3NXZA

Crystal structure of uree from helicobacter pylori (cu2+ bound form)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
MIIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
molecule keywords Urease accessory protein ureE
total genus 38
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3nxzA01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3nxzA02
3NY0A 1C3GA 1GMWA 3NXZA 3TJAA 3TJ9A 1EARA 3AGYA 3AGZA 1GMVA 4J80A 2B26A 2QLDA 4L3KA 3LZ8A 3L9ZA 1EB0A 1NLTA 2Q2GA 1GMUA 3LA0A 1GMWD 3AGXA 3TJ8A 3I38A 2HFVA 1XAOA
chains in the Genus database with same CATH superfamily
2JX2A 2VC0A 3D68A 1NCLA 5AXLA 5GMKa 3J81Y 3HD2A 5DETA 4X66J 2HGNA 2HNZB 3PG9A 5JVGQ 5KT2A 2DGXA 1IBLF 1RWOB 3I82A 1R8CA 3FSYA 3VZHA 4KHMA 4XPCA 3BBBA 2A0FB 4LFCF 1FJ7A 2CNKB 4KFBA 1AW0A 1NUEA 1VC0A 1U0HA 4YP3A 2DGOA 3GILA 1DTTA 1S72S 5KFAA 1S4EA 1JXEA 2QA4G 5D3GA 2KFZA 3FFIA 2ABYA 3TQEA 3M9NB 1R3NA 1Y5IB 2OKQA 3D6FB 3DLEB 3GWCA 4NZ7A 2HNYB 5GAEI 4DF4A 4PYAA 2AGQA 5CYJA 1RWNB 1ZZFA 1YITS 4DR4F 3M1VA 3T1HJ 1FF2A 5DDPC 2RU9A 4FS2A 5D6GA 1NNDA 4KV8B 3RAMA 3CJSA 1VBKA 4XO0A 1C1CA 3BGUA 2KFYA 4NXMJ 1NSPA 4QCLA 2E5JA 3O5TB 3WQPA 3RB3A 2ZBCA 2PGCA 2ATCB 4USHA 4M5NA 2DXDA 1X9MA 2E5IA 3CDAA 2O66A 4YEAA 1PSDA 2B9EA 2R7XA 3O8WA 1FXLA 2K3IA 2W9CA 2RH3A 3D6HB 4I56A 1D9DA 1IBKF 3ZZOA 3RRHA 4FBUA 2CVIA 1NLTA 5DM7Q 2YNGA 1R8AA 2MTLA 3M8PA 3HHKA 4USUA 1ZPVA 2Y8WA 1HWKA 4LRDA 3IS9A 3OXGA 1AYEA 3AH6A 3Q8QB 5DQHA 1GEHA 3JTOA 2VV5A 3DDIA 1RAIB 1L3VA 1TR0A 2FPHX 2VUGA 1DAXA 2XSFA 2HZVA 4K4VA 3RR8A 4CLWA 1FKAF 2LMIA 4UW2A 2HK2A 3RYLA 3MAAA 3OL7A 1IBMF 1DQ9A 4AD6A 1VBXA 3JAMU 4FXVA 4EYHB 5KFVA 1I5OB 3V81B 3OLAA 5IM0A 2MY8A 5EX0A 5C7PA 3M8PB 2UXCJ 3POTB 3CDEA 3WX4A 3W3SA 4B3SJ 1RT6B 4QQBA 2VJUA 1NK7A 5B0DA 1C0TA 1X0PA 3SCIE 2NR0A 4AQYF 2XYHB 1WDTA 5E41A 3MF5A 1FD8A 1PJ7A 3UVJB 3BSOA 2BM1A 2BQUA 3C16B 4UY85 4LMZA 2WW4A 4KPYA 5CYQA 4DQPA 1F3FA 1FEEA 2Z2ZA 2NLWA 3UN2A 5DQIA 4DL6A 4TQSA 4PXEA 2J9CA 1TV6A 3CCLS 3PDNA 1YX2A 3DGVA 1G1XA 5IS2A 3A12A 1DQAA 3V6JA 2FHMA 3A13A 3LH2S 4LR9A 1LWXA 1RHQB 2HWTA 2NYHA 1VYAA 2KXHA 4YB5A 3B4DA 3V4MA 1IVZA 1LK5A 2BXJA 4DU8A 4F50A 4F3OA 4B3SF 2XYPB 1BGXT 5L38A 4PWDB 1F6TA 3DLGA 4FXDA 3CXCR 1KR4A 3OR2B 3ENAA 1KOHA 4NYZA 4PG4A 3MR6A 4KYZA 3M9MB 4TYAA 1NSAA 1U1KA 1RYSA 5KG6A 4FBTA 2RDIA 1XJWB 3FCVA 4RBVA 1BQNB 3Q8SB 4JYAJ 2FVCA 3CB4A 4DQRA 1GX6A 3M2VA 1YK9A 4ZVOB 4EO6A 1ZPWX 1RWPB 3Q83A 3QSIA 1M1KT 1ZH5A 4NASA 4ED6A 3QMQA 1ZM3A 4Q8EA 3C6TA 1YRUA 2IYGA 2ZVSA 2HWIA 2COLA 2MQLA 1GMVA 2DNHA 2H1YA 2YVSA 4NEYA 5E3CA 3ZTOA 4A48A 4PWDA 4QU7A 2RHSB 4YOEA 1ZA2B 3T1HF 2R8HA 3WC0A 3BGOP 1MW7A 2QA4S 2D3UA 5K14B 2WBRA 3EVMA 3GV5B 4J9PA 4EBCA 2IA6A 2V9WA 4DDFA 2XZDB 2QLWA 2ZNZA 3SSQA 2FJAB 4WU2A 2P9EA 1UA0A 1OYDA 1VI7A 3G9CA 4B3OB 4DPXA 4ID8A 1CJUB 1N6QB 3P45B 1HFEL 2QJ3A 1HQEB 1HBUB 3H4BA 1D8ZA 4MFBB 2E5LF 3DRYA 4OYBA 4F2RA 1NKCA 2GQ2A 3I5CA 4AXJA 2E1AA 1FKPA 5EUHA 2MKJA 3CSKA 3S01A 4DLGA 1ITPA 3S7RA 4K4XA 3MPYA 4DFKA 2D41A 2NXEA 2GA7A 1BMQB 3O44A 4PQAA 3V2UC 4ZJQA 4GC6A 4OQJA 4KB7A 2K1RA 2ASLA 4DR7J 1H2UX 3N79A 4DSEA 1H2TZ 2VG5B 3WZ0A 2BYCA 4C0BA 1OY8A 2R2SA 2V8PA 3QAEA 2CQPA 4U9RA 1SQGA 2A10A 1REVA 2AIRB 2ZE2B 3IR5B 3TR5A 2K8GA 2EC2A 2MXYA 1A6LA 1YTYA 1NLKL 2OTLS 2G1DA 1FESA 3WIUA 2ZH8A 2NZ4A 5A2QU 4X4NA 2IVFB 5HSPA 4WP8A 4OI6A 3OV7A 5A76A 2ASJA 2HGMA 3O1LA 1N34J 2XC9A 2J0SD 3O6QA 4N8OA 4DV3F 2HIQA 2R7RA 4PRFA 1VQKS 3EGNA 5KG3A 2BZ2A 4ANEA 3NBPA 3K57A 2R8IA 1KDNA 1F5BA 1IJEB 1S6QA 3QO9B 4NX9A 4NLVA 4CYUA 4WCEQ 2LQ5A 2MGZA 2DH8A 1RYRA 3OQ2A 2F9DA 4AUKA 1C1BB 2E1CA 1ZAXA 2AMCB 3FFIB 4CO5A 4KO0A 3GPAA 3AJ2A 3M6UA 5I3UA 4KIAA 4JV0A 4WE1A 5LOQA 1K44A 3F56A 3HLUA 3JYTB 4DOZA 4O3NA 1TMMA 3K58A 4A8XA 1NK9A 4WBFA 2JEFA 3ONQA 3P8BB 4GC7A 1S49A 3CNQP 2J76E 5BYSA 1GFWB 1M5OC 4DXLA 2DRAA 4JI5J 1OSCA 2GCFA 2E7WA 1L3TA 1DLOA 5FDLB 5A8RA 3V5RA 2J7UA 2KHDA 4ZVRB 3SFUA 3KK1A 4B3MJ 4CCHA 4ENOA 2VASA 5LSOA 1S0OA 4NXNF 1QAIA 2UU9J 3W62A 5LMNF 1RU1A 2RNEA 3CD6S 3DLLQ 1R89A 3LWLA 2Q1LA 1HLWA 2ZDOA 3NRBA 3ET6B 2NSBA 1J2VA 1RWWB 1JLCB 3LF0A 1B99A 3JSYA 5E7OB 3M8QB 4IQMA 3SDEB 4CO3A 3GJQB 2U1AA 1KN6A 1S6PB 1RACB 1F5AA 4TY9A 2ASDA 3NCRA 3JSMA 4D3GA 3AAWB 2FYXA 1WORA 2Z0GA 2X51A 1BC6A 3FEYB 1B7YB 2EFOA 2E66A 4DHVA 2J8SA 1VISA 1TKXA 2VC1A 2CQIA 2ZDPA 5L9NA 4LBHA 3OXLA 4QR2A 1RE1B 1XMOF 1MN7A 4OI0A 4ID5B 1RBAA 5M2RA 4L72B 1JQGA 1NK8A 2HMIA 2HHVA 2YKNB 3TJ8A 3W9IA 3KLEA 4NMLA 1R6VA 5C24A 3M8QA 1YSJA 2XMMA 3EVWA 2LDIA 3T9NA 5DO2A 4N77A 2RQCA 2M4MA 3J7ZT 1UJ5A 1NPKA 1RT6A 7FD1A 4ED3A 1FKOA 2KYZA 1U1RA 1I3OB 1U6FA 2UVVA 3SFGA 4WPAA 1U26A 1VQ5S 1TKTB 5I3UB 3MPDA 4FYYB 1RAAB 3UI3A 3R5CA 4AL5A 2XSJB 3PX0A 2BW7A 4MYTA 3S8SA 1CQNA 3RU0A 3BKUA 4OYPA 3J80U 4KTQA 3C2PA 1UAWA 2D7SA 4O4GB 1BXNA 1FRIA 1K1QA 1PCAA 4UUWA 4ZHRA 4I2QB 2XTJP 3I6PA 4GVLA 3OLBA 1JWWA 1X4BA 4K4ZA 5I42A 4UOCA 2D69A 2V63A 2V4RA 1RGVA 3KXDA 4LF7F 3I96A 4N41A 1C0UA 2HSEB 2V4JA 3QNWB 5CH7B 5BYRA 3H2VE 2AYBA 1LW0A 2CWKA 5KFUA 5HMYA 2KXNB 2DPIA 1T9WA 5ETOA 4WFNQ 9RUBA 4ZIWA 2WVBA 1SKSA 5IQ6A 2W01A 3GU0A 3HVTA 3BO2A 5EWFA 4DUYF 4OX6A 4K59A 1OPIA 1U09A 2J0WA 2M2BA 2CG8A 2MKHA 3MHYA 4DV3J 3WC2A 2DNRA 2OUGA 4JI8J 3CE8A 3G4SS 4DV1F 4WWSA 1JKHA 5D4OA 2GGPB 1OY9A 2GJ2A 3EICA 4LBPA 4OX9J 4OZ0A 1AUSL 2V8VA 1UVLA 2FB0A 2KZZA 2NXJA 4RBTA 4B02A 3QT7A 3KLHB 1I94J 5HROB 5IT9Y 3HVAA 2VD3A 1HNXF 4K2JA 2G1HA 2XZTB 3AA8A 3VR1A 3QJJA 1UL3A 2CNLB 1GT8A 1Q7LB 3M30B 4HL9A 1BY9A 4HTJA 4MKBA 5L46A 1MWQA 1FDBA 1DJ0A 1Q1KA 3ZTSA 5DM6Q 3UD4P 2B4PA 3CPWR 1HNVA 3UN3A 1X4GA 2M0GB 5HI7A 3BREA 5IFMA 3OSNA 2X1GA 4OZJA 4GO7X 3UW1A 1YGYA 1SKRA 3B4MA 4OV6A 5D4NA 3BZQA 1TUVA 4LSNB 2WZ1A 3IP0A 4I2PB 1NXIA 5IM0B 3M2RA 1U1QA 1TU0B 4JI0F 1U8WA 5KG4A 3QLHB 1KD1T 4MYUA 3KJFB 2HRUA 4MFBA 3G8TA 4E98A 5KT5A 1NJXA 4IDKA 2DHAA 1XTZA 2WK4A 1Y3JA 2YWGA 1RAJA 3U7JA 3WBZA 4DPWA 4EYIB 3Q0AA 4CLFA 1X60A 2R8KA 4NZ6A 1DFDA 4UOFA 3IG1B 1UTAA 4J9UE 1CJKA 3R7BB 2JLGA 2B0GA 4ILMA 2C3MA 1KP6A 1MMLA 2PA3A 3IO1A 1Y4ZB 4ETZA 3FNNA 1XMQF 2YWFA 3CWJA 4M5DB 3SV3A 2YH1A 1TV6B 4NI2B 4MTPA 1TAQA 4ZLJA 2QSFA 4DV7J 4C8YA 3ZZZA 2JWNA 4LUBA 3CJKA 3UNYA 3QZ8A 2MQNA 1F3VA 4MK8A 3PKMA 2C2OB 1LQ9A 2LU2A 2MPUA 3TUIC 1YZ7A 2VFSA 3BN7A 1LFWA 2HHHF 1H0HB 4CT9A 3OL8A 4LRBA 1B0VA 1YDLA 3VVUA 1CJTA 3L7OA 3RRGA 1IR0A 3HZEA 4CTAB 1Q7YT 1WJ9A 3KNAA 2DGTA 5GAEU 1D3WA 3TANA 3D67A 3J80Y 4Y2IA 3HK2A 3QO9A 3OR2A 2M8HA 3I5BA 2EK6A 5CD4H 4HKQA 1C1BA 1WF2A 1BQNA 1KHWA 3CJKB 5B0BA 1TP7A 2ILZA 1LWCB 4NLUA 3RB6A 1C4CA 3EXYA 3CCSS 4PG5A 3CJQA 3AFGA 4E8UA 5GADU 2YWEA 1W2BR 3P4UB 4JI3J 3MMAA 4NLWA 3GV8B 2QFIA 1TUWA 2RUSA 4HT7A 5HVHA 4PWUA 4CTAA 4P52A 4ERDA 3EDRB 5BR8F 1P1TA 2YX4A 5DG7A 1GXUA 4DSKA 1APSA 5GADI 1JLGA 4PQUA 2NUUG 1WC6A 4UTGA 3WHIA 1VQMS 4ZN3A 1ICEB 1RJJA 3KG4A 5LMNJ 3OFEA 2IIHA 2LXIA 3QAUA 1EB0A 2AZ1A 4KRWA 4S0MA 4UZCA 2HQIA 4PR6A 1IUJA 3K17A 2M9KA 1P9YA 3WDOA 4ER8A 2FVRA 3MR2A 3H90A 2KHCA 3L7PA 1J5OA 2CPFA 4P71A 3MXHP 2CJKA 1QAXA 3CD7A 4YB7A 5AT1B 2ZM6J 1N0UA 2MMYA 1HWUA 4FN5A 3D7SB 4P72A 2MLXA 4R0JA 3CCJS 3B8HA 4FYDA 4ZPDA 1KQSR 3CO9A 3GIKA 5FIIA 4UUXA 4LT6A 4WYLA 4CLUA 2FHJD 4B3RJ 4R8UB 2UUTA 3MFIA 4F04B 4NWBA 2HMIB 2ZHAA 1DTTB 2VICA 5H9FJ 2ZE2A 5KFIA 4RNFA 5D3GB 2UVWA 3OTEA 1KS2A 2XMJA 3D9BA 4BC7A 2ADBA 2D1CA 8RUCA 3T5KA 4DL2A 3BBCA 3NP5A 3PO4A 1CVJA 2YKMA 3GMGA 2X1BA 2IM0A 4Q44A 4X65F 3EZUA 4UQGA 1E6VB 2L3MA 7FDRA 1WHWA 2AJ0A 2ZJRQ 2CDQA 4QIWD 5HN0A 1HNWJ 1QE1A 4LSZB 3ZTRA 3PW2A 1R8BA 4XDCA 2PO4A 3TEGA 3BGFA 4ZP8A 2XS5A 3T1YJ 2ZZMA 2A2CA 4PAAA 4N47A 3BO3A 3DC2A 2JVMA 2ROEA 4F36A 1BD6A 3AXKA 5I42B 1S9GB 3DOMB 4NXNJ 2VBYA 2B5JB 2W4DA 4H4OB 4EK2A 2AP6A 4TYBA 3G8SA 2ZH9A 3RJMB 1TL5A 1VRUA 3BGLA 3MMCA 1S0MA 1UA1A 3A8EA 3QIPA 5D77A 5DGAA 5K8PA 4UT4A 3J7Z5 3PXGa 2QYCA 4DR1J 3UFCX 4OZ1A 3SQOP 4I6YA 2W2OP 4XIUA 2DGQA 2FD2A 2G0JA 3D2WA 5J2NA 2AU0A 1HNIA 3GCWP 5EWGA 1R0BG 3A1YG 3HPOA 1W7WA 2G2OA 2YX1A 4G3IA 4ZVHA 4JI7J 3E2EA 5ETMA 2BV3A 4ZPAA 3L7UA 4I69A 3LW5C 1KFDA 2GJIA 3RBEA 2XNRA 3KUEA 2AX0A 2IYIA 2IC3A 2QC3A 4OJ1A 2RS2A 1RWKB 2VFTA 2M52A 1XC9A 3PR5B 1RTZA 2MKYA 2Z2YB 4WU3A 3TARA 1C0TB 3VWSA 1BUXA 2KO1A 3N6NA 2IPOB 1BQXA 3DDNA 3JTNA 3DRRB 5T41A 4ZS6A 4QW8A 2G13A 4NA2A 3OL6A 2Q79A 3CCVS 4LR7A 2M70A 2ZZTA 3VAHA 1X9WA 1OS5A 4X4PA 1UFKA 3VGVA 1FDDA 3AT1B 4ZVUB 2DHSA 4DMZA 2G0CA 1TL7A 2V5HG 5KFNA 1T9UA 3CJ8A 3DRPA 4OMFG 3TW0A 3UWTA 3TQ1A 2ERRA 4RU2A 3RUBL 1S1VB 2QT7A 4QYRA 3GYNA 2HFSA 3VHQA 1YIJS 3BV8A 3IWLA 1YJNS 1RT5A 2IDEA 4M5HA 1I94F 3I4HX 1N88A 3PACA 2OO4A 1FRKA 2I9SA 1JLEB 3C15A 4RW8B 2BJ7A 1M5VC 1G3OA 4MK9A 2XWXA 4TLRA 4C11B 3RB0A 4TVAB 2J6UA 2CQ3A 2A6OA 1OWXA 1HIYA 4DV6J 3HFKA 2WHOA 4U95A 1SVDA 3Q24A 2HW3A 2H65B 4YDDB 4DQSA 4OX7A 2DHHA 4O4GA 3CCMS 2XY5A 4FXWA 3UCGA 3DLGB 3IR7B 8ATCB 1T02A 1WG5A 4KGXB 5HBMA 2XLIA 5C2GA 1S1VA 4OFZA 2PMWA 4ES1A 2CA9A 1SC4B 3N9UC 1RT2A 1CBKA 2V8GA 2Z8QA 3FQKA 3PEJA 4CH0S 5KFQA 1SJ3P 3DOLB 2KYXA 1EIYB 1N54B 4FPRA 2ILYA 5IWAJ 1X7VA 4TXSA 5ETLA 1ZTWA 2XCPA 1WC3A 2O67A 2W2MP 4ANCA 2KDOA 2O3DA 2V94A 5HJYA 2ZZNA 3F44A 3MAQA 1U7LA 1TAUA 2PD1A 1WHYA 1TELA 1MSWD 3HF5A 1HYSB 4CLKA 2ZKUA 3PYFA 3D3BJ 2CQHA 3VAMA 3KYLA 1L3SA 1N5YA 3PX4A 4ECYA 4P75A 3L9ZA 1HHSA 3R5DA 4LF9F 2C28A 2BM0A 4LIWA 4CQ1A 1VRTA 5C42B 4CLLA 3AQPA 3F0NA 5KFPA 1HQEA 4DPTA 4O3RA 2QX0A 3M4XA 6FDRA 1Q78A 2DNOA 1EX8A 4C48A 3SI8A 2X7IA 2GQCA 1NK5A 4JOUA 4OJHA 2N4CA 2F1FA 1YZ6A 1NO8A 2KJWA 4JP8A 2NZCA 2Z30B 5EGYA 2VQFF 1DARA 3OTOJ 4DV4F 1NB2A 1A0OB 4B08A 1SJQA 5I4MA 5F8LA 2UU9F 3QBCA 3KLFA 3JSBA 4URGA 2ZJPQ 2HHWA 3BKFA 5IT4A 3DM2A 1RHKB 4A8WA 4JI6J 3DLJA 2O01C 4HHUA 2IM3A 2WSEC 4I2PA 1RB0A 3NGUA 3SQGA 4UZBA 4DV7F 2F3JA 4WXOA 4LQ9A 3BEGB 3M32B 3QYYA 1WC4A 3UPFA 4LF4F 2CQ1A 2R7UA 3TVYA 4DV4J 4MAKA 1LNQA 3W66A 1U47A 3M6VA 2BA9A 3W65A 4DZ6A 3T5JA 2A18A 2HGLA 4HH1A 1SIZA 4U67Q 3CJ5A 1F9FA 2FQQB 3PRVA 1T03B 1RBLA 3BBFA 3K5OA 3SSRA 3PY8A 2LECA 1BLUA 1VFJA 3MECB 4F2SA 2B4OA 5KFJA 3TUPA 3RGIA 1N33F 2RILA 1EKRA 3W2WB 3PW7A 2UXBJ 3HXMA 3A8JA 3KJNB 4M5DA 4QR1A 3GG1A 3DHWC 1FCAA 2DKOB 2I8EA 5SUHA 1AZSB 1HYSA 3G87A 4IQXA 2MKCA 1H7XA 4ECRA 1XN9A 2Y0BB 