 5DS7A 4LIWA 3VALA 2DHAA 1JLAB 4DV7F 2XI2A 2B9XA 5A8WB 4LVOP 3R5DA 5IS2A 2O01C 2I1RA 2OPSB 1PYTA 1FERA 1T3NA 4NXMF 2HHQA 2ZH4A 1F5AA 1BY9A 4NZ0A 4WP3A 2IM3A 3QPIA 2NYHA 4N56A 1RBOB 2V34A 3KJQB 1LWFA 4EBCA 1UVMA 2ZVSA 3CMES 2RMLA 1S9GB 3GIRA 3LO3A 5H9FJ 4RUHA 3FQLA 2R7TA 4YDXA 1NJWA 5J1PA 1UPMB 1FCAA 5HROB 3UCGA 1Y4ZB 5HMXA 1HNIB 3N5FA 1J5OB 2R2TA 3CJRA 5HO4A 2A2CA 2E7WA 3MMAA 1F3VA 1S6UA 3L7UA 4LVNP 5HVFA 2VV5A 1PYOB 3M2UB 3OR1A 3DGVA 2ZUAA 4C8OA 1VRTA 4JUZA 4J9VA 2M7SA 2BM1A 4TQSA 1NM2A 1H3DA 2VB6A 2KTQA 3OXGA 4LF8F 1I1GA 3X1LB 1UWAA 2XSFA 1VQPS 2V94A 1YX2A 2B0GA 4DR7J 2C2DA 4R0EA 5CZXA 4M5DB 4OHVA 3MHYA 1BUXA 2XYGB 4IOCQ 1Q7YT 2OSRA 5BR8F 1RWWB 4Y00A 4EI2A 1Q86T 3OVSA 2KYXA 1N56A 3MMCB 1JJCB 1JQGA 1FRIA 4L75A 2RKIB 4F4YA 1N32F 2DH8A 3Q2SC 2V8PA 2R7QA 3JAMU 1FTRA 1BLUA 4PYAA 5J1EA 4IRCA 2MZSA 4K5SA 2A18A 3KUGA 4YS2A 1E6VB 2W25A 2F65A 3R7NB 3QWPA 5BYQA 4ZITA 1Q8BA 2XY6A 4GVBB 1UP1A 5KT2A 3MCOA 4OZ1A 2I6WA 4ELVA 3DHXA 2HW3A 3AJ2A 3PR4A 5F8NA 1JLBA 3K5PA 1VBZA 2FB0A 3NGRA 3FJ2A 2D41A 4JI7F 5DO2A 3KK2B 2ALYB 4Y3CA 3I96A 2RQCA 3D0IE 1XNQJ 2RVJA 1RTJB 2PA3A 4YOEA 4F36A 1AUDA 1CC7A 1RWKB 2AX1A 3F56A 3AQPA 2ZZTA 3J81j 3V6KA 4OZ3A 1YQHA 1VC5A 2EFPA 2JVMA 4J90A 3V2UC 3GIMA 4Q2MA 3KLEB 5KFPA 1BGXT 4WCEQ 2DO4A 4GC6A 5EUHA 4OYPA 2M2BA 3IBWA 2CQBA 3MOJB 1KVKA 3SV4A 2BW2A 1S1UB 4Y34A 2RJZA 4KFBA 1RWMB 4ZPAA 1QUVA 3K59A 1GXLA 2DXEA 2IM2A 5HSPA 4HTJA 2ZH3A 1U45A 3MEKA 1VDHA 2MQOA 3ILLA 3IA0A 2DK2A 2OO4A 3UDEA 3G8SA 1YJ7A 5CYQA 4OI3A 2ZM6F 2MZQA 3EPGA 5A8KB 1KLMA 1IKYB 2OPQA 2E1AA 4DR4J 1Q8LA 5LJ3Y 1IBLJ 4LFBF 1BXNA 3TRGA 2FIUA 4C6AA 2QLJB 4OIXA 1FFGB 5G0RB 1K0TA 5KT4A 4QOTA 2PGCA 3IM9A 3G86A 3NGDA 3G9CA 1GTEA 3DOMB 5LJ5Y 2HHHF 5F8GA 4Y2CA 2UXDJ 4MH8A 1EQMA 3M32B 4CDIA 2MKJA 2P8IA 4OHXA 2VJVA 4DQRA 4P2MA 1C4AA 2X3DA 4Y28C 1HHTP 2ZH5A 2WCXA 1JB0C 1AYEA 2CQ4A 5C2CA 4OL8A 3M8PA 1EP4B 3D6TB 5HN0A 3GV8B 4ZCIA 2MJUA 1XMBA 2DGXA 5KG4A 1F9HA 2DH7A 3PX4A 5MAOA 4BLGA 3MM8B 1T95A 3KDOA 1YTYA 1RT1B 3W2VA 1KSPA 4F7VA 4X4QA 3CULA 4ZIWA 3KK1B 4MYTA 4RNMA 1UFWA 5DLGA 1N4LA 1G7CB 1SH0A 4LBHA 4B9UA 2LQ9A 4K2JA 2VPWB 5KOXA 3DMJB 3FFIB 5EX3A 3RW6A 4DPOA 1KN6A 2LEBA 4HYKA 3PJ9A 4DV4F 2N4DA 2OJ3A 1NAQA 3LAMA 2ZNZA 4YFUA 3PW0A 2Y1JA 2YNHB 1Z2LA 3LW5C 3B82A 4OZLA 5ETLA 1D1UA 3CCZA 5D4LA 4J5OA 4Q45A 5DLFA 2ZOGA 2H3EB 4ECQA 3PX0A 5DQGA 2M8HA 4R8UA 3PRVA 3BKFA 2DNNA 2FDNA 1FX4A 4HEA9 4WIQA 2MQLA 4DN0A 3MUTP 1CSJA 3LALA 2HAIA 2DHXA 1CEZA 3HX9A 3I5CA 1S12A 1WACA 1VC6A 1C0TA 5E5NA 5CYMA 2ASYA 3TVZA 4P73A 3DKDA 2K3IA 1FEEA 1R8AA 4ZA1A 1XTZA 2JOQA 1HD0A 2F5GA 5DDPC 3MF5A 3GIKA 2ZE2A 3BBBA 1RWVB 2VQFJ 5KG3A 1U49A 3G6YA 1X8DA 5GAEU 4O4GA 1RT3A 3TO8A 3PZPA 2C3OA 1XMQJ 1FJEB 1UZDA 2HBQB 3A4TA 3W5YA 1X4AA 1DZ5A 2MMYA 2FZKB 2XLKA 2F8MA 2XZWA 2J0WA 2XMJA 2QA4G 1HYSB 2OFHX 1D9DA 4ZS6A 4FF1A 1SJ4P 2P6SA 3PKYA 2BQ3A 1H73A 5KFCA 1Y7PA 3F0NA 3I38A 1YVFA 2CWKA 2WVFA 1O51A 3DGPA 3T6JA 3BQ1A 2PI5A 4QWCA 4IYQA 4DV2J 1TKDA 1HQEA 2GVZA 3TEGA 4IDKB 3Q8UA 2XCPA 1XC9A 1K1SA 4NI2B 4Y2KA 2ZVIA 3G8QA 2LEPA 2BKPA 1RDRA 4MIWA 1FVSA 2NXNA 1NPRA 4KGVB 4B9SA 4YR3A 2AWZA 3SDEB 5DGBA 3KLHA 2A0FB 1YGYA 3KLIB 4PUOA 2HK2A 1AB8A 3N9UC 2B9YA 3OQ2A 2VZ9A 4RPFA 4U8VA 2LQJA 1X7VA 4ER8A 2YWFA 1C3GA 4CM0A 1XERA 3DOKA 1GQEA 3QO9B 2HS4A 3P49B 1B0PA 1F9EB 2OGUA 1Q81T 1WUUA 2AD9A 1TV6B 1RT4A 1FE4A 2I8EA 2VKRA 1IKVA 4YY3F 2HWHA 4K59A 2ZJRQ 3DYAA 3MFHA 3T1YJ 1FJGF 1FJ7A 1O8BA 4RUAA 2ZUGA 3FBCA 3ILIA 3PEHA 4KB7A 2YWHA 1UAWA 1SI9A 3P45B 3BGLA 2DJWA 1KTQA 4RNNA 4F4XA 4V19J 5B0GA 3OJUA 3DLEA 4KAIA 4QIEA 2A1BA 3FEXB 4YP3A 3EM1A 1TFWA 4J9MA 4XIUA 2QIFA 1FKPB 4IOAQ 3IRXA 3LP0B 3J80U 1FFSB 3T5JA 2XYPB 3AB4B 1RAHB 1AA1B 1KD1T 2IMOA 2BMBA 3LGNA 1N36J 3RAMA 2JLGA 3I9ZA 1U1KA 1S9EA 2AEJA 2VJUA 3F41A 4MTPA 2J76E 4OLPA 2OD4A 2AZ3A 3AA9A 2QYGA 1UFLA 2ZBPA 4JOUA 4NLXA 1KLNA 1FNOA 2F4VJ 1RAEB 5K5MA 1M1GA 1OSCA 2I38A 2XSJA 1YHQS 3DI6A 3ET6B 3LPEA 4ED1A 2B6AB 1YRXA 1H72C 3HF5A 2EKNA 2HHVA 3N4WA 1PG5B 2FVPA 4O44B 4XK8C 5EDWA 2DNKA 3KDNA 3ZFVA 4AQYJ 1RI7A 3QGGA 1ZETA 5J2NB 2G0CA 1VRQC 2CIMA 4JP8A 2CVIA 4FDFA 1W25A 3BSCA 2CJKA 3TJ8A 4DQPA 3TZYA 2DO0A 2Y1RI 2MLZA 2UZAA 2YH1A 3CCRS 3VQTA 2F8HA 1UFKA 3V6JA 1AFIA 4M5JA 1WDTA 5B0EA 2IAJB 3ZTSA 5M2PA 1IKWA 3I0SB 2DTJA 4ED0A 2LXUA 1DFDA 4EYHB 1T7PA 2JLFA 1JIHA 2OEMA 3HULA 3GV7B 3BQ2A 3H2VE 3DM2A 5B0DA 1TKXA 2MQ8A 5AXLA 3RBEA 4ERDA 1M5OC 2ZD1B 3AJDA 3UW1A 3VZIA 5KG6A 3GV5B 5SUHA 1MWZA 2V2QA 4G3IA 2J8SA 3CCUS 2YX7A 3DC2A 1F2HA 4TU8A 4OI6A 4UOCA 1BWEA 3QWUA 1H74A 1R0AA 5I42A 3BYRA 2FUG9 4QWBA 5C42A 2JFKA 3F44A 4NPOA 2UU9J 5F8HA 1UVNA 1J27A 2I2YA 3GJQB 4QU6A 2MKSA 2ZOFA 3HJFA 3NBPB 1IVZA 1OO0B 2Y9HA 5JVGQ 2MDAA 3BSOA 2IYIA 3Q24A 2HZVA 1UVIA 4AXIA 3GR1A 4NYOA 1TVRA 2JEJA 8AT1B 1CLFA 3A3PB 4F0MA 3HHEA 4CYUA 4LF7J 3MM9B 2JEIA 2GJIA 5GMKa 1XN9A 3C6TA 2KN4A 4ZJOA 3CJTA 5AE1A 3HFVA 4V1Ak 2Z2MA 4KHPJ 4PXDA 2QE5A 3C16B 3WHIA 3RJMB 3QJPA 1F6TA 2C42A 4OQJA 2HWIA 4ED7A 1SJRA 4TY9A 4CLTA 2XMWA 4NLPA 2DPIA 5HAOA 4CH1A 3H7HB 4F3QA 4Q5VA 1SPBP 3DLGA 2E9TA 5EGYA 1B7FA 4BWMA 3EYZA 1RZMA 4OX8A 1IKXB 2J9DA 3VVUA 1WG5A 6AT1B 3U02A 1LWEB 1LW0A 5F41A 3B4DA 3BN4A 5IZHA 1MROA 3A13A 3EVWA 1FRJA 1YBAA 4LSNB 4YQWA 1IWAA 2YKMA 3QT5A 3UCUP 4C2MA 2C3MA 3SCKE 1MMNA 4DR7F 4LRDA 2IY5B 1VK8A 1EZZB 1QM9A 4RX6A 3D0GE 4ZKAA 1KRPA 2MSTA 3UDLA 4RBTA 2QSFA 4RKUC 2ACYA 3I0RA 3C6UB 4AXJA 3MGJA 4ANEA 2MKHA 1U8SA 3K8VA 2BOPA 2B43A 1F9FA 1WKKA 2HFUA 4NZ7A 3I4PA 4I68A 3FZBA 4O0IA 1PJ6A 2AQ4A 3DRPA 4PWWA 5KFSA 1NB2A 3GG0A 4NX9A 1OQ6A 3A3NB 3OD2A 4EO6A 3KLFA 2BVZA 1GXTA 3LQVA 2LLZA 3BGFA 4LFAJ 1T8EA 2MQQA 4DR2J 1XNQF 4PZVA 2H51B 4FNHA 3ZZPA 4DWIA 3H5UA 1EQ0A 5J2MA 2ZJQQ 1YIJS 1NHUA 1V3ZA 1MNEA 1YJVA 2J7WA 1RHKB 2HNYB 3OUYB 2D9OA 1YRTA 2L48A 3CGIA 1K73T 3BS9A 4B3RJ 2QGFB 1RYSA 1UCNA 2MJNA 4PQUA 3NWRA 1QSYA 2FLLA 3C15A 1ZH5A 2BZ2A 4RU2A 4ES2A 1F5CA 4O3SA 3EGWB 3FBFA 1Q8KA 3ILJA 3HHLC 3CJ4A 1VIOA 2AZ1A 4ILLA 1UEUA 5DDOC 4I56A 3P96A 1HWKA 3T41A 1U0HA 3AOCA 3G71S 4LF6J 2LFVA 8ATCB 1P6TA 2DCLA 3ADAC 1YJNS 4GO5X 5F8LA 4QYZJ 1T05A 4ID5B 3CCMS 4OJ3A 2R7SA 3E3XA 4DR4F 1IBLF 3VF0B 4WE1B 2L3MA 3K57A 3M6XA 5JMNA 4PPZA 4ZVQB 1G2EA 2C3UA 4CO5A 1FA0A 3QAEA 3E51A 2XMKA 2QMWA 4OYXA 3NNCA 3THPA 2DNLA 3OPKA 5CH7B 1RTDA 3MM7B 3E01B 2J9DE 2MZTA 5IT4A 3CJSA 2ILYA 1FKAF 1TK8A 1HFEL 4M1KA 3Q22A 2XHCA 3R27A 1WHVA 1JJHA 5GAHU 5KFTA 2W9CA 2R9LA 2MKIA 3BGRA 5A76A 3GILA 4AYBD 2IA0A 3WC2A 4C11A 4BCAA 4P74A 3QT7A 1FRKA 3SIPB 1ZAXA 3K5NA 4FXDA 3WBZA 1U1PA 2RSQA 3GU0A 2VH7A 3IAM9 2R2RA 1VQLS 3H2LA 4ATNA 4J9RA 5IC6B 3IMQJ 4HDGA 2VICA 3TAMA 1S9FA 5DG7A 2ZC4A 4KC5A 4NCAA 1GT8A 3BBCA 2MHNA 1NLTA 5HANA 1NKCA 1NDCA 4S0MA 2MGZA 3NL0A 2N7YA 3KNAA 2WONA 4URQU 3HT3A 1PJ7A 4E2FB 3UDCA 3I9V9 2EC0A 5FIIA 3V81B 1C1CA 1N5QA 1B7YB 1FEHA 4DR5J 4KHRA 2HQFA 1CG2A 4W90B 2EBGA 3D4JA 3QSYB 3BN7A 3DLKB 3RBDA 2OPRB 2E9RX 2DBBA 1K0VA 4ZLPA 3BDEA 2OLWA 2QLFB 2CQ1A 4OYBA 2ALZA 2VG6B 2WRMA 4K4ZA 3PTWA 3VGUA 3KXDA 1WKLA 1NKEA 2VQFF 3VTIA 3SXLA 2KFYA 3BR8A 3HVAA 3KKFA 4KH0B 2GFFA 2JWNA 1GAOA 2IC3B 1RT7B 5IWAJ 1XMQF 2GA7A 4J7CA 4DL7A 4W92B 1U6FA 3M8ZA 2C2EA 3C2PA 4MYUA 2I5JB 5KFWA 5H1SV 3ENWA 1CJUB 2XTJP 3HHKA 3C5XC 4PKDB 4Y6IA 3OL6A 2FHOB 1GMUA 2ZEJA 2QZ8A 4JI3J 5J2QB 2NXUA 1JK9B 3N5BA 5ADZA 1X5OA 5GAGU 1Z2ZA 3DN9A 4B3TJ 3NY0A 5HBMB 1FDBA 3IC1A 1OMSA 4DV2F 4A47A 4I7FA 3ZXWA 3OL8A 1VBYA 2VOOA 4B3SJ 1H2TZ 1NK8A 1RE1B 2WW8A 5CD4H 3M4XA 2YQ0A 1FTCA 4OYMA 4HHUA 2O67A 1GX6A 1NDPA 3D1HA 3NS6A 3H98A 2AEMA 2OEKA 2KT3A 1HHQA 4KY3A 4DHVA 2WVBA 3MEEA 3J7YU 2JHEA 1EB0A 2ZBQA 1D8ZA 3GCXP 3SQOP 1WTBA 1E6YA 2BANB 2D7SA 5IXUA 8RUCA 2K3KA 5IT9U 1E6VA 1XR6A 3ITHB 5KFZA 3T1YF 3HKWA 3O2IA 2HNDA 5F0WA 1VC0A 1S10A 4KBIA 3TANA 2WBMA 4WJBA 3MM6A 5T7LA 2KKHA 4K5RA 3W65A 3H59A 4YHHJ 1H2VZ 4J80A 3PCOB 1LW2B 2L9WA 1LV5A 3BM7A 1WOOA 5B0FA 2RU3A 3I5AA 4ECWA 3MPWA 1HBOB 3UQSA 3I32A 4M5KA 3R3TA 4ZCLA 4JBCA 4ED5A 3KG1A 3KUEA 1TL7A 5KFNA 4YDDB 4H4KA 1N36F 3KLEA 4BBYA 5FLXU 2E5GA 3H4DA 5D4OA 4RUCA 5KFAA 3T9NA 2PA8D 4LIRA 2B7CB 3D68A 2F4VF 4NXNJ 1RAOA 5F8MA 3HFZB 4QR1A 2JSXA 1SL1A 1TTHB 2M70A 2XNQA 4RW6A 4OYAA 5FDLA 3CWJA 1ZAVA 3E8OA 2HBRB 3MPVA 4H54A 4NCGB 1RTHB 4CO2A 1GNKA 4PQAA 5E3AA 3HM9A 3UNYA 1SC6A 4AQYF 4FBUA 3LWLA 1NDKA 4X4SA 5KFYA 3ZZTA 2J6TA 1BQMB 4LUBA 2OIHA 3P4UB 2HBYB 4HACB 4C8ZA 1JNRB 3RR7A 1R31A 2V5HG 4DX6A 4UTGA 5BYRA 3QAUA 3K2YA 4CLPA 2UUTA 1ZTTA 3M2RA 2HNZB 4RWWA 4OJGA 3G8TA 1U4BA 4FKXA 4NLRA 3THVA 3GR0A 1NJIT 1OSDA 1D8YA 4NCBA 3GJTB 4WP8A 3TQ1A 2ZBCA 2VIHA 3HVTA 3K8WA 5IFMA 2HMIA 4DV0J 4ECXA 5DG8A 2DD8S 1YLXA 2KXFA 4M5NA 1B0TA 3BSNA 2HWTA 2HGMA 1Y5IB 4P9SA 4QR0A 2JH3A 1DQ8A 2RHSB 1PO6A 1NK6A 2Z56B 1UMJA 2BE2A 3IWLA 4W4MA 2R7WA 2XY5A 1D3WA 4FYWB 4LF9J 4BS2A 4K0KJ 3K7RA 2MPUA 1VHFA 5HL7Q 2UU9F 3HO1A 5D4PA 1ZZFA 3BO2A 1ICEB 2BR0A 3QIPA 3ETMA 3DOLA 1DLOA 1WI8A 