1QL0A

Sm endonuclease from seratia marcenscens at atomic resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
241
structure length
241
Chain Sequence
SIDNCAVGCPTGGSSKVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NUCLEASE
publication title Atomic Structure of the Serratia Marcescens Endonuclease at 1.1 A Resolution and the Enzyme Reaction Mechanism.
pubmed doi rcsb
source organism Serratia marcescens
total genus 79
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 1999-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 1ql0A00
5DLVA 3NKOA 3NKNA 2O3BA 4QH0A 4GTZA 4GTXA 3WAVA 4ZGAA 5L0KA 5INHA 4GTWA 1QL0A 4QN0A 3S5BA 3NKMA 5GKCA 5HRTA 1G8TA 2XGRA 4ZG7A 4A1NA 5IJSA 5L0BA 4ZG6A 3NKQA 2XH3A 4GTYA 3OWVA 4B56A 4ZG9A 1ZM8A 1SMNA 5IJQA 4QGOA 5GKPA 3NKPA 1QAEA 5DLTA 5L0EA 5KXAA 2XRGA 3NKRA 5LQQA 5DLWA 2XR9A 3WAXA 3ISMA 4E3YA 3WAWA 5LIAA 3WAYA
chains in the Genus database with same CATH superfamily
5DLVA 3NKOA 3NKNA 2O3BA 4QH0A 4GTZA 4GTXA 3WAVA 4ZGAA 5L0KA 5INHA 4GTWA 1QL0A 4QN0A 3S5BA 3NKMA 5GKCA 5HRTA 1G8TA 2XGRA 4ZG7A 4A1NA 5IJSA 5L0BA 4ZG6A 3NKQA 2XH3A 4GTYA 3OWVA 4B56A 4ZG9A 1ZM8A 1SMNA 5IJQA 4QGOA 5GKPA 3NKPA 1QAEA 5DLTA 5L0EA 5KXAA 2XRGA 3NKRA 5LQQA 5DLWA 2XR9A 3WAXA 3ISMA 4E3YA 3WAWA 5LIAA 3WAYA
chains in the Genus database with same CATH topology
5DLVA 3NKOA 3NKNA 2O3BA 4QH0A 4GTZA 4GTXA 3WAVA 4ZGAA 5L0KA 5INHA 4GTWA 1QL0A 4QN0A 3S5BA 3NKMA 5GKCA 5HRTA 1G8TA 2XGRA 4ZG7A 4A1NA 5IJSA 5L0BA 4ZG6A 3NKQA 2XH3A 4GTYA 3OWVA 4B56A 4ZG9A 1ZM8A 1SMNA 5IJQA 4QGOA 5GKPA 3NKPA 1QAEA 5DLTA 5L0EA 5KXAA 2XRGA 3NKRA 5LQQA 5DLWA 2XR9A 3WAXA 3ISMA 4E3YA 3WAWA 5LIAA 3WAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLV A;  3NKO A;  3NKN A;  2O3B A;  4QH0 A;  4GTZ A;  4GTX A;  3WAV A;  4ZGA A;  5L0K A;  5INH A;  4GTW A;  1QL0 A;  4QN0 A;  3S5B A;  3NKM A;  5GKC A;  5HRT A;  1G8T A;  2XGR A;  4ZG7 A;  4A1N A;  5IJS A;  5L0B A;  4ZG6 A;  3NKQ A;  2XH3 A;  4GTY A;  3OWV A;  4B56 A;  4ZG9 A;  1ZM8 A;  1SMN A;  5IJQ A;  4QGO A;  5GKP A;  3NKP A;  1QAE A;  5DLT A;  5L0E A;  5KXA A;  2XRG A;  3NKR A;  5LQQ A;  5DLW A;  2XR9 A;  3WAX A;  3ISM A;  4E3Y A;  3WAW A;  5LIA A;  3WAY A; 
#chains in the Genus database with same CATH topology
 5DLV A;  3NKO A;  3NKN A;  2O3B A;  4QH0 A;  4GTZ A;  4GTX A;  3WAV A;  4ZGA A;  5L0K A;  5INH A;  4GTW A;  1QL0 A;  4QN0 A;  3S5B A;  3NKM A;  5GKC A;  5HRT A;  1G8T A;  2XGR A;  4ZG7 A;  4A1N A;  5IJS A;  5L0B A;  4ZG6 A;  3NKQ A;  2XH3 A;  4GTY A;  3OWV A;  4B56 A;  4ZG9 A;  1ZM8 A;  1SMN A;  5IJQ A;  4QGO A;  5GKP A;  3NKP A;  1QAE A;  5DLT A;  5L0E A;  5KXA A;  2XRG A;  3NKR A;  5LQQ A;  5DLW A;  2XR9 A;  3WAX A;  3ISM A;  4E3Y A;  3WAW A;  5LIA A;  3WAY A; 
#chains in the Genus database with same CATH homology
 5DLV A;  3NKO A;  3NKN A;  2O3B A;  4QH0 A;  4GTZ A;  4GTX A;  3WAV A;  4ZGA A;  5L0K A;  5INH A;  4GTW A;  1QL0 A;  4QN0 A;  3S5B A;  3NKM A;  5GKC A;  5HRT A;  1G8T A;  2XGR A;  4ZG7 A;  4A1N A;  5IJS A;  5L0B A;  4ZG6 A;  3NKQ A;  2XH3 A;  4GTY A;  3OWV A;  4B56 A;  4ZG9 A;  1ZM8 A;  1SMN A;  5IJQ A;  4QGO A;  5GKP A;  3NKP A;  1QAE A;  5DLT A;  5L0E A;  5KXA A;  2XRG A;  3NKR A;  5LQQ A;  5DLW A;  2XR9 A;  3WAX A;  3ISM A;  4E3Y A;  3WAW A;  5LIA A;  3WAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...