2NPFA 3CIZA 5B0GA 3AGZA 1OYEA 4M63A 2BE7D 1U25A 1MWZA 4NE9C 5C2CA 3O3LA 3LZ8A 2SXLA 3U1MA 1N5TA 2CPJA 1NPPA 3KLIA 3MM8A 3FUYA 3MD3A 2FHKA 2AW0A 1QE1B 3DNCA 4LQ3A 4G1QA 2KG1A 5FDLA 4N56A 3KK3A 3NS5A 3UE2A 1FE4A 2JZ5A 5AXKA 3SSSA 2FUG9 2I38A 3NLCA 2W8LA 4DWIA 5L8RC 2F4VF 2R8GA 2XCAA 2WCXA 4B3TJ 3K5PA 5HMXA 1VLOA 2IMOA 3MMAB 2W9BA 4JI1J 1WI8A 3ZZ0A 3MMCB 4CM0A 1N4LA 3NG8A 4PUOA 2ZWPA 1RBOB 3QIPB 4DUYJ 5KT4A 4ZVSB 5HQ8A 4M94A 3DGPB 5HVFA 2DB1A 2DCUB 3Q2TC 4ZK7M 3HO1A 4LF6J 2D9OA 3VAFA 3BKTA 1H6KX 4CO1A 1MLAA 2YWWA 4DSFA 3TEHB 3H5XA 4C8KA 3N28A 5DLFA 1MWYA 1NDKA 2WVFA 2NCKL 5KT6A 5E3QA 1HNZF 2Q2GA 4OYWA 3TA2A 3QZ7A 1YG0A 1KQFB 4ECXA 1J5OB 3EZ5A 3UD5A 3H20A 2JSXA 3PNIA 2R8JA 4P10A 2IJRA 2O1PA 1FERA 4YMEA 3GE9A 2OPPB 4DQQA 1LV5A 2IJFA 1RABB 1FFGB 3OTDA 2ADCA 4DX7A 1RHJB 3QGGA 5DLGA 1FVQA 1S9EA 2BEFA 4ZPCA 4CLYA 3EPIA 1VQOS 2XSJA 2EXUA 4IO1A 4LF7J 3MOZA 2YX7A 1XR7A 1R6YA 1QUVA 3TAMA 4ZDNA 4CP5A 2GHVC 2OIHA 2CWXA 1UVKA 1CSJA 3C6UB 1IKXA 2Q3PA 3MCSA 3VGSA 4ZHRB 1R27B 4ED2A 2EBEA 1RHUB 2L9NA 3I32A 4DSLA 2B3TB 2ZD1A 4O44B 4QIGA 3DU6A 4ANDA 4C0HA 3G2XA 1X5PA 1ZM9A 2HHPA 4X64F 2MKSA 1WTBA 2W2QP 3OJSA 4N7TA 3T19A 1Q8KA 4HR2A 5BXIA 4MKAA 4DEZA 5A8KB 1C2PA 3GFYA 4PPZA 1KVKA 3FEZA 2IVMA 3VGUA 3THTA 1ZAWA 1G4CA 3G8QA 4NLOA 5E2QA 3OTOF 3TA0A 2BOAA 4OHVA 5CYQB 4KKOB 1Q53A 4RW4A 3CJ0A 3S1TA 1OSDA 3GFZA 3I0SA 4ECSA 2C2MB 2BJ1A 2KB2A 3N5FA 5KG5A 3JB9k 5D8HB 1NDPA 1RTHB 2C3UA 2QYGA 2DITA 4M5KA 5KFRA 3Q8PB 2F63A 3KHGA 1J5EF 4PABA 3IBWA 2R2RA 1VQ8S 1VRUB 1CS4A 3AJDA 1RT7B 3MPVA 4LVOP 3THPA 1RCXB 4NLRA 2MQPA 2CPHA 2AQ4A 4CZCA 2BE2A 1O51A 3HSGA 2BX6A 3KHRA 3HHEA 1RK8A 3HI9A 4KSEB 4F0MA 2RRAA 3PO5A 1AFIA 4DX6A 1J27A 1JLAB 3K59A 1Y7PA 4ECVA 3DLBA 1S1XB 2V0NA 4J37A 2ZH4A 2J6SA 4OLPA 4W92B 1HMVB 2ASYA 3MM9B 4GVBA 2UUCJ 4LF8J 4DV2F 4TU9A 4RW7A 5DZ6A 1T3OA 2B8QA 1SIWB 1RWXB 2CQCA 2FJEB 3CJ3A 2KH9A 2OD6A 2E7XA 1UFWA 4KY3A 2F8HA 3PW5A 3M2RB 2LQ9A 2MZ1A 2AGOA 1RISA 1WG4A 3LOUA 3QLHA 2OP5A 4Y2CA 2KRBA 3HHLA 2B26A 2OELA 4NLXA 3C6TB 3M2UB 3TUZC 1WKKA 3H2UB 2CNNB 1HBOB 1X4DA 5F8HA 1QVGR 4EMDA 1ACMB 1NJZA 2UUBF 1NSKL 5DZ7A 2YNFA 2XNQA 2XMTA 3I0RA 1TVRA 4YDXA 2HBZB 5E3PA 2RKIB 1TQLA 2XWYA 2DXFA 4PCQA 1OY6A 3D1OA 2C1EB 3PRDA 2BDPA 1FX4A 1TL7B 2CQ0A 4DX5A 3CIMA 2MY7A 2L9WA 3SQGB 4RR5A 5AE2A 5LXYA 5IT0A 4HACA 2LA6A 2C2DA 2IJNA 2GIFA 2KJVA 2E1MC 4NI2A 2FJDB 1XAOA 1HBUA 4CLPA 2PSZA 3MEDA 4URSA 4ZOSA 2KG0A 2VDHA 5H9EK 2UP1A 4DFJA 4IRCA 1BWVA 2DTJA 1JLFA 3MDFA 4LSLB 1PYTA 2P2CB 4GMKA 3GSDA 5E33A 4YQWA 2CDRB 4C11A 4KHRA 3SCLE 2EC0A 1TL1B 2J9DE 2WAQD 3AGYA 4J80A 1FXDA 1WKJA 4K5SA 2EW9A 2Q66A 3HHNB 2HVIA 4PXDA 2UXDF 3OVSA 1SH3A 5KOWA 9ATCB 1VMBA 1QJHA 5ETQA 5DRKA 1SV5A 3G71S 4BWMA 1IKYA 3J7A1 1VK3A 1U0HB 4WTYA 4NXMF 1QM9A 4DN0A 3WIVA 3X1LB 1TL4A 1X31C 4UOGA 1KOOA 1SI9A 2Z57B 4NCAA 1HKAA 3CDUA 2HHQA 2E5GA 3W9JA 5DS7A 4ELUA 3MCOA 3LGHA 1ZM4A 3GIRA 5J2PA 2MQMA 2AV5A 3CJRA 4J9KA 3ENWA 4Y00A 3BJYA 4NCBA 1F9EB 1IBCB 4K4TA 4KV8A 2JRRA 1HWJA 2HBQB 5THWA 5FLXU 2L41A 2HQFA 3R9LA 4LJMA 1GXLA 1H7WA 1RTJB 2AEJA 2OPQB 2QGFB 4IR9A 3MCNA 3NMRA 5G4DA 2GNKA 2OPSB 5BYQA 5F3ZA 3TA1A 2ATLA 1IM4A 1SUQB 3SCKE 4YB1P 4WP3A 2VPZB 3P5BP 3UO0A 4FZVA 4P74A 5IXUA 4H4KA 5A8WB 1OJ4A 3S6EA 1N32J 2CQ2A 3KG0A 1HPZA 2OEMA 2DD8S 4OI3A 2WVEA 4J9MA 3UD3P 2DPJA 3AODA 2GS8A 2K7JA 2DH9A 1S1WB 1PGZA 1YRTA 4LF5J 3VQSA 4TNOA 3K8VA 5HLFB 1S48A 2RB7A 1YLXA 4PXBA 2MQQA 4O4RA 3FK4A 4OYIA 3H5YA 4RLEA 1GAOA 3PHEA 1U48A 2VA3A 4LF4J 2VOPA 1IR1A 3BB5A 2UUAF 1LFPA 1OPZA 2RF2B 4USTA 3AOBA 3IRXB 3ILLA 3LUYA 1T94A 2CPEA 2YKOA 3LPYA 3AKOB 3R5GA 4Z37A 5I3QA 5A8WA 4A8KA 3ISNC 2RQ4A 3M32A 3NEKA 4OI2A 4ZCKA 4QW9A 5H9EJ 4B9LA 3UDLA 3US5A 3H5UA 5KTQA 1HR0F 5GAHU 3QSYB 2JEJA 4V19X 4P7TA 3MEKA 4B9VA 2GQQA 3GYXB 4QIFA 1WF1A 2FJWA 3KK2B 3HSJA 1WOOA 3CD0A 1JK9B 1TUGB 5M2PA 2AGPA 4ZVFA 2IA0A 2OPRB 4RKUC 3IRXA 4QBUA 1F1BB 3AGXA 1S9EB 3HDSA 5F8MA 3T1AA 1T05B 1GX5A 4IFYB 1Q86T 1HARA 3V6KA 2KVQE 2HFOA 3MM6A 1N52B 2MZQA 2HS4A 1SCJB 5C24B 1FNOA 3BS9A 3OVBA 1OQ6A 2FVQA 1YHQS 3EXCX 2VKZG 2FZGB 2V34A 2XG8A 1WACA 3EE3A 3K2YA 3N4WA 2DT9A 3TRGA 1K1SA 1U4BA 3Q8RB 2PA8D 3KNGA 4E0DA 1N33J 1Q8LA 2ZC3A 2JVRA 4O3SA 2AHOB 3R27A 4BLGA 3R2CJ 3M6XA 5A8KA 3K8WA 1IXKA 1XEZA 3KLIB 1TTHB 3KUGA 3MM8B 2FVPA 3PYGA 1C1CB 3RR7A 1XERA 2DJWA 1UKUA 3MEEB 5ETSA 3QATA 4AXIA 2QEXS 2HQCA 5KFXA 4RJVA 5K9FA 4ETXA 5F3TA 1NSQA 1IM6A 1URRA 3DLKB 5F0UA 4EBEA 1BQMB 1KLMA 1QTNB 2HNDA 4RNOA 2NREA 2KFNA 1FFSB 2FTRA 3UCZP 1Z2LA 2J0QD 4X4RA 1CULB 2XMKA 4JV5F 4OV1A 2DEJA 1V6HA 2IC3B 1X8DA 1CS4B 3A3OB 1R7IA 4MIWA 3HZGA 1UPMB 4CRJA 1KSPA 4PUOB 2G2YA 1IKVB 4U7UK 3K7RA 1ZTTA 3IS9B 4CIOA 2VQFJ 3M8WA 4I6AA 3U1NA 2N7CA 3HT3A 2GVZA 1VBYA 1YBTA 3EUNA 4H4KC 1GK8A 4HTIA 1KLMB 3MAHA 2LVWA 4KGVB 3PEHA 1VQNS 5J2MA 3R1LA 2DEIA 5KG7A 3GTYX 1V9OA 2WOMB 1QDUB 2JFDA 2HHTA 2H4WB 1VC5A 2GGPA 4PG7A 4A8SA 3I31A 2AZ3A 2Y3YA 2DR8A 1SBRA 5KFYA 1VRQC 3CT9A 5LM7E 5HROA 2HEKA 1H3DA 2CZ4A 3POTA 1NH8A 3R7SB 2KL8A 3I38A 3KWMA 1NJIT 1L5UA 1XMQJ 1TK5A 5HMWA 1FWLA 1FHTA 1FKPB 2GO9A 3ITHA 2CVEA 2FLOA 3G96A 1HNVB 1LKZA 4IFYA 4Y28C 3SYZA 3IM8A 2MB0B 2JHEA 2AWZA 1RT4A 1TKZA 1QD1A 1UP1A 1XBWA 1R31A 4MK7A 4Y3CA 4JBCA 4O0IA 5ETRA 4LF6F 3K5NA 1H74A 3W7BA 2VPYB 4ZN1A 4LSNA 4B3MF 2HZCA 2QSWA 3GR0A 1SH0A 2UV8G 3M8RA 4USKA 1OQ3A 4WZQA 4DPUA 1VIOA 2OLWA 4O3PA 1CJVB 1M5SA 5IV3A 3TZYA 2VPWB 2X3DA 4Q7AA 3OVAA 2PFFB 2RAQA 2B51A 4UF4A 1EHWA 5E0OA 4OHXA 4Q2MA 4N76A 2YQ0A 2R42A 3DFEA 1UWBB 3I87A 4QWCA 1S57A 2UVUA 2ACYA 5J1NA 3RZAA 4KGMA 4ZCMA 2KXFA 3EZOA 4KKOA 4M8LA 2EG2A 1RLDA 3IBCB 2GJFA 3T1YF 2AJ4A 2DNQA 1D9AA 5KFKA 1W25A 1HQ2A 1NJWA 2RS8A 1WDDA 3OR1A 4J7CA 4DL0C 1QSLA 1NEEA 1WEYA 2QLDA 4E2FB 5LL6d 1Y00A 3C19A 2VQEF 4RW6A 5J2QA 1ZS6A 5J2PB 2CPXA 2JRSA 5ADZA 1S97A 1HBMB 4DV0F 2DR7A 4OYOA 3FSXA 4F4KA 5GVQA 3CTRA 5IZHA 1YJTA 1RA6A 3Q8VA 1N36F 3EDQB 3TUJC 1T8EA 1G2EA 1CEZA 2VONA 1NPRA 3L95X 4C0OC 3BGRA 4X4QA 1Y5LB 4A8MP 3ZZTA 2DIVA 2WW8A 1QVFR 4X84A 4F02A 2H4YB 3GJRB 1RP5A 3CCZA 3RW7A 4J9OA 3QGIA 5CAAA 5DG9A 3KG1A 2NXNA 4KH0B 1M90T 1B3TA 3SDEA 4K0KJ 4NMXA 4DUTA 4C98A 3GZ7A 2EKNA 1FNMA 4LFAJ 2YKQA 2UUCF 4FKYA 1S1UB 3KDOA 4OX9F 3D6MB 2RE1A 3GFHA 1TKDA 1NK0A 1U8SA 2RJZA 5L1LA 2ZOMA 3ILOA 1TVRB 3BDEA 3MMBB 4KAIA 4MKYA 1PJ5A 4OYMA 1QUPA 3FZ2A 4OLOA 2E9TA 1DHMA 2GIRA 1G7CB 1FXRA 2ODXA 1O0PA 3MCMA 4V1Ak 2JJ4D 2VBWA 1Y0HA 3W2WA 2QLJB 1MG7A 4CLSA 4KFBB 4EZ6A 3H42A 5D0GA 2OAUA 2YWHA 1WWHA 4ZLPA 5K20B 3BSAA 2BABA 3DOKB 1RU2A 2E1RA 3OFHA 4MIBA 2BOPA 1KLNA 5D0RA 1LOUA 5B7WA 2GHWA 2VG6B 3AD9C 4FNHA 4RWXA 1F2GA 4ED0A 4EEYA 4CWBA 2HRTA 3W61A 3J81U 4J90A 3W8GA 4B3RF 3TAPA 1FVSA 2RVJA 2GMJA 2P6TA 5CD4A 3M1VB 1T9VA 4CM2A 4X65J 2XHWA 2H5EA 5B0CA 2EEYA 2J9EA 4R8UA 2JC0A 3OHBA 4I67A 3K0JA 4CYUB 4R5PB 2ZJQQ 3JXOA 4YUDA 1D0EA 3X3UA 1P27B 1RAGB 4PKDB 3HFZB 4DPOA 2CRLA 3RTVA 4M95A 1H72C 1WTFA 3D4JA 3MUTP 5EX3A 2J9DA 1JJ4A 4LRFA 2DNMA 2N3LA 2IHR1 3AXMA 4W98A 1LEOA 3ISZA 3O2IA 1KTVA 2W9BB 2ZKTA 4YR3A 3HULA 2XEXA 2FIUA 3H98A 3AQOA 2HQ3A 1WC5A 5KFHA 4EFAC 4N8NA 4L3NA 1MROB 3DXSX 4RNHA 1UJ6A 2V50A 4BBYA 1TL3A 4FKXA 4MH8A 4ZVQB 1RSCA 2J8AA 2K3KA 2V69A 4P2MA 3C14B 4F4ZA 3FBEA 2BRKA 3NL0A 1U2FA 3OFGA 4ELVA 2W2PP 4OHWA 3GQCA 3ET6A 3UN5A 1QAYA 5E3AA 2JEGA 2YKAA 2UUAJ 2D3ZA 3W5XA 3V81A 4KR0B 3W2VB 2ZUGA 1S6PA 1GMUA 5ETTA 2L48A 3KHLA 4DBQA 3PIOQ 5IOLA 2DNGA 2HFNA 4B17A 5BR8J 2VKRA 1RZMA 4WFXA 3C3LA 1TL3B 2A1BA 3LP0B 3BQ2A 2RF2A 1EJ7L 2HHHJ 1PJ6A 1N32F 3FQLA 2IAJA 4F4WA 4LR8A 3PKYA 3OFFA 2WOMA 2CUYA 1UPPA 4X64J 3TAMB 1M1GA 2CPIA 4C8NA 4YHHF 3EYZA 1N36J 4B9UA 4GO5X 4IKAA 1MN9A 1X5TA 3PRBA 2E5LJ 3LP1A 3HVWA 4GKJJ 2YNGB 2A3JA 1UEUA 1G6BA 2D9PA 2GO8A 2OMOA 4QWDA 3C5XC 1KNZA 1IQTA 3FJ2A 5KFEA 2KM8B 3ZZPA 1RT1A 2HAFA 1GTHA 1E6YB 1SC3B 4IH6A 4L74A 4L75A 2BJ8A 1ULRA 3SBMA 3TZWA 4F0KA 3TO8A 4DV5F 3ITHB 1S77D 1XWLA 3AB2B 2ZITA 1GXTA 3QGHA 4Y2MA 1T05A 2BE9B 1KHVA 3LGMA 2GX8A 1AT1B 1VGYA 4P6QA 4RZRA 4USJC 2BANA 2R7QA 3EGZA 1Q95G 3NNAA 5A0YA 1FNXH 4DV0J 4YN3B 1FE0A 4Z7CA 2CPDA 2Y0SD 3HD1A 1LXJA 3MM5B 4DFPA 2C2RA 2QL5B 3H25A 2DR6A 1VQPS 2HVEA 4EU0A 2GV1A 1EQMA 3GLJA 1Y9OA 1W26A 2BE2B 5LXRA 2GZOA 5HANA 3CCWA 2DR5A 1NHUA 1Y11A 2QV6A 1HBNB 2ZBIA 1RAEB 3DRSA 4IFVA 4NPOA 2DNPA 2CJXB 2WONB 3LP2B 1S0NA 1J5EJ 1M1HA 1RTDB 2MDAA 1TZ0A 4NLPA 2JDJA 4RW7B 4JV2A 3J81j 1RT2B 4WTOB 2W4CA 2AEFA 2AT1B 4B3OA 1DTQB 3GCXP 3IGNA 2N82B 4JI2J 1CJUA 2LLZA 1N6QA 1U1NA 2XI2A 5AJ3F 3LAMA 2RHQB 3C6EC 1H73A 3GSIA 5KG0A 2KM8C 3PCOB 5HP1A 4ICLA 3VAGA 3G82B 4DL7A 1D8YA 2ZEJA 3SCJE 2GAHC 1IKWB 3D1HA 3RB4A 1UMJA 2OJ3A 2F4FA 1HBNA 2WSFC 3BM7A 4R25A 5LMUF 1JNZB 4LBIA 1VQ9S 1QSSA 5HQLA 3ISND 2DNLA 4H4MB 3BGRB 4TY8A 1WEXA 2XBPA 5KAKA 2FLNA 1CPZA 2MZJA 3D6TB 3P3DA 2CPZA 4OYAA 2B9XA 4DL3A 3PJWA 3HSZA 5ETKA 2P5VA 2BRLA 3PX6A 2VG5A 1PBUA 1VRTB 2WVCA 5CYMB 5C42A 2JEIA 2BACA 2HFUA 3MEGA 4LVNP 2ZM6F 3IM9A 5AE1A 4FF3A 5GMEA 1U02A 2GVDB 5G0RA 4YR0A 4M5JA 2PN6A 2KKHA 4CI0B 5K8MA 4U8VA 5HL7Q 4DL4A 5HK4A 1P1LA 1Q8BA 1NRKA 1JNRB 2WB1D 2CJBA 2CJAA 3A8IA 3BH6B 3CDBA 3GJSB 5KFTA 3BN4A 2GMHA 1ZZNA 3G6YA 2IRUA 3JQMA 4DG1A 2PI5A 4DFMA 2M5YA 5CYMA 3N6LA 2EK1A 5B08A 2PC6A 5JMNA 3MOJB 3MZIA 2UVRA 3MWBA 2CAJA 4YR2A 1FD2A 4ZPBA 3QRRA 2JC1A 1IBKJ 2Y1LB 1RWVB 1XQIA 4O0NA 3N6MA 1CLFA 5F8NA 2HLUA 3HVRA 2RDJA 3IWNC 1Q0NA 1YKWA 5KOXA 5B09A 3KLVA 2B56A 1Q4RA 4FVMA 4B9NA 2V2ZA 4F4AA 2D3O1 3P49B 1K0VA 2F65A 2GAGC 3QFWA 3UQSA 5F8IA 3HX9A 2K1RB 1B4SA 2VJVA 5BJRA 3VAIA 1JB0C 4AL7A 1S1TA 5J1EA 4R5PA 4LF5F 2AYEA 3V6DA 2RRNA 4YY3F 1QLNA 1X0FA 2CZVC 2BJ9A 4MJKA 4ECQA 3DLEA 2XI3A 1HPZB 2ZHOA 5IC6B 3G6VA 2FHJA 1HBMA 1KONA 4DZDA 4LF1A 3M8YA 2P6SA 4OJGA 3P5TL 3NBPB 4BC9A 2ZHBA 4J91A 3JSMB 5GAGI 3LA0A 4ZIVA 3R5AA 3TWZA 2VB6A 1JLGB 3ZTPA 1X5SA 5DDOC 4RNNA 1NKEA 1XNQJ 2RT3A 2MHNA 2HS0A 1QTMA 2B8PA 1X4HA 2R7WA 4ZVPB 4ZCLA 3HJVA 3Q8YA 4TKTA 2DGVA 4KQZA 5KFMA 2GMLA 1WOPA 1HNIB 1TFYA 3TOQA 4JI7F 4ID5A 4DV5J 1NJYA 2Z2LA 3QRPA 2YKNA 3KLEB 4J9SA 1S12A 1RI7A 1ZBTA 1MMNA 1C4AA 1SQFA 1WG1A 4ALZA 4WIIA 3CC7S 4OZLA 2IM1A 1LWEA 4ECWA 2GFFA 4QYZK 2B6AA 3MPWA 4ZKAA 1K73T 1GNKA 5HATA 3D5MA 3DMJB 4ECZA 