5CD4A 2HRUA 3C46A 3RR8A 2EKYA 3AD9C 1PCAA 1RISA 3M6UA 3FEYB 2R2UA 4WKRA 3PHEA 5H9FK 1OIAA 2LQBA 5RUBA 2BV3A 1QAXA 1MG7A 2YWGA 4N8OA 4A48A 4H4OB 3BREA 5AT1B 5KFGA 5K8NA 5ETTA 3JQMA 4LF7F 2DNPA 1ZAWA 4DSLA 1HWLA 1ACMB 4KV8B 1UVKA 1RHUB 3ENAA 2CKWA 1NEEA 1IR2A 4USTA 3M1VA 4KHPF 3BO3A 3MPYA 2EG2A 1L3VA 2LA6A 1FHTA 2K2PA 2VBYA 4OX6A 4HT5A 4G65A 4NYPA 3DDIA 3TOQA 3PO4A 3CCQS 3AY0A 3AJ1A 2PMWA 2AYEA 2H4WB 1S6QA 3C14A 2WTFA 2VD3A 2XO6A 4I6AA 3QLHB 1QE1A 1HKAA 4RW9B 3M8QA 3M2VA 1FKOB 4PCQA 3THTA 4BWJA 4I2QA 2KG0A 2W1BA 2CJXB 3CC4S 4H4MA 3SZ2A 3VGSA 1K8AT 3OVBA 3FEZA 4F4ZA 3T5HA 1CVJA 2NZ4A 5L1JA 2YQ1A 1NJZA 3AOAA 4I2PB 1UA0A 2QL5B 2VU5A 2F1FA 2FHJA 3BGOP 3G2XA 1R8CA 5HQMA 1FD8A 4BC9A 2FVQA 2DNGA 2MB0B 1HI0P 2MYFA 4X4VA 1X4FA 3GMGA 4HT7A 2CXEA 1HMVA 3KK3B 4PWDA 4AD6A 4IH5A 4ECSA 4WBFA 1A9NB 4C0BA 1LWCA 1NU4A 3CJ2A 4JI2J 1B0VA 4ZCMA 4DPXA 4WWSA 2XWYA 1B64A 3R5JB 2EG1A 4F3OA 5GMDA 4GC7A 4E98A 1RT6B 2FHMA 1MN9A 3Q8VA 2DNYA 1RTZA 2K7JA 4PG7A 2XBPA 3NMRA 4Y2AA 1ZOTA 5ETQA 4ZJQA 1O0PA 4PYDA 3CC7S 1XJWB 3PO5A 4N8NA 4LFAF 3GZ7A 3FSXA 4DR2F 2OI2A 2ZHBA 3GG1A 3LP2A 3WDOA 1M0SA 2ZDOA 4KO0B 2CZ9A 3O44A 4YR0A 4DXLA 1HBMB 3SFUA 3DRRA 3PIPQ 4X64J 4K8RA 5C24B 4B3RF 1IM6A 1JLQB 1RA6A 3W3SA 4DFPA 3CXCR 3JSBA 1N5YB 5K9FA 5L38A 4DJBA 3TUJC 1HIYA 1OQ3A 4DI6A 2MLXA 2PSZA 2WOMA 1HNZJ 1YRUA 2JEGA 1TL5A 2VASA 5B0CA 3A1YG 4ILRA 4Q8EA 4M95A 1AUSL 2O1PA 1Y5NB 2W24A 3DRXA 4IH6A 4DDFA 3PW2A 2WB4A 2VFTA 2JZ8A 1UZHA 3JYTA 3TAPA 3X3UA 2CNLB 4LF6F 4CCHA 1U1RA 3SV3A 1RT5A 4V19X 4HVZA 3PHTA 4QW8A 4N41A 1M5KC 3HP6A 1URRA 1TL3A 1U2RA 1FDNA 4DPTA 1SUQB 2FJWA 4ILMA 4NWBA 3ZZOA 2X3GA 1UW9A 2WW4A 4K50A 4WTYA 3RYLA 1TK0A 2QT7A 3TZXA 4YB6A 3IR5B 2OEJA 5J1NA 2L08A 1OPIA 1RT2B 5I3PA 2XY7A 2CJQA 3MWBA 2B5JA 1CJTB 2D3ZA 3QBCA 3CJQA 4DEZA 3MR2A 3TA1A 4RBUA 2R4FA 3LOUA 5DGAA 4OZ2A 2P9GA 1WF2A 3AAWB 2B4VA 5IM0A 5D3GA 2C3PA 2HHSA 3TZWA 4NLWA 2HFNA 3PFOA 2AMCB 4DCPB 2G13A 3AB2B 3HJVA 4DPWA 4K4XA 2FGCA 1WJ9A 4KRWA 2MZRA 3I55S 4LRFA 3W8PA 2CPYA 3PJXA 1JLGB 2CQ2A 5C25A 2OMOA 4U9RA 1V3SA 4CO0A 5A2QU 2DIUA 2LU1A 4LQ3A 1N34J 1OWXA 5HLFA 4C7QA 2P5VA 4KGMA 2YQ3A 3J80Y 4DU8A 2CADA 2FY1A 4A8SA 1S97A 1EARA 5I4MA 3AD8C 3NLCA 4B17A 1Y9OA 4W98A 5HK4A 1HBNB 2V69A 4ZVUB 3CJKB 2V8DA 2MKCA 3U1LA 3MCNA 3EZ5A 3M30B 4UOGA 1WC1A 3ISND 5KFRA 3IO1A 1SC1B 2V8GA 4URSA 5F9LA 4DR5F 4ECTA 3BZQA 4C8LA 4EYIB 1VR6A 2IRYA 4C9DA 2ADBA 2CQGA 3PX6A 5A0YA 2EBEA 9RUBA 1NK9A 4KE5A 4OV1A 4B9MA 2V2ZA 2EEYA 4TU9A 4FPRA 2XULA 1S1VB 5EHHA 3FCWA 4CLSA 2VDHA 4TLRA 2G9OA 4F0KA 5K14B 4C97A 3HMJG 2VG5A 4ZPWR 2RUGA 4HKQA 5LT5A 3K0JA 3EZUA 4FP9A 2UXBJ 2ILZA 3ILOA 3TI0A 3TA0A 4USHA 4YMEA 3UO0A 4CO3A 5IWAF 2GMLA 1RACB 2V50A 3GFYA 4DSKA 1SKWA 1IBCB 1Q7LB 2RQMA 2E7XA 2D9PA 1EKRA 2JFDA 1P9QC 1YJUA 1VOMA 4JI8J 1NSAA 3OW2R 3H42A 1KNZA 3T1AA 3VCDA 5CHCB 2MZJA 2X7IA 2C2RA 1HNWJ 2Q6CA 3VVTA 5CYJA 3AH6A 4JI3F 4DS5A 3Q2TC 1JXEA 3SEOA 4KYZA 2JX2A 4B3TF 3H40A 4CH7A 4PG8A 1I5OB 1RTIA 4EEYA 4B3SF 1S1WA 1MWQA 3NG8A 4IUFA 1LEOA 4IG3A 2VHGA 2OMLA 2CNKB 1LWFB 3I87A 2KM8B 4IOBA 1U47A 2ASJA 3D0HE 2HQIA 2DKOB 3E2EA 1NMEB 2IHR1 4HDHA 4O23A 4Z7CA 1APSA 4RW4A 2UUCJ 4YN3B 3AD7C 1DTQA 2HGNA 2L9NA 4E8UA 4LRAA 3MMAB 1VLOA 4CLZA 2IRUA 3IS9A 5CA5A 4DCOB 1VQOS 3S01A 3OR1B 1WWHA 1S6PA 1VRTB 4HR2A 1SC4B 3G82A 2DISA 1WDDA 4FXWA 2ADCA 1RWOB 4EUVA 2XZDB 1RQ0A 2R3VA 1VI7A 2ROPA 2O5DA 1JKHA 1LK5A 2R7UA 2N3OA 2RD5C 1KKHA 4MK9A 4YHHF 3OTOJ 3SSSA 3TWZA 4G1PA 5M2RA 7AT1B 4NA2A 4HH0A 4R5PA 3N0VA 3BGUA 2XLJA 2NCKL 2PMZD 3IR6B 4OJHA 3NS7B 4HTIA 1HWJA 4USWA 3EGVA 2V2VA 1W2BR 3W5ZA 3S1TA 5D4NA 2OELA 3LH2S 5J1EB 3EX7B 1R8PA 2NSBA 2ZNYA 5F3TA 3NAIA 3W2WA 4MIAA 3RUBL 1SJ1A 4NXNF 3W1YC 1Q1KA 2ODXA 1XAOA 4X66J 4DQSA 2LQ5A 2D69A 1Y3JA 1JLBB 1VQ5S 2VA2A 3C66A 2E5HA 3FRYA 2IPOB 1XMOJ 1U02A 3GYGA 2EC2A 4Q44A 3QATA 4L76A 1AROP 2IM1A 2P9CA 3UE2A 3EZOA 3EDRB 3D3CJ 5EN1A 2C28A 3ZNUA 4URGA 1LOUA 1NHVA 3D67A 2UP1A 1NCLA 2GX8A 3PIOQ 4FN5A 3T1HJ 1YJ9S 3JSMA 5AE2A 4M94A 1F3FA 4KFBB 4DSIA 2BA9A 2W4DA 3KOAA 1JWWA 1UJ6A 3IBCB 1DHMA 2IJFA 3A8KA 4KKOA 3L95X 1TQLA 1U7LA 2XWXA 4B3MJ 5J2PA 1KOHA 4CRJA 4L6V3 3T5KA 3HKZD 5CYQB 2JEFA 4DV0F 5HQLA 1KLMB 4KGXB 2OPQB 2EPIA 3GIJA 1S0MA 3RB4A 1VJWA 4CNYA 1U2CA 3UWTA 4HLBA 2JC0A 2DNHA 4FYXB 3FSYA 5JUMA 4LF9F 2EWHA 3FVYA 1SBRA 4K0KF 4AE5A 2K1RA 2DNQA 1SL2A 3UPFA 2I9SA 3SQGA 3TAQA 4DX7A 2QL7B 2ZWPA 1CPZA 3OFEA 3KLGA 5HJXA 5AJ3J 3HLUA 3POTA 3JB9k 2FD2A 1RCXB 3HVWA 5GADI 5HATA 2VPZB 4TXSA 2XS2A 1YSJA 1TUVA 3M8PB 2P2CB 2VOPA 1CC8A 3OXFA 4FXVA 1RXOB 2YWEA 3QGPA 4WFAQ 2HEKA 3W2VB 4EBDA 1IJFB 2W2MP 2HYIB 3KMQA 4RLEA 2ZH7A 2YKNA 3CIMA 2BE9B 2WB1D 1HHSA 1ITPA 3MPDA 4P75A 3D6HB 2Q66A 3MR5A 4X4RA 3U7JA 1T03A 2VBWA 3MR3A 1YK9A 5DG9A 2OTJS 1QY7A 3LUYA 4CT9A 2HS0A 2C2OB 3A3OB 4DOZA 2BKNA 2XEXA 1ELOA 1NK5A 5LSRA 3NMAA 1IM4A 4X84A 2GNKA 2FVCA 2D3UA 4R8UB 4MT1A 4DL6A 4X4NA 2X51A 2NUHA 4LF2A 4LR8A 2YNFA 3KG0A 2ZH6A 2QMXA 2FVSA 4O3QA 3M8WA 5HP1A 3BYPA 2HIQA 5I3UA 1KBRA 2BJDA 4P72A 2HIYA 2MKYA 5BYSA 4Y0FA 3IFEA 1P1TA 5D6GA 1S57A 2FYXA 1U6BA 2GQ2A 2DIVA 1C0TB 4DR3J 3MAAA 5CYMB 4FF4A 1BQNA 5KFLA 4NLQA 1CJKB 4PR6A 4MKVA 2QLWA 4LRBA 4JI2F 2FLPA 2ZE2B 3VGVA 1NPPA 5B0AA 4ZVOB 2QLXA 2KYZA 3WX4A 2YNIA 4O4GB 1RT3B 1P8GA 1S79A 3TX0A 4CWBA 1WG1A 3B6BA 4B9TA 2FJDB 7FD1A 2C2ZB 4FKYA 5HMWA 2VFVA 2YVSA 2N4CA 3MM5A 4MKYA 3BH6B 1RABB 2DXDA 4OV6A 4AT1B 2JZ5A 2W8LA 1IUJA 4GVLA 2CNOB 5DM7Q 3SCJE 3VAFA 2CPJA 3RRGA 2HK3A 4X64F 4N5SA 2H48B 3DGPB 3PXGa 3ENVA 5T14A 4UZBA 1HQEB 2VBZA 2M52A 3GCWP 2GVZB 2DYAA 1RYRA 1KWMA 3FKBA 4DG1A 5HJYA 4LSLA 2LEAA 1X5PA 4P7TA 4Z37A 3W60A 4HL9A 4QYZK 3PM9A 5H9EJ 1HNZF 2FC8A 4OHZA 4F2RA 1N6QA 3KLHB 4U8YA 1FK9A 1U1NA 4PUOB 3U27A 1F1BB 2JJ4D 2W2QP 2ZITA 2DHHA 3T6BA 1SKRA 4O3NA 2AEFA 3ZTRA 1TP7A 3DOKB 4WKYA 3MECA 2PFDA 2BQRA 4ZLNA 5KFOA 1AW0A 1TL1A 1UL3A 4DL5A 2J9EA 1XIQA 5FJ4A 3WQPA 2X1FA 2J7KA 1ZM2A 4ZCKA 3HSZA 4FBTA 1YDLA 1RT4B 1LNQA 4JI0J 1IKVB 1JLCA 3DYAB 1CS4A 3LGHA 5C5JA 1FRXA 1VRUA 2U2FA 4CLWA 4TKTA 3OSNA 5CCLA 1H7XA 4AL6A 2ZH2A 4LFCJ 3SFGA 3Q83A 1R6VA 3CSKA 3DLEB 4L74A 1HQ2A 2V4JA 4RUBA 2RDJA 5IT9Y 2DGUA 1X9SA 4IKAA 1S1TA 4NLGA 5LSOA 2XMAA 3DRSA 3IRXB 4DUTA 2J9CA 1OYEA 4A8YA 2CQ0A 1L3TA 1WHWA 1FRHA 2WSCC 3MPUB 4ECVA 1S9EB 3P5TL 3EWGA 4UW2A 5KFUA 4M5GA 1QAYA 5AXMA 1I6JA 3UVJA 2XSJB 3FNNA 2IRXA 5KFDA 1N34F 3DI6B 5EWGA 2VFRA 1FRLA 2EFNA 2KG1A 3D6FB 3JS9A 2EXUA 1GMVA 1RAJA 2HVDA 3KMSA 1TR0A 5FLXY 3BV8A 1VQ4S 1G4CA 1HLWA 1SB6A 4U67Q 5K8PA 3O8WA 4DCJB 1WORA 3QJJA 4DR6J 2LA4A 1MU2A 2MHEA 4NLYA 3T19A 3BJYA 4IRDA 4ZN3A 3M7VA 1X5SA 1AZSA 3NEKA 3IBFB 2BBEA 2XB2D 4MFBA 1R0BG 1SH3A 3N6NA 3G96A 2ASLA 1IKWB 2XS5A 2J8AA 3GB0A 4IH7A 1WTFA 4J9QA 3R7SB 2XMUA 4TYBA 1XWLA 4ZK7M 1UTAA 2DNRA 4QIGA 3ISZA 1TK5A 1JLEA 3T5LA 1KVIA 3LA0A 5DETA 3EXYA 1T9TA 3DM2B 1TKXB 1V5IB 1SJ3P 4OLOA 1S1XA 1JJ4A 2DCUB 4YUDA 3I4HX 3EGZA 4Q2LA 2YX1A 4CO4A 4DZDA 2PT0A 2UXBF 2DNZA 2GVDA 4OYZA 5A8RB 2E29A 2CQIA 1F2GA 2IBKA 5E7OB 1WF0A 3NGKA 4DF8A 4PXCA 4O3RA 2WVDA 3MEDA 3CNQP 3GYXB 4MMOA 3H2UB 3CDBA 1R0AB 5I42B 1HPZA 3W62A 2N82B 4JI8F 5C42B 4C3MA 3D1OA 3CO9A 2KU7A 2CQPA 1HNWF 2BABA 1SXLA 4MK7A 3UR0A 3FMBA 1IQZA 1R8BA 2FVRA 2ASDA 1TMJA 1M5SA 2ZFHA 4PRFA 4PABA 5D0HA 1TVRB 4Q0BA 2RH3A 3CJ8A 2HGLA 2CPXA 1X31C 3KHLA 4CYUB 3AFGA 1QTNB 3C6TB 1RBAA 4J9KA 4RW7A 3ZTOA 3ONQA 1FJCA 1KQKA 1UJ5A 4USJC 5KFEA 1PYSB 3HZGA 2XLIA 1SV5A 5CAAA 2UUCF 4DL4A 3DLGB 1WSVA 5L1KA 3KFWX 1REVA 4B02A 2CQ3A 2BJ1A 5D0RA 4PG5A 2B51A 4ENOA 4CZCA 4XDDA 1LW0B 1FO1A 1Q78A 1S76D 1T0TV 2OHDA 5THWA 1MROB 3GSDA 3LP1A 5EWFA 4O4RA 2YKMB 1RKIA 3KLVA 3AA8A 4Q7AA 1QVFR 4B3OA 1NO8A 3OVAA 2GCFA 3D7SB 2EFVA 2BM0A 3OTOF 2RF2A 1VJQA 1JLFA 4N76A 1PGZA 4KJIA 2DB1A 1C0UA 2VC0A 2VFSA 2H5EA 3PW5A 2GO9A 2W4PA 3S6EA 5D77A 2CJYB 5IQQA 2HKEA 5GMEA 3R97A 4ICLA 4IR1A 4O0NA 1FXLA 1Q16B 3GJRB 5LXYA 3R1HA 2Z0GA 1WSRA 4DU7A 1HQUA 3I0RB 4R0JA 3TVKA 3LZ8A 3NGSA 1ZM9A 3HSGA 2HVIA 1PSDA 2HZAA 3R6GB 3M9MB 2QLDA 3HHLA 2ATLA 2ROEA 3GYNA 1U24A 2HFVA 4DUYJ 3DRPB 3W5XA 4X66F 1IBKJ 3KLFB 1WG4A 4IFVA 4IO9Q 3ZNJ1 4LF5J 3VZHA 1VQMS 3CIZA 1XMOF 3RU0A 2FHJD 4NLOA 5B09A 2LKZA 5J2MB 3QGIA 2YTCA 3QRRA 1V3RA 2EVZA 1X0PA 1U1MA 1VK3A 3AXKA 1QAIA 4QCLA 4ELUA 2LYVA 3EDQB 4QIFA 4EMDA 3JXOA 1PBUA 2WBRA 1RJJA 5T41A 3FK4A 4PXEA 4PQUB 5E33A 2NUUG 4ZLLA 2FJEB 1NSKL 3BPDA 4WP9A 1PC4A 3T1HF 4DV5J 2EFOA 3F73A 3C15B 2NS1B 5DDQC 2LP4A 3IG1A 1NLKL 1FT8A 3CCJS 2QX0A 1NBEB 3DDKA 1HWIA 3Q23A 2Y8WA 1QSLA 4ZN1A 4OZNA 4F25A 3RRKA 4B3MF 4J9LA 3OTDA 4DR1J 1NK0A 1XK8A 4RU9A 1TKTA 3U1NA 2Z57B 1U0HB 1RB0A 1NK7A 2E1CA 2G2OA 2VG7A 3R1LA 4JI5J 3Q86A 4CLKA 1T05B 3H5SA 2RU9A 2EI5A 3QNWB 1W26A 1VQ6S 3JQJA 3JTPA 3C8YA 5KFIA 5M2UA 2EFGA 2QMUB 3H5XA 9ATCB 4F02A 4Y2MA 4ZDNA 2XGPA 4UZCA 1N0UA 3KUHA 5AXKA 4LBIA 2X1AA 1YI2S 1IR0A 4ZPBA 4IFYA 1JXVA 2RHQB 1PKUA 3MMJA 4ID8A 3DLLQ 