The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
241
|
structure length |
241
|
Chain Sequence |
SIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Atomic structure of the Serratia marcescens endonuclease at 1.1 A resolution and the enzyme reaction mechanism.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Serratia marcescens
|
molecule keywords |
NUCLEASE SM2 ISOFORM
|
total genus |
74
|
structure length |
241
|
sequence length |
241
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.1.30.2: Serratia marcescens nuclease. |
pdb deposition date | 2000-11-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01223 | Endonuclease_NS | DNA/RNA non-specific endonuclease |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Extracellular Endonuclease; Chain A | Extracellular Endonuclease, subunit A |
#chains in the Genus database with same CATH superfamily 4GTX A; 4QH0 A; 4B56 A; 5DLW A; 4ZGA A; 5LQQ A; 3NKN A; 2XRG A; 3NKM A; 5L0B A; 3WAX A; 3WAY A; 5KXA A; 1ZM8 A; 2O3B A; 3NKO A; 4QGO A; 5DLV A; 4ZG7 A; 2XR9 A; 3WAW A; 5LIA A; 5GKP A; 5DLT A; 3ISM A; 1QL0 A; 3WAV A; 5IJQ A; 2XH3 A; 3S5B A; 4ZG9 A; 5GKC A; 4GTZ A; 1QAE A; 5L0K A; 4A1N A; 4E3Y A; 5INH A; 3NKR A; 3OWV A; 4GTW A; 3NKP A; 4GTY A; 4ZG6 A; 2XGR A; 5HRT A; 4QN0 A; 3NKQ A; 5IJS A; 1G8T A; 5L0E A; 1SMN A; #chains in the Genus database with same CATH topology 4GTX A; 4QH0 A; 4B56 A; 5DLW A; 4ZGA A; 5LQQ A; 3NKN A; 2XRG A; 3NKM A; 5L0B A; 3WAX A; 3WAY A; 5KXA A; 1ZM8 A; 2O3B A; 3NKO A; 4QGO A; 5DLV A; 4ZG7 A; 2XR9 A; 3WAW A; 5LIA A; 5GKP A; 5DLT A; 3ISM A; 1QL0 A; 3WAV A; 5IJQ A; 2XH3 A; 3S5B A; 4ZG9 A; 5GKC A; 4GTZ A; 1QAE A; 5L0K A; 4A1N A; 4E3Y A; 5INH A; 3NKR A; 3OWV A; 4GTW A; 3NKP A; 4GTY A; 4ZG6 A; 2XGR A; 5HRT A; 4QN0 A; 3NKQ A; 5IJS A; 1G8T A; 5L0E A; 1SMN A; #chains in the Genus database with same CATH homology 4GTX A; 4QH0 A; 4B56 A; 5DLW A; 4ZGA A; 5LQQ A; 3NKN A; 2XRG A; 3NKM A; 5L0B A; 3WAX A; 3WAY A; 5KXA A; 1ZM8 A; 2O3B A; 3NKO A; 4QGO A; 5DLV A; 4ZG7 A; 2XR9 A; 3WAW A; 5LIA A; 5GKP A; 5DLT A; 3ISM A; 1QL0 A; 3WAV A; 5IJQ A; 2XH3 A; 3S5B A; 4ZG9 A; 5GKC A; 4GTZ A; 1QAE A; 5L0K A; 4A1N A; 4E3Y A; 5INH A; 3NKR A; 3OWV A; 4GTW A; 3NKP A; 4GTY A; 4ZG6 A; 2XGR A; 5HRT A; 4QN0 A; 3NKQ A; 5IJS A; 1G8T A; 5L0E A; 1SMN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...