2XS7A 1HR0J 4B9SA 4IRDA 2Y9HA 1FWKA 2E1PA 4JI2F 2ZUAA 2B43A 2CPYA 3LP0A 4WFBQ 3BSNA 2OPRA 2XB2D 2BVZA 5B0AA 2PIIA 1FTCA 2B9WA 3VALA 4KE5A 1T9YA 1FK9B 4BS2A 2XMVA 1R0CB 4KT0C 1S9FA 4DR6F 1Q81T 2XMWA 4X2BA 1IJFB 4XDDA 3QQCD 4Q0BB 3EGWB 2YTCA 4Q8FA 2QZ8A 3HHLC 2OPPA 3EMTA 2EG1A 3M05A 1VOMA 2QN6B 3H4DA 2KT2A 1T11A 3FEXB 2EWHA 5KFSA 1IQZA 1E6VA 1UEKA 4CLZA 3K5MA 1X9SA 4DPYA 2V8DA 3C15B 1B0TA 3OTBA 4NZ0A 4JI8F 3SZ2A 4KHPF 2PEHA 4JYAF 2WRMA 3RG6A 3UVJA 1RT3B 2EI5A 3ZTQA 4GKKJ 1NZAA 1ELOA 2C2EA 3I9ZA 3FBBA 3KJVA 5HMZA 3HT0A 1R43A 1RQ0A 2DRDA 4XPEA 4ZP9A 1JXLA 3CMES 1T9TA 4DF8A 3E8OA 2QLBB 2DXEA 5A0YB 2KT3A 4ZVEA 1IBLJ 1S9GA 3DOMA 3UNGC 1VR6A 3M8ZA 2DHXA 3QGPA 3HHDA 3FMWA 3MM5A 2VHGA 4HVZA 3KLHA 4MKVA 3J7YI 1F9HA 4MT1A 3QWPA 5KFOA 5F8GA 2GC8A 4GRSA 2F40A 4OZ5A 2OFGX 4DN9A 3V4IA 2LXUA 3BO4A 2L08A 2ZH6A 3BYPA 3KJVB 2R4FA 1SB6A 3E3XA 1RUSA 2Q43A 2WBMA 2WONA 1XMOJ 3P96A 5D4LA 4ZCIA 4YHHJ 2A6MA 3NMAA 2LKZA 4LF8F 4USMA 1X4EA 1PIEA 2OFHX 4YB6A 1N5YB 1X5OA 3H8YA 4F3MA 2UUBJ 1HL6A 4LRCA 3OL9A 1HW8A 4JV1A 4FS1A 3DXBA 3R6GB 2CQBA 1U6BA 1N5QA 2CIMA 2BBEA 2CJQA 2RQMA 2VL1A 1K0TA 3GP9A 4ICLB 2FJBB 4TU7A 2PMZD 2IVYA 2Z56B 4C8LA 1ROFA 1U2CA 1T9XA 3FRZA 4WYWA 1UZHA 4MIAA 1WEZA 4EWTA 4C8ZA 3EPGA 2Q6BA 4DX8H 2LCWA 2IAJB 4H4MA 4TY8B 3BYRA 1NAQA 3FBFA 3KLFB 1JX4A 4JI6F 4QWEA 1JKHB 1K9MT 4Z7YA 4K4YA 1U1PA 2AJ1A 3ENQA 3DRPB 2MLYA 2HLTA 4NYPA 2XGPA 1RTIA 1WSRA 2VFRA 1VIXA 3MEGB 3PFOA 3DRXA 4G65A 4LFAF 4ES3A 1FJGJ 1KWMA 4I0WA 1X4FA 4ED8A 3MR7A 3NCQA 3FZBA 5SZTA 1RT1B 3NAIA 2GVDA 1JJCB 1YJ9S 3P6YC 1JMTA 4RUBA 2W1BA 2HURA 1WI6A 2HBRB 4DR3J 4WKRA 2V2VA 3JQKA 4IOAQ 1U0SA 1UWBA 5A6PA 2OD4A 2ZH3A 3C16A 4IRKA 2DNKA 3GFXA 5LT5A 1P9QC 3CW2C 3HFVA 1U6ZA 3M7VA 5D4PA 3D28A 3QWUA 3W8PA 5KFBA 3LTOA 3A3PB 2UXCF 2MJNA 3B6BA 3QIDA 5KFCA 3ELHA 3LQVA 2KU7A 2DNYA 3DDKA 3QT8A 4RO0A 3VV2B 5AXMA 5DG8A 1IBMJ 4OZ2A 1Q82T 1AXQA 2CQGA 3DOLA 1N34F 3ETMA 4RW6B 3CC4S 2PDAA 4QWBA 2OGUA 4NLYA 4CT8A 4KBIA 1KC8T 2H51B 1SJFA 5IT9U 1SC1B 3NGDA 5ITHA 1W2IA 1FRLA 2YKPA 2EFNA 4IOBA 2IFXA 2G0IA 2MZRA 1SV5B 5T7LA 3T6JA 3TX8A 3ZXWA 1H38A 4C9DA 3KUHA 2EFVA 2MHEA 4JI0J 2CNOB 2MSSA 5JVHQ 3TX0A 1VQ4S 1AA1B 4Q43A 3KK3B 4PG8A 4QU6A 2XMUA 2NUHA 4WF9Q 5GAGU 2LQ8A 2QRRA 4F7VA 2WTFA 2C2NA 5LJ3Y 3Q86A 2C3PA 1H2VZ 4WE1B 2DNNA 3W60A 5L1IA 2M8DB 1RHMB 1KVJA 4DUZJ 5FJ4A 1JJHA 2MKIA 2HKEA 1IKWA 3THVA 5DGBA 1HI8A 2JZ8A 2XO6A 2AYGA 4K0KF 1NHKL 4ZVGA 1S79A 3DGPA 3GG0A 4P7VA 3MMBA 4IUFA 4DR6J 5B0EA 1SH2A 1S5ZA 4JB8B 3R97A 2NXUA 5IV4A 4F3QA 1CQMA 3BR9A 4DS5A 2DYAA 4C4WA 4OI4A 1QAJA 1LWCA 2FGOA 1V3SA 3CVKA 2BQRA 2V4QA 1R8PA 1WD6A 2X1FA 1MMDA 3MMJA 1SJ1A 3IAM9 5MAOA 4A46A 2J0XA 2QO3A 1TK8A 5CXTA 1FFWB 3IXQA 1XNQF 4GKJF 2XS2A 1LWEB 1FA0A 2LU1A 3ILIA 4LFCJ 4B3TF 5A2QY 4I1TA 2HNZA 3G6ES 2E44A 4K4UA 1N5VA 3MTKA 4Y0FA 4C8MA 2RSQA 6AT1B 2E9ZA 2FY1A 3M8SA 3UR0A 4PQUB 2OSRA 1V5IB 2QMWA 4DI6A 3MECA 4M5GA 5KG1A 3MR3A 1WC1A 1MNEA 1V3ZA 2F9JA 5KFWA 4Q5VA 4RU9A 4FNIA 2AX1A 4A8OA 3M9OB 4DR5F 1FK9A 1P6TA 1T95A 2LP4A 5KT7A 3BQ1A 2W9AA 4J9LA 1VK8A 3MM7A 3E51A 1U1OA 4DUZF 2N4DA 4JI1F 3JS9A 4FPIA 3Q89A 3T9ZA 3J7YU 1RDRA 2XULA 3BSCA 3GR1A 4QJVA 4CH7A 3OBIA 2KI2A 3LPEA 4RL1A 2FVSA 2JOQA 2J6TA 3KMQA 1FRHA 1TKTA 3EJMA 4ZA1A 1EP4A 1UFLA 2CG4A 2K7KA 2F8MA 5ETVA 3CMAS 4K5RA 1CC8A 2HS3A 1S6QB 3PHTA 2MGZB 3B78A 1S1TB 3ZNUA 1OO0B 1KKHA 3HKWA 3OXFA 1HI1A 3B54A 4HI2A 3BPSP 4TLQA 1U49A 4A8FA 2CJYB 3DCAA 2R7SA 1S7HA 3VQTA 1EARA 1KQKA 2CKWA 2CJ9A 1VLYA 4QIVA 4WXWA 4OHZA 4G6VB 5CABA 4BDPA 2IM2A 3NOCA 4J9VA 4L3KA 4DV2J 5DDQC 4TQRA 1EQ0A 4ZMMA 3H0PA 2B9YA 3AD8C 1VQSA 3W2VA 4LFBJ 3G86A 4F26A 1N8RT 1F60B 3MPUB 4K2XA 5D78A 3W9HA 1YJWS 1KEKA 2V9KA 4K50A 4NCGB 3OHAA 3NGKA 3PV8A 3HKZD 3UDVA 1HD1A 2ACMA 1S1XA 5F8JA 1BQMA 2HNDB 3N0VA 4WFZA 1HMVA 1RLCL 4DR2J 3PTWA 1VQ7S 2F8EX 2DR9A 3DLHA 1BE4A 1VCTA 1N48A 2FJVA 1JLCA 1CULA 4CO2A 4CNYA 3PIPQ 4PXCA 3CMQA 3IR6B 3HP6A 3PJXA 2R2UA 1FEHA 3UCUP 3IRWP 1ZETA 1MU2B 1S10A 3KHHA 2PT0A 3NKYA 3LALA 2V2QA 2W25A 1IWAA 1UVIA 1AB8A 1LK7A 5K5MA 4JI3F 4ZLNA 1WKLA 3CGIA 4HI1A 2HPUA 4RW8A 3B82A 4P2XA 1DRZA 4JV5J 3H2LA 2ZBQA 3VAKA 1PC5A 4EZ9A 2MQ8A 2EKYA 4I4BA 1JLBA 1OIAA 3CCTA 2VBXA 2HVZA 1KBRA 5IQQA 2BKOA 1K8AT 2BANB 1UVMA 1Y10A 2NS1B 3A3NB 4PEOA 4ZPWR 5KFGA 1JJ2R 2W2NP 1HW9A 4LF2A 3GIIA 1I51B 2VOOA 2AKWB 2DY1A 1LWFA 1MU2A 2MSTA 4X62J 2DCLA 4UY8T 4AFFA 4IO9Q 4ILLA 2ZD1B 4O44A 3BQ0A 4X4UA 5A6WA 1WF0A 2U2FA 2W7OA 3K89A 4IDKB 4C3LA 2QG9B 3T5HA 4LSLA 2XY7A 2P9CA 1DZ5A 4QZVB 2RMLA 2PFDA 2HHSA 5E5NA 1WC0A 2J7KA 2ZH2A 3ULHA 1TL1A 1CJKB 1RKIA 1U1LA 1PG5B 4C7QA 4YS2A 2UZAA 3W5ZA 3HCXA 1FI4A 2LYVA 2VH7A 2FGCA 4FF2A 3NS7B 4HDHA 4USIA 1KFSA 4RW4B 1AFJA 1S99A 4LRAA 4U7CA 3I56S 2KTQA 1P8GA 1YVFA 1FO1A 1O5JA 4KC5A 4C2MA 1GMWD 1F0XA 2E29A 1FDAA 2KN4A 4U96A 1C0UB 2QLXA 4W4MA 3U02A 2DO0A 1LW0B 2YY3A 3AOCA 3LO3A 4B9MA 3UDCA 4NLDA 2DGWA 2L9DA 3V4IB 1DQ8A 1HWIA 3RRKA 5HP1B 1SKUB 2EPIA 2Q6CA 3G82A 1V3RA 1F2HA 1CJTB 4RWWA 1GMWA 1L3KA 2Y1RI 5LSRA 3KJQB 3ADAC 4NLGA 4ES2A 4FF1A 3Q22A 2FLLA 1M5HA 4IOCQ 3FVYA 3MM9A 4GVBB 3QJLA 4AYBD 5DDRC 1UW4A 3NGRA 1FRJA 3OR1B 4ITSA 1ZM2A 2YQ3A 1U45A 2IRXA 3TZZA 2JVOA 1T7PA 4CO4A 2VQEJ 2HZAA 2CQDA 2HRYA 4NLQA 5B0FA 3FSIA 2P9GA 4K4SA 4U6PA 5J2QB 2DGSA 2Z58B 2ROGA 4Y34A 4J5OA 4P9SA 2V6AA 3CJTA 2RUGA 3FGVA 4HT5A 4ZVTB 3M2UA 3TP2A 3AJ1A 2DY9A 4EI2A 5G0RB 2AD9A 2FJXA 1XNRJ 3N01A 2DHGA 2GIQA 3UDEA 4DSJA 1T03A 3K5LA 1TFWA 1YWXA 4ECUA 3WX8A 4Y2AA 2H3EB 2P8IA 1EZZB 3IFEA 3H40A 5T14A 3OUYB 4RUAA 2ROPA 1PYSB 3IC1A 1S76D 2OEKA 4K8RA 2UXBF 2MKKA 3V6HA 1M5KC 5GAHI 1JLFB 4Y2KA 4UOHA 2EFQA 4AL6A 2V67A 1PAUB 2K06A 3OD2A 4KHPJ 1RAOA 3LAKA 4AE5A 1RXOB 1T3NA 1HQUA 4NLTA 2XMAA 4HEA9 4DCOB 3KLGB 3JAMY 4OIXA 2M7SA 1IKYB 2BKPA 2LFVA 1HNWF 3ZFVA 1YRXA 4ZP6A 3V6DB 3ENVA 5KFDA 3BR8A 1U1MA 2O5DA 2IBKA 4M5LA 5F41A 5D15A 4KO0B 4IH7A 1I6JA 4B9TA 3QRQA 2IMWP 5J1PA 4WP9A 1PBAA 3JYTA 4IG0A 2VF3A 4C3MA 2DIUA 2ZNYA 2W7PA 2YBVA 4R0EA 1FRMA 3R8YA 3IN5A 2YPZA 8AT1B 3RW6A 1EP4B 4O3QA 3IGVA 4Y6IA 5T7LB 3MFHA 2JLFA 3NAHA 4ECTA 3MEEA 3OSPA 4I6WA 4QWAA 4I64A 4XK8C 4WFYA 2V2KA 3QT5A 3MUVP 1EKSA 1SUQA 1FT8A 2RQKA 3ICLA 4NEZA 2YQ1A 1XR6A 3CJ2A 4QPTA 3NWGA 3LGNA 5KFZA 4F25A 2QA1A 3CF5Q 3PW0A 2I6WA 2VFVA 4O3OA 2XHCA 1VJQA 5F9LA 1NZ8A 2LDYA 3JQJA 4M5MA 3GV7B 2F7VA 1C3GA 3E01B 3D3CJ 4OYZA 2BJDA 4A4JA 1NK6A 3FMBA 2B6AB 2RD5C 5HLFA 3DMJA 4G1IA 3CCRS 4QIEA 4G1QB 3R5JB 4OX8A 3I4PA 5IWAF 2GVZB 4ZPVR 3DN9A 1ZYQA 1GH8A 1TKXB 1R0AB 3JSRA 2JFKA 1VQ6S 2EVZA 2HBYB 3KTQA 5J2MB 3PZPA 4ED5A 2HFZA 2FZKB 3DYAB 3NCPA 2W9CB 2OSQA 1FJEB 2WSCC 5H9FK 4DCPB 4TU8A 3R6LB 1A9NB 1PAEX 1YJRA 2J5AA 1VS3A 1WUUA 3GJTB 3AY0A 4I7FB 2POKA 3RAQA 2ZH5A 5L1JA 1SKWA 3CD5A 5LSLA 3KK2A 3VAJA 4X4VA 3PJ9A 4OZNA 5HVGA 2ZC4A 4LFBF 1T0TV 2LEBA 2XZWA 5EHHA 2FY8A 2DH7A 3NXZA 4ZP7A 2B4UA 2YNHA 3H59A 1N5SA 4QPXA 2M88A 3DU5A 5KFFA 1SPBP 1RT3A 3FCHA 4AQYJ 4C8OA 1JLBB 1Q5VA 2UUWA 2YXLA 3I5AA 3AB4B 2NPIA 3DYAA 4FYXB 2W24A 3MURP 3EGVA 2CADA 5D0EA 5LJ5Y 2E9RX 2Y8YA 3MM7B 4HHJA 2MJUA 2QIFA 4I2QA 1U2RA 1UZDA 3BH7B 3LANA 1RT5B 1RTHA 4F67A 4W90B 1RWMB 2C2KB 4EUVA 1HHQA 2V4JB 4H54A 3U1LA 3KDNA 4BHQA 4V19J 2XLKA 3F41A 5AXNA 3CDWA 1HD0A 1B70B 4DV1J 1NDLA 2VODA 2VPXB 3NGSA 3OT9A 1URNA 2LQJA 3FBCA 2I5JB 2OTJS 1NB7A 4X66F 5JXSA 1CC7A 3OW2R 1NU4A 3AHPA 4J9QA 3RAXA 4ED4A 5RUBA 3KOAA 2E5HA 2K2PA 3C6UA 5HBMB 1HNXJ 4L73A 1WNEA 2H54B 2JH3A 3R1HA 1Z1ZA 1VHIA 1S6UA 4ED7A 2CQ4A 2B5JA 2J7WA 4H4OA 2Y1JA 2G4BA 3DHXA 3TI0A 2BR0A 2AJQA 1JLQB 5CA5A 4WJBA 3SIPB 5M2UA 1B7FA 3LWMA 1HHTP 3KFWX 3NNCA 3HHLD 5DJBA 1SC6A 2JLEA 3HHLB 2I5JA 5EWEA 5K8OA 3GB0A 3R5BA 1NMEB 2D3OR 1YJ7A 4KGKA 2BUNA 3T41A 2BJEA 3DRSB 3H7HB 4IFVB 1HI0P 2C2ZB 5J2NB 1UWAA 2VBZA 1FRXA 7AT1B 5JUMA 2XLJA 2RKIA 1S7IA 3KMSA 2HQDA 3NY0A 2YNIB 4WZMA 3PYDA 4LIRA 4M5IA 4DJBA 1RAHB 1DTQA 5CQGA 2V8HA 2ZWOA 1RTIB 4JI4J 5EN1A 2WB4A 2ZH1A 3EX7B 2I0XA 4NRTA 1Q8IA 1WOSA 3R3TA 4IG3A 4PPDA 3Q2SC 1LXNA 2DVIA 2F5GA 4OL8A 4U8YA 4CH1A 2W8KA 4A8YA 4ED1A 1NBEB 3A4TA 4RPFA 2HYIB 2BQ3A 2FC9A 3I9V9 1RHRB 2VG7B 1YQHA 1AROP 3HMJG 2AJ2A 5K14A 4HYKA 1H98A 1Z2ZA 3DM2B 4D3HA 1KQGB 1JXVA 4X4TA 1SJ4P 1Q79A 5MLCV 1EETA 2FHOB 3IA0A 3JTPA 4FDFA 2E7VA 1HA1A 3TNVA 1SL1A 1D1UA 3OUYA 1LWFB 3TVKA 4ELTA 3MR5A 2Y1IA 3GYGA 3DOKA 4A8QA 1WELA 1RWUA 4X62F 4OI1A 4DR7F 3HSDA 2PEBA 1PO6A 5I3PA 2AJFE 2OI2A 2HWHA 3QT6A 1YBUA 1HBOA 3TJ9A 3HM9A 3ZNJ1 4ZLLA 3IMQJ 1RADB 2MLZA 4I68A 5L9XA 2CFXA 2I1RA 1SL2A 4EO8A 1FX2A 2QL7B 1O6XA 2G9OA 4L76A 4WIQA 4C97A 5EDWA 2NXCA 2ZOGA 2H5JB 5JJBA 3CO0P 3CEDA 2OH2A 3VCDA 2YWKA 1VDHA 4WFAQ 3R7NB 5AE3A 3UR3C 4K7QA 4HH0A 3MGJA 3D0IE 3CULA 3Q8UA 2NYIA 4HHHA 1PKUA 1SJRA 4HACB 2AF6A 4X4OA 4ZPTR 1REVB 2DISA 3MI7X 3MEDB 1AZSA 2RIJA 3EVOA 4F8RA 4RNMA 1IWGA 2R2TA 2HNYA 1VC6A 3D0HE 1XK8A 1QY7A 4IG0B 1A7GE 4C3KA 1JIHA 2C3OA 5HO4A 2XGQA 2DBBA 4Q45A 1ZAVA 5CZVA 4CLTA 2B7BB 1U24A 3AD7C 2LEPA 4FYVB 4IYQA 4FP9A 2WVDA 2C22A 4FYWB 4DSIA 1TMJA 3QJPA 3PM9A 2AYMA 5ETPA 2FLPA 1X4AA 1IR2A 4O23A 1IN0A 4DV6F 2DRBA 4XTTA 3G6XA 3D54A 4J9NA 3F73A 3FRYA 3QPIA 1SL0A 3L4BC 4Y65A 5HJXA 3CC2S 3RBXA 3C66A 1VHFA 4FF4A 1EAYC 4WK3A 4JI4F 2HVHA 5H1SV 4KH1B 2B4VA 1Q5YA 2D74B 1PC4A 4DR5J 1S1UA 1D9FA 1BHNA 4LREA 1VQYA 2VA2A 1DY3A 1RTJA 3W5YA 4EBDA 3DKDA 4WK1A 4RUCA 2KZMA 2DK2A 4CO0A 5A8RB 3DI6B 2OPSA 4XAKA 2CZ9A 5AJ3J 2X1AA 4BWJA 1HWLA 3I55S 4DR2F 3AOAA 4LF9J 4ATNA 2IDLA 1UCNA 5HQMA 1KTQA 1VQLS 1UJ4A 4QYZJ 2YPYA 1LW2B 1NHVA 2LXFA 4A47A 5L39A 4NRUA 4JI5F 4ZITA 2A2DA 2IBOA 1ZA1B 3OPKA 4DCJB 4YFUA 1NM2A 3LP1B 1BWEA 1WHXA 1NH7A 4Z2XA 2M3DA 2CXEA 2XYGB 1B0PA 2ZOFA 4RUHA 2YKMB 3FC9A 4P73A 3TZXA 3MUMP 4J9RA 4NL5A 2ALZA 1M5PC 1HNZJ 3DI6A 3IAS9 4C6AA 4K4WA 3KKFA 4FVCA 3A8KA 1WSVA 5E3RA 3MD1A 4DQIA 2W7AA 2YNHB 2KT5A 1Y5NB 4USWA 2KRRA 1Z4UA 4ILRA 1S59A 2OEJA 5C5JA 4KJIA 4Q2LA 4RW9A 4N5SA 4F4YA 3J7AN 1XMBA 1VBZA 5FLXY 3PVXA 4F0HA 3D66A 4BCAA 2QLFB 3FDSA 3NGTA 4NYOA 3VTIA 2LA4A 1IKXB 2R9LA 5F0WA 2BKNA 4DL5A 4Q0BA 2QMUB 4JUZA 3VGTA 1RAFB 4OYXA 4CDIA 5C25A 2HIYA 2HHUA 1DURA 1FKOB 1S4FA 3FCWA 1DBDA 4DR4J 5HAOA 3PYEA 2X3GA 5ETNA 4ZJOA 1UVJA 2MQOA 3BPDA 2ZBRA 1MROA 1D09B 