3MEGA 1DBDA 4QR2A 1Q8IA 2HLTA 1U6ZA 1FD2A 3GQCA 2R8JA 5AJ3F 1X60A 3FBBA 3CT9A 2KRBA 5E2QA 4CTAA 2DNOA 3FDSA 1RTDB 4J91A 2YNGA 1I3OB 3PRBA 4LREA 3K17A 4DZ6A 1AT1B 3L7OA 2JDJA 3J81U 2M88A 2V9KA 4K7QA 4TYAA 2HVEA 1RAFB 2HFOA 3EUNA 3OFFA 2W9CB 3BGRB 1QJHA 1EKSA 2BJEA 1X4BA 4C11B 3MMBA 1FXDA 4ZJLA 1WNEA 3M8SA 2ABYA 1BMQB 5BXIA 1F5BA 5IQ6A 5E3CA 1YZ7A 2FLOA 2AHOB 3V4IA 4LRCA 3CF5Q 2GIFA 4NLDA 2H65B 3TAMB 3CD7A 2Q1LA 5IV4A 3V6DA 4A8FA 2YPZA 5C2GA 2UV8A 2RUSA 5F8IA 2CPDA 1S7HA 1AXQA 5L1IA 1B4SA 3Q8QB 2MGZB 3VGTA 2WONB 3GFXA 4XPEA 2FHKA 5A2QY 2RRNA 3NRBA 1RUSA 3BDPA 1C1CB 1N33J 5KT3A 1C1BA 1RAIB 4F67A 2N3LA 2GIRA 3KWMA 3KHGA 4C3KA 1CBKA 2HRYA 5KFFA 2A6OA 2BEFA 2V0NA 1NUEA 1HNVA 3U1MA 3CDEA 4DR3F 4DV3J 2Z30B 1U1OA 1UWBA 4X4OA 4RW8A 4ZVTB 3EVOA 5AXNA 3R6LB 2OSQA 3B4MA 4KPYA 3QZ7A 2E5JA 4HI2A 3ZTQA 3LAKA 3HD2A 3R2DJ 2VONA 3BEGB 4HHJA 3IM8A 4J9PA 1A7GE 3W66A 4MKAA 1T9UA 1NSQA 2KT2A 4K4WA 3FC9A 5KFJA 1FNXH 2XC9A 2XMTA 1BE4A 1WEZA 2OFGX 4IG0A 3OFHA 4KHMA 2ATCB 2R42A 1SH2A 1D9FA 3C6EC 4ZP8A 3K5OA 3OXLA 1ZYQA 5B08A 1MN7A 1GXUA 2C2NA 4LF1A 1UPPA 2C1EB 2OPPA 1M5PC 2HLUA 3OV7A 3PW7A 4JI6J 1PILA 2LU2A 3L09A 3KYLA 4U96A 2AT1B 2AJ0A 4WF9Q 2DGOA 5KT7A 1GTHA 2AYMA 1IR1A 1DTTA 1TKZA 1QVGR 2XQCA 1FNMA 1CJVA 2DGTA 1S0VA 1FWLA 1X5TA 3OSPA 2RNEA 3I56S 4I7FB 4DUZJ 1S49A 3QIDA 4ZVHA 3BPSP 1R27B 2GMJA 4AL5A 4TU7A 2GJFA 3UDVA 4OZ5A 1ZM4A 5KG2A 1U48A 4UOHA 2YWWA 5ETOA 2AKWB 1SJQA 3KJVA 2EFQA 2B9EA 2B4OA 4PWUA 1GFWB 3CO0P 1KHVA 2VBXA 3NKYA 1U1QA 3MEEB 2CZVC 1S4EA 3RW7A 3SI8A 1E6YB 3KNGA 4JI0F 3ETOA 2GS8A 3UD4P 5B0BA 4ZPDA 3DLHA 2V4RA 2ZH8A 1SKUB 4NEYA 2KHDA 2ZDPA 2HNDB 4X2BA 4TY8A 3MM6B 5T7LB 2H54B 4LFCF 1Y0HA 3US5A 1VMBA 4LT6A 4G1QA 2HQDA 4CLFA 3PJWA 4WU2A 3OR2A 4ED2A 4QWDA 3GLJA 4KPCA 4DX5A 2UUBJ 4QPXA 3VR1A 1L3UA 2ZHAA 2BJ3A 4KH1B 1WHXA 2KJWA 3VAIA 1LXNA 2HHTA 1VFJA 3BH7B 2CAJA 2E1MC 5FD1A 4OMFG 1TL7B 3DXSX 5MLCV 2KRRA 3HHDA 2E5LJ 3JSYA 4OJ1A 3K5MA 4OYOA 3M9OB 2P9EA 5GAEI 2G0JA 3NCPA 2VPXB 4M8LA 2X1GA 3IR7B 3P5BP 4LR7A 1TL4A 4DV6J 3L7PA 1T9VA 1SC3B 4JI4J 1P27B 4A8QA 4TLQA 4RW6B 2F8EX 5FDLB 2HSEB 1ZTWA 1MW7A 5DQIA 4ETXA 2BUNA 7FDRA 2BJ8A 2A10A 3CCVS 2MXYA 4M5LA 3WX8A 2DHGA 2M5YA 2DT9A 4F0HA 4RO0A 4QIVA 1YITS 2W9BA 2F3JA 5ETNA 3FQKA 1S99A 1P1LA 2W7AA 1TFYA 1VHIA 4ECYA 4DR6F 1J2VA 3HZEA 2UUAJ 4DSFA 3WC0A 2IA6A 1BQXA 1KQGB 3TARA 3CJ0A 1NZAA 2IJNA 1UVJA 1HW8A 1JLAA 3A8JA 3P8BB 2WZ1A 4NYZA 1KEKA 2G2YA 4NMLA 1X4GA 1WC3A 5A8WA 2AGQA 1SIWB 3OL7A 3QFHA 2OPSA 4CO1A 1H98A 3M2RB 1NPKA 1TUGB 2QRRA 4FF2A 3L9ZA 3FUYA 3D66A 2KH9A 1N8RT 4JV2A 1RHJB 4I1TA 3OFGA 3AHPA 2HHWA 1ZPWX 3HVTB 2HMIB 4Y65A 3C3LA 1S9GA 3M6VA 4HI1A 2V4QA 4CNZA 2V63A 3TEHB 1YWXA 3DNCA 5EX0A 3NNAA 3H8YA 2CWXA 1FVQA 1TUWA 3CUNA 5HROA 4GKKJ 3MURP 1RHQB 1YJTA 3W61A 1HNIA 3R7BB 1J5OA 2DITA 1RWPB 2RAQA 1EHWA 5EWEA 2BE2B 3QYYA 3KJFB 2FJVA 4QIWD 1PJ5A 3GTYX 2C2MB 1HI1A 3SYZA 3M2UA 4B9NA 3QIPB 4GMKA 1S48A 3DOLB 1X4CA 1DLOB 3D6MB 1UETA 3GFHA 2E44A 1N0VC 4NASA 1S59A 2DR9A 2PFFB 3M9NB 3KHHA 5KAKA 4M5DA 3MFIA 2F40A 4WK1A 1HNXJ 5L9XA 3MZIA 3HFKA 4E0DA 2KM8C 4ZHRB 3M1VB 1EX8A 3MMCA 5KFVA 4X62J 2G1DA 3QFWA 2IM0A 3RB3A 2QA2A 2RKIA 3EPIA 3T9ZA 4UUWA 2QLBB 3QMQA 1S6QB 3C14B 1M1KT 4WYWA 4TN2A 2H5IB 4UUXA 1QE1B 5ETVA 1CJKA 3IXQA 3M8QB 3M2VB 5K20B 1YKWA 1N54B 4NRTA 4I2QB 1R89A 3SBMA 4USKA 2NXEA 2NYIA 1YZ6A 4GVBA 1QLNA 1IJEB 1NHKL 4M5HA 5A6PA 4P6QA 4H4MB 3TYTA 1AFJA 1DARA 2CVEA 3PYFA 3KK2A 2DR8A 2YH0A 2ROGA 4FS2A 4ZP9A 4F8RA 2HFZA 2CDRB 4PPDA 1RTJA 1HI8A 4QWEA 3V5RA 2R8IA 1H0HB 3PW4A 4CQ1A 1T3OA 2GV1A 1U8WA 3K58A 3QSIA 2E9ZA 2NPFA 4J9SA 2BYCA 1HMVB 1KS2A 2OP5A 4LJMA 1GMWA 2DY1A 3OL9A 4PWDB 2EK1A 2C3YA 5IC4B 1LWCB 1S1UA 3G87A 4DV1J 4DSJA 4U6PA 5ETSA 4CI0B 3CMQA 2R7XA 2CYYA 3O6QA 2YWKA 2RQKA 3QT6A 4DUYF 2NR0A 3HT0A 2ZC3A 1IBKF 3OHAA 4RBVA 4LF5F 2D1CA 1RLCL 3CDAA 5A8KA 1IKYA 4OHWA 2HQ3A 2Z4PA 4USUA 4U95A 4ZLJA 3LP2B 2ZWOA 4I64A 3W9JA 1SVDA 4K2XA 2JL9A 2BQUA 1PBAA 5G0RA 1M5HA 1RAGB 2AJ2A 3DRRB 2FC9A 1NKBA 1UKUA 2G2ZA 4UOFA 3DOMA 1A6LA 2H9ZA 1SL0A 1YJWS 3M32A 4N7TA 1HL6A 5KTQA 2V8VA 4P2XA 1PIEA 4DV5F 3ZZRA 2JRRA 3D3BJ 2ZZMA 3LANA 4DN9A 2BJ9A 4AL7A 2WOMB 2BACA 1HD1A 4C4WA 1EP4A 3FCHA 3L4BC 1ZM3A 3UD3P 4DR1F 3MM8A 1IXKA 3TVYA 3W63A 2YXLA 1RT1A 3JYTB 3DXBA 1WI6A 2P6TA 4JI5F 1UW4A 1FFWB 2RIJA 1O6XA 1RT5B 3KK1A 3G4SS 3HSJA 3CCTA 1YJRA 1TL3B 2W2OP 4K4UA 2W2PP 1DURA 5DZ7A 3DMJA 3FFIA 1RAAB 4A8KA 1JJ2R 5L9NA 2BRKA 3CEDA 1NDLA 2PN6A 3D9BA 4L73A 2YKAA 4F2SA 3IN5A 5L46A 2XZTB
chains in the Genus database with same CATH topology
3TJAA 2B26A 1EB0A 4J80A 3TJ9A 1EARA 3AGXA 4L3KA 3L9ZA 1XAOA 3NXZA 2Q2GA 1GMWA 3LZ8A 3I38A 3LA0A 3TJ8A 2HFVA 3NY0A 1C3GA 3AGZA 1NLTA 2QLDA 1GMUA 1GMVA 3AGYA 1GMWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJA A;  2B26 A;  1EB0 A;  4J80 A;  3TJ9 A;  1EAR A;  3AGX A;  4L3K A;  3L9Z A;  1XAO A;  3NXZ A;  2Q2G A;  1GMW A;  3LZ8 A;  3I38 A;  3LA0 A;  3TJ8 A;  2HFV A;  3NY0 A;  1C3G A;  3AGZ A;  1NLT A;  2QLD A;  1GMU A;  1GMV A;  3AGY A;  1GMW D; 
#chains in the Genus database with same CATH topology
 4OI4 A;  4ZVP B;  5KG7 A;  3OLA A;  2B5J B;  3VHQ A;  2YNH A;  2RS2 A;  1CUL B;  1FI4 A;  5DJB A;  2HHX A;  2XS7 A;  4F3M A;  4X4U A;  3AGZ A;  2QL9 B;  1MWY A;  2RE1 A;  1RLD A;  5IOL A;  2AGP A;  1OY6 A;  1Q95 G;  5IM0 B;  1KC8 T;  5D3G B;  4QQB A;  3CDW A;  5HI7 A;  2HRT A;  4DLE A;  2GZO A;  4ZMM A;  2ZOM A;  1IQT A;  2WSF C;  2UVV A;  4ES1 A;  2Y1I A;  4EO8 A;  4NOH A;  3J7A 1;  5C25 B;  2JLE A;  5JVH Q;  1X9M A;  4RNH A;  2ZZN A;  2KVQ E;  3O3L A;  4IQX A;  1ROF A;  5HLF B;  3BKT A;  3CTR A;  3TA2 A;  2LDY A;  2H5J B;  3IRW P;  2HZC A;  1Q53 A;  4KGK A;  2DNM A;  4LSZ B;  1RCO B;  5DQH A;  1R7I A;  1IBM J;  4FS1 A;  2VQE J;  2CZ4 A;  2ZKT A;  5E3R A;  5A8R A;  3OJS A;  3N6L A;  3TUI C;  2AJ1 A;  2RQ4 A;  3UN5 A;  1N33 F;  5KFB A;  1HYS A;  5KFK A;  4WFZ A;  3Q89 A;  1FWK A;  2PC6 A;  1HBU B;  2B26 A;  4FYD A;  5A0Y B;  4F4A A;  4I6W A;  1RU1 A;  4MKB A;  5DRK A;  1UEK A;  4OZJ A;  2UV8 G;  2NQP A;  4DV3 F;  1L3K A;  2DGQ A;  2HG4 A;  5GVQ A;  2W01 A;  3N28 A;  4JV1 A;  1XR5 A;  4IDK A;  1KFS A;  3N79 A;  2W8K A;  3RBZ A;  3DLJ A;  4AND A;  2C2K B;  4NI2 A;  3EGN A;  2VG5 B;  2UVW A;  3Q0A A;  1B3T A;  2GHW A;  4ED3 A;  3GE9 A;  5L8R C;  2N7C A;  3SDE A;  3KLI A;  1GX5 A;  5C7P A;  4QU7 A;  3DHW C;  3CD0 A;  4C98 A;  3ENQ A;  3R8Y A;  5CZV A;  2G4B A;  1XNR J;  3MOZ A;  3R5G A;  3QO9 A;  1HW9 A;  1OYD A;  3RZA A;  3PFE A;  2VPY B;  2AX0 A;  2DGW A;  1TV6 A;  2RRA A;  4JI6 F;  3UD5 A;  4Z2X A;  3PG9 A;  3DRY A;  4M63 A;  1N5S A;  1JNZ B;  3S7R A;  1ZZN A;  3JQK A;  5H9E K;  2YKP A;  1ZA2 B;  1DJ0 A;  3CD6 S;  2UXC J;  3VV2 B;  1IN0 A;  2IMW P;  3H90 A;  3SMZ A;  2GMH A;  3NNH A;  1EET B;  6FD1 A;  1KOO A;  2V2K A;  3EIC A;  5K8M A;  1RTI B;  4DUZ F;  2AJQ A;  5GAH I;  1S1W B;  6FDR A;  2ZHO A;  1KTV A;  4FF3 A;  4IG3 B;  1T9Y A;  4ED4 A;  1J5E J;  4ZPV R;  2X1B A;  5HQ8 A;  4WK3 A;  4CLU A;  4XAK A;  3QGH A;  1VBX A;  1DAX A;  1FKP A;  3LP0 A;  1VQK S;  4WXO A;  1FDA A;  3NS5 A;  3VAK A;  3N01 A;  2WHO A;  1S0N A;  3VAJ A;  5D8H B;  2LDI A;  4RW4 B;  2JVO A;  5ETM A;  1DTQ B;  2CPZ A;  3MUM P;  4I4B A;  1GEH A;  1ZBT A;  1Q79 A;  3PYG A;  3IS9 B;  2APO A;  3FZ2 A;  4DBQ A;  3CCE S;  2YKQ A;  3ET6 A;  4A8W A;  2B6A A;  2B9W A;  1S6P B;  1UEV A;  4IR9 A;  4ZOS A;  3G82 B;  5F9N A;  4MAK A;  3UN3 A;  1KVJ A;  1M1H A;  4I67 A;  4YB5 A;  1R3N A;  2VL1 A;  3SSR A;  3CDU A;  1V9O A;  2XMV A;  4ZPC A;  2QSW A;  4O44 A;  1JKH B;  2GGP B;  4USM A;  2CA9 A;  3NGU A;  5J2N A;  4OI0 A;  3HHN B;  4ZP7 A;  3H5Y A;  2UUB F;  3MD1 A;  2VC1 A;  3IAS 9;  4R5P B;  2IVM A;  3ZZZ A;  1WC5 A;  4LF4 J;  4LBP A;  1R0C B;  1URN A;  2ERR A;  3UR3 C;  2Y1L B;  3ISN C;  4F4K A;  1EJ7 L;  1T9X A;  1RHR B;  4DFK A;  4K4S A;  3R9L A;  2KFZ A;  1O5J A;  2ZH1 A;  4WXW A;  3BSA A;  5DDR C;  4NA3 A;  2E5L F;  4F50 A;  3NXZ A;  2KFN A;  5LMN J;  4DPU A;  2IAJ A;  3W2W B;  3I0S A;  1VIS A;  1VBK A;  3UFC X;  2RB7 A;  4C0H A;  1M90 T;  3TP2 A;  3NGT A;  2O66 A;  3Q8R B;  4DV6 F;  1PC5 A;  4GKJ J;  2B56 A;  3TR5 A;  2ZH9 A;  4JI4 F;  4MIB A;  2FZC B;  4KIA A;  2KZZ A;  3UI3 A;  3AKO B;  5L39 A;  1PAE X;  1MMD A;  2CJB A;  2AGO A;  5IT0 A;  3B8H A;  2ZD1 A;  4NLT A;  2CJA A;  3NP5 A;  3MXH P;  2D74 B;  2AP6 A;  1F0X A;  1S72 S;  1OJ4 A;  5DM6 Q;  2PEB A;  2FPH X;  1P9Y A;  4C3L A;  2UUA F;  5GAG I;  2ACM A;  1SKS A;  2FY8 A;  3EMT A;  4ZVE A;  1QUP A;  4WFY A;  4IQM A;  4P10 A;  2YBV A;  1M5V C;  4YR2 A;  3H4B A;  3MCS A;  1WOS A;  2J6S A;  3CCW A;  2E1R A;  1V6H A;  4A8M P;  1W7W A;  2LEC A;  3NBP A;  5KT6 A;  1NK4 A;  5F0U A;  4AUK A;  3JSM B;  3LTO A;  5D0E A;  1R43 A;  2UXD F;  3ZC4 