1QL0A

Sm endonuclease from seratia marcenscens at atomic resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
241
structure length
241
Chain Sequence
SIDNCAVGCPTGGSSKVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEASE
publication title Atomic Structure of the Serratia Marcescens Endonuclease at 1.1 A Resolution and the Enzyme Reaction Mechanism.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 79
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 1999-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 1ql0A00
4QN0A 5HRTA 3OWVA 5DLTA 5GKPA 5LIAA 5L0EA 3WAWA 2XRGA 4E3YA 4ZGAA 3WAXA 5IJQA 1G8TA 4ZG6A 1SMNA 4GTYA 4A1NA 4ZG7A 2XGRA 4QH0A 3NKNA 3S5BA 3WAYA 5KXAA 2XH3A 1QL0A 5DLWA 5LQQA 3WAVA 3NKRA 1QAEA 5DLVA 2O3BA 3NKOA 5IJSA 5INHA 4ZG9A 3NKPA 1ZM8A 5L0BA 4GTZA 3ISMA 4QGOA 3NKMA 4GTXA 5L0KA 3NKQA 4B56A 5GKCA 2XR9A 4GTWA
chains in the Genus database with same CATH superfamily
4QN0A 5HRTA 3OWVA 5DLTA 5GKPA 5LIAA 5L0EA 3WAWA 2XRGA 4E3YA 4ZGAA 3WAXA 5IJQA 1G8TA 4ZG6A 1SMNA 4GTYA 4A1NA 4ZG7A 2XGRA 4QH0A 3NKNA 3S5BA 3WAYA 5KXAA 2XH3A 1QL0A 5DLWA 5LQQA 3WAVA 3NKRA 1QAEA 5DLVA 2O3BA 3NKOA 5IJSA 5INHA 4ZG9A 3NKPA 1ZM8A 5L0BA 4GTZA 3ISMA 4QGOA 3NKMA 4GTXA 5L0KA 3NKQA 4B56A 5GKCA 2XR9A 4GTWA
chains in the Genus database with same CATH topology
4QN0A 5HRTA 3OWVA 5DLTA 5GKPA 5LIAA 5L0EA 3WAWA 2XRGA 4E3YA 4ZGAA 3WAXA 5IJQA 1G8TA 4ZG6A 1SMNA 4GTYA 4A1NA 4ZG7A 2XGRA 4QH0A 3NKNA 3S5BA 3WAYA 5KXAA 2XH3A 1QL0A 5DLWA 5LQQA 3WAVA 3NKRA 1QAEA 5DLVA 2O3BA 3NKOA 5IJSA 5INHA 4ZG9A 3NKPA 1ZM8A 5L0BA 4GTZA 3ISMA 4QGOA 3NKMA 4GTXA 5L0KA 3NKQA 4B56A 5GKCA 2XR9A 4GTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QN0 A;  5HRT A;  3OWV A;  5DLT A;  5GKP A;  5LIA A;  5L0E A;  3WAW A;  2XRG A;  4E3Y A;  4ZGA A;  3WAX A;  5IJQ A;  1G8T A;  4ZG6 A;  1SMN A;  4GTY A;  4A1N A;  4ZG7 A;  2XGR A;  4QH0 A;  3NKN A;  3S5B A;  3WAY A;  5KXA A;  2XH3 A;  1QL0 A;  5DLW A;  5LQQ A;  3WAV A;  3NKR A;  1QAE A;  5DLV A;  2O3B A;  3NKO A;  5IJS A;  5INH A;  4ZG9 A;  3NKP A;  1ZM8 A;  5L0B A;  4GTZ A;  3ISM A;  4QGO A;  3NKM A;  4GTX A;  5L0K A;  3NKQ A;  4B56 A;  5GKC A;  2XR9 A;  4GTW A; 
#chains in the Genus database with same CATH topology
 4QN0 A;  5HRT A;  3OWV A;  5DLT A;  5GKP A;  5LIA A;  5L0E A;  3WAW A;  2XRG A;  4E3Y A;  4ZGA A;  3WAX A;  5IJQ A;  1G8T A;  4ZG6 A;  1SMN A;  4GTY A;  4A1N A;  4ZG7 A;  2XGR A;  4QH0 A;  3NKN A;  3S5B A;  3WAY A;  5KXA A;  2XH3 A;  1QL0 A;  5DLW A;  5LQQ A;