3EWGA 2YH0A 4NCGA 3TYTA 2MZTA 2QL9B 2VFUA 2LQBA 4OZ3A 4RW9B 3MM6B 5D0HA 2ZFHA 3SEOA 5KFLA 2H9ZA 1REGX 3C14A 3NOGA 4NA3A 4NA1A 3I0SB 5LMUJ 2H48B 3GONA 1YJVA 1RA7A 3C8YA 2XM3A 2DGUA 4GKKF 2PMHA 5C25B 2HFVA 2NSCA 2F4VJ 4QR0A 4URQU 3E01A 1Q16B 4M1KA 2EFPA 3U27A 3NNHA 3M2VB 1XR5A 1ZOTA 3CCQS 2HQGA 1I1GA 1YJUA 1RT7A 2QA2A 5CCMA 4U7UD 2MZSA 4HLBA 3FKBA 1YI2S 3HVTB 3BDPA 1RCOB 2R7OA 1WHVA 1UETA 1CG2A 3DLKA 3D0GE 3DRRA 2UV8A 4P2FA 1N0VC 3SMZA 5KG2A 1R0AA 4DS4A 2HHXA 1UW9A 2QMXA 4IH5A 2C3YA 2OMLA 3MAAB 2R7TA 2CYYA 4ZJLA 2YNIA 3SXLA 2JNJA 2RDDA 3C46A 1M0SA 4UQTA 5CCLA 1FDNA 1AUDA 1N56A 2C42A 4I7FA 4RBUA 2V68A 4DR1F 2PI4A 5IC4B 3ZZRA 3AA9A 1IKVA 3NS6A 4EGLA 3RBDA 1CJVA 2UXDJ 3M30A 3GIJA 2EFGA 3L09A 1E6YA 2QTWA 2AEMA 1JLEA 1FJCA 2VG7A 3W64A 4P2SA 3NWRA 5KT3A 4IR1A 4HDGA 2N3OA 4DR3F 3GIMA 1PILA 3H5SA 2ZBPA 5FD1A 3N5BA 4USVA 5U47A 4YY3J 1V5VA 3OJUA 2QE5A 1RKJA 1XIQA 2IY5B 1FJGF 2FZCB 2PE8A 4KGZB 2I2YA 3CJ4A 3L3CA 2ALYB 2KVIA 4WKYA 3PR4A 1GQEA 4F4XA 4KPCA 2FC8A 1GTEA 1NK4A 2QFJA 1UVNA 2Z4PA 2IRYA 2HG4A 1B64A 1K47A 2BW2A 3TVZA 3VF0B 3IG1A 2ZVIA 2XY6A 4TN2A 1RT4B 1TKZB 1Y3KA 2N7YA 2VU5A 3QFHA 5CZXA 1PYOB 3VZIA 3VVTA 2XO7A 3PW4A 2B7CB 3SV4A 3CCES 3ZZYA 1TK0A 3LP2A 3W1YC 1RTDA 2NQPA 4PWWA 3CUNA 6FD1A 5J1EB 2HK3A 4PYDA 1S0VA 4DU7A 1NKBA 1VJWA 3MTJA 2W4PA 2ZH7A 4NOHA 4PG6A 5K8NA 1OMSA 3ZZUA 1QSYA 2JL9A 5GMDA 1JLQA 1KVIA 4L6V3 3D1QA 4NLSA 4X4SA 1X4CA 4PZVA 4DLEA 2VIHA 1F5CA 1NDCA 2DO4A 2VDIA 3BF4A 3EM1A 4OJ3A 1JLAA 1UEVA 3R2DJ 5CHCB 3CCUS 2R7VA 2DNZA 2OPQA 3ETOA 2HAIA 4OHYA 1FTRA 2FDNA 1DLOB 2MYFA 2RRBA 5DQGA 3KK1B 3HJFA 2MEWA 1FWPA 2APOA 4G1PA 4MMOA 1O8BA 2BMBA 3IBFB 3T6BA 2Z2MA 3Q23A 5F9NA 3TJAA 2R3VA 3T5LA 4QOTA 3T3FA 1XNRF 2XQCA 2BJ3A 4IG3B 1R8HA 1S1WA 2VG6A 3OTCA 1S6OA 1YBAA 4AT1B 3W63A 4RX6A 2VZ9A 2GHPA 2H5IB 2LEAA 2YNFB 3I0RB 3IWXA 4CNZA 2OHDA 1HQUB 1L3UA 1SQEA 3ILJA 5L1KA 3KLGA 1KRPA 2GW8A 2HVDA 1EETB 3TAQA 3M6WA 4DG1B 3ZO7A 1LW2A 3ZC4A 1SXLA 3PFEA 2G2ZA 3RBZA 2RU3A 2EBGA
chains in the Genus database with same CATH topology
3NY0A 1C3GA 1GMWA 3NXZA 3TJAA 3TJ9A 1EARA 3AGYA 3AGZA 1GMVA 4J80A 2B26A 2QLDA 4L3KA 3LZ8A 3L9ZA 1EB0A 1NLTA 2Q2GA 1GMUA 3LA0A 1GMWD 3AGXA 3TJ8A 3I38A 2HFVA 1XAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NY0 A;  1C3G A;  1GMW A;  3NXZ A;  3TJA A;  3TJ9 A;  1EAR A;  3AGY A;  3AGZ A;  1GMV A;  4J80 A;  2B26 A;  2QLD A;  4L3K A;  3LZ8 A;  3L9Z A;  1EB0 A;  1NLT A;  2Q2G A;  1GMU A;  3LA0 A;  1GMW D;  3AGX A;  3TJ8 A;  3I38 A;  2HFV A;  1XAO A; 
#chains in the Genus database with same CATH topology
 2JX2 A;  2VC0 A;  3D68 A;  1NCL A;  5AXL A;  5GMK a;  3J81 Y;  3HD2 A;  5DET A;  4X66 J;  2HGN A;  2HNZ B;  3PG9 A;  5JVG Q;  5KT2 A;  2DGX A;  1IBL F;  1RWO B;  3I82 A;  1R8C A;  3FSY A;  3VZH A;  4KHM A;  4XPC A;  3BBB A;  2A0F B;  4LFC F;  1FJ7 A;  2CNK B;  4KFB A;  1AW0 A;  1NUE A;  1VC0 A;  1U0H A;  4YP3 A;  2DGO A;  3GIL A;  1DTT A;  1S72 S;  5KFA A;  1S4E A;  1JXE A;  2QA4 G;  5D3G A;  2KFZ A;  3FFI A;  2ABY A;  3TQE A;  3M9N B;  1R3N A;  1Y5I B;  2OKQ A;  3D6F B;  3DLE B;  3GWC A;  4NZ7 A;  2HNY B;  5GAE I;  4DF4 A;  4PYA A;  2AGQ A;  5CYJ A;  1RWN B;  1ZZF A;  1YIT S;  4DR4 F;  3M1V A;  3T1H J;  1FF2 A;  5DDP C;  2RU9 A;  4FS2 A;  5D6G A;  1NND A;  4KV8 B;  3RAM A;  3CJS A;  1VBK A;  4XO0 A;  1C1C A;  3BGU A;  2KFY A;  4NXM J;  1NSP A;  4QCL A;  2E5J A;  3O5T B;  3WQP A;  3RB3 A;  2ZBC A;  2PGC A;  2ATC B;  4USH A;  4M5N A;  2DXD A;  1X9M A;  2E5I A;  3CDA A;  2O66 A;  4YEA A;  1PSD A;  2B9E A;  2R7X A;  3O8W A;  1FXL A;  2K3I A;  2W9C A;  2RH3 A;  3D6H B;  4I56 A;  1D9D A;  1IBK F;  3ZZO A;  3RRH A;  4FBU A;  2CVI A;  1NLT A;  5DM7 Q;  2YNG A;  1R8A A;  2MTL A;  3M8P A;  3HHK A;  4USU A;  1ZPV A;  2Y8W A;  1HWK A;  4LRD A;  3IS9 A;  3OXG A;  1AYE A;  3AH6 A;  3Q8Q B;  5DQH A;  1GEH A;  3JTO A;  2VV5 A;  3DDI A;  1RAI B;  1L3V A;  1TR0 A;  2FPH X;  2VUG A;  1DAX A;  2XSF A;  2HZV A;  4K4V A;  3RR8 A;  4CLW A;  1FKA F;  2LMI A;  4UW2 A;  2HK2 A;  3RYL A;  3MAA A;  3OL7 A;  1IBM F;  1DQ9 A;  4AD6 A;  1VBX A;  3JAM U;  4FXV A;  4EYH B;  5KFV A;  1I5O B;  3V81 B;  3OLA A;  5IM0 A;  2MY8 A;  5EX0 A;  5C7P A;  3M8P B;  2UXC J;  3POT B;  3CDE A;  3WX4 A;  3W3S A;  4B3S J;  1RT6 B;  4QQB A;  2VJU A;  1NK7 A;  5B0D A;  1C0T A;  1X0P A;  3SCI E;  2NR0 A;  4AQY F;  2XYH B;  1WDT A;  5E41 A;  3MF5 A;  1FD8 A;  1PJ7 A;  3UVJ B;  3BSO A;  2BM1 A;  2BQU A;  3C16 B;  4UY8 5;  4LMZ A;  2WW4 A;  4KPY A;  5CYQ A;  4DQP A;  1F3F A;  1FEE A;  2Z2Z A;  2NLW A;  3UN2 A;  5DQI A;  4DL6 A;  4TQS A;  4PXE A;  2J9C A;  1TV6 A;  3CCL S;  3PDN A;  1YX2 A;  3DGV A;  1G1X A;  5IS2 A;  3A12 A;  1DQA A;  3V6J A;  2FHM A;  3A13 A;  3LH2 S;  4LR9 A;  1LWX A;  1RHQ B;  2HWT A;  2NYH A;  1VYA A;  2KXH A;  4YB5 A;  3B4D A;  3V4M A;  1IVZ A;  1LK5 A;  2BXJ A;  4DU8 A;  4F50 A;  4F3O A;  4B3S F;  2XYP B;  1BGX T;  5L38 A;  4PWD B;  1F6T A;  3DLG A;  4FXD A;  3CXC R;  1KR4 A;  3OR2 B;  3ENA A;  1KOH A;  4NYZ A;  4PG4 A;  3MR6 A;  4KYZ A;  3M9M B;  4TYA A;  1NSA A;  1U1K A;  1RYS A;  5KG6 A;  4FBT A;  2RDI A;  1XJW B;  3FCV A;  4RBV A;  1BQN B;  3Q8S B;  4JYA J;  2FVC A;  3CB4 A;  4DQR A;  1GX6 A;  3M2V A;  1YK9 A;  4ZVO B;  4EO6 A;  1ZPW X;  1RWP B;  3Q83 A;  3QSI A;  1M1K T;  1ZH5 A;  4NAS A;  4ED6 A;  3QMQ A;  1ZM3 A;  4Q8E A;  3C6T A;  1YRU A;  2IYG A;  2ZVS A;  2HWI A;  2COL A;  2MQL A;  1GMV A;  2DNH A;  2H1Y A;  2YVS A;  4NEY A;  5E3C A;  3ZTO A;  4A48 A;  4PWD A;  4QU7 A;  2RHS B;  4YOE A;  1ZA2 B;  3T1H F;  2R8H A;  3WC0 A;  3BGO P;  1MW7 A;  2QA4 S;  2D3U A;  5K14 B;  2WBR A;  3EVM A;  3GV5 B;  4J9P A;  4EBC A;  2IA6 A;  2V9W A;  4DDF A;  2XZD B;  2QLW A;  2ZNZ A;  3SSQ A;  2FJA B;  4WU2 A;  2P9E A;  1UA0 A;  1OYD A;  1VI7 A;  3G9C A;  4B3O B;  4DPX A;  4ID8 A;  1CJU B;  1N6Q B;  3P45 B;  1HFE L;  2QJ3 A;  1HQE B;  1HBU B;  3H4B A;  1D8Z A;  4MFB B;  2E5L F;  3DRY A;  4OYB A;  4F2R A;  1NKC A;  2GQ2 A;  3I5C A;  4AXJ A;  2E1A A;  1FKP A;  5EUH A;  2MKJ A;  3CSK A;  3S01 A;  4DLG A;  1ITP A;  3S7R A;  4K4X A;  3MPY A;  4DFK A;  2D41 A;  2NXE A;  2GA7 A;  1BMQ B;  3O44 A;  4PQA A;  3V2U C;  4ZJQ A;  4GC6 A;  4OQJ A;  4KB7 A;  2K1R A;  2ASL A;  4DR7 J;  1H2U X;  3N79 A;  4DSE A;  1H2T Z;  2VG5 B;  3WZ0 A;  2BYC A;  4C0B A;  1OY8 A;  2R2S A;  2V8P A;  3QAE A;  2CQP A;  4U9R A;  1SQG A;  2A10 A;  1REV A;  2AIR B;  2ZE2 B;  3IR5 B;  3TR5 A;  2K8G A;  2EC2 A;  2MXY A;  1A6L A;  1YTY A;  1NLK L;  2OTL S;  2G1D A;  1FES A;  3WIU A;  2ZH8 A;  2NZ4 A;  5A2Q U;  4X4N A;  2IVF B;  5HSP A;  4WP8 A;  4OI6 A;  3OV7 A;  5A76 A;  2ASJ A;  2HGM A;  3O1L A;  1N34 J;  2XC9 A;  2J0S D;  3O6Q A;  4N8O A;  4DV3 F;  2HIQ A;  2R7R A;  4PRF A;  1VQK S;  3EGN A;  5KG3 A;  2BZ2 A;  4ANE A;  3NBP A;  3K57 A;  2R8I A;  1KDN A;  1F5B A;  1IJE B;  1S6Q A;  3QO9 B;  4NX9 A;  4NLV A;  4CYU A;  4WCE Q;  2LQ5 A;  2MGZ A;  2DH8 A;  1RYR A;  3OQ2 A;  2F9D A;  4AUK A;  1C1B B;  2E1C A;  1ZAX A;  2AMC B;  3FFI B;  4CO5 A;  4KO0 A;  3GPA A;  3AJ2 A;  3M6U A;  5I3U A;  4KIA A;  4JV0 A;  4WE1 A;  5LOQ A;  1K44 A;  3F56 A;  3HLU A;  3JYT B;  4DOZ A;  4O3N A;  1TMM A;  3K58 A;  4A8X A;  1NK9 A;  4WBF A;  2JEF A;  3ONQ A;  3P8B B;  4GC7 A;  1S49 A;  3CNQ P;  2J76 E;  5BYS A;  1GFW B;  1M5O C;  4DXL A;  2DRA A;  4JI5 J;  1OSC A;  2GCF A;  2E7W A;  1L3T A;  1DLO A;  5FDL B;  5A8R A;  3V5R A;  2J7U A;  2KHD A;  4ZVR B;  3SFU A;  3KK1 A;  4B3M J;  4CCH A;  4ENO A;  2VAS A;  5LSO A;  1S0O A;  4NXN F;  1QAI A;  2UU9 J;  3W62 A;  5LMN F;  1RU1 A;  2RNE A;  3CD6 S;  3DLL Q;  1R89 A;  3LWL A;  2Q1L A;  1HLW A;  2ZDO A;  3NRB A;  3ET6 B;  2NSB A;  1J2V A;  1RWW B;  1JLC B;  3LF0 A;  1B99 A;  3JSY A;  5E7O B;  3M8Q B;  4IQM A;  3SDE B;  4CO3 A;  3GJQ B;  2U1A A;  1KN6 A;  1S6P B;  1RAC B;  1F5A A;  4TY9 A;  2ASD A;  3NCR A;  3JSM A;  4D3G A;  3AAW B;  2FYX A;  1WOR A;  2Z0G A;  2X51 A;  1BC6 A;  3FEY B;  1B7Y B;  2EFO A;  2E66 A;  4DHV A;  2J8S A;  1VIS A;  1TKX A;  2VC1 A;  2CQI A;  2ZDP A;  5L9N A;  4LBH A;  3OXL A;  4QR2 A;  1RE1 B;  1XMO F;  1MN7 A;  4OI0 A;  4ID5 B;  1RBA A;  5M2R A;  4L72 B;  1JQG A;  1NK8 A;  2HMI A;  2HHV A;  2YKN B;  3TJ8 A;  3W9I A;  3KLE A;  4NML A;  1R6V A;  5C24 A;  3M8Q A;  1YSJ A;  2XMM A;  3EVW A;  2LDI A;  3T9N A;  5DO2 A;  4N77 A;  2RQC A;  2M4M A;  3J7Z T;  1UJ5 A;  1NPK A;  1RT6 A;  7FD1 A;  4ED3 A;  1FKO A;  2KYZ A;  1U1R A;  1I3O B;  1U6F A;  2UVV A;  3SFG A;  4WPA A;  1U26 A;  1VQ5 S;  1TKT B;  5I3U B;  3MPD A;  4FYY B;  1RAA B;  3UI3 A;  3R5C A;  4AL5 A;  2XSJ B;  3PX0 A;  2BW7 A;  4MYT A;  3S8S A;  1CQN A;  3RU0 A;  3BKU A;  4OYP A;  3J80 U;  4KTQ A;  3C2P A;  1UAW A;  2D7S A;  4O4G B;  1BXN A;  1FRI A;  1K1Q A;  1PCA A;  4UUW A;  4ZHR A;  4I2Q B;  2XTJ P;  3I6P A;  4GVL A;  3OLB A;  1JWW A;  1X4B A;  4K4Z A;  5I42 A;  4UOC A;  2D69 A;  2V63 A;  2V4R A;  1RGV A;  3KXD A;  4LF7 F;  3I96 A;  4N41 A;  1C0U A;  2HSE B;  2V4J A;  3QNW B;  5CH7 B;  5BYR A;  3H2V E;  2AYB A;  1LW0 A;  2CWK A;  5KFU A;  5HMY A;  2KXN B;  2DPI A;  1T9W A;  5ETO A;  4WFN Q;  9RUB A;  4ZIW A;  2WVB A;  1SKS A;  5IQ6 A;  2W01 A;  3GU0 A;  3HVT A;  3BO2 A;  5EWF A;  4DUY F;  4OX6 A;  4K59 A;  1OPI A;  1U09 A;  2J0W A;  2M2B A;  2CG8 A;  2MKH A;  3MHY A;  4DV3 J;  3WC2 A;  2DNR A;  2OUG A;  4JI8 J;  3CE8 A;  3G4S S;  4DV1 F;  4WWS A;  1JKH A;  5D4O A;  2GGP B;  1OY9 A;  2GJ2 A;  3EIC A;  4LBP A;  4OX9 J;  4OZ0 A;  1AUS L;  2V8V A;  1UVL A;  2FB0 A;  2KZZ A;  2NXJ A;  4RBT A;  4B02 A;  3QT7 A;  3KLH B;  1I94 J;  5HRO B;  5IT9 Y;  3HVA A;  2VD3 A;  1HNX F;  4K2J A;  2G1H A;  2XZT B;  3AA8 A;  3VR1 A;  3QJJ A;  1UL3 A;  2CNL B;  1GT8 A;  1Q7L B;  3M30 B;  4HL9 A;  1BY9 A;  4HTJ A;  4MKB A;  5L46 A;  1MWQ A;  1FDB A;  1DJ0 A;  1Q1K A;  3ZTS A;  5DM6 Q;  3UD4 P;  2B4P A;  3CPW R;  1HNV A;  3UN3 A;  1X4G A;  2M0G B;  5HI7 A;  3BRE A;  5IFM A;  3OSN A;  2X1G A;  4OZJ A;  4GO7 X;  3UW1 A;  1YGY