A;  3D5M A;  1LKZ A;  2H1Y A;  3HHL D;  3CC2 S;  1MSW D;  2GHV C;  1EAY C;  1X4E A;  5G4D A;  4KKO B;  1U09 A;  4X4P A;  3UCZ P;  2GO8 A;  4ALZ A;  5J2P B;  2H4Y B;  3MM9 A;  4UY8 T;  2Q6B A;  4OX9 J;  4OX7 A;  4NEZ A;  3QZ8 A;  1Y00 A;  4HHH A;  3J7Y I;  2QFJ A;  3VAH A;  3C16 A;  4F26 A;  1KP6 A;  3MI7 X;  4GKK F;  4L72 B;  1LFW A;  5ETR A;  1NND A;  1VGY A;  2GJ2 A;  1RSC A;  2OAU A;  4WZM A;  2LCW A;  2GC8 A;  2D3O R;  2K1R B;  2QTW A;  2MQP A;  4DSE A;  1IKX A;  3SQG B;  1LWE A;  3Q8P B;  5IV3 A;  4EZ6 A;  1CQN A;  3KLG B;  3POT B;  2CPF A;  2FGO A;  3UN2 A;  4LSN A;  2RDD A;  2XHW A;  5ETK A;  4X65 J;  4CM2 A;  2Z58 B;  1RGV A;  1FX2 A;  2KO1 A;  3AT1 B;  2MY7 A;  4DF4 A;  2KVI A;  3HVR A;  1HNX F;  3KHR A;  1ZS6 A;  3CJ5 A;  2E66 A;  4RJV A;  4DPY A;  3AGY A;  3TJA A;  3D1Q A;  3DU6 A;  4L3K A;  2CRL A;  1R8H A;  3LGM A;  4UQG A;  4X62 F;  4XO0 A;  4JYA J;  2E7V A;  2YKN B;  4AFF A;  2AJ4 A;  3MCM A;  4N47 A;  3PR5 B;  1BHN A;  3HSD A;  2CQC A;  1WEY A;  2HUR A;  2F9D A;  3J81 Y;  3PYE A;  3C6U A;  4LR9 A;  1T03 B;  4ED8 A;  2NXC A;  4DX8 H;  2HHP A;  2VF3 A;  4OFZ A;  3A8E A;  3KJN B;  1UJ4 A;  1VQ9 S;  1TAU A;  1Y10 A;  2QV6 A;  2FJA B;  3NCR A;  3W8G A;  2OH2 A;  1K1Q A;  1S4F A;  2GQQ A;  3QRP A;  1KFD A;  2RT3 A;  2J7U A;  2BW7 A;  4Q43 A;  3NOG A;  3I82 A;  2VA3 A;  1KQF B;  2CQD A;  1JX4 A;  5K8O A;  3KTQ A;  2R2S A;  3WIV A;  5U47 A;  2YNF B;  2SXL A;  3ZZY A;  1CQM A;  3BB5 A;  5HP1 B;  2DR7 A;  5LMU J;  1XBW A;  2MKK A;  2QJ3 A;  5I3U B;  1WC4 A;  3WZ0 A;  1NB7 A;  2HAF A;  2WAQ D;  2HNY A;  3OUY A;  2K8G A;  1K44 A;  2ZBI A;  3D54 A;  3EVM A;  4RZR A;  3FCV A;  3B54 A;  1REG X;  3MAA B;  4QBU A;  3RG6 A;  3VAM A;  2Q2G A;  1BQN B;  4B08 A;  4J9O A;  3QT8 A;  1SQG A;  1KON A;  3R2C J;  3JTN A;  5D15 A;  3PDN A;  2ZKU A;  3T3F A;  1G3O A;  1U25 A;  4DV1 F;  4FYV B;  3R5B A;  3DFE A;  2HBZ B;  2YNI B;  4DLG A;  4NL5 A;  2QC3 A;  4BHQ A;  3G6X A;  2CPH A;  3A12 A;  3J7A N;  4FVM A;  1HR0 J;  5LL6 d;  4DFJ A;  2UVR A;  1FWP A;  1Z1Z A;  2BRL A;  1TZ0 A;  2XO7 A;  1H6K X;  4ID5 A;  4OHY A;  2QN6 B;  3MM5 B;  3BBF A;  4CLY A;  4JV5 J;  4ANC A;  4WE1 A;  4EU0 A;  2AYG A;  2MEW A;  3PNI A;  3WIU A;  3BR9 A;  2BDP A;  3CE8 A;  2IFX A;  2KJV A;  1RWU A;  4FZV A;  1X9W A;  4I0W A;  2V8H A;  3ZZ0 A;  2DEI A;  2HS3 A;  1XR7 A;  1U1L A;  4EGL A;  1IWG A;  2V67 A;  2Z2Z A;  4DG1 B;  4LSL B;  2PO4 A;  1YG0 A;  2OTL S;  2FZG B;  4NZ6 A;  2U1A A;  3MM7 A;  4M5I A;  1T9W A;  3E01 A;  1MML A;  1N6Q B;  2B8Q A;  1I94 J;  4QPT A;  2JRS A;  3CD5 A;  1FK9 B;  3J7Z T;  4B9V A;  2F9J A;  1OPZ A;  2DXF A;  5HVG A;  3MEC B;  1NJX A;  3MDF A;  2R8H A;  2B7B B;  1VS3 A;  1TL1 B;  4KSE B;  2RIL A;  4RL1 A;  1XQI A;  4P52 A;  1WEL A;  2CDQ A;  1JLC B;  1CS4 B;  3AXM A;  4WFX A;  4MJK A;  1RAD B;  3FGV A;  2F63 A;  3LWM A;  1U26 A;  1VRU B;  1RBL A;  3OT9 A;  5HVH A;  4DL3 A;  1G1X A;  2CFX A;  2LMI A;  4DQQ A;  4ED6 A;  4A4J A;  2CPE A;  3RB0 A;  3JAM Y;  4G6V B;  2XI3 A;  3S8S A;  2G1H A;  1N52 B;  2KXH A;  4ZVS B;  3ZTP A;  2FLN A;  2Q43 A;  1K9M T;  4EBE A;  2V4J B;  2GIQ A;  3CPW R;  3V81 A;  2RRB A;  1S1T B;  2WSE C;  2K06 A;  4YB1 P;  2R7O A;  1LXJ A;  3DRS B;  1WF1 A;  3NCQ A;  3QRQ A;  1TMM A;  2VUG A;  1NJY A;  2NSC A;  1H38 A;  1BC6 A;  5LSL A;  1KQS R;  3DLK A;  3FBE A;  4JI1 J;  2OPR A;  1VQ7 S;  2Y8Y A;  1U2F A;  3GSI A;  2I0X A;  3M8R A;  4YB7 A;  3UVJ B;  3L3C A;  1NH7 A;  2CG8 A;  3QJL A;  2VG6 A;  3DLB A;  4CT8 A;  2DGS A;  4NLS A;  2PEH A;  5F3Z A;  1ULR A;  2CG4 A;  3H20 A;  2UVU A;  4CH0 S;  2RS8 A;  4EWT A;  4ECR A;  4U7U D;  2AYB A;  5CCM A;  4P2F A;  1RWN B;  2IC3 A;  1RT7 A;  1IBM F;  2PMH A;  4WYL A;  4D3G A;  5D0G A;  4ITS A;  2VQE F;  3H25 A;  3A8I A;  2QA4 S;  3W7B A;  4A8O A;  2I5J A;  1MU2 B;  3AGX A;  2EW9 A;  1CJU A;  2IDL A;  1TAQ A;  2MY8 A;  3IGV A;  3PY8 A;  1AZS B;  5ETP A;  1WC0 A;  3G6V A;  2Y0S D;  1RU2 A;  2R8K A;  3SSQ A;  4MFB B;  1RKJ A;  4DV7 J;  5J2Q A;  2CUY A;  3IP0 A;  3V6H A;  2AF6 A;  5HBM A;  2JC1 A;  4NXM J;  2M9K A;  2DRA A;  3LPY A;  1FRM A;  1X0F A;  3PKM A;  5D78 A;  4UF4 A;  4M5M A;  3HXM A;  1JLE B;  2KHC A;  5I3Q A;  1S1X B;  1OS5 A;  2XYH B;  2NPI A;  2GVD B;  5KFX A;  2LQ8 A;  2J0X A;  3JTO A;  3AOB A;  1N88 A;  2L9D A;  4FNI A;  5KG1 A;  4ZPT R;  4ZVG A;  4ZHR A;  3GON A;  3BQ0 A;  4UQT A;  4F4W A;  3MED B;  3W64 A;  1XNR F;  4ECZ A;  1Q5V A;  4J9N A;  1D9A A;  2E5I A;  1KR4 A;  3TJ9 A;  1HPZ B;  1DRZ A;  3ULH A;  2BAN A;  3TNV A;  1C4C A;  2CQH A;  4G1I A;  3W9I A;  2NRE A;  3OBI A;  3D2W A;  2DRD A;  2GQC A;  2HFS A;  3ITH A;  3ZO7 A;  1SQF A;  1T02 A;  5E3P A;  5KOW A;  1HWU A;  3MTJ A;  2UXC F;  2KL8 A;  3EXC X;  1DQA A;  4ECU A;  4LF8 J;  1QAJ A;  4EFA C;  2PII A;  2UUW A;  3ZZU A;  4Q0B B;  5KFH A;  2KXN B;  4KTQ A;  3O1L A;  2VFU A;  2OKQ A;  1Q0N A;  5BR8 J;  1LW2 A;  5E0O A;  2Z8Q A;  1J5E F;  3TUZ C;  4RW7 B;  4RNF A;  1JMT A;  1DQ9 A;  5GAD U;  2QEX S;  1HBO A;  4ZIV A;  2ZJP Q;  4QW9 A;  1N32 J;  2DH9 A;  4I69 A;  1VCT A;  3P3D A;  4O3P A;  3HPO A;  3LF0 A;  4OI1 A;  2O3D A;  1SV5 B;  3OTB A;  3CCL S;  1QDU B;  3BKU A;  1REV B;  2E1P A;  5E3Q A;  4WII A;  4QJV A;  3VAG A;  2D3O 1;  2Z2Y B;  2XGQ A;  4ELT A;  1F60 B;  2NZC A;  2AW0 A;  2J0Q D;  4NA1 A;  1K47 A;  2CNN B;  1T11 A;  1QD1 A;  3TX8 A;  3LP1 B;  1B99 A;  3R5A A;  4NCG A;  4JI7 J;  1RTH A;  2W7O A;  1RWX B;  4B3O B;  1SJF A;  2M3D A;  1YBU A;  3OTC A;  1X4D A;  4UY8 5;  4A8X A;  2RF2 B;  1JLF B;  5BJR A;  1BQM A;  1C0U B;  4WPA A;  1FE0 A;  2HQC A;  2KT5 A;  4LF4 F;  4XPC A;  3NWG A;  4KQZ A;  3EJM A;  2IJR A;  4HAC A;  2DGV A;  4ICL B;  3Q8Y A;  2JVR A;  3QQC D;  3D28 A;  4H4K C;  2R8G A;  2AV5 A;  5LMN F;  3PV8 A;  1HQU B;  4XTT A;  1EIY B;  2GW8 A;  1Q82 T;  2GAH C;  2DR5 A;  1H7W A;  2HNZ A;  3MTK A;  4N77 A;  1FXR A;  3HHL B;  4GKJ F;  5CXT A;  2HVH A;  1WOP A;  1FES A;  2V68 A;  2JNJ A;  3TUP A;  1S77 D;  2R7R A;  2POK A;  4OZ0 A;  4BC7 A;  4IFV B;  4NMX A;  2WVE A;  2ZM6 J;  4K4V A;  4QYR A;  1LQ9 A;  3CB4 A;  5HMZ A;  4RR5 A;  4CP5 A;  4LFB J;  2L41 A;  2W9A A;  2YKO A;  1B70 B;  1NSP A;  2KDO A;  1V5V A;  3PYD A;  4J37 A;  4L3N A;  4KGZ B;  4I6Y A;  1VYA A;  3SCL E;  2IBO A;  3RB6 A;  1GMW D;  2BKO A;  2MLY A;  1G6B A;  2HHH J;  2GHP A;  2EK6 A;  3KG4 A;  4LMZ A;  2DY9 A;  1N48 A;  3HK2 A;  1MLA A;  1XEZ A;  4TNO A;  4PG4 A;  1L5U A;  2AIR B;  3MD3 A;  1QTM A;  3PRD A;  3IG1 B;  4OI2 A;  3FMW A;  2LVW A;  1CUL A;  3GP9 A;  5ITH A;  2CPI A;  3I6P A;  3PAC A;  4XDC A;  4H4O A;  1RHM B;  4KR0 B;  2WK4 A;  4WFN Q;  2MZ1 A;  2PE8 A;  3TW0 A;  3RTV A;  4OX9 F;  1I51 B;  1TKT B;  4OYI A;  4BDP A;  1UA1 A;  4KV8 A;  2XCA A;  2VG7 B;  1VQY A;  3H0P A;  2BJ7 A;  2RDI A;  5SZT A;  4WU3 A;  1C2P A;  3ICL A;  5KFM A;  4K4T A;  1SQE A;  4QZV B;  2WVC A;  4Z7Y A;  2W2N P;  3QLH A;  4U7U K;  5HMY A;  1JXL A;  4RW9 A;  2B8P A;  1FKO A;  4IFY B;  4YEA A;  1L3S A;  4DV4 J;  1GK8 A;  4EK2 A;  1NXI A;  3MEG B;  1DY3 A;  3HCX A;  3Q8S B;  3V4M A;  1OY8 A;  3IGN A;  4CTA B;  2VDI A;  2YNG B;  3MAH A;  4X65 F;  2LXI A;  4I2P A;  2HQG A;  2NLW A;  2M8D B;  2M4M A;  1VLY A;  5LOQ A;  2DPJ A;  2VOD A;  2YPY A;  1TU0 B;  3CW2 C;  3BF4 A;  4FVC A;  3MMB B;  1HBU A;  1Y5L B;  4DS4 A;  3NOC A;  5A6W A;  4JYA F;  4IO1 A;  3KK3 A;  3TZZ A;  3HDS A;  3CCS S;  2Z2L A;  5KG5 A;  4Y2I A;  4WZQ A;  3C19 A;  2A3J A;  3V4I B;  4TVA B;  1VQ8 S;  3K5L A;  2F4F A;  4JB8 B;  3V6D B;  2HVZ A;  3I31 A;  5KFQ A;  3W9H A;  1RT6 A;  4DFM A;  1FF2 A;  1N5V A;  2IYG A;  2DRB A;  2IVY A;  4P7V A;  3R5C A;  2J5A A;  1RP5 A;  3PVX A;  3VWS A;  4ETZ A;  2DEJ A;  2Q3P A;  4FPI A;  3J7Z 5;  5KT5 A;  1YBT A;  1C1B B;  4A46 A;  2F7V A;  2K7K A;  4C0O C;  4TQR A;  1KHW A;  5L1L A;  4KO0 A;  5LMU F;  4GRS A;  3CMA S;  5B7W A;  1HBM A;  4NLV A;  1S7I A;  4PXB A;  4Q8F A;  1HNV B;  4P2S A;  5E41 A;  3IWN C;  2IDE A;  4WFB Q;  5C24 A;  2DHS A;  2PI4 A;  1UWB B;  1JLQ A;  4RW8 B;  3FSI A;  2COL A;  5LXR A;  2G0I A;  4ZVR B;  1N5Y A;  2OD6 A;  3OLB A;  1NRK A;  1D0E A;  3RAX A;  1EET A;  1KDN A;  2QFI A;  3RRH A;  1Q5Y A;  1NZ8 A;  3HI9 A;  2BX6 A;  3JSR A;  3DDN A;  3FRZ A;  2IIH A;  4C48 A;  2V6A A;  1GH8 A;  3K89 A;  3DCA A;  4IG0 B;  4C8Y A;  1HR0 F;  1VIX A;  1Y11 A;  2MQM A;  3PEJ A;  1NH8 A;  1HA1 A;  4B9L A;  2LXF A;  4HH1 A;  3MUV P;  2FJX A;  2R7V A;  2BE7 D;  4FYY B;  4NRU A;  1OY9 A;  3M05 A;  4O3O A;  4OYW A;  4ZP6 A;  4JV5 F;  4RNO A;  2OPP B;  3GII A;  3VQS A;  2NXJ A;  4YY3 J;  1SUQ A;  1X4H A;  2XMM A;  2W4C A;  2KB2 A;  3MAQ A;  1D09 B;  2IVF B;  1S0O A;  1PAU B;  1RK8 A;  