A;  1SKR A;  3B4M A;  4OV6 A;  5D4N A;  3BZQ A;  1TUV A;  4LSN B;  2WZ1 A;  3IP0 A;  4I2P B;  1NXI A;  5IM0 B;  3M2R A;  1U1Q A;  1TU0 B;  4JI0 F;  1U8W A;  5KG4 A;  3QLH B;  1KD1 T;  4MYU A;  3KJF B;  2HRU A;  4MFB A;  3G8T A;  4E98 A;  5KT5 A;  1NJX A;  4IDK A;  2DHA A;  1XTZ A;  2WK4 A;  1Y3J A;  2YWG A;  1RAJ A;  3U7J A;  3WBZ A;  4DPW A;  4EYI B;  3Q0A A;  4CLF A;  1X60 A;  2R8K A;  4NZ6 A;  1DFD A;  4UOF A;  3IG1 B;  1UTA A;  4J9U E;  1CJK A;  3R7B B;  2JLG A;  2B0G A;  4ILM A;  2C3M A;  1KP6 A;  1MML A;  2PA3 A;  3IO1 A;  1Y4Z B;  4ETZ A;  3FNN A;  1XMQ F;  2YWF A;  3CWJ A;  4M5D B;  3SV3 A;  2YH1 A;  1TV6 B;  4NI2 B;  4MTP A;  1TAQ A;  4ZLJ A;  2QSF A;  4DV7 J;  4C8Y A;  3ZZZ A;  2JWN A;  4LUB A;  3CJK A;  3UNY A;  3QZ8 A;  2MQN A;  1F3V A;  4MK8 A;  3PKM A;  2C2O B;  1LQ9 A;  2LU2 A;  2MPU A;  3TUI C;  1YZ7 A;  2VFS A;  3BN7 A;  1LFW A;  2HHH F;  1H0H B;  4CT9 A;  3OL8 A;  4LRB A;  1B0V A;  1YDL A;  3VVU A;  1CJT A;  3L7O A;  3RRG A;  1IR0 A;  3HZE A;  4CTA B;  1Q7Y T;  1WJ9 A;  3KNA A;  2DGT A;  5GAE U;  1D3W A;  3TAN A;  3D67 A;  3J80 Y;  4Y2I A;  3HK2 A;  3QO9 A;  3OR2 A;  2M8H A;  3I5B A;  2EK6 A;  5CD4 H;  4HKQ A;  1C1B A;  1WF2 A;  1BQN A;  1KHW A;  3CJK B;  5B0B A;  1TP7 A;  2ILZ A;  1LWC B;  4NLU A;  3RB6 A;  1C4C A;  3EXY A;  3CCS S;  4PG5 A;  3CJQ A;  3AFG A;  4E8U A;  5GAD U;  2YWE A;  1W2B R;  3P4U B;  4JI3 J;  3MMA A;  4NLW A;  3GV8 B;  2QFI A;  1TUW A;  2RUS A;  4HT7 A;  5HVH A;  4PWU A;  4CTA A;  4P52 A;  4ERD A;  3EDR B;  5BR8 F;  1P1T A;  2YX4 A;  5DG7 A;  1GXU A;  4DSK A;  1APS A;  5GAD I;  1JLG A;  4PQU A;  2NUU G;  1WC6 A;  4UTG A;  3WHI A;  1VQM S;  4ZN3 A;  1ICE B;  1RJJ A;  3KG4 A;  5LMN J;  3OFE A;  2IIH A;  2LXI A;  3QAU A;  1EB0 A;  2AZ1 A;  4KRW A;  4S0M A;  4UZC A;  2HQI A;  4PR6 A;  1IUJ A;  3K17 A;  2M9K A;  1P9Y A;  3WDO A;  4ER8 A;  2FVR A;  3MR2 A;  3H90 A;  2KHC A;  3L7P A;  1J5O A;  2CPF A;  4P71 A;  3MXH P;  2CJK A;  1QAX A;  3CD7 A;  4YB7 A;  5AT1 B;  2ZM6 J;  1N0U A;  2MMY A;  1HWU A;  4FN5 A;  3D7S B;  4P72 A;  2MLX A;  4R0J A;  3CCJ S;  3B8H A;  4FYD A;  4ZPD A;  1KQS R;  3CO9 A;  3GIK A;  5FII A;  4UUX A;  4LT6 A;  4WYL A;  4CLU A;  2FHJ D;  4B3R J;  4R8U B;  2UUT A;  3MFI A;  4F04 B;  4NWB A;  2HMI B;  2ZHA A;  1DTT B;  2VIC A;  5H9F J;  2ZE2 A;  5KFI A;  4RNF A;  5D3G B;  2UVW A;  3OTE A;  1KS2 A;  2XMJ A;  3D9B A;  4BC7 A;  2ADB A;  2D1C A;  8RUC A;  3T5K A;  4DL2 A;  3BBC A;  3NP5 A;  3PO4 A;  1CVJ A;  2YKM A;  3GMG A;  2X1B A;  2IM0 A;  4Q44 A;  4X65 F;  3EZU A;  4UQG A;  1E6V B;  2L3M A;  7FDR A;  1WHW A;  2AJ0 A;  2ZJR Q;  2CDQ A;  4QIW D;  5HN0 A;  1HNW J;  1QE1 A;  4LSZ B;  3ZTR A;  3PW2 A;  1R8B A;  4XDC A;  2PO4 A;  3TEG A;  3BGF A;  4ZP8 A;  2XS5 A;  3T1Y J;  2ZZM A;  2A2C A;  4PAA A;  4N47 A;  3BO3 A;  3DC2 A;  2JVM A;  2ROE A;  4F36 A;  1BD6 A;  3AXK A;  5I42 B;  1S9G B;  3DOM B;  4NXN J;  2VBY A;  2B5J B;  2W4D A;  4H4O B;  4EK2 A;  2AP6 A;  4TYB A;  3G8S A;  2ZH9 A;  3RJM B;  1TL5 A;  1VRU A;  3BGL A;  3MMC A;  1S0M A;  1UA1 A;  3A8E A;  3QIP A;  5D77 A;  5DGA A;  5K8P A;  4UT4 A;  3J7Z 5;  3PXG a;  2QYC A;  4DR1 J;  3UFC X;  4OZ1 A;  3SQO P;  4I6Y A;  2W2O P;  4XIU A;  2DGQ A;  2FD2 A;  2G0J A;  3D2W A;  5J2N A;  2AU0 A;  1HNI A;  3GCW P;  5EWG A;  1R0B G;  3A1Y G;  3HPO A;  1W7W A;  2G2O A;  2YX1 A;  4G3I A;  4ZVH A;  4JI7 J;  3E2E A;  5ETM A;  2BV3 A;  4ZPA A;  3L7U A;  4I69 A;  3LW5 C;  1KFD A;  2GJI A;  3RBE A;  2XNR A;  3KUE A;  2AX0 A;  2IYI A;  2IC3 A;  2QC3 A;  4OJ1 A;  2RS2 A;  1RWK B;  2VFT A;  2M52 A;  1XC9 A;  3PR5 B;  1RTZ A;  2MKY A;  2Z2Y B;  4WU3 A;  3TAR A;  1C0T B;  3VWS A;  1BUX A;  2KO1 A;  3N6N A;  2IPO B;  1BQX A;  3DDN A;  3JTN A;  3DRR B;  5T41 A;  4ZS6 A;  4QW8 A;  2G13 A;  4NA2 A;  3OL6 A;  2Q79 A;  3CCV S;  4LR7 A;  2M70 A;  2ZZT A;  3VAH A;  1X9W A;  1OS5 A;  4X4P A;  1UFK A;  3VGV A;  1FDD A;  3AT1 B;  4ZVU B;  2DHS A;  4DMZ A;  2G0C A;  1TL7 A;  2V5H G;  5KFN A;  1T9U A;  3CJ8 A;  3DRP A;  4OMF G;  3TW0 A;  3UWT A;  3TQ1 A;  2ERR A;  4RU2 A;  3RUB L;  1S1V B;  2QT7 A;  4QYR A;  3GYN A;  2HFS A;  3VHQ A;  1YIJ S;  3BV8 A;  3IWL A;  1YJN S;  1RT5 A;  2IDE A;  4M5H A;  1I94 F;  3I4H X;  1N88 A;  3PAC A;  2OO4 A;  1FRK A;  2I9S A;  1JLE B;  3C15 A;  4RW8 B;  2BJ7 A;  1M5V C;  1G3O A;  4MK9 A;  2XWX A;  4TLR A;  4C11 B;  3RB0 A;  4TVA B;  2J6U A;  2CQ3 A;  2A6O A;  1OWX A;  1HIY A;  4DV6 J;  3HFK A;  2WHO A;  4U95 A;  1SVD A;  3Q24 A;  2HW3 A;  2H65 B;  4YDD B;  4DQS A;  4OX7 A;  2DHH A;  4O4G A;  3CCM S;  2XY5 A;  4FXW A;  3UCG A;  3DLG B;  3IR7 B;  8ATC B;  1T02 A;  1WG5 A;  4KGX B;  5HBM A;  2XLI A;  5C2G A;  1S1V A;  4OFZ A;  2PMW A;  4ES1 A;  2CA9 A;  1SC4 B;  3N9U C;  1RT2 A;  1CBK A;  2V8G A;  2Z8Q A;  3FQK A;  3PEJ A;  4CH0 S;  5KFQ A;  1SJ3 P;  3DOL B;  2KYX A;  1EIY B;  1N54 B;  4FPR A;  2ILY A;  5IWA J;  1X7V A;  4TXS A;  5ETL A;  1ZTW A;  2XCP A;  1WC3 A;  2O67 A;  2W2M P;  4ANC A;  2KDO A;  2O3D A;  2V94 A;  5HJY A;  2ZZN A;  3F44 A;  3MAQ A;  1U7L A;  1TAU A;  2PD1 A;  1WHY A;  1TEL A;  1MSW D;  3HF5 A;  1HYS B;  4CLK A;  2ZKU A;  3PYF A;  3D3B J;  2CQH A;  3VAM A;  3KYL A;  1L3S A;  1N5Y A;  3PX4 A;  4ECY A;  4P75 A;  3L9Z A;  1HHS A;  3R5D A;  4LF9 F;  2C28 A;  2BM0 A;  4LIW A;  4CQ1 A;  1VRT A;  5C42 B;  4CLL A;  3AQP A;  3F0N A;  5KFP A;  1HQE A;  4DPT A;  4O3R A;  2QX0 A;  3M4X A;  6FDR A;  1Q78 A;  2DNO A;  1EX8 A;  4C48 A;  3SI8 A;  2X7I A;  2GQC A;  1NK5 A;  4JOU A;  4OJH A;  2N4C A;  2F1F A;  1YZ6 A;  1NO8 A;  2KJW A;  4JP8 A;  2NZC A;  2Z30 B;  5EGY A;  2VQF F;  1DAR A;  3OTO J;  4DV4 F;  1NB2 A;  1A0O B;  4B08 A;  1SJQ A;  5I4M A;  5F8L A;  2UU9 F;  3QBC A;  3KLF A;  3JSB A;  4URG A;  2ZJP Q;  2HHW A;  3BKF A;  5IT4 A;  3DM2 A;  1RHK B;  4A8W A;  4JI6 J;  3DLJ A;  2O01 C;  4HHU A;  2IM3 A;  2WSE C;  4I2P A;  1RB0 A;  3NGU A;  3SQG A;  4UZB A;  4DV7 F;  2F3J A;  4WXO A;  4LQ9 A;  3BEG B;  3M32 B;  3QYY A;  1WC4 A;  3UPF A;  4LF4 F;  2CQ1 A;  2R7U A;  3TVY A;  4DV4 J;  4MAK A;  1LNQ A;  3W66 A;  1U47 A;  3M6V A;  2BA9 A;  3W65 A;  4DZ6 A;  3T5J A;  2A18 A;  2HGL A;  4HH1 A;  1SIZ A;  4U67 Q;  3CJ5 A;  1F9F A;  2FQQ B;  3PRV A;  1T03 B;  1RBL A;  3BBF A;  3K5O A;  3SSR A;  3PY8 A;  2LEC A;  1BLU A;  1VFJ A;  3MEC B;  4F2S A;  2B4O A;  5KFJ A;  3TUP A;  3RGI A;  1N33 F;  2RIL A;  1EKR A;  3W2W B;  3PW7 A;  2UXB J;  3HXM A;  3A8J A;  3KJN B;  4M5D A;  4QR1 A;  3GG1 A;  3DHW C;  1FCA A;  2DKO B;  2I8E A;  5SUH A;  1AZS B;  1HYS A;  3G87 A;  4IQX A;  2MKC A;  1H7X A;  4ECR A;  1XN9 A;  2Y0B B;  2NPF A;  3CIZ A;  5B0G A;  3AGZ A;  1OYE A;  4M63 A;  2BE7 D;  1U25 A;  1MWZ A;  4NE9 C;  5C2C A;  3O3L A;  3LZ8 A;  2SXL A;  3U1M A;  1N5T A;  2CPJ A;  1NPP A;  3KLI A;  3MM8 A;  3FUY A;  3MD3 A;  2FHK A;  2AW0 A;  1QE1 B;  3DNC A;  4LQ3 A;  4G1Q A;  2KG1 A;  5FDL A;  4N56 A;  3KK3 A;  3NS5 A;  3UE2 A;  1FE4 A;  2JZ5 A;  5AXK A;  3SSS A;  2FUG 9;  2I38 A;  3NLC A;  2W8L A;  4DWI A;  5L8R C;  2F4V F;  2R8G A;  2XCA A;  2WCX A;  4B3T J;  3K5P A;  5HMX A;  1VLO A;  2IMO A;  3MMA B;  2W9B A;  4JI1 J;  1WI8 A;  3ZZ0 A;  3MMC B;  4CM0 A;  1N4L A;  3NG8 A;  4PUO A;  2ZWP A;  1RBO B;  3QIP B;  4DUY J;  5KT4 A;  4ZVS B;  5HQ8 A;  4M94 A;  3DGP B;  5HVF A;  2DB1 A;  2DCU B;  3Q2T C;  4ZK7 M;  3HO1 A;  4LF6 J;  2D9O A;  3VAF A;  3BKT A;  1H6K X;  4CO1 A;  1MLA A;  2YWW A;  4DSF A;  3TEH B;  3H5X A;  4C8K A;  3N28 A;  5DLF A;  1MWY A;  1NDK A;  2WVF A;  2NCK L;  5KT6 A;  5E3Q A;  1HNZ F;  2Q2G A;  4OYW A;  3TA2 A;  3QZ7 A;  1YG0 A;  1KQF B;  4ECX A;  1J5O B;  3EZ5 A;  3UD5 A;  3H20 A;  2JSX A;  3PNI A;  2R8J A;  4P10 A;  2IJR A;  2O1P A;  1FER A;  4YME A;  3GE9 A;  2OPP B;  4DQQ A;  1LV5 A;  2IJF A;  1RAB B;  1FFG B;  3OTD A;  2ADC A;  4DX7 A;  1RHJ B;  3QGG A;  5DLG A;  1FVQ A;  1S9E A;  2BEF A;  4ZPC A;  4CLY A;  3EPI A;  1VQO S;  2XSJ A;  2EXU A;  4IO1 A;  4LF7 J;  3MOZ A;  2YX7 A;  1XR7 A;  1R6Y A;  1QUV A;  3TAM A;  4ZDN A;  4CP5 A;  2GHV C;  2OIH A;  2CWX A;  1UVK A;  1CSJ A;  3C6U B;  1IKX A;  2Q3P A;  3MCS A;  3VGS A;  4ZHR B;  1R27 B;  4ED2 A;  2EBE A;  1RHU B;  2L9N A;  3I32 A;  4DSL A;  2B3T B;  2ZD1 A;  4O44 B;  4QIG A;  3DU6 A;  4AND A;  4C0H A;  3G2X A;  1X5P A;  1ZM9 A;  2HHP A;  4X64 F;  2MKS A;  1WTB A;  2W2Q P;  3OJS A;  4N7T A;  3T19 A;  1Q8K A;  4HR2 A;  5BXI A;  4MKA A;  4DEZ A;  5A8K B;  1C2P A;  3GFY A;  4PPZ A;  1KVK A;  3FEZ A;  2IVM A;  3VGU A;  3THT A;  1ZAW A;  1G4C A;  3G8Q A;  4NLO A;  5E2Q A;  3OTO F;  3TA0 A;  2BOA A;  4OHV A;  5CYQ B;  4KKO B;  1Q53 A;  4RW4 A;  3CJ0 A;  3S1T A;  1OSD A;  3GFZ A;  3I0S A;  4ECS A;  2C2M B;  2BJ1 A;  2KB2 A;  3N5F A;  5KG5 A;  3JB9 k;  5D8H B;  1NDP A;  1RTH B;  2C3U A;  2QYG A;  2DIT A;  4M5K A;  5KFR A;  3Q8P B;  2F63 A;  3KHG A;  1J5E F;  4PAB A;  3IBW A;  2R2R A;  1VQ8 S;  1VRU B;  1CS4 A;  3AJD A;  1RT7 B;  3MPV A;  4LVO P;  3THP A;  1RCX B;  4NLR A;  2MQP A;  2CPH A;  2AQ4 A;  4CZC A;  2BE2 A;  1O51 A;  3HSG A;  2BX6 A;  3KHR A;  3HHE A;  1RK8 A;  3HI9 A;  4KSE B;  4F0M A;  2RRA A;  3PO5 A;  1AFI A;  4DX6 A;  1J27 A;  1JLA B;  3K59 A;  1Y7P A;  4ECV A;  3DLB A;  1S1X B;  2V0N A;  4J37 A;  2ZH4 A;  2J6S A;  4OLP A;  4W92 B;  1HMV B;  2ASY A;  3MM9 B;  4GVB A;  2UUC J;  4LF8 J;  4DV2 F;  4TU9 A;  4RW7 A;  5DZ6 A;  1T3O A;  2B8Q A;  1SIW B;  1RWX B;  2CQC A;  2FJE B;  3CJ3 A;  2KH9 A;  2OD6 A;  2E7X A;  1UFW A;  4KY3 A;  2F8H A;  3PW5 A;  3M2R B;  2LQ9 A;  2MZ1 A;  2AGO A;  1RIS A;  1WG4 A;  3LOU A;  3QLH A;  2OP5 A;  4Y2C A;  2KRB A;  3HHL A;  2B26 A;  2OEL A;  4NLX A;  3C6T B;  3M2U B;  3TUZ C;  1WKK A;  3H2U B;  2CNN B;  1HBO B;  1X4D A;  5F8H A;  1QVG R;  4EMD A;  1ACM B;  1NJZ A;  2UUB F;  1NSK L;  5DZ7 A;  2YNF A;  2XNQ A;  2XMT A;  3I0R A;  1TVR A;  4YDX A;  2HBZ B;  5E3P A;  2RKI B;  1TQL A;  2XWY A;  2DXF A;  4PCQ A;  1OY6 A;  3D1O A;  2C1E B;  3PRD A;  2BDP A;  1FX4 A;  1TL7 B;  2CQ0 A;  4DX5 A;  3CIM A;  2MY7 A;  2L9W A;  3SQG B;  4RR5 A;  5AE2 A;  5LXY A;  5IT0 A;  4HAC A;  2LA6 A;  2C2D A;  2IJN A;  2GIF A;  2KJV A;  2E1M C;  4NI2 A;  2FJD B;  1XAO A;  1HBU A;  4CLP A;  2PSZ A;  3MED A;  4URS A;  4ZOS A;  2KG0 A;  2VDH A;  5H9E K;  2UP1 A;  4DFJ A;  4IRC A;  1BWV A;  2DTJ A;  1JLF A;  3MDF A;  4LSL B;  1PYT A;  2P2C B;  4GMK A;  3GSD A;  5E33 A;  4YQW A;  2CDR B;  4C11 A;  4KHR A;  3SCL E;  2EC0 A;  1TL1 B;  2J9D E;  2WAQ D;  3AGY A;  4J80 A;  1FXD A;  1WKJ A;  4K5S A;  2EW9 A;  2Q66 A;  3HHN B;  2HVI A;  4PXD A;  2UXD F;  3OVS A;  1SH3 A;  5KOW A;  9ATC B;  1VMB A;  1QJH A;  5ETQ A;  5DRK A;  1SV5 A;  3G71 S;  4BWM A;  1IKY A;  3J7A 1;  1VK3 A;  1U0H B;  4WTY A;  4NXM F;  1QM9 A;  4DN0 A;  3WIV A;  3X1L B;  1TL4 A;  1X31 C;  4UOG A;  1KOO A;  1SI9 A;  2Z57 B;  4NCA A;  1HKA A;  3CDU A;  2HHQ A;  2E5G A;  3W9J A;  5DS7 A;  4ELU A;  3MCO A;  3LGH A;  1ZM4 A;  3GIR A;  5J2P A;  2MQM A;  2AV5 A;  3CJR A;  4J9K A;  3ENW A;  4Y00 A;  3BJY A;  4NCB A;  1F9E B;  1IBC B;  4K4T A;  4KV8 A;  2JRR A;  1HWJ A;  2HBQ B;  5THW A;  5FLX U;  2L41 A;  2HQF A;  3R9L A;  4LJM A;  1GXL A;  1H7W A;  1RTJ B;  2AEJ A;  2OPQ B;  2QGF B;  4IR9 A;  3MCN A;  3NMR A;  5G4D A;  2GNK A;  2OPS B;  5BYQ A;  5F3Z A;  3TA1 A;  2ATL A;  1IM4 A;  1SUQ B;  3SCK E;  4YB1 P;  4WP3 A;  2VPZ B;  3P5B P;  3UO0 A;  4FZV A;  4P74 A;  5IXU A;  4H4K A;  5A8W B;  1OJ4 A;  3S6E A;  1N32 J;  2CQ2 A;  3KG0 A;  1HPZ A;  2OEM A;  2DD8 S;  4OI3 A;  2WVE A;  4J9M A;  3UD3 P;  2DPJ A;  3AOD A;  2GS8 A;  2K7J A;  2DH9 A;  1S1W B;  1PGZ A;  1YRT A;  4LF5 J;  3VQS A;  4TNO A;  3K8V A;  5HLF B;  1S48 A;  2RB7 A;  1YLX A;  4PXB A;  2MQQ A;  4O4R A;  3FK4 A;  4OYI A;  3H5Y A;  4RLE A;  1GAO A;  3PHE A;  1U48 A;  2VA3 A;  4LF4 J;  2VOP A;  1IR1 A;  3BB5 A;  2UUA F;  1LFP A;  1OPZ A;  2RF2 B;  4UST A;  3AOB A;  3IRX B;  3ILL A;  3LUY A;  1T94 A;  2CPE A;  2YKO A;  3LPY A;  3AKO B;  3R5G A;  4Z37 A;  5I3Q A;  5A8W A;  4A8K A;  3ISN C;  2RQ4 A;  3M32 A;  3NEK A;  4OI2 A;  4ZCK A;  4QW9 A;  5H9E J;  4B9L A;  3UDL A;  3US5 A;  3H5U A;  5KTQ A;  1HR0 F;  5GAH U;  3QSY B;  2JEJ A;  4V19 X;  4P7T A;  3MEK A;  4B9V A;  2GQQ A;  3GYX B;  4QIF A;  1WF1 A;  2FJW A;  3KK2 B;  3HSJ A;  1WOO A;  3CD0 A;  1JK9 B;  1TUG B;  5M2P A;  2AGP A;  4ZVF A;  2IA0 A;  2OPR B;  4RKU C;  3IRX A;  4QBU A;  1F1B B;  3AGX A;  1S9E B;  3HDS A;  5F8M A;  3T1A A;  1T05 B;  1GX5 A;  4IFY B;  1Q86 T;  1HAR A;  3V6K A;  2KVQ E;  2HFO A;  3MM6 A;  1N52 B;  2MZQ A;  2HS4 A;  1SCJ B;  5C24 B;  1FNO A;  3BS9 A;  3OVB A;  1OQ6 A;  2FVQ A;  1YHQ S;  3EXC X;  2VKZ G;  2FZG B;  2V34 A;  2XG8 A;  1WAC A;  3EE3 A;  3K2Y A;  3N4W A;  2DT9 A;  3TRG A;  1K1S A;  1U4B A;  3Q8R B;  2PA8 D;  3KNG A;  4E0D A;  1N33 J;  1Q8L A;  2ZC3 A;  2JVR A;  4O3S A;  2AHO B;  3R27 A;  4BLG A;  3R2C J;  3M6X A;  5A8K A;  3K8W A;  1IXK A;  1XEZ A;  3KLI B;  1TTH B;  3KUG A;  3MM8 B;  2FVP A;  3PYG A;  1C1C B;  3RR7 A;  1XER A;  2DJW A;  1UKU A;  3MEE B;  5ETS A;  3QAT A;  4AXI A;  2QEX S;  2HQC A;  5KFX A;  4RJV A;  5K9F A;  4ETX A;  5F3T A;  1NSQ A;  1IM6 A;  1URR A;  3DLK B;  5F0U A;  4EBE A;  1BQM B;  1KLM A;  1QTN B;  2HND A;  4RNO A;  2NRE A;  2KFN A;  1FFS B;  2FTR A;  3UCZ P;  1Z2L A;  2J0Q D;  4X4R A;  1CUL B;  2XMK A;  4JV5 F;  4OV1 A;  2DEJ A;  1V6H A;  2IC3 B;  1X8D A;  1CS4 B;  3A3O B;  1R7I A;  4MIW A;  3HZG A;  1UPM B;  4CRJ A;  1KSP A;  4PUO B;  2G2Y A;  1IKV B;  4U7U K;  3K7R A;  1ZTT A;  3IS9 B;  4CIO A;  2VQF J;  3M8W A;  4I6A A;  3U1N A;  2N7C A;  3HT3 A;  2GVZ A;  1VBY A;  1YBT A;  3EUN A;  4H4K C;  1GK8 A;  4HTI A;  1KLM B;  3MAH A;  2LVW A;  4KGV B;  3PEH A;  1VQN S;  5J2M A;  3R1L A;  2DEI A;  5KG7 A;  3GTY X;  1V9O A;  2WOM B;  1QDU B;  2JFD A;  2HHT A;  2H4W B;  1VC5 A;  2GGP A;  4PG7 A;  4A8S A;  3I31 A;  2AZ3 A;  2Y3Y A;  2DR8 A;  1SBR A;  5KFY A;  1VRQ C;  3CT9 A;  5LM7 E;  5HRO A;  2HEK A;  1H3D A;  2CZ4 A;  3POT A;  1NH8 A;  3R7S B;  2KL8 A;  3I38 A;  3KWM A;  1NJI T;  1L5U A;  1XMQ J;  1TK5 A;  5HMW A;  1FWL A;  1FHT A;  1FKP B;  2GO9 A;  3ITH A;  2CVE A;  2FLO A;  3G96 A;  1HNV B;  1LKZ A;  4IFY A;  4Y28 C;  3SYZ A;  3IM8 A;  2MB0 B;  2JHE A;  2AWZ A;  1RT4 A;  1TKZ A;  1QD1 A;  1UP1 A;  1XBW A;  1R31 A;  4MK7 A;  4Y3C A;  4JBC A;  4O0I A;  5ETR A;  4LF6 F;  3K5N A;  1H74 A;  3W7B A;  2VPY B;  4ZN1 A;  4LSN A;  4B3M F;  2HZC A;  2QSW A;  3GR0 A;  1SH0 A;  2UV8 G;  3M8R A;  4USK A;  1OQ3 A;  4WZQ A;  4DPU A;  1VIO A;  2OLW A;  4O3P A;  1CJV B;  1M5S A;  5IV3 A;  3TZY A;  2VPW B;  2X3D A;  4Q7A A;  3OVA A;  2PFF B;  2RAQ A;  2B51 A;  4UF4 A;  1EHW A;  5E0O A;  4OHX A;  4Q2M A;  4N76 A;  2YQ0 A;  2R42 A;  3DFE A;  1UWB B;  3I87 A;  4QWC A;  1S57 A;  2UVU A;  2ACY A;  5J1N A;  3RZA A;  4KGM A;  4ZCM A;  2KXF A;  3EZO A;  4KKO A;  4M8L A;  2EG2 A;  1RLD A;  3IBC B;  2GJF A;  3T1Y F;  2AJ4 A;  2DNQ A;  1D9A A;  5KFK A;  1W25 A;  1HQ2 A;  1NJW A;  2RS8 A;  1WDD A;  3OR1 A;  4J7C A;  4DL0 C;  1QSL A;  1NEE A;  1WEY A;  2QLD A;  4E2F B;  5LL6 d;  1Y00 A;  3C19 A;  2VQE F;  4RW6 A;  5J2Q A;  1ZS6 A;  5J2P B;  2CPX A;  2JRS A;  5ADZ A;  1S97 A;  1HBM B;  4DV0 F;  2DR7 A;  4OYO A;  3FSX A;  4F4K A;  5GVQ A;  3CTR A;  5IZH A;  1YJT A;  1RA6 A;  3Q8V A;  1N36 F;  3EDQ B;  3TUJ C;  1T8E A;  1G2E A;  1CEZ A;  2VON A;  1NPR A;  3L95 X;  4C0O C;  3BGR A;  4X4Q A;  1Y5L B;  4A8M P;  3ZZT A;  2DIV A;  2WW8 A;  1QVF R;  4X84 A;  4F02 A;  2H4Y B;  3GJR B;  1RP5 A;  3CCZ A;  3RW7 A;  4J9O A;  3QGI A;  5CAA A;  5DG9 A;  3KG1 A;  2NXN A;  4KH0 B;  1M90 T;  1B3T A;  3SDE A;  4K0K J;  4NMX A;  4DUT A;  4C98 A;  3GZ7 A;  2EKN A;  1FNM A;  4LFA J;  2YKQ A;  2UUC F;  4FKY A;  1S1U B;  3KDO A;  4OX9 F;  3D6M B;  2RE1 A;  3GFH A;  1TKD A;  1NK0 A;  1U8S A;  2RJZ A;  5L1L A;  2ZOM A;  3ILO A;  1TVR B;  3BDE A;  3MMB B;  4KAI A;  4MKY A;  1PJ5 A;  4OYM A;  1QUP A;  3FZ2 A;  4OLO A;  2E9T A;  1DHM A;  2GIR A;  1G7C B;  1FXR A;  2ODX A;  1O0P A;  3MCM A;  4V1A k;  2JJ4 D;  2VBW A;  1Y0H A;  3W2W A;  2QLJ B;  1MG7 A;  4CLS A;  4KFB B;  4EZ6 A;  3H42 A;  5D0G A;  2OAU A;  2YWH A;  1WWH A;  4ZLP A;  5K20 B;  3BSA A;  2BAB A;  3DOK B;  1RU2 A;  2E1R A;  3OFH A;  4MIB A;  2BOP A;  1KLN A;  5D0R A;  1LOU A;  5B7W A;  2GHW A;  2VG6 B;  3AD9 C;  4FNH A;  4RWX A;  1F2G A;  4ED0 A;  4EEY A;  4CWB A;  2HRT A;  3W61 A;  3J81 U;  4J90 A;  3W8G A;  4B3R F;  3TAP A;  1FVS A;  2RVJ A;  2GMJ A;  2P6T A;  5CD4 A;  3M1V B;  1T9V A;  4CM2 A;  4X65 J;  2XHW A;  2H5E A;  5B0C A;  2EEY A;  2J9E A;  4R8U A;  2JC0 A;  3OHB A;  4I67 A;  3K0J A;  4CYU B;  4R5P B;  2ZJQ Q;  3JXO A;  4YUD A;  1D0E A;  3X3U A;  1P27 B;  1RAG B;  4PKD B;  3HFZ B;  4DPO A;  2CRL A;  3RTV A;  4M95 A;  1H72 C;  1WTF A;  3D4J A;  3MUT P;  5EX3 A;  2J9D A;  1JJ4 A;  4LRF A;  2DNM A;  2N3L A;  2IHR 1;  3AXM A;  4W98 A;  1LEO A;  3ISZ A;  3O2I A;  1KTV A;  2W9B B;  2ZKT A;  4YR3 A;  3HUL A;  2XEX A;  2FIU A;  3H98 A;  3AQO A;  2HQ3 A;  1WC5 A;  5KFH A;  4EFA C;  4N8N A;  4L3N A;  1MRO B;  3DXS X;  4RNH A;  1UJ6 A;  2V50 A;  4BBY A;  1TL3 A;  4FKX A;  4MH8 A;  4ZVQ B;  1RSC A;  2J8A A;  2K3K A;  2V69 A;  4P2M A;  3C14 B;  4F4Z A;  3FBE A;  2BRK A;  3NL0 A;  1U2F A;  3OFG A;  4ELV A;  2W2P P;  4OHW A;  3GQC A;  3ET6 A;  3UN5 A;  1QAY A;  5E3A A;  2JEG A;  2YKA A;  2UUA J;  2D3Z A;  3W5X A;  3V81 A;  4KR0 B;  3W2V B;  2ZUG A;  1S6P A;  1GMU A;  5ETT A;  2L48 A;  3KHL A;  4DBQ A;  3PIO Q;  5IOL A;  2DNG A;  2HFN A;  4B17 A;  5BR8 J;  2VKR A;  1RZM A;  4WFX A;  3C3L A;  1TL3 B;  2A1B A;  3LP0 B;  3BQ2 A;  2RF2 A;  1EJ7 L;  2HHH J;  1PJ6 A;  1N32 F;  3FQL A;  2IAJ A;  4F4W A;  4LR8 A;  3PKY A;  3OFF A;  2WOM A;  2CUY A;  1UPP A;  4X64 J;  3TAM B;  1M1G A;  2CPI A;  4C8N A;  4YHH F;  3EYZ A;  1N36 J;  4B9U A;  4GO5 X;  4IKA A;  1MN9 A;  1X5T A;  3PRB A;  2E5L J;  3LP1 A;  3HVW A;  4GKJ J;  2YNG B;  2A3J A;  1UEU A;  1G6B A;  2D9P A;  2GO8 A;  2OMO A;  4QWD A;  3C5X C;  1KNZ A;  1IQT A;  3FJ2 A;  5KFE A;  2KM8 B;  3ZZP A;  1RT1 A;  2HAF A;  1GTH A;  1E6Y B;  1SC3 B;  4IH6 A;  4L74 A;  4L75 A;  2BJ8 A;  1ULR A;  3SBM A;  3TZW A;  4F0K A;  3TO8 A;  4DV5 F;  3ITH B;  1S77 D;  1XWL A;  3AB2 B;  2ZIT A;  1GXT A;  3QGH A;  4Y2M A;  1T05 A;  2BE9 B;  1KHV A;  3LGM A;  2GX8 A;  1AT1 B;  1VGY A;  4P6Q A;  4RZR A;  4USJ C;  2BAN A;  2R7Q A;  3EGZ A;  1Q95 G;  3NNA A;  5A0Y A;  1FNX H;  4DV0 J;  4YN3 B;  1FE0 A;  4Z7C A;  2CPD A;  2Y0S D;  3HD1 A;  1LXJ A;  3MM5 B;  4DFP A;  2C2R A;  2QL5 B;  3H25 A;  2DR6 A;  1VQP S;  2HVE A;  4EU0 A;  2GV1 A;  1EQM A;  3GLJ A;  1Y9O A;  1W26 A;  2BE2 B;  5LXR A;  2GZO A;  5HAN A;  3CCW A;  2DR5 A;  1NHU A;  1Y11 A;  2QV6 A;  1HBN B;  2ZBI A;  1RAE B;  3DRS A;  4IFV A;  4NPO A;  2DNP A;  2CJX B;  2WON B;  3LP2 B;  1S0N A;  1J5E J;  1M1H A;  1RTD B;  2MDA A;  1TZ0 A;  4NLP A;  2JDJ A;  4RW7 B;  4JV2 A;  3J81 j;  1RT2 B;  4WTO B;  2W4C A;  2AEF A;  2AT1 B;  4B3O A;  1DTQ B;  3GCX P;  3IGN A;  2N82 B;  4JI2 J;  1CJU A;  2LLZ A;  1N6Q A;  1U1N A;  2XI2 A;  5AJ3 F;  3LAM A;  2RHQ B;  3C6E C;  1H73 A;  3GSI A;  5KG0 A;  2KM8 C;  3PCO B;  5HP1 A;  4ICL A;  3VAG A;  3G82 B;  4DL7 A;  1D8Y A;  2ZEJ A;  3SCJ E;  2GAH C;  1IKW B;  3D1H A;  3RB4 A;  1UMJ A;  2OJ3 A;  2F4F A;  1HBN A;  2WSF C;  3BM7 A;  4R25 A;  5LMU F;  1JNZ B;  4LBI A;  1VQ9 S;  1QSS A;  5HQL A;  3ISN D;  2DNL A;  4H4M B;  3BGR B;  4TY8 A;  1WEX A;  2XBP A;  5KAK A;  2FLN A;  1CPZ A;  2MZJ A;  3D6T B;  3P3D A;  2CPZ A;  4OYA A;  2B9X A;  4DL3 A;  3PJW A;  3HSZ A;  5ETK A;  2P5V A;  2BRL A;  3PX6 A;  2VG5 A;  1PBU A;  1VRT B;  2WVC A;  5CYM B;  5C42 A;  2JEI A;  2BAC A;  2HFU A;  3MEG A;  4LVN P;  2ZM6 F;  3IM9 A;  5AE1 A;  4FF3 A;  5GME A;  1U02 A;  2GVD B;  5G0R A;  4YR0 A;  4M5J A;  2PN6 A;  2KKH A;  4CI0 B;  5K8M A;  4U8V A;  5HL7 Q;  4DL4 A;  5HK4 A;  1P1L A;  1Q8B A;  1NRK A;  1JNR