2Y0B B;  2GAG C;  2KI2 A;  1FJG J;  1ZPV A;  3CVK A;  4C8N A;  1DTT B;  3UNG C;  1TKZ B;  3P6Y C;  1BWV A;  4CLL A;  2Q79 A;  4PAA A;  4KT0 C;  1CJV B;  3RBX A;  2QO3 A;  1TEL A;  4DMZ A;  1Y3K A;  3OHB A;  1RT2 A;  3NAH A;  1T94 A;  3BO4 A;  1S6O A;  4PEO A;  2MTL A;  4D3H A;  2BOA A;  3I5B A;  1CJT A;  2OUG A;  3TQE A;  4DL0 C;  2DVI A;  2KZM A;  2GGP A;  3MR6 A;  4R25 A;  2AU0 A;  1I94 F;  4JV0 A;  5DZ6 A;  4K4Y A;  2FJB B;  1WEX A;  3KJV B;  3M8Y A;  1LK7 A;  5CQG A;  1SCJ B;  2PDA A;  1WC6 A;  5KG0 A;  1VQS A;  3RAQ A;  1JLG A;  4ES3 A;  3CJ3 A;  2ZBR A;  2M0G B;  1S5Z A;  3IWX A;  4P71 A;  2J6U A;  2PD1 A;  1WHY A;  3GFZ A;  1LWX A;  3OTE A;  1WKJ A;  5JXS A;  1Q4R A;  2QA1 A;  4TY8 B;  3SCI E;  5AE3 A;  3DU5 A;  2V9W A;  3G6E S;  4USV A;  2FQQ B;  2CJ9 A;  5LM7 E;  4U7C A;  4WTO B;  4G1Q B;  2B4P A;  5CAB A;  1LFP A;  3OR2 B;  4ZVF A;  1HBN A;  1FDD A;  3CJK A;  2QG9 B;  1QSS A;  3M30 A;  4GO7 X;  4EZ9 A;  1R6Y A;  2HHU A;  2MQN A;  1WD6 A;  4DQI A;  1H2U X;  2FTR A;  3N6M A;  1N5T A;  1ZA1 B;  4MK8 A;  4PG6 A;  4F04 B;  2AJF E;  2QYC A;  2YY3 A;  4C8M A;  4JI1 F;  3GPA A;  4UT4 A;  4LQ9 A;  3O5T B;  2YX4 A;  2BXJ A;  4NE9 C;  1SIZ A;  3M6W A;  2MSS A;  1A0O B;  4USI A;  3AOD A;  5JJB A;  1S1V A;  3GJS B;  2XNR A;  5F8J A;  4CIO A;  5K14 A;  4QWA A;  4NLU A;  4DL2 A;  3GWC A;  1HAR A;  2A6M A;  3EE3 A;  1Z4U A;  4C8K A;  2VKZ G;  3ELH A;  2C22 A;  3MR7 A;  3AQO A;  4RWX A;  2B3T B;  2J0S D;  4X4T A;  2XM3 A;  2W9B B;  4IRK A;  1W2I A;  1VQN S;  2W7P A;  3RGI A;  1U0S A;  2Y3Y A;  2B4U A;  2HPU A;  2DR6 A;  2XG8 A;  2A2D A;  1RA7 A;  4J9U E;  1BD6 A;  3B78 A;  1UVL A;  3HD1 A;  5DS7 A;  4LIW A;  3VAL A;  2DHA A;  1JLA B;  4DV7 F;  2XI2 A;  2B9X A;  5A8W B;  4LVO P;  3R5D A;  5IS2 A;  2O01 C;  2I1R A;  2OPS B;  1PYT A;  1FER A;  1T3N A;  4NXM F;  2HHQ A;  2ZH4 A;  1F5A A;  1BY9 A;  4NZ0 A;  4WP3 A;  2IM3 A;  3QPI A;  2NYH A;  4N56 A;  1RBO B;  2V34 A;  3KJQ B;  1LWF A;  4EBC A;  1UVM A;  2ZVS A;  3CME S;  2RML A;  1S9G B;  3GIR A;  3LO3 A;  5H9F J;  4RUH A;  3FQL A;  2R7T A;  4YDX A;  1NJW A;  5J1P A;  1UPM B;  1FCA A;  5HRO B;  3UCG A;  1Y4Z B;  5HMX A;  1HNI B;  3N5F A;  1J5O B;  2R2T A;  3CJR A;  5HO4 A;  2A2C A;  2E7W A;  3MMA A;  1F3V A;  1S6U A;  3L7U A;  4LVN P;  5HVF A;  2VV5 A;  1PYO B;  3M2U B;  3OR1 A;  3DGV A;  2ZUA A;  4C8O A;  1VRT A;  4JUZ A;  4J9V A;  2M7S A;  2BM1 A;  4TQS A;  1NM2 A;  1H3D A;  2VB6 A;  2KTQ A;  3OXG A;  4LF8 F;  1I1G A;  3X1L B;  1UWA A;  2XSF A;  1VQP S;  2V94 A;  1YX2 A;  2B0G A;  4DR7 J;  2C2D A;  4R0E A;  5CZX A;  4M5D B;  4OHV A;  3MHY A;  1BUX A;  2XYG B;  4IOC Q;  1Q7Y T;  2OSR A;  5BR8 F;  1RWW B;  4Y00 A;  4EI2 A;  1Q86 T;  3OVS A;  2KYX A;  1N56 A;  3MMC B;  1JJC B;  1JQG A;  1FRI A;  4L75 A;  2RKI B;  4F4Y A;  1N32 F;  2DH8 A;  3Q2S C;  2V8P A;  2R7Q A;  3JAM U;  1FTR A;  1BLU A;  4PYA A;  5J1E A;  4IRC A;  2MZS A;  4K5S A;  2A18 A;  3KUG A;  4YS2 A;  1E6V B;  2W25 A;  2F65 A;  3R7N B;  3QWP A;  5BYQ A;  4ZIT A;  1Q8B A;  2XY6 A;  4GVB B;  1UP1 A;  5KT2 A;  3MCO A;  4OZ1 A;  2I6W A;  4ELV A;  3DHX A;  2HW3 A;  3AJ2 A;  3PR4 A;  5F8N A;  1JLB A;  3K5P A;  1VBZ A;  2FB0 A;  3NGR A;  3FJ2 A;  2D41 A;  4JI7 F;  5DO2 A;  3KK2 B;  2ALY B;  4Y3C A;  3I96 A;  2RQC A;  3D0I E;  1XNQ J;  2RVJ A;  1RTJ B;  2PA3 A;  4YOE A;  4F36 A;  1AUD A;  1CC7 A;  1RWK B;  2AX1 A;  3F56 A;  3AQP A;  2ZZT A;  3J81 j;  3V6K A;  4OZ3 A;  1YQH A;  1VC5 A;  2EFP A;  2JVM A;  4J90 A;  3V2U C;  3GIM A;  4Q2M A;  3KLE B;  5KFP A;  1BGX T;  4WCE Q;  2DO4 A;  4GC6 A;  5EUH A;  4OYP A;  2M2B A;  3IBW A;  2CQB A;  3MOJ B;  1KVK A;  3SV4 A;  2BW2 A;  1S1U B;  4Y34 A;  2RJZ A;  4KFB A;  1RWM B;  4ZPA A;  1QUV A;  3K59 A;  1GXL A;  2DXE A;  2IM2 A;  5HSP A;  4HTJ A;  2ZH3 A;  1U45 A;  3MEK A;  1VDH A;  2MQO A;  3ILL A;  3IA0 A;  2DK2 A;  2OO4 A;  3UDE A;  3G8S A;  1YJ7 A;  5CYQ A;  4OI3 A;  2ZM6 F;  2MZQ A;  3EPG A;  5A8K B;  1KLM A;  1IKY B;  2OPQ A;  2E1A A;  4DR4 J;  1Q8L A;  5LJ3 Y;  1IBL J;  4LFB F;  1BXN A;  3TRG A;  2FIU A;  4C6A A;  2QLJ B;  4OIX A;  1FFG B;  5G0R B;  1K0T A;  5KT4 A;  4QOT A;  2PGC A;  3IM9 A;  3G86 A;  3NGD A;  3G9C A;  1GTE A;  3DOM B;  5LJ5 Y;  2HHH F;  5F8G A;  4Y2C A;  2UXD J;  4MH8 A;  1EQM A;  3M32 B;  4CDI A;  2MKJ A;  2P8I A;  4OHX A;  2VJV A;  4DQR A;  4P2M A;  1C4A A;  2X3D A;  4Y28 C;  1HHT P;  2ZH5 A;  2WCX A;  1JB0 C;  1AYE A;  2CQ4 A;  5C2C A;  4OL8 A;  3M8P A;  1EP4 B;  3D6T B;  5HN0 A;  3GV8 B;  4ZCI A;  2MJU A;  1XMB A;  2DGX A;  5KG4 A;  1F9H A;  2DH7 A;  3PX4 A;  5MAO A;  4BLG A;  3MM8 B;  1T95 A;  3KDO A;  1YTY A;  1RT1 B;  3W2V A;  1KSP A;  4F7V A;  4X4Q A;  3CUL A;  4ZIW A;  3KK1 B;  4MYT A;  4RNM A;  1UFW A;  5DLG A;  1N4L A;  1G7C B;  1SH0 A;  4LBH A;  4B9U A;  2LQ9 A;  4K2J A;  2VPW B;  5KOX A;  3DMJ B;  3FFI B;  5EX3 A;  3RW6 A;  4DPO A;  1KN6 A;  2LEB A;  4HYK A;  3PJ9 A;  4DV4 F;  2N4D A;  2OJ3 A;  1NAQ A;  3LAM A;  2ZNZ A;  4YFU A;  3PW0 A;  2Y1J A;  2YNH B;  1Z2L A;  3LW5 C;  3B82 A;  4OZL A;  5ETL A;  1D1U A;  3CCZ A;  5D4L A;  4J5O A;  4Q45 A;  5DLF A;  2ZOG A;  2H3E B;  4ECQ A;  3PX0 A;  5DQG A;  2M8H A;  4R8U A;  3PRV A;  3BKF A;  2DNN A;  2FDN A;  1FX4 A;  4HEA 9;  4WIQ A;  2MQL A;  4DN0 A;  3MUT P;  1CSJ A;  3LAL A;  2HAI A;  2DHX A;  1CEZ A;  3HX9 A;  3I5C A;  1S12 A;  1WAC A;  1VC6 A;  1C0T A;  5E5N A;  5CYM A;  2ASY A;  3TVZ A;  4P73 A;  3DKD A;  2K3I A;  1FEE A;  1R8A A;  4ZA1 A;  1XTZ A;  2JOQ A;  1HD0 A;  2F5G A;  5DDP C;  3MF5 A;  3GIK A;  2ZE2 A;  3BBB A;  1RWV B;  2VQF J;  5KG3 A;  1U49 A;  3G6Y A;  1X8D A;  5GAE U;  4O4G A;  1RT3 A;  3TO8 A;  3PZP A;  2C3O A;  1XMQ J;  1FJE B;  1UZD A;  2HBQ B;  3A4T A;  3W5Y A;  1X4A A;  1DZ5 A;  2MMY A;  2FZK B;  2XLK A;  2F8M A;  2XZW A;  2J0W A;  2XMJ A;  2QA4 G;  1HYS B;  2OFH X;  1D9D A;  4ZS6 A;  4FF1 A;  1SJ4 P;  2P6S A;  3PKY A;  2BQ3 A;  1H73 A;  5KFC A;  1Y7P A;  3F0N A;  3I38 A;  1YVF A;  2CWK A;  2WVF A;  1O51 A;  3DGP A;  3T6J A;  3BQ1 A;  2PI5 A;  4QWC A;  4IYQ A;  4DV2 J;  1TKD A;  1HQE A;  2GVZ A;  3TEG A;  4IDK B;  3Q8U A;  2XCP A;  1XC9 A;  1K1S A;  4NI2 B;  4Y2K A;  2ZVI A;  3G8Q A;  2LEP A;  2BKP A;  1RDR A;  4MIW A;  1FVS A;  2NXN A;  1NPR A;  4KGV B;  4B9S A;  4YR3 A;  2AWZ A;  3SDE B;  5DGB A;  3KLH A;  2A0F B;  1YGY A;  3KLI B;  4PUO A;  2HK2 A;  1AB8 A;  3N9U C;  2B9Y A;  3OQ2 A;  2VZ9 A;  4RPF A;  4U8V A;  2LQJ A;  1X7V A;  4ER8 A;  2YWF A;  1C3G A;  4CM0 A;  1XER A;  3DOK A;  1GQE A;  3QO9 B;  2HS4 A;  3P49 B;  1B0P A;  1F9E B;  2OGU A;  1Q81 T;  1WUU A;  2AD9 A;  1TV6 B;  1RT4 A;  1FE4 A;  2I8E A;  2VKR A;  1IKV A;  4YY3 F;  2HWH A;  4K59 A;  2ZJR Q;  3DYA A;  3MFH A;  3T1Y J;  1FJG F;  1FJ7 A;  1O8B A;  4RUA A;  2ZUG A;  3FBC A;  3ILI A;  3PEH A;  4KB7 A;  2YWH A;  1UAW A;  1SI9 A;  3P45 B;  3BGL A;  2DJW A;  1KTQ A;  4RNN A;  4F4X A;  4V19 J;  5B0G A;  3OJU A;  3DLE A;  4KAI A;  4QIE A;  2A1B A;  3FEX B;  4YP3 A;  3EM1 A;  1TFW A;  4J9M A;  4XIU A;  2QIF A;  1FKP B;  4IOA Q;  3IRX A;  3LP0 B;  3J80 U;  1FFS B;  3T5J A;  2XYP B;  3AB4 B;  1RAH B;  1AA1 B;  1KD1 T;  2IMO A;  2BMB A;  3LGN A;  1N36 J;  3RAM A;  2JLG A;  3I9Z A;  1U1K A;  1S9E A;  2AEJ A;  2VJU A;  3F41 A;  4MTP A;  2J76 E;  4OLP A;  2OD4 A;  2AZ3 A;  3AA9 A;  2QYG A;  1UFL A;  2ZBP A;  4JOU A;  4NLX A;  1KLN A;  1FNO A;  2F4V J;  1RAE B;  5K5M A;  1M1G A;  1OSC A;  2I38 A;  2XSJ A;  1YHQ S;  3DI6 A;  3ET6 B;  3LPE A;  4ED1 A;  2B6A B;  1YRX A;  1H72 C;  3HF5 A;  2EKN A;  2HHV A;  3N4W A;  1PG5 B;  2FVP A;  4O44 B;  4XK8 C;  5EDW A;  2DNK A;  3KDN A;  3ZFV A;  4AQY J;  1RI7 A;  3QGG A;  1ZET A;  5J2N B;  2G0C A;  1VRQ C;  2CIM A;  4JP8 A;  2CVI A;  4FDF A;  1W25 A;  3BSC A;  2CJK A;  3TJ8 A;  4DQP A;  3TZY A;  2DO0 A;  2Y1R I;  2MLZ A;  2UZA A;  2YH1 A;  3CCR S;  3VQT A;  2F8H A;  1UFK A;  3V6J A;  1AFI A;  4M5J A;  1WDT A;  5B0E A;  2IAJ B;  3ZTS A;  5M2P A;  1IKW A;  3I0S B;  2DTJ A;  4ED0 A;  2LXU A;  1DFD A;  4EYH B;  1T7P A;  2JLF A;  1JIH A;  2OEM A;  3HUL A;  3GV7 B;  3BQ2 A;  3H2V E;  3DM2 A;  5B0D A;  1TKX A;  2MQ8 A;  5AXL A;  3RBE A;  4ERD A;  1M5O C;  2ZD1 B;  3AJD A;  3UW1 A;  3VZI A;  5KG6 A;  3GV5 B;  5SUH A;  1MWZ A;  2V2Q A;  4G3I A;  2J8S A;  3CCU S;  2YX7 A;  3DC2 A;  1F2H A;  4TU8 A;  4OI6 A;  4UOC A;  1BWE A;  3QWU A;  1H74 A;  1R0A A;  5I42 A;  3BYR A;  2FUG 9;  4QWB A;  5C42 A;  2JFK A;  3F44 A;  4NPO A;  2UU9 J;  5F8H A;  1UVN A;  1J27 A;  2I2Y A;  3GJQ B;  4QU6 A;  2MKS A;  2ZOF A;  3HJF A;  3NBP B;  1IVZ A;  1OO0 B;  2Y9H A;  5JVG Q;  2MDA A;  3BSO A;  2IYI A;  3Q24 A;  2HZV A;  1UVI A;  4AXI A;  3GR1 A;  4NYO A;  1TVR