B;  2WB1 D;  2CJB A;  2CJA A;  3A8I A;  3BH6 B;  3CDB A;  3GJS B;  5KFT A;  3BN4 A;  2GMH A;  1ZZN A;  3G6Y A;  2IRU A;  3JQM A;  4DG1 A;  2PI5 A;  4DFM A;  2M5Y A;  5CYM A;  3N6L A;  2EK1 A;  5B08 A;  2PC6 A;  5JMN A;  3MOJ B;  3MZI A;  2UVR A;  3MWB A;  2CAJ A;  4YR2 A;  1FD2 A;  4ZPB A;  3QRR A;  2JC1 A;  1IBK J;  2Y1L B;  1RWV B;  1XQI A;  4O0N A;  3N6M A;  1CLF A;  5F8N A;  2HLU A;  3HVR A;  2RDJ A;  3IWN C;  1Q0N A;  1YKW A;  5KOX A;  5B09 A;  3KLV A;  2B56 A;  1Q4R A;  4FVM A;  4B9N A;  2V2Z A;  4F4A A;  2D3O 1;  3P49 B;  1K0V A;  2F65 A;  2GAG C;  3QFW A;  3UQS A;  5F8I A;  3HX9 A;  2K1R B;  1B4S A;  2VJV A;  5BJR A;  3VAI A;  1JB0 C;  4AL7 A;  1S1T A;  5J1E A;  4R5P A;  4LF5 F;  2AYE A;  3V6D A;  2RRN A;  4YY3 F;  1QLN A;  1X0F A;  2CZV C;  2BJ9 A;  4MJK A;  4ECQ A;  3DLE A;  2XI3 A;  1HPZ B;  2ZHO A;  5IC6 B;  3G6V A;  2FHJ A;  1HBM A;  1KON A;  4DZD A;  4LF1 A;  3M8Y A;  2P6S A;  4OJG A;  3P5T L;  3NBP B;  4BC9 A;  2ZHB A;  4J91 A;  3JSM B;  5GAG I;  3LA0 A;  4ZIV A;  3R5A A;  3TWZ A;  2VB6 A;  1JLG B;  3ZTP A;  1X5S A;  5DDO C;  4RNN A;  1NKE A;  1XNQ J;  2RT3 A;  2MHN A;  2HS0 A;  1QTM A;  2B8P A;  1X4H A;  2R7W A;  4ZVP B;  4ZCL A;  3HJV A;  3Q8Y A;  4TKT A;  2DGV A;  4KQZ A;  5KFM A;  2GML A;  1WOP A;  1HNI B;  1TFY A;  3TOQ A;  4JI7 F;  4ID5 A;  4DV5 J;  1NJY A;  2Z2L A;  3QRP A;  2YKN A;  3KLE B;  4J9S A;  1S12 A;  1RI7 A;  1ZBT A;  1MMN A;  1C4A A;  1SQF A;  1WG1 A;  4ALZ A;  4WII A;  3CC7 S;  4OZL A;  2IM1 A;  1LWE A;  4ECW A;  2GFF A;  4QYZ K;  2B6A A;  3MPW A;  4ZKA A;  1K73 T;  1GNK A;  5HAT A;  3D5M A;  3DMJ B;  4ECZ A;  2XS7 A;  1HR0 J;  4B9S A;  4IRD A;  2Y9H A;  1FWK A;  2E1P A;  4JI2 F;  2ZUA A;  2B43 A;  2CPY A;  3LP0 A;  4WFB Q;  3BSN A;  2OPR A;  2XB2 D;  2BVZ A;  5B0A A;  2PII A;  1FTC A;  2B9W A;  3VAL A;  4KE5 A;  1T9Y A;  1FK9 B;  4BS2 A;  2XMV A;  1R0C B;  4KT0 C;  1S9F A;  4DR6 F;  1Q81 T;  2XMW A;  4X2B A;  1IJF B;  4XDD A;  3QQC D;  4Q0B B;  3EGW B;  2YTC A;  4Q8F A;  2QZ8 A;  3HHL C;  2OPP A;  3EMT A;  2EG1 A;  3M05 A;  1VOM A;  2QN6 B;  3H4D A;  2KT2 A;  1T11 A;  3FEX B;  2EWH A;  5KFS A;  1IQZ A;  1E6V A;  1UEK A;  4CLZ A;  3K5M A;  1X9S A;  4DPY A;  2V8D A;  3C15 B;  1B0T A;  3OTB A;  4NZ0 A;  4JI8 F;  3SZ2 A;  4KHP F;  2PEH A;  4JYA F;  2WRM A;  3RG6 A;  3UVJ A;  1RT3 B;  2EI5 A;  3ZTQ A;  4GKK J;  1NZA A;  1ELO A;  2C2E A;  3I9Z A;  3FBB A;  3KJV A;  5HMZ A;  3HT0 A;  1R43 A;  1RQ0 A;  2DRD A;  4XPE A;  4ZP9 A;  1JXL A;  3CME S;  1T9T A;  4DF8 A;  3E8O A;  2QLB B;  2DXE A;  5A0Y B;  2KT3 A;  4ZVE A;  1IBL J;  1S9G A;  3DOM A;  3UNG C;  1VR6 A;  3M8Z A;  2DHX A;  3QGP A;  3HHD A;  3FMW A;  3MM5 A;  2VHG A;  4HVZ A;  3KLH A;  4MKV A;  3J7Y I;  1F9H A;  4MT1 A;  3QWP A;  5KFO A;  5F8G A;  2GC8 A;  4GRS A;  2F40 A;  4OZ5 A;  2OFG X;  4DN9 A;  3V4I A;  2LXU A;  3BO4 A;  2L08 A;  2ZH6 A;  3BYP A;  3KJV B;  2R4F A;  1SB6 A;  3E3X A;  1RUS A;  2Q43 A;  2WBM A;  2WON A;  1XMO J;  3P96 A;  5D4L A;  4ZCI A;  4YHH J;  2A6M A;  3NMA A;  2LKZ A;  4LF8 F;  4USM A;  1X4E A;  1PIE A;  2OFH X;  4YB6 A;  1N5Y B;  1X5O A;  3H8Y A;  4F3M A;  2UUB J;  1HL6 A;  4LRC A;  3OL9 A;  1HW8 A;  4JV1 A;  4FS1 A;  3DXB A;  3R6G B;  2CQB A;  1U6B A;  1N5Q A;  2CIM A;  2BBE A;  2CJQ A;  2RQM A;  2VL1 A;  1K0T A;  3GP9 A;  4ICL B;  2FJB B;  4TU7 A;  2PMZ D;  2IVY A;  2Z56 B;  4C8L A;  1ROF A;  1U2C A;  1T9X A;  3FRZ A;  4WYW A;  1UZH A;  4MIA A;  1WEZ A;  4EWT A;  4C8Z A;  3EPG A;  2Q6B A;  4DX8 H;  2LCW A;  2IAJ B;  4H4M A;  4TY8 B;  3BYR A;  1NAQ A;  3FBF A;  3KLF B;  1JX4 A;  4JI6 F;  4QWE A;  1JKH B;  1K9M T;  4Z7Y A;  4K4Y A;  1U1P A;  2AJ1 A;  3ENQ A;  3DRP B;  2MLY A;  2HLT A;  4NYP A;  2XGP A;  1RTI A;  1WSR A;  2VFR A;  1VIX A;  3MEG B;  3PFO A;  3DRX A;  4G65 A;  4LFA F;  4ES3 A;  1FJG J;  1KWM A;  4I0W A;  1X4F A;  4ED8 A;  3MR7 A;  3NCQ A;  3FZB A;  5SZT A;  1RT1 B;  3NAI A;  2GVD A;  1JJC B;  1YJ9 S;  3P6Y C;  1JMT A;  4RUB A;  2W1B A;  2HUR A;  1WI6 A;  2HBR B;  4DR3 J;  4WKR A;  2V2V A;  3JQK A;  4IOA Q;  1U0S A;  1UWB A;  5A6P A;  2OD4 A;  2ZH3 A;  3C16 A;  4IRK A;  2DNK A;  3GFX A;  5LT5 A;  1P9Q C;  3CW2 C;  3HFV A;  1U6Z A;  3M7V A;  5D4P A;  3D28 A;  3QWU A;  3W8P A;  5KFB A;  3LTO A;  3A3P B;  2UXC F;  2MJN A;  3B6B A;  3QID A;  5KFC A;  3ELH A;  3LQV A;  2KU7 A;  2DNY A;  3DDK A;  3QT8 A;  4RO0 A;  3VV2 B;  5AXM A;  5DG8 A;  1IBM J;  4OZ2 A;  1Q82 T;  1AXQ A;  2CQG A;  3DOL A;  1N34 F;  3ETM A;  4RW6 B;  3CC4 S;  2PDA A;  4QWB A;  2OGU A;  4NLY A;  4CT8 A;  4KBI A;  1KC8 T;  2H51 B;  1SJF A;  5IT9 U;  1SC1 B;  3NGD A;  5ITH A;  1W2I A;  1FRL A;  2YKP A;  2EFN A;  4IOB A;  2IFX A;  2G0I A;  2MZR A;  1SV5 B;  5T7L A;  3T6J A;  3TX8 A;  3ZXW A;  1H38 A;  4C9D A;  3KUH A;  2EFV A;  2MHE A;  4JI0 J;  2CNO B;  2MSS A;  5JVH Q;  3TX0 A;  1VQ4 S;  1AA1 B;  4Q43 A;  3KK3 B;  4PG8 A;  4QU6 A;  2XMU A;  2NUH A;  4WF9 Q;  5GAG U;  2LQ8 A;  2QRR A;  4F7V A;  2WTF A;  2C2N A;  5LJ3 Y;  3Q86 A;  2C3P A;  1H2V Z;  4WE1 B;  2DNN A;  3W60 A;  5L1I A;  2M8D B;  1RHM B;  1KVJ A;  4DUZ J;  5FJ4 A;  1JJH A;  2MKI A;  2HKE A;  1IKW A;  3THV A;  5DGB A;  1HI8 A;  2JZ8 A;  2XO6 A;  2AYG A;  4K0K F;  1NHK L;  4ZVG A;  1S79 A;  3DGP A;  3GG0 A;  4P7V A;  3MMB A;  4IUF A;  4DR6 J;  5B0E A;  1SH2 A;  1S5Z A;  4JB8 B;  3R97 A;  2NXU A;  5IV4 A;  4F3Q A;  1CQM A;  3BR9 A;  4DS5 A;  2DYA A;  4C4W A;  4OI4 A;  1QAJ A;  1LWC A;  2FGO A;  1V3S A;  3CVK A;  2BQR A;  2V4Q A;  1R8P A;  1WD6 A;  2X1F A;  1MMD A;  3MMJ A;  1SJ1 A;  3IAM 9;  5MAO A;  4A46 A;  2J0X A;  2QO3 A;  1TK8 A;  5CXT A;  1FFW B;  3IXQ A;  1XNQ F;  4GKJ F;  2XS2 A;  1LWE B;  1FA0 A;  2LU1 A;  3ILI A;  4LFC J;  4B3T F;  5A2Q Y;  4I1T A;  2HNZ A;  3G6E S;  2E44 A;  4K4U A;  1N5V A;  3MTK A;  4Y0F A;  4C8M A;  2RSQ A;  6AT1 B;  2E9Z A;  2FY1 A;  3M8S A;  3UR0 A;  4PQU B;  2OSR A;  1V5I B;  2QMW A;  4DI6 A;  3MEC A;  4M5G A;  5KG1 A;  3MR3 A;  1WC1 A;  1MNE A;  1V3Z A;  2F9J A;  5KFW A;  4Q5V A;  4RU9 A;  4FNI A;  2AX1 A;  4A8O A;  3M9O B;  4DR5 F;  1FK9 A;  1P6T A;  1T95 A;  2LP4 A;  5KT7 A;  3BQ1 A;  2W9A A;  4J9L A;  1VK8 A;  3MM7 A;  3E51 A;  1U1O A;  4DUZ F;  2N4D A;  4JI1 F;  3JS9 A;  4FPI A;  3Q89 A;  3T9Z A;  3J7Y U;  1RDR A;  2XUL A;  3BSC A;  3GR1 A;  4QJV A;  4CH7 A;  3OBI A;  2KI2 A;  3LPE A;  4RL1 A;  2FVS A;  2JOQ A;  2J6T A;  3KMQ A;  1FRH A;  1TKT A;  3EJM A;  4ZA1 A;  1EP4 A;  1UFL A;  2CG4 A;  2K7K A;  2F8M A;  5ETV A;  3CMA S;  4K5R A;  1CC8 A;  2HS3 A;  1S6Q B;  3PHT A;  2MGZ B;  3B78 A;  1S1T B;  3ZNU A;  1OO0 B;  1KKH A;  3HKW A;  3OXF A;  1HI1 A;  3B54 A;  4HI2 A;  3BPS P;  4TLQ A;  1U49 A;  4A8F A;  2CJY B;  3DCA A;  2R7S A;  1S7H A;  3VQT A;  1EAR A;  1KQK A;  2CKW A;  2CJ9 A;  1VLY A;  4QIV A;  4WXW A;  4OHZ A;  4G6V B;  5CAB A;  4BDP A;  2IM2 A;  3NOC A;  4J9V A;  4L3K A;  4DV2 J;  5DDQ C;  4TQR A;  1EQ0 A;  4ZMM A;  3H0P A;  2B9Y A;  3AD8 C;  1VQS A;  3W2V A;  4LFB J;  3G86 A;  4F26 A;  1N8R T;  1F60 B;  3MPU B;  4K2X A;  5D78 A;  3W9H A;  1YJW S;  1KEK A;  2V9K A;  4K50 A;  4NCG B;  3OHA A;  3NGK A;  3PV8 A;  3HKZ D;  3UDV A;  1HD1 A;  2ACM A;  1S1X A;  5F8J A;  1BQM A;  2HND B;  3N0V A;  4WFZ A;  1HMV A;  1RLC L;  4DR2 J;  3PTW A;  1VQ7 S;  2F8E X;  2DR9 A;  3DLH A;  1BE4 A;  1VCT A;  1N48 A;  2FJV A;  1JLC A;  1CUL A;  4CO2 A;  4CNY A;  3PIP Q;  4PXC A;  3CMQ A;  3IR6 B;  3HP6 A;  3PJX A;  2R2U A;  1FEH A;  3UCU P;  3IRW P;  1ZET A;  1MU2 B;  1S10 A;  3KHH A;  2PT0 A;  3NKY A;  3LAL A;  2V2Q A;  2W25 A;  1IWA A;  1UVI A;  1AB8 A;  1LK7 A;  5K5M A;  4JI3 F;  4ZLN A;  1WKL A;  3CGI A;  4HI1 A;  2HPU A;  4RW8 A;  3B82 A;  4P2X A;  1DRZ A;  4JV5 J;  3H2L A;  2ZBQ A;  3VAK A;  1PC5 A;  4EZ9 A;  2MQ8 A;  2EKY A;  4I4B A;  1JLB A;  1OIA A;  3CCT A;  2VBX A;  2HVZ A;  1KBR A;  5IQQ A;  2BKO A;  1K8A T;  2BAN B;  1UVM A;  1Y10 A;  2NS1 B;  3A3N B;  4PEO A;  4ZPW R;  5KFG A;  1JJ2 R;  2W2N P;  1HW9 A;  4LF2 A;  3GII A;  1I51 B;  2VOO A;  2AKW B;  2DY1 A;  1LWF A;  1MU2 A;  2MST A;  4X62 J;  2DCL A;  4UY8 T;  4AFF A;  4IO9 Q;  4ILL A;  2ZD1 B;  4O44 A;  3BQ0 A;  4X4U A;  5A6W A;  1WF0 A;  2U2F A;  2W7O A;  3K89 A;  4IDK B;  4C3L A;  2QG9 B;  3T5H A;  4LSL A;  2XY7 A;  2P9C A;  1DZ5 A;  4QZV B;  2RML A;  2PFD A;  2HHS A;  5E5N A;  1WC0 A;  2J7K A;  2ZH2 A;  3ULH A;  1TL1 A;  1CJK B;  1RKI A;  1U1L A;  1PG5 B;  4C7Q A;  4YS2 A;  2UZA A;  3W5Z A;  3HCX A;  1FI4 A;  2LYV A;  2VH7 A;  2FGC A;  4FF2 A;  3NS7 B;  4HDH A;  4USI A;  1KFS A;  4RW4 B;  1AFJ A;  1S99 A;  4LRA A;  4U7C A;  3I56 S;  2KTQ A;  1P8G A;  1YVF A;  1FO1 A;  1O5J A;  4KC5 A;  4C2M A;  1GMW D;  1F0X A;  2E29 A;  1FDA A;  2KN4 A;  4U96 A;  1C0U B;  2QLX A;  4W4M A;  3U02 A;  2DO0 A;  1LW0 B;  2YY3 A;  3AOC A;  3LO3 A;  4B9M A;  3UDC A;  4NLD A;  2DGW A;  2L9D A;  3V4I B;  1DQ8 A;  1HWI A;  3RRK A;  5HP1 B;  1SKU B;  2EPI A;  2Q6C A;  3G82 A;  1V3R A;  1F2H A;  1CJT B;  4RWW A;  1GMW A;  1L3K A;  2Y1R I;  5LSR A;  3KJQ B;  3ADA C;  4NLG A;  4ES2 A;  4FF1 A;  3Q22 A;  2FLL A;  1M5H A;  4IOC Q;  3FVY A;  3MM9 A;  4GVB B;  3QJL A;  4AYB D;  5DDR C;  1UW4 A;  3NGR A;  1FRJ A;  3OR1 B;  4ITS A;  1ZM2 A;  2YQ3 A;  1U45 A;  2IRX A;  3TZZ A;  2JVO A;  1T7P A;  4CO4 A;  2VQE J;  2HZA A;  2CQD A;  2HRY A;  4NLQ A;  5B0F A;  3FSI A;  2P9G A;  4K4S A;  4U6P A;  5J2Q B;  2DGS A;  2Z58 B;  2ROG A;  4Y34 A;  4J5O A;  4P9S A;  2V6A A;  3CJT A;  2RUG A;  3FGV A;  4HT5 A;  4ZVT B;  3M2U A;  3TP2 A;  3AJ1 A;  2DY9 A;  4EI2 A;  5G0R B;  2AD9 A;  2FJX A;  1XNR J;  3N01 A;  2DHG A;  2GIQ A;  3UDE A;  4DSJ A;  1T03 A;  3K5L A;  1TFW A;  1YWX A;  4ECU A;  3WX8 A;  4Y2A A;  2H3E B;  2P8I A;  1EZZ B;  3IFE A;  3H40 A;  5T14 A;  3OUY B;  4RUA A;  2ROP A;  1PYS B;  3IC1 A;  1S76 D;  2OEK A;  4K8R A;  2UXB F;  2MKK A;  3V6H A;  1M5K C;  5GAH I;  1JLF B;  4Y2K A;  4UOH A;  2EFQ A;  4AL6 A;  2V67 A;  1PAU B;  2K06 