A;  2JEJ A;  8AT1 B;  1CLF A;  3A3P B;  4F0M A;  3HHE A;  4CYU A;  4LF7 J;  3MM9 B;  2JEI A;  2GJI A;  5GMK a;  1XN9 A;  3C6T A;  2KN4 A;  4ZJO A;  3CJT A;  5AE1 A;  3HFV A;  4V1A k;  2Z2M A;  4KHP J;  4PXD A;  2QE5 A;  3C16 B;  3WHI A;  3RJM B;  3QJP A;  1F6T A;  2C42 A;  4OQJ A;  2HWI A;  4ED7 A;  1SJR A;  4TY9 A;  4CLT A;  2XMW A;  4NLP A;  2DPI A;  5HAO A;  4CH1 A;  3H7H B;  4F3Q A;  4Q5V A;  1SPB P;  3DLG A;  2E9T A;  5EGY A;  1B7F A;  4BWM A;  3EYZ A;  1RZM A;  4OX8 A;  1IKX B;  2J9D A;  3VVU A;  1WG5 A;  6AT1 B;  3U02 A;  1LWE B;  1LW0 A;  5F41 A;  3B4D A;  3BN4 A;  5IZH A;  1MRO A;  3A13 A;  3EVW A;  1FRJ A;  1YBA A;  4LSN B;  4YQW A;  1IWA A;  2YKM A;  3QT5 A;  3UCU P;  4C2M A;  2C3M A;  3SCK E;  1MMN A;  4DR7 F;  4LRD A;  2IY5 B;  1VK8 A;  1EZZ B;  1QM9 A;  4RX6 A;  3D0G E;  4ZKA A;  1KRP A;  2MST A;  3UDL A;  4RBT A;  2QSF A;  4RKU C;  2ACY A;  3I0R A;  3C6U B;  4AXJ A;  3MGJ A;  4ANE A;  2MKH A;  1U8S A;  3K8V A;  2BOP A;  2B43 A;  1F9F A;  1WKK A;  2HFU A;  4NZ7 A;  3I4P A;  4I68 A;  3FZB A;  4O0I A;  1PJ6 A;  2AQ4 A;  3DRP A;  4PWW A;  5KFS A;  1NB2 A;  3GG0 A;  4NX9 A;  1OQ6 A;  3A3N B;  3OD2 A;  4EO6 A;  3KLF A;  2BVZ A;  1GXT A;  3LQV A;  2LLZ A;  3BGF A;  4LFA J;  1T8E A;  2MQQ A;  4DR2 J;  1XNQ F;  4PZV A;  2H51 B;  4FNH A;  3ZZP A;  4DWI A;  3H5U A;  1EQ0 A;  5J2M A;  2ZJQ Q;  1YIJ S;  1NHU A;  1V3Z A;  1MNE A;  1YJV A;  2J7W A;  1RHK B;  2HNY B;  3OUY B;  2D9O A;  1YRT A;  2L48 A;  3CGI A;  1K73 T;  3BS9 A;  4B3R J;  2QGF B;  1RYS A;  1UCN A;  2MJN A;  4PQU A;  3NWR A;  1QSY A;  2FLL A;  3C15 A;  1ZH5 A;  2BZ2 A;  4RU2 A;  4ES2 A;  1F5C A;  4O3S A;  3EGW B;  3FBF A;  1Q8K A;  3ILJ A;  3HHL C;  3CJ4 A;  1VIO A;  2AZ1 A;  4ILL A;  1UEU A;  5DDO C;  4I56 A;  3P96 A;  1HWK A;  3T41 A;  1U0H A;  3AOC A;  3G71 S;  4LF6 J;  2LFV A;  8ATC B;  1P6T A;  2DCL A;  3ADA C;  1YJN S;  4GO5 X;  5F8L A;  4QYZ J;  1T05 A;  4ID5 B;  3CCM S;  4OJ3 A;  2R7S A;  3E3X A;  4DR4 F;  1IBL F;  3VF0 B;  4WE1 B;  2L3M A;  3K57 A;  3M6X A;  5JMN A;  4PPZ A;  4ZVQ B;  1G2E A;  2C3U A;  4CO5 A;  1FA0 A;  3QAE A;  3E51 A;  2XMK A;  2QMW A;  4OYX A;  3NNC A;  3THP A;  2DNL A;  3OPK A;  5CH7 B;  1RTD A;  3MM7 B;  3E01 B;  2J9D E;  2MZT A;  5IT4 A;  3CJS A;  2ILY A;  1FKA F;  1TK8 A;  1HFE L;  4M1K A;  3Q22 A;  2XHC A;  3R27 A;  1WHV A;  1JJH A;  5GAH U;  5KFT A;  2W9C A;  2R9L A;  2MKI A;  3BGR A;  5A76 A;  3GIL A;  4AYB D;  2IA0 A;  3WC2 A;  4C11 A;  4BCA A;  4P74 A;  3QT7 A;  1FRK A;  3SIP B;  1ZAX A;  3K5N A;  4FXD A;  3WBZ A;  1U1P A;  2RSQ A;  3GU0 A;  2VH7 A;  3IAM 9;  2R2R A;  1VQL S;  3H2L A;  4ATN A;  4J9R A;  5IC6 B;  3IMQ J;  4HDG A;  2VIC A;  3TAM A;  1S9F A;  5DG7 A;  2ZC4 A;  4KC5 A;  4NCA A;  1GT8 A;  3BBC A;  2MHN A;  1NLT A;  5HAN A;  1NKC A;  1NDC A;  4S0M A;  2MGZ A;  3NL0 A;  2N7Y A;  3KNA A;  2WON A;  4URQ U;  3HT3 A;  1PJ7 A;  4E2F B;  3UDC A;  3I9V 9;  2EC0 A;  5FII A;  3V81 B;  1C1C A;  1N5Q A;  1B7Y B;  1FEH A;  4DR5 J;  4KHR A;  2HQF A;  1CG2 A;  4W90 B;  2EBG A;  3D4J A;  3QSY B;  3BN7 A;  3DLK B;  3RBD A;  2OPR B;  2E9R X;  2DBB A;  1K0V A;  4ZLP A;  3BDE A;  2OLW A;  2QLF B;  2CQ1 A;  4OYB A;  2ALZ A;  2VG6 B;  2WRM A;  4K4Z A;  3PTW A;  3VGU A;  3KXD A;  1WKL A;  1NKE A;  2VQF F;  3VTI A;  3SXL A;  2KFY A;  3BR8 A;  3HVA A;  3KKF A;  4KH0 B;  2GFF A;  2JWN A;  1GAO A;  2IC3 B;  1RT7 B;  5IWA J;  1XMQ F;  2GA7 A;  4J7C A;  4DL7 A;  4W92 B;  1U6F A;  3M8Z A;  2C2E A;  3C2P A;  4MYU A;  2I5J B;  5KFW A;  5H1S V;  3ENW A;  1CJU B;  2XTJ P;  3HHK A;  3C5X C;  4PKD B;  4Y6I A;  3OL6 A;  2FHO B;  1GMU A;  2ZEJ A;  2QZ8 A;  4JI3 J;  5J2Q B;  2NXU A;  1JK9 B;  3N5B A;  5ADZ A;  1X5O A;  5GAG U;  1Z2Z A;  3DN9 A;  4B3T J;  3NY0 A;  5HBM B;  1FDB A;  3IC1 A;  1OMS A;  4DV2 F;  4A47 A;  4I7F A;  3ZXW A;  3OL8 A;  1VBY A;  2VOO A;  4B3S J;  1H2T Z;  1NK8 A;  1RE1 B;  2WW8 A;  5CD4 H;  3M4X A;  2YQ0 A;  1FTC A;  4OYM A;  4HHU A;  2O67 A;  1GX6 A;  1NDP A;  3D1H A;  3NS6 A;  3H98 A;  2AEM A;  2OEK A;  2KT3 A;  1HHQ A;  4KY3 A;  4DHV A;  2WVB A;  3MEE A;  3J7Y U;  2JHE A;  1EB0 A;  2ZBQ A;  1D8Z A;  3GCX P;  3SQO P;  1WTB A;  1E6Y A;  2BAN B;  2D7S A;  5IXU A;  8RUC A;  2K3K A;  5IT9 U;  1E6V A;  1XR6 A;  3ITH B;  5KFZ A;  3T1Y F;  3HKW A;  3O2I A;  2HND A;  5F0W A;  1VC0 A;  1S10 A;  4KBI A;  3TAN A;  2WBM A;  4WJB A;  3MM6 A;  5T7L A;  2KKH A;  4K5R A;  3W65 A;  3H59 A;  4YHH J;  1H2V Z;  4J80 A;  3PCO B;  1LW2 B;  2L9W A;  1LV5 A;  3BM7 A;  1WOO A;  5B0F A;  2RU3 A;  3I5A A;  4ECW A;  3MPW A;  1HBO B;  3UQS A;  3I32 A;  4M5K A;  3R3T A;  4ZCL A;  4JBC A;  4ED5 A;  3KG1 A;  3KUE A;  1TL7 A;  5KFN A;  4YDD B;  4H4K A;  1N36 F;  3KLE A;  4BBY A;  5FLX U;  2E5G A;  3H4D A;  5D4O A;  4RUC A;  5KFA A;  3T9N A;  2PA8 D;  4LIR A;  2B7C B;  3D68 A;  2F4V F;  4NXN J;  1RAO A;  5F8M A;  3HFZ B;  4QR1 A;  2JSX A;  1SL1 A;  1TTH B;  2M70 A;  2XNQ A;  4RW6 A;  4OYA A;  5FDL A;  3CWJ A;  1ZAV A;  3E8O A;  2HBR B;  3MPV A;  4H54 A;  4NCG B;  1RTH B;  4CO2 A;  1GNK A;  4PQA A;  5E3A A;  3HM9 A;  3UNY A;  1SC6 A;  4AQY F;  4FBU A;  3LWL A;  1NDK A;  4X4S A;  5KFY A;  3ZZT A;  2J6T A;  1BQM B;  4LUB A;  2OIH A;  3P4U B;  2HBY B;  4HAC B;  4C8Z A;  1JNR B;  3RR7 A;  1R31 A;  2V5H G;  4DX6 A;  4UTG A;  5BYR A;  3QAU A;  3K2Y A;  4CLP A;  2UUT A;  1ZTT A;  3M2R A;  2HNZ B;  4RWW A;  4OJG A;  3G8T A;  1U4B A;  4FKX A;  4NLR A;  3THV A;  3GR0 A;  1NJI T;  1OSD A;  1D8Y A;  4NCB A;  3GJT B;  4WP8 A;  3TQ1 A;  2ZBC A;  2VIH A;  3HVT A;  3K8W A;  5IFM A;  2HMI A;  4DV0 J;  4ECX A;  5DG8 A;  2DD8 S;  1YLX A;  2KXF A;  4M5N A;  1B0T A;  3BSN A;  2HWT A;  2HGM A;  1Y5I B;  4P9S A;  4QR0 A;  2JH3 A;  1DQ8 A;  2RHS B;  1PO6 A;  1NK6 A;  2Z56 B;  1UMJ A;  2BE2 A;  3IWL A;  4W4M A;  2R7W A;  2XY5 A;  1D3W A;  4FYW B;  4LF9 J;  4BS2 A;  4K0K J;  3K7R A;  2MPU A;  1VHF A;  5HL7 Q;  2UU9 F;  3HO1 A;  5D4P A;  1ZZF A;  3BO2 A;  1ICE B;  2BR0 A;  3QIP A;  3ETM A;  3DOL A;  1DLO A;  1WI8 A;  5CD4 A;  2HRU A;  3C46 A;  3RR8 A;  2EKY A;  3AD9 C;  1PCA A;  1RIS A;  3M6U A;  3FEY B;  2R2U A;  4WKR A;  3PHE A;  5H9F K;  1OIA A;  2LQB A;  5RUB A;  2BV3 A;  1QAX A;  1MG7 A;  2YWG A;  4N8O A;  4A48 A;  4H4O B;  3BRE A;  5AT1 B;  5KFG A;  5K8N A;  5ETT A;  3JQM A;  4LF7 F;  2DNP A;  1ZAW A;  4DSL A;  1HWL A;  1ACM B;  4KV8 B;  1UVK A;  1RHU B;  3ENA A;  2CKW A;  1NEE A;  1IR2 A;  4UST A;  3M1V A;  4KHP F;  3BO3 A;  3MPY A;  2EG2 A;  1L3V A;  2LA6 A;  1FHT A;  2K2P A;  2VBY A;  4OX6 A;  4HT5 A;  4G65 A;  4NYP A;  3DDI A;  3TOQ A;  3PO4 A;  3CCQ S;  3AY0 A;  3AJ1 A;  2PMW A;  2AYE A;  2H4W B;  1S6Q A;  3C14 A;  2WTF A;  2VD3 A;  2XO6 A;  4I6A A;  3QLH B;  1QE1 A;  1HKA A;  4RW9 B;  3M8Q A;  3M2V A;  1FKO B;  4PCQ A;  3THT A;  4BWJ A;  4I2Q A;  2KG0 A;  2W1B A;  2CJX B;  3CC4 S;  4H4M A;  3SZ2 A;  3VGS A;  1K8A T;  3OVB A;  3FEZ A;  4F4Z A;  3T5H A;  1CVJ A;  2NZ4 A;  5L1J A;  2YQ1 A;  1NJZ A;  3AOA A;  4I2P B;  1UA0 A;  2QL5 B;  2VU5 A;  2F1F A;  2FHJ A;  3BGO P;  3G2X A;  1R8C A;  5HQM A;  1FD8 A;  4BC9 A;  2FVQ A;  2DNG A;  2MB0 B;  1HI0 P;  2MYF A;  4X4V A;  1X4F A;  3GMG A;  4HT7 A;  2CXE A;  1HMV A;  3KK3 B;  4PWD A;  4AD6 A;  4IH5 A;  4ECS A;  4WBF A;  1A9N B;  4C0B A;  1LWC A;  1NU4 A;  3CJ2 A;  4JI2 J;  1B0V A;  4ZCM A;  4DPX A;  4WWS A;  2XWY A;  1B64 A;  3R5J B;  2EG1 A;  4F3O A;  5GMD A;  4GC7 A;  4E98 A;  1RT6 B;  2FHM A;  1MN9 A;  3Q8V A;  2DNY A;  1RTZ A;  2K7J A;  4PG7 A;  2XBP A;  3NMR A;  4Y2A A;  1ZOT A;  5ETQ A;  4ZJQ A;  1O0P A;  4PYD A;  3CC7 S;  1XJW B;  3PO5 A;  4N8N A;  4LFA F;  3GZ7 A;  3FSX A;  4DR2 F;  2OI2 A;  2ZHB A;  3GG1 A;  3LP2 A;  3WDO A;  1M0S A;  2ZDO A;  4KO0 B;  2CZ9 A;  3O44 A;  4YR0 A;  4DXL A;  1HBM B;  3SFU A;  3DRR A;  3PIP Q;  4X64 J;  4K8R A;  5C24 B;  4B3R F;  1IM6 A;  1JLQ B;  1RA6 A;  3W3S A;  4DFP A;  3CXC R;  3JSB A;  1N5Y B;  5K9F A;  5L38 A;  4DJB A;  3TUJ C;  1HIY A;  1OQ3 A;  4DI6 A;  2MLX A;  2PSZ A;  2WOM A;  1HNZ J;  1YRU A;  2JEG A;  1TL5 A;  2VAS A;  5B0C A;  3A1Y G;  4ILR A;  4Q8E A;  4M95 A;  1AUS L;  2O1P A;  1Y5N B;  2W24 A;  3DRX A;  4IH6 A;  4DDF A;  3PW2 A;  2WB4 A;  2VFT A;  2JZ8 A;  1UZH A;  3JYT A;  3TAP A;  3X3U A;  2CNL B;  4LF6 F;  4CCH A;  1U1R A;  3SV3 A;  1RT5 A;  4V19 X;  4HVZ A;  3PHT A;  4QW8 A;  4N41 A;  1M5K C;  3HP6 A;  1URR A;  1TL3 A;  1U2R A;  1FDN A;  4DPT A;  1SUQ B;  2FJW A;  4ILM A;  4NWB A;  3ZZO A;  2X3G A;  1UW9 A;  2WW4 A;  4K50 A;  4WTY A;  3RYL A;  1TK0 A;  2QT7 A;  3TZX A;  4YB6 A;  3IR5 B;  2OEJ A;  5J1N A;  2L08 A;  1OPI A;  1RT2 B;  5I3P A;  2XY7 A;  2CJQ A;  3MWB A;  2B5J A;  1CJT B;  2D3Z A;  3QBC A;  