A;  3OD2 A;  4KHP J;  1RAO A;  3LAK A;  4AE5 A;  1RXO B;  1T3N A;  1HQU A;  4NLT A;  2XMA A;  4HEA 9;  4DCO B;  3KLG B;  3JAM Y;  4OIX A;  2M7S A;  1IKY B;  2BKP A;  2LFV A;  1HNW F;  3ZFV A;  1YRX A;  4ZP6 A;  3V6D B;  3ENV A;  5KFD A;  3BR8 A;  1U1M A;  2O5D A;  2IBK A;  4M5L A;  5F41 A;  5D15 A;  4KO0 B;  4IH7 A;  1I6J A;  4B9T A;  3QRQ A;  2IMW P;  5J1P A;  4WP9 A;  1PBA A;  3JYT A;  4IG0 A;  2VF3 A;  4C3M A;  2DIU A;  2ZNY A;  2W7P A;  2YBV A;  4R0E A;  1FRM A;  3R8Y A;  3IN5 A;  2YPZ A;  8AT1 B;  3RW6 A;  1EP4 B;  4O3Q A;  3IGV A;  4Y6I A;  5T7L B;  3MFH A;  2JLF A;  3NAH A;  4ECT A;  3MEE A;  3OSP A;  4I6W A;  4QWA A;  4I64 A;  4XK8 C;  4WFY A;  2V2K A;  3QT5 A;  3MUV P;  1EKS A;  1SUQ A;  1FT8 A;  2RQK A;  3ICL A;  4NEZ A;  2YQ1 A;  1XR6 A;  3CJ2 A;  4QPT A;  3NWG A;  3LGN A;  5KFZ A;  4F25 A;  2QA1 A;  3CF5 Q;  3PW0 A;  2I6W A;  2VFV A;  4O3O A;  2XHC A;  1VJQ A;  5F9L A;  1NZ8 A;  2LDY A;  3JQJ A;  4M5M A;  3GV7 B;  2F7V A;  1C3G A;  3E01 B;  3D3C J;  4OYZ A;  2BJD A;  4A4J A;  1NK6 A;  3FMB A;  2B6A B;  2RD5 C;  5HLF A;  3DMJ A;  4G1I A;  3CCR S;  4QIE A;  4G1Q B;  3R5J B;  4OX8 A;  3I4P A;  5IWA F;  2GVZ B;  4ZPV R;  3DN9 A;  1ZYQ A;  1GH8 A;  1TKX B;  1R0A B;  3JSR A;  2JFK A;  1VQ6 S;  2EVZ A;  2HBY B;  3KTQ A;  5J2M B;  3PZP A;  4ED5 A;  2HFZ A;  2FZK B;  3DYA B;  3NCP A;  2W9C B;  2OSQ A;  1FJE B;  2WSC C;  5H9F K;  4DCP B;  4TU8 A;  3R6L B;  1A9N B;  1PAE X;  1YJR A;  2J5A A;  1VS3 A;  1WUU A;  3GJT B;  3AY0 A;  4I7F B;  2POK A;  3RAQ A;  2ZH5 A;  5L1J A;  1SKW A;  3CD5 A;  5LSL A;  3KK2 A;  3VAJ A;  4X4V A;  3PJ9 A;  4OZN A;  5HVG A;  2ZC4 A;  4LFB F;  1T0T V;  2LEB A;  2XZW A;  5EHH A;  2FY8 A;  2DH7 A;  3NXZ A;  4ZP7 A;  2B4U A;  2YNH A;  3H59 A;  1N5S A;  4QPX A;  2M88 A;  3DU5 A;  5KFF A;  1SPB P;  1RT3 A;  3FCH A;  4AQY J;  4C8O A;  1JLB B;  1Q5V A;  2UUW A;  2YXL A;  3I5A A;  3AB4 B;  2NPI A;  3DYA A;  4FYX B;  2W24 A;  3MUR P;  3EGV A;  2CAD A;  5D0E A;  5LJ5 Y;  2E9R X;  2Y8Y A;  3MM7 B;  4HHJ A;  2MJU A;  2QIF A;  4I2Q A;  1U2R A;  1UZD A;  3BH7 B;  3LAN A;  1RT5 B;  1RTH A;  4F67 A;  4W90 B;  1RWM B;  2C2K B;  4EUV A;  1HHQ A;  2V4J B;  4H54 A;  3U1L A;  3KDN A;  4BHQ A;  4V19 J;  2XLK A;  3F41 A;  5AXN A;  3CDW A;  1HD0 A;  1B70 B;  4DV1 J;  1NDL A;  2VOD A;  2VPX B;  3NGS A;  3OT9 A;  1URN A;  2LQJ A;  3FBC A;  2I5J B;  2OTJ S;  1NB7 A;  4X66 F;  5JXS A;  1CC7 A;  3OW2 R;  1NU4 A;  3AHP A;  4J9Q A;  3RAX A;  4ED4 A;  5RUB A;  3KOA A;  2E5H A;  2K2P A;  3C6U A;  5HBM B;  1HNX J;  4L73 A;  1WNE A;  2H54 B;  2JH3 A;  3R1H A;  1Z1Z A;  1VHI A;  1S6U A;  4ED7 A;  2CQ4 A;  2B5J A;  2J7W A;  4H4O A;  2Y1J A;  2G4B A;  3DHX A;  3TI0 A;  2BR0 A;  2AJQ A;  1JLQ B;  5CA5 A;  4WJB A;  3SIP B;  5M2U A;  1B7F A;  3LWM A;  1HHT P;  3KFW X;  3NNC A;  3HHL D;  5DJB A;  1SC6 A;  2JLE A;  3HHL B;  2I5J A;  5EWE A;  5K8O A;  3GB0 A;  3R5B A;  1NME B;  2D3O R;  1YJ7 A;  4KGK A;  2BUN A;  3T41 A;  2BJE A;  3DRS B;  3H7H B;  4IFV B;  1HI0 P;  2C2Z B;  5J2N B;  1UWA A;  2VBZ A;  1FRX A;  7AT1 B;  5JUM A;  2XLJ A;  2RKI A;  1S7I A;  3KMS A;  2HQD A;  3NY0 A;  2YNI B;  4WZM A;  3PYD A;  4LIR A;  4M5I A;  4DJB A;  1RAH B;  1DTQ A;  5CQG A;  2V8H A;  2ZWO A;  1RTI B;  4JI4 J;  5EN1 A;  2WB4 A;  2ZH1 A;  3EX7 B;  2I0X A;  4NRT A;  1Q8I A;  1WOS A;  3R3T A;  4IG3 A;  4PPD A;  3Q2S C;  1LXN A;  2DVI A;  2F5G A;  4OL8 A;  4U8Y A;  4CH1 A;  2W8K A;  4A8Y A;  4ED1 A;  1NBE B;  3A4T A;  4RPF A;  2HYI B;  2BQ3 A;  2FC9 A;  3I9V 9;  1RHR B;  2VG7 B;  1YQH A;  1ARO P;  3HMJ G;  2AJ2 A;  5K14 A;  4HYK A;  1H98 A;  1Z2Z A;  3DM2 B;  4D3H A;  1KQG B;  1JXV A;  4X4T A;  1SJ4 P;  1Q79 A;  5MLC V;  1EET A;  2FHO B;  3IA0 A;  3JTP A;  4FDF A;  2E7V A;  1HA1 A;  3TNV A;  1SL1 A;  1D1U A;  3OUY A;  1LWF B;  3TVK A;  4ELT A;  3MR5 A;  2Y1I A;  3GYG A;  3DOK A;  4A8Q A;  1WEL A;  1RWU A;  4X62 F;  4OI1 A;  4DR7 F;  3HSD A;  2PEB A;  1PO6 A;  5I3P A;  2AJF E;  2OI2 A;  2HWH A;  3QT6 A;  1YBU A;  1HBO A;  3TJ9 A;  3HM9 A;  3ZNJ 1;  4ZLL A;  3IMQ J;  1RAD B;  2MLZ A;  4I68 A;  5L9X A;  2CFX A;  2I1R A;  1SL2 A;  4EO8 A;  1FX2 A;  2QL7 B;  1O6X A;  2G9O A;  4L76 A;  4WIQ A;  4C97 A;  5EDW A;  2NXC A;  2ZOG A;  2H5J B;  5JJB A;  3CO0 P;  3CED A;  2OH2 A;  3VCD A;  2YWK A;  1VDH A;  4WFA Q;  3R7N B;  5AE3 A;  3UR3 C;  4K7Q A;  4HH0 A;  3MGJ A;  3D0I E;  3CUL A;  3Q8U A;  2NYI A;  4HHH A;  1PKU A;  1SJR A;  4HAC B;  2AF6 A;  4X4O A;  4ZPT R;  1REV B;  2DIS A;  3MI7 X;  3MED B;  1AZS A;  2RIJ A;  3EVO A;  4F8R A;  4RNM A;  1IWG A;  2R2T A;  2HNY A;  1VC6 A;  3D0H E;  1XK8 A;  1QY7 A;  4IG0 B;  1A7G E;  4C3K A;  1JIH A;  2C3O A;  5HO4 A;  2XGQ A;  2DBB A;  4Q45 A;  1ZAV A;  5CZV A;  4CLT A;  2B7B B;  1U24 A;  3AD7 C;  2LEP A;  4FYV B;  4IYQ A;  4FP9 A;  2WVD A;  2C22 A;  4FYW B;  4DSI A;  1TMJ A;  3QJP A;  3PM9 A;  2AYM A;  5ETP A;  2FLP A;  1X4A A;  1IR2 A;  4O23 A;  1IN0 A;  4DV6 F;  2DRB A;  4XTT A;  3G6X A;  3D54 A;  4J9N A;  3F73 A;  3FRY A;  3QPI A;  1SL0 A;  3L4B C;  4Y65 A;  5HJX A;  3CC2 S;  3RBX A;  3C66 A;  1VHF A;  4FF4 A;  1EAY C;  4WK3 A;  4JI4 F;  2HVH A;  5H1S V;  4KH1 B;  2B4V A;  1Q5Y A;  2D74 B;  1PC4 A;  4DR5 J;  1S1U A;  1D9F A;  1BHN A;  4LRE A;  1VQY A;  2VA2 A;  1DY3 A;  1RTJ A;  3W5Y A;  4EBD A;  3DKD A;  4WK1 A;  4RUC A;  2KZM A;  2DK2 A;  4CO0 A;  5A8R B;  3DI6 B;  2OPS A;  4XAK A;  2CZ9 A;  5AJ3 J;  2X1A A;  4BWJ A;  1HWL A;  3I55 S;  4DR2 F;  3AOA A;  4LF9 J;  4ATN A;  2IDL A;  1UCN A;  5HQM A;  1KTQ A;  1VQL S;  1UJ4 A;  4QYZ J;  2YPY A;  1LW2 B;  1NHV A;  2LXF A;  4A47 A;  5L39 A;  4NRU A;  4JI5 F;  4ZIT A;  2A2D A;  2IBO A;  1ZA1 B;  3OPK A;  4DCJ B;  4YFU A;  1NM2 A;  3LP1 B;  1BWE A;  1WHX A;  1NH7 A;  4Z2X A;  2M3D A;  2CXE A;  2XYG B;  1B0P A;  2ZOF A;  4RUH A;  2YKM B;  3FC9 A;  4P73 A;  3TZX A;  3MUM P;  4J9R A;  4NL5 A;  2ALZ A;  1M5P C;  1HNZ J;  3DI6 A;  3IAS 9;  4C6A A;  4K4W A;  3KKF A;  4FVC A;  3A8K A;  1WSV A;  5E3R A;  3MD1 A;  4DQI A;  2W7A A;  2YNH B;  2KT5 A;  1Y5N B;  4USW A;  2KRR A;  1Z4U A;  4ILR A;  1S59 A;  2OEJ A;  5C5J A;  4KJI A;  4Q2L A;  4RW9 A;  4N5S A;  4F4Y A;  3J7A N;  1XMB A;  1VBZ A;  5FLX Y;  3PVX A;  4F0H A;  3D66 A;  4BCA A;  2QLF B;  3FDS A;  3NGT A;  4NYO A;  3VTI A;  2LA4 A;  1IKX B;  2R9L A;  5F0W A;  2BKN A;  4DL5 A;  4Q0B A;  2QMU B;  4JUZ A;  3VGT A;  1RAF B;  4OYX A;  4CDI A;  5C25 A;  2HIY A;  2HHU A;  1DUR A;  1FKO B;  1S4F A;  3FCW A;  1DBD A;  4DR4 J;  5HAO A;  3PYE A;  2X3G A;  5ETN A;  4ZJO A;  1UVJ A;  2MQO A;  3BPD A;  2ZBR A;  1MRO A;  1D09 B;  3EWG A;  2YH0 A;  4NCG A;  3TYT A;  2MZT A;  2QL9 B;  2VFU A;  2LQB A;  4OZ3 A;  4RW9 B;  3MM6 B;  5D0H A;  2ZFH A;  3SEO A;  5KFL A;  2H9Z A;  1REG X;  3C14 A;  3NOG A;  4NA3 A;  4NA1 A;  3I0S B;  5LMU J;  2H48 B;  3GON A;  1YJV A;  1RA7 A;  3C8Y A;  2XM3 A;  2DGU A;  4GKK F;  2PMH A;  5C25 B;  2HFV A;  2NSC A;  2F4V J;  4QR0 A;  4URQ U;  3E01 A;  1Q16 B;  4M1K A;  2EFP A;  3U27 A;  3NNH A;  3M2V B;  1XR5 A;  1ZOT A;  3CCQ S;  2HQG A;  1I1G A;  1YJU A;  1RT7 A;  2QA2 A;  5CCM A;  4U7U D;  2MZS A;  4HLB A;  3FKB A;  1YI2 S;  3HVT B;  3BDP A;  1RCO B;  2R7O A;  1WHV A;  1UET A;  1CG2 A;  3DLK A;  3D0G E;  3DRR A;  2UV8 A;  4P2F A;  1N0V C;  3SMZ A;  5KG2 A;  1R0A A;  4DS4 A;  2HHX A;  1UW9 A;  2QMX A;  4IH5 A;  2C3Y A;  2OML A;  3MAA B;  2R7T A;  2CYY A;  4ZJL A;  2YNI A;  3SXL A;  2JNJ A;  2RDD A;  3C46 A;  1M0S A;  4UQT A;  5CCL A;  1FDN A;  1AUD A;  1N56 A;  2C42 A;  4I7F A;  4RBU A;  2V68 A;  4DR1 F;  2PI4 A;  5IC4 B;  3ZZR A;  3AA9 A;  1IKV A;  3NS6 A;  4EGL A;  3RBD A;  1CJV A;  2UXD J;  3M30 A;  3GIJ A;  2EFG A;  3L09 A;  1E6Y A;  2QTW A;  2AEM A;  1JLE A;  1FJC A;  2VG7 A;  3W64 A;  4P2S A;  3NWR A;  5KT3 A;  4IR1 A;  4HDG A;  2N3O A;  4DR3 F;  3GIM A;  1PIL A;  3H5S A;  2ZBP A;  5FD1 A;  3N5B A;  4USV A;  5U47 A;  4YY3 J;  1V5V A;  3OJU A;  2QE5 A;  1RKJ A;  1XIQ A;  2IY5 B;  1FJG F;  2FZC B;  2PE8 A;  4KGZ B;  2I2Y A;  3CJ4 A;  3L3C A;  2ALY B;  2KVI A;  4WKY A;  3PR4 A;  1GQE A;  4F4X A;  4KPC A;  2FC8 A;  1GTE A;  1NK4 A;  2QFJ A;  1UVN A;  2Z4P A;  2IRY A;  2HG4 A;  1B64 A;  1K47 A;  2BW2 A;  3TVZ A;  3VF0 B;  3IG1 A;  2ZVI A;  2XY6 A;  4TN2 A;  1RT4 B;  1TKZ B;  1Y3K A;  2N7Y A;  2VU5 A;  3QFH A;  5CZX A;  1PYO B;  3VZI A;  3VVT A;  2XO7 A;  3PW4 A;  2B7C B;  3SV4 A;  3CCE S;  3ZZY A;  1TK0 A;  3LP2 A;  3W1Y C;  1RTD A;  2NQP A;  4PWW A;  3CUN A;  6FD1 A;  5J1E B;  2HK3 A;  4PYD A;  1S0V A;  4DU7 A;  1NKB A;  1VJW A;  3MTJ A;  2W4P A;  2ZH7 A;  4NOH A;  4PG6 A;  5K8N A;  1OMS A;  3ZZU A;  1QSY A;  2JL9 A;  5GMD A;  1JLQ A;  1KVI A;  4L6V 3;  3D1Q A;  4NLS A;  4X4S A;  1X4C A;  4PZV A;  4DLE A;  2VIH A;  1F5C A;  1NDC A;  2DO4 A;  2VDI A;  3BF4 A;  3EM1 A;  4OJ3 A;  1JLA A;  1UEV A;  3R2D J;  5CHC B;  3CCU S;  2R7V A;  2DNZ A;  2OPQ A;  3ETO A;  2HAI A;  4OHY A;  1FTR A;  2FDN A;  1DLO B;  2MYF A;  2RRB A;  5DQG A;  3KK1 B;  3HJF A;  2MEW A;  1FWP A;  2APO A;  4G1P A;  4MMO A;  1O8B A;  2BMB A;  3IBF B;  3T6B A;  2Z2M A;  3Q23 A;  5F9N A;  3TJA A;  2R3V A;  3T5L A;  4QOT A;  3T3F A;  1XNR F;  2XQC A;  2BJ3 A;  4IG3 B;  1R8H A;  1S1W A;  2VG6 A;  3OTC A;  1S6O A;  1YBA A;  4AT1 B;  3W63 A;  4RX6 A;  2VZ9 A;  2GHP A;  2H5I B;  2LEA A;  2YNF B;  3I0R B;  3IWX A;  4CNZ A;  2OHD A;  1HQU B;  1L3U A;  1SQE A;  3ILJ A;  5L1K A;  3KLG A;  1KRP A;  2GW8 A;  2HVD A;  1EET B;  3TAQ A;  3M6W A;  4DG1 B;  3ZO7 A;  1LW2 A;  3ZC4 A;  1SXL A;  3PFE A;  2G2Z A;  3RBZ A;  2RU3 A;  2EBG A; 
#chains in the Genus database with same CATH homology
 3NY0 A;  1C3G A;  1GMW A;  3NXZ A;  3TJA A;  3TJ9 A;  1EAR A;  3AGY A;  3AGZ A;  1GMV A;  4J80 A;  2B26 A;  2QLD A;  4L3K A;  3LZ8 A;  3L9Z A;  1EB0 A;  1NLT A;  2Q2G A;  1GMU A;  3LA0 A;  1GMW D;  3AGX A;  3TJ8 A;  3I38 A;  2HFV A;  1XAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...