3CJQ A;  4DEZ A;  3MR2 A;  3TA1 A;  4RBU A;  2R4F A;  3LOU A;  5DGA A;  4OZ2 A;  2P9G A;  1WF2 A;  3AAW B;  2B4V A;  5IM0 A;  5D3G A;  2C3P A;  2HHS A;  3TZW A;  4NLW A;  2HFN A;  3PFO A;  2AMC B;  4DCP B;  2G13 A;  3AB2 B;  3HJV A;  4DPW A;  4K4X A;  2FGC A;  1WJ9 A;  4KRW A;  2MZR A;  3I55 S;  4LRF A;  3W8P A;  2CPY A;  3PJX A;  1JLG B;  2CQ2 A;  5C25 A;  2OMO A;  4U9R A;  1V3S A;  4CO0 A;  5A2Q U;  2DIU A;  2LU1 A;  4LQ3 A;  1N34 J;  1OWX A;  5HLF A;  4C7Q A;  2P5V A;  4KGM A;  2YQ3 A;  3J80 Y;  4DU8 A;  2CAD A;  2FY1 A;  4A8S A;  1S97 A;  1EAR A;  5I4M A;  3AD8 C;  3NLC A;  4B17 A;  1Y9O A;  4W98 A;  5HK4 A;  1HBN B;  2V69 A;  4ZVU B;  3CJK B;  2V8D A;  2MKC A;  3U1L A;  3MCN A;  3EZ5 A;  3M30 B;  4UOG A;  1WC1 A;  3ISN D;  5KFR A;  3IO1 A;  1SC1 B;  2V8G A;  4URS A;  5F9L A;  4DR5 F;  4ECT A;  3BZQ A;  4C8L A;  4EYI B;  1VR6 A;  2IRY A;  4C9D A;  2ADB A;  2CQG A;  3PX6 A;  5A0Y A;  2EBE A;  9RUB A;  1NK9 A;  4KE5 A;  4OV1 A;  4B9M A;  2V2Z A;  2EEY A;  4TU9 A;  4FPR A;  2XUL A;  1S1V B;  5EHH A;  3FCW A;  4CLS A;  2VDH A;  4TLR A;  2G9O A;  4F0K A;  5K14 B;  4C97 A;  3HMJ G;  2VG5 A;  4ZPW R;  2RUG A;  4HKQ A;  5LT5 A;  3K0J A;  3EZU A;  4FP9 A;  2UXB J;  2ILZ A;  3ILO A;  3TI0 A;  3TA0 A;  4USH A;  4YME A;  3UO0 A;  4CO3 A;  5IWA F;  2GML A;  1RAC B;  2V50 A;  3GFY A;  4DSK A;  1SKW A;  1IBC B;  1Q7L B;  2RQM A;  2E7X A;  2D9P A;  1EKR A;  2JFD A;  1P9Q C;  1YJU A;  1VOM A;  4JI8 J;  1NSA A;  3OW2 R;  3H42 A;  1KNZ A;  3T1A A;  3VCD A;  5CHC B;  2MZJ A;  2X7I A;  2C2R A;  1HNW J;  2Q6C A;  3VVT A;  5CYJ A;  3AH6 A;  4JI3 F;  4DS5 A;  3Q2T C;  1JXE A;  3SEO A;  4KYZ A;  2JX2 A;  4B3T F;  3H40 A;  4CH7 A;  4PG8 A;  1I5O B;  1RTI A;  4EEY A;  4B3S F;  1S1W A;  1MWQ A;  3NG8 A;  4IUF A;  1LEO A;  4IG3 A;  2VHG A;  2OML A;  2CNK B;  1LWF B;  3I87 A;  2KM8 B;  4IOB A;  1U47 A;  2ASJ A;  3D0H E;  2HQI A;  2DKO B;  3E2E A;  1NME B;  2IHR 1;  4HDH A;  4O23 A;  4Z7C A;  1APS A;  4RW4 A;  2UUC J;  4YN3 B;  3AD7 C;  1DTQ A;  2HGN A;  2L9N A;  4E8U A;  4LRA A;  3MMA B;  1VLO A;  4CLZ A;  2IRU A;  3IS9 A;  5CA5 A;  4DCO B;  1VQO S;  3S01 A;  3OR1 B;  1WWH A;  1S6P A;  1VRT B;  4HR2 A;  1SC4 B;  3G82 A;  2DIS A;  1WDD A;  4FXW A;  2ADC A;  1RWO B;  4EUV A;  2XZD B;  1RQ0 A;  2R3V A;  1VI7 A;  2ROP A;  2O5D A;  1JKH A;  1LK5 A;  2R7U A;  2N3O A;  2RD5 C;  1KKH A;  4MK9 A;  4YHH F;  3OTO J;  3SSS A;  3TWZ A;  4G1P A;  5M2R A;  7AT1 B;  4NA2 A;  4HH0 A;  4R5P A;  3N0V A;  3BGU A;  2XLJ A;  2NCK L;  2PMZ D;  3IR6 B;  4OJH A;  3NS7 B;  4HTI A;  1HWJ A;  4USW A;  3EGV A;  2V2V A;  1W2B R;  3W5Z A;  3S1T A;  5D4N A;  2OEL A;  3LH2 S;  5J1E B;  3EX7 B;  1R8P A;  2NSB A;  2ZNY A;  5F3T A;  3NAI A;  3W2W A;  4MIA A;  3RUB L;  1SJ1 A;  4NXN F;  3W1Y C;  1Q1K A;  2ODX A;  1XAO A;  4X66 J;  4DQS A;  2LQ5 A;  2D69 A;  1Y3J A;  1JLB B;  1VQ5 S;  2VA2 A;  3C66 A;  2E5H A;  3FRY A;  2IPO B;  1XMO J;  1U02 A;  3GYG A;  2EC2 A;  4Q44 A;  3QAT A;  4L76 A;  1ARO P;  2IM1 A;  2P9C A;  3UE2 A;  3EZO A;  3EDR B;  3D3C J;  5EN1 A;  2C28 A;  3ZNU A;  4URG A;  1LOU A;  1NHV A;  3D67 A;  2UP1 A;  1NCL A;  2GX8 A;  3PIO Q;  4FN5 A;  3T1H J;  1YJ9 S;  3JSM A;  5AE2 A;  4M94 A;  1F3F A;  4KFB B;  4DSI A;  2BA9 A;  2W4D A;  3KOA A;  1JWW A;  1UJ6 A;  3IBC B;  1DHM A;  2IJF A;  3A8K A;  4KKO A;  3L95 X;  1TQL A;  1U7L A;  2XWX A;  4B3M J;  5J2P A;  1KOH A;  4CRJ A;  4L6V 3;  3T5K A;  3HKZ D;  5CYQ B;  2JEF A;  4DV0 F;  5HQL A;  1KLM B;  4KGX B;  2OPQ B;  2EPI A;  3GIJ A;  1S0M A;  3RB4 A;  1VJW A;  4CNY A;  1U2C A;  3UWT A;  4HLB A;  2JC0 A;  2DNH A;  4FYX B;  3FSY A;  5JUM A;  4LF9 F;  2EWH A;  3FVY A;  1SBR A;  4K0K F;  4AE5 A;  2K1R A;  2DNQ A;  1SL2 A;  3UPF A;  2I9S A;  3SQG A;  3TAQ A;  4DX7 A;  2QL7 B;  2ZWP A;  1CPZ A;  3OFE A;  3KLG A;  5HJX A;  5AJ3 J;  3HLU A;  3POT A;  3JB9 k;  2FD2 A;  1RCX B;  3HVW A;  5GAD I;  5HAT A;  2VPZ B;  4TXS A;  2XS2 A;  1YSJ A;  1TUV A;  3M8P B;  2P2C B;  2VOP A;  1CC8 A;  3OXF A;  4FXV A;  1RXO B;  2YWE A;  3QGP A;  4WFA Q;  2HEK A;  3W2V B;  4EBD A;  1IJF B;  2W2M P;  2HYI B;  3KMQ A;  4RLE A;  2ZH7 A;  2YKN A;  3CIM A;  2BE9 B;  2WB1 D;  1HHS A;  1ITP A;  3MPD A;  4P75 A;  3D6H B;  2Q66 A;  3MR5 A;  4X4R A;  3U7J A;  1T03 A;  2VBW A;  3MR3 A;  1YK9 A;  5DG9 A;  2OTJ S;  1QY7 A;  3LUY A;  4CT9 A;  2HS0 A;  2C2O B;  3A3O B;  4DOZ A;  2BKN A;  2XEX A;  1ELO A;  1NK5 A;  5LSR A;  3NMA A;  1IM4 A;  4X84 A;  2GNK A;  2FVC A;  2D3U A;  4R8U B;  4MT1 A;  4DL6 A;  4X4N A;  2X51 A;  2NUH A;  4LF2 A;  4LR8 A;  2YNF A;  3KG0 A;  2ZH6 A;  2QMX A;  2FVS A;  4O3Q A;  3M8W A;  5HP1 A;  3BYP A;  2HIQ A;  5I3U A;  1KBR A;  2BJD A;  4P72 A;  2HIY A;  2MKY A;  5BYS A;  4Y0F A;  3IFE A;  1P1T A;  5D6G A;  1S57 A;  2FYX A;  1U6B A;  2GQ2 A;  2DIV A;  1C0T B;  4DR3 J;  3MAA A;  5CYM B;  4FF4 A;  1BQN A;  5KFL A;  4NLQ A;  1CJK B;  4PR6 A;  4MKV A;  2QLW A;  4LRB A;  4JI2 F;  2FLP A;  2ZE2 B;  3VGV A;  1NPP A;  5B0A A;  4ZVO B;  2QLX A;  2KYZ A;  3WX4 A;  2YNI A;  4O4G B;  1RT3 B;  1P8G A;  1S79 A;  3TX0 A;  4CWB A;  1WG1 A;  3B6B A;  4B9T A;  2FJD B;  7FD1 A;  2C2Z B;  4FKY A;  5HMW A;  2VFV A;  2YVS A;  2N4C A;  3MM5 A;  4MKY A;  3BH6 B;  1RAB B;  2DXD A;  4OV6 A;  4AT1 B;  2JZ5 A;  2W8L A;  1IUJ A;  4GVL A;  2CNO B;  5DM7 Q;  3SCJ E;  3VAF A;  2CPJ A;  3RRG A;  2HK3 A;  4X64 F;  4N5S A;  2H48 B;  3DGP B;  3PXG a;  3ENV A;  5T14 A;  4UZB A;  1HQE B;  2VBZ A;  2M52 A;  3GCW P;  2GVZ B;  2DYA A;  1RYR A;  1KWM A;  3FKB A;  4DG1 A;  5HJY A;  4LSL A;  2LEA A;  1X5P A;  4P7T A;  4Z37 A;  3W60 A;  4HL9 A;  4QYZ K;  3PM9 A;  5H9E J;  1HNZ F;  2FC8 A;  4OHZ A;  4F2R A;  1N6Q A;  3KLH B;  4U8Y A;  1FK9 A;  1U1N A;  4PUO B;  3U27 A;  1F1B B;  2JJ4 D;  2W2Q P;  2ZIT A;  2DHH A;  3T6B A;  1SKR A;  4O3N A;  2AEF A;  3ZTR A;  1TP7 A;  3DOK B;  4WKY A;  3MEC A;  2PFD A;  2BQR A;  4ZLN A;  5KFO A;  1AW0 A;  1TL1 A;  1UL3 A;  4DL5 A;  2J9E A;  1XIQ A;  5FJ4 A;  3WQP A;  2X1F A;  2J7K A;  1ZM2 A;  4ZCK A;  3HSZ A;  4FBT A;  1YDL A;  1RT4 B;  1LNQ A;  4JI0 J;  1IKV B;  1JLC A;  3DYA B;  1CS4 A;  3LGH A;  5C5J A;  1FRX A;  1VRU A;  2U2F A;  4CLW A;  4TKT A;  3OSN A;  5CCL A;  1H7X A;  4AL6 A;  2ZH2 A;  4LFC J;  3SFG A;  3Q83 A;  1R6V A;  3CSK A;  3DLE B;  4L74 A;  1HQ2 A;  2V4J A;  4RUB A;  2RDJ A;  5IT9 Y;  2DGU A;  1X9S A;  4IKA A;  1S1T A;  4NLG A;  5LSO A;  2XMA A;  3DRS A;  3IRX B;  4DUT A;  2J9C A;  1OYE A;  4A8Y A;  2CQ0 A;  1L3T A;  1WHW A;  1FRH A;  2WSC C;  3MPU B;  4ECV A;  1S9E B;  3P5T L;  3EWG A;  4UW2 A;  5KFU A;  4M5G A;  1QAY A;  5AXM A;  1I6J A;  3UVJ A;  2XSJ B;  3FNN A;  2IRX A;  5KFD A;  1N34 F;  3DI6 B;  5EWG A;  2VFR A;  1FRL A;  2EFN A;  2KG1 A;  3D6F B;  3JS9 A;  2EXU A;  1GMV A;  1RAJ A;  2HVD A;  3KMS A;  1TR0 A;  5FLX Y;  3BV8 A;  1VQ4 S;  1G4C A;  1HLW A;  1SB6 A;  4U67 Q;  5K8P A;  3O8W A;  4DCJ B;  1WOR A;  3QJJ A;  4DR6 J;  2LA4 A;  1MU2 A;  2MHE A;  4NLY A;  3T19 A;  3BJY A;  4IRD A;  4ZN3 A;  3M7V A;  1X5S A;  1AZS A;  3NEK A;  3IBF B;  2BBE A;  2XB2 D;  4MFB A;  1R0B G;  1SH3 A;  3N6N A;  3G96 A;  2ASL A;  1IKW B;  2XS5 A;  2J8A A;  3GB0 A;  4IH7 A;  1WTF A;  4J9Q A;  3R7S B;  2XMU A;  4TYB A;  1XWL A;  4ZK7 M;  1UTA A;  2DNR A;  4QIG A;  3ISZ A;  1TK5 A;  1JLE A;  3T5L A;  1KVI A;  3LA0 A;  5DET A;  3EXY A;  1T9T A;  3DM2 B;  1TKX B;  1V5I B;  1SJ3 P;  4OLO A;  1S1X A;  1JJ4 A;  2DCU B;  4YUD A;  3I4H X;  3EGZ A;  4Q2L A;  2YX1 A;  4CO4 A;  4DZD A;  2PT0 A;  2UXB F;  2DNZ A;  2GVD A;  4OYZ A;  5A8R B;  2E29 A;  2CQI A;  1F2G A;  2IBK A;  5E7O B;  1WF0 A;  3NGK A;  4DF8 A;  4PXC A;  4O3R A;  2WVD A;  3MED A;  3CNQ P;  3GYX B;  4MMO A;  3H2U B;  3CDB A;  1R0A B;  5I42 B;  1HPZ A;  3W62 A;  2N82 B;  4JI8 F;  5C42 B;  4C3M A;  3D1O A;  3CO9 A;  2KU7 A;  2CQP A;  1HNW F;  2BAB A;  1SXL A;  4MK7 A;  3UR0 A;  3FMB A;  1IQZ A;  1R8B A;  2FVR A;  2ASD A;  1TMJ A;  1M5S A;  2ZFH A;  4PRF A;  4PAB A;  5D0H A;  1TVR B;  4Q0B A;  2RH3 A;  3CJ8 A;  2HGL A;  2CPX A;  1X31 C;  3KHL A;  4CYU B;  3AFG A;  1QTN B;  3C6T B;  1RBA A;  4J9K A;  4RW7 A;  3ZTO A;  3ONQ A;  1FJC A;  1KQK A;  1UJ5 A;  4USJ C;  5KFE A;  1PYS B;  3HZG A;  2XLI A;  1SV5 A;  5CAA A;  2UUC F;  4DL4 A;  3DLG B;  1WSV A;  5L1K A;  3KFW X;  1REV A;  4B02 A;  2CQ3 A;  2BJ1 A;  5D0R A;  4PG5 A;  2B51 A;  4ENO A;  4CZC A;  4XDD A;  1LW0 B;  1FO1 A;  1Q78 A;  1S76 D;  1T0T V;  2OHD A;  5THW A;  1MRO B;  3GSD A;  3LP1 A;  5EWF A;  4O4R A;  2YKM B;  1RKI A;  3KLV A;  3AA8 A;  4Q7A A;  1QVF R;  4B3O A;  1NO8 A;  3OVA A;  2GCF A;  3D7S B;  2EFV A;  2BM0 A;  3OTO F;  2RF2 A;  1VJQ A;  1JLF A;  4N76 A;  1PGZ A;  4KJI A;  2DB1 A;  1C0U A;  2VC0 A;  2VFS A;  2H5E A;  3PW5 A;  2GO9 A;  2W4P A;  3S6E A;  5D77 A;  2CJY B;  5IQQ A;  2HKE A;  5GME A;  3R97 A;  4ICL A;  4IR1 A;  4O0N A;  1FXL A;  1Q16 B;  3GJR B;  5LXY A;  3R1H A;  2Z0G A;  1WSR A;  4DU7 A;  1HQU A;  3I0R B;  4R0J A;  3TVK A;  3LZ8 A;  3NGS A;  1ZM9 A;  3HSG A;  2HVI A;  1PSD A;  2HZA A;  3R6G B;  3M9M B;  2QLD A;  3HHL A;  2ATL A;  2ROE A;  3GYN A;  1U24 A;  2HFV A;  4DUY J;  3DRP B;  3W5X A;  4X66 F;  1IBK J;  3KLF B;  1WG4 A;  4IFV A;  4IO9 Q;  3ZNJ 1;  4LF5 J;  3VZH A;  1VQM S;  3CIZ A;  1XMO F;  3RU0 A;  2FHJ D;  4NLO A;  5B09 A;  2LKZ A;  5J2M B;  3QGI A;  2YTC A;  3QRR A;  1V3R A;  2EVZ A;  1X0P A;  1U1M A;  1VK3 A;  3AXK A;  1QAI A;  4QCL A;  4ELU A;  2LYV A;  3EDQ B;  4QIF A;  4EMD A;  3JXO A;  1PBU A;  2WBR A;  1RJJ A;  5T41 A;  3FK4 A;  4PXE A;  4PQU B;  5E33 A;  2NUU G;  4ZLL A;  2FJE B;  1NSK L;  3BPD A;  4WP9 A;  1PC4 A;  3T1H F;  4DV5 J;  2EFO A;  3F73 A;  3C15 B;  2NS1 B;  5DDQ C;  2LP4 A;  3IG1 A;  1NLK L;  1FT8 A;  3CCJ S;  2QX0 A;  1NBE B;  3DDK A;  1HWI A;  3Q23 A;  2Y8W A;  1QSL A;  4ZN1 A;  4OZN A;  4F25 A;  3RRK A;  4B3M F;  4J9L A;  3OTD A;  4DR1 J;  1NK0 A;  1XK8 A;  4RU9 A;  1TKT A;  3U1N A;  2Z57 B;  1U0H B;  1RB0 A;  1NK7 A;  2E1C A;  2G2O A;  2VG7 A;  3R1L A;  4JI5 J;  3Q86 A;  4CLK A;  1T05 B;  3H5S A;  2RU9 A;  2EI5 A;  3QNW B;  1W26 A;  1VQ6 S;  3JQJ A;  3JTP A;  3C8Y A;  5KFI A;  5M2U A;  2EFG A;  2QMU B;  3H5X A;  9ATC B;  4F02 A;  4Y2M A;  4ZDN A;  2XGP A;  4UZC A;  1N0U A;  3KUH A;  5AXK A;  4LBI A;  2X1A A;  1YI2 S;  1IR0 A;  4ZPB A;  4IFY A;  1JXV A;  2RHQ B;  1PKU A;  3MMJ A;  4ID8 A;  3DLL Q;  3MEG A;  1DBD A;  4QR2 A;  1Q8I A;  2HLT A;  1U6Z A;  1FD2 A;  3GQC A;  2R8J A;  5AJ3 F;  1X60 A;  3FBB A;  3CT9 A;  2KRB A;  5E2Q A;  4CTA A;  2DNO A;  3FDS A;  1RTD B;  4J91 A;  2YNG A;  1I3O B;  3PRB A;  4LRE A;  3K17 A;  4DZ6 A;  1AT1 B;  3L7O A;  2JDJ A;  3J81 U;  2M88 A;  2V9K A;  4K7Q A;  4TYA A;  2HVE A;  1RAF B;  2HFO A;  3EUN A;  3OFF A;  2W9C B;  3BGR B;  1QJH A;  1EKS A;  2BJE A;  1X4B A;  4C11 B;  3MMB A;  1FXD A;  4ZJL A;  1WNE A;  3M8S A;  2ABY A;  1BMQ B;  5BXI A;  1F5B A;  5IQ6 A;  5E3C A;  1YZ7 A;  2FLO A;  2AHO B;  3V4I A;  4LRC A;  3CF5 Q;  2GIF A;  4NLD A;  2H65 B;  3TAM B;  3CD7 A;  2Q1L A;  5IV4 A;  3V6D A;  4A8F A;  2YPZ A;  5C2G A;  2UV8 A;  2RUS A;  5F8I A;  2CPD A;  1S7H A;  1AXQ A;  5L1I A;  1B4S A;  3Q8Q B;  2MGZ B;  3VGT A;  2WON B;  3GFX A;  4XPE A;  2FHK A;  5A2Q Y;  2RRN A;  3NRB A;  1RUS A;  3BDP A;  1C1C B;  1N33 J;  5KT3 A;  1C1B A;  1RAI B;  4F67 A;  2N3L A;  2GIR A;  3KWM A;  3KHG A;  4C3K A;  1CBK A;  2HRY A;  5KFF A;  2A6O A;  2BEF A;  2V0N A;  1NUE A;  1HNV A;  3U1M A;  3CDE A;  4DR3 F;  4DV3 J;  2Z30 B;  1U1O A;  1UWB A;  4X4O A;  4RW8 A;  4ZVT B;  3EVO A;  5AXN A;  3R6L B;  2OSQ A;  3B4M A;  4KPY A;  3QZ7 A;  2E5J A;  4HI2 A;  3ZTQ A;  3LAK A;  3HD2 A;  3R2D J;  2VON A;  3BEG B;  4HHJ A;  3IM8 A;  4J9P A;  1A7G E;  3W66 A;  4MKA A;  1T9U A;  1NSQ A;  2KT2 A;  4K4W A;  3FC9 A;  5KFJ A;  1FNX H;  2XC9 A;  2XMT A;  1BE4 A;  1WEZ A;  2OFG X;  4IG0 A;  3OFH A;  4KHM A;  2ATC B;  2R42 A;  1SH2 A;  1D9F A;  3C6E C;  4ZP8 A;  3K5O A;  3OXL A;  1ZYQ A;  5B08 A;  1MN7 A;  1GXU A;  2C2N A;  4LF1 A;  1UPP A;  2C1E B;  2OPP A;  1M5P C;  2HLU A;  3OV7 A;  3PW7 A;  4JI6 J;  1PIL A;  2LU2 A;  3L09 A;  3KYL A;  4U96 A;  2AT1 B;  2AJ0 A;  4WF9 Q;  2DGO A;  5KT7 A;  1GTH A;  2AYM A;  1IR1 A;  1DTT A;  1TKZ A;  1QVG R;  2XQC A;  1FNM A;  1CJV A;  2DGT A;  1S0V A;  1FWL A;  1X5T A;  3OSP A;  2RNE A;  3I56 S;  4I7F B;  4DUZ J;  1S49 A;  3QID A;  4ZVH A;  3BPS P;  1R27 B;  2GMJ A;  4AL5 A;  4TU7 A;  2GJF A;  3UDV A;  4OZ5 A;  1ZM4 A;  5KG2 A;  1U48 A;  4UOH A;  2YWW A;  5ETO A;  2AKW B;  1SJQ A;  3KJV A;  2EFQ A;  2B9E A;  2B4O A;  4PWU A;  1GFW B;  3CO0 P;  1KHV A;  2VBX A;  3NKY A;  1U1Q A;  3MEE B;  2CZV C;  1S4E A;  3RW7 A;  3SI8 A;  1E6Y B;  3KNG A;  4JI0 F;  3ETO A;  2GS8 A;  3UD4 P;  5B0B A;  4ZPD A;  3DLH A;  2V4R A;  2ZH8 A;  1SKU B;  4NEY A;  2KHD A;  2ZDP A;  2HND B;  4X2B A;  4TY8 A;  3MM6 B;  5T7L B;  2H54 B;  4LFC F;  1Y0H A;  3US5 A;  1VMB A;  4LT6 A;  4G1Q A;  2HQD A;  4CLF A;  3PJW A;  4WU2 A;  3OR2 A;  4ED2 A;  4QWD A;  3GLJ A;  4KPC A;  4DX5 A;  2UUB J;  4QPX A;  3VR1 A;  1L3U A;  2ZHA A;  2BJ3 A;  4KH1 B;  1WHX A;  2KJW A;  3VAI A;  1LXN A;  2HHT A;  1VFJ A;  3BH7 B;  2CAJ A;  2E1M C;  5FD1 A;  4OMF G;  1TL7 B;  3DXS X;  5MLC V;  2KRR A;  3HHD A;  2E5L J;  3JSY A;  4OJ1 A;  3K5M A;  4OYO A;  3M9O B;  2P9E A;  5GAE I;  2G0J A;  3NCP A;  2VPX B;  4M8L A;  2X1G A;  3IR7 B;  3P5B P;  4LR7 A;  1TL4 A;  4DV6 J;  3L7P A;  1T9V A;  1SC3 B;  4JI4 J;  1P27 B;  4A8Q A;  4TLQ A;  4RW6 B;  2F8E X;  5FDL B;  2HSE B;  1ZTW A;  1MW7 A;  5DQI A;  4ETX A;  2BUN A;  7FDR A;  2BJ8 A;  2A10 A;  3CCV S;  2MXY A;  4M5L A;  3WX8 A;  2DHG A;  2M5Y A;  2DT9 A;  4F0H A;  4RO0 A;  4QIV A;  1YIT S;  2W9B A;  2F3J A;  5ETN A;  3FQK A;  1S99 A;  1P1L A;  2W7A A;  1TFY A;  1VHI A;  4ECY A;  4DR6 F;  1J2V A;  3HZE A;  2UUA J;  4DSF A;  3WC0 A;  2IA6 A;  1BQX A;  1KQG B;  3TAR A;  3CJ0 A;  1NZA A;  2IJN A;  1UVJ A;  1HW8 A;  1JLA A;  3A8J A;  3P8B B;  2WZ1 A;  4NYZ A;  1KEK A;  2G2Y A;  4NML A;  1X4G A;  1WC3 A;  5A8W A;  2AGQ A;  1SIW B;  3OL7 A;  3QFH A;  2OPS A;  4CO1 A;  1H98 A;  3M2R B;  1NPK A;  1TUG B;  2QRR A;  4FF2 A;  3L9Z A;  3FUY A;  3D66 A;  2KH9 A;  1N8R T;  4JV2 A;  1RHJ B;  4I1T A;  3OFG A;  3AHP A;  2HHW A;  1ZPW X;  3HVT B;  2HMI B;  4Y65 A;  3C3L A;  1S9G A;  3M6V A;  4HI1 A;  2V4Q A;  4CNZ A;  2V63 A;  3TEH B;  1YWX A;  3DNC A;  5EX0 A;  3NNA A;  3H8Y A;  2CWX A;  1FVQ A;  1TUW A;  3CUN A;  5HRO A;  4GKK J;  3MUR P;  1RHQ B;  1YJT A;  3W61 A;  1HNI A;  3R7B B;  1J5O A;  2DIT A;  1RWP B;  2RAQ A;  1EHW A;  5EWE A;  2BE2 B;  3QYY A;  3KJF B;  2FJV A;  4QIW D;  1PJ5 A;  3GTY X;  2C2M B;  1HI1 A;  3SYZ A;  3M2U A;  4B9N A;  3QIP B;  4GMK A;  1S48 A;  3DOL B;  1X4C A;  1DLO B;  3D6M B;  1UET A;  3GFH A;  2E44 A;  1N0V C;  4NAS A;  1S59 A;  2DR9 A;  2PFF B;  3M9N B;  3KHH A;  5KAK A;  4M5D A;  3MFI A;  2F40 A;  4WK1 A;  1HNX J;  5L9X A;  3MZI A;  3HFK A;  4E0D A;  2KM8 C;  4ZHR B;  3M1V B;  1EX8 A;  3MMC A;  5KFV A;  4X62 J;  2G1D A;  3QFW A;  2IM0 A;  3RB3 A;  2QA2 A;  2RKI A;  3EPI A;  3T9Z A;  4UUW A;  2QLB B;  3QMQ A;  1S6Q B;  3C14 B;  1M1K T;  4WYW A;  4TN2 A;  2H5I B;  4UUX A;  1QE1 B;  5ETV A;  1CJK A;  3IXQ A;  3M8Q B;  3M2V B;  5K20 B;  1YKW A;  1N54 B;  4NRT A;  4I2Q B;  1R89 A;  3SBM A;  4USK A;  2NXE A;  2NYI A;  1YZ6 A;  4GVB A;  1QLN A;  1IJE B;  1NHK L;  4M5H A;  5A6P A;  4P6Q A;  4H4M B;  3TYT A;  1AFJ A;  1DAR A;  2CVE A;  3PYF A;  3KK2 A;  2DR8 A;  2YH0 A;  2ROG A;  4FS2 A;  4ZP9 A;  4F8R A;  2HFZ A;  2CDR B;  4PPD A;  1RTJ A;  1HI8 A;  4QWE A;  3V5R A;  2R8I A;  1H0H B;  3PW4 A;  4CQ1 A;  1T3O A;  2GV1 A;  1U8W A;  3K58 A;  3QSI A;  2E9Z A;  2NPF A;  4J9S A;  2BYC A;  1HMV B;  1KS2 A;  2OP5 A;  4LJM A;  1GMW A;  2DY1 A;  3OL9 A;  4PWD B;  2EK1 A;  2C3Y A;  5IC4 B;  1LWC B;  1S1U A;  3G87 A;  4DV1 J;  4DSJ A;  4U6P A;  5ETS A;  4CI0 B;  3CMQ A;  2R7X A;  2CYY A;  3O6Q A;  2YWK A;  2RQK A;  3QT6 A;  4DUY F;  2NR0 A;  3HT0 A;  2ZC3 A;  1IBK F;  3OHA A;  4RBV A;  4LF5 F;  2D1C A;  1RLC L;  3CDA A;  5A8K A;  1IKY A;  4OHW A;  2HQ3 A;  2Z4P A;  4USU A;  4U95 A;  4ZLJ A;  3LP2 B;  2ZWO A;  4I64 A;  3W9J A;  1SVD A;  4K2X A;  2JL9 A;  2BQU A;  1PBA A;  5G0R A;  1M5H A;  1RAG B;  2AJ2 A;  3DRR B;  2FC9 A;  1NKB A;  1UKU A;  2G2Z A;  4UOF A;  3DOM A;  1A6L A;  2H9Z A;  1SL0 A;  1YJW S;  3M32 A;  4N7T A;  1HL6 A;  5KTQ A;  2V8V A;  4P2X A;  1PIE A;  4DV5 F;  3ZZR A;  2JRR A;  3D3B J;  2ZZM A;  3LAN A;  4DN9 A;  2BJ9 A;  4AL7 A;  2WOM B;  2BAC A;  1HD1 A;  4C4W A;  1EP4 A;  3FCH A;  3L4B C;  1ZM3 A;  3UD3 P;  4DR1 F;  3MM8 A;  1IXK A;  3TVY A;  3W63 A;  2YXL A;  1RT1 A;  3JYT B;  3DXB A;  1WI6 A;  2P6T A;  4JI5 F;  1UW4 A;  1FFW B;  2RIJ A;  1O6X A;  1RT5 B;  3KK1 A;  3G4S S;  3HSJ A;  3CCT A;  1YJR A;  1TL3 B;  2W2O P;  4K4U A;  2W2P P;  1DUR A;  5DZ7 A;  3DMJ A;  3FFI A;  1RAA B;  4A8K A;  1JJ2 R;  5L9N A;  2BRK A;  3CED A;  1NDL A;  2PN6 A;  3D9B A;  4L73 A;  2YKA A;  4F2S A;  3IN5 A;  5L46 A;  2XZT B; 
#chains in the Genus database with same CATH homology
 3TJA A;  2B26 A;  1EB0 A;  4J80 A;  3TJ9 A;  1EAR A;  3AGX A;  4L3K A;  3L9Z A;  1XAO A;  3NXZ A;  2Q2G A;  1GMW A;  3LZ8 A;  3I38 A;  3LA0 A;  3TJ8 A;  2HFV A;  3NY0 A;  1C3G A;  3AGZ A;  1NLT A;  2QLD A;  1GMU A;  1GMV A;  3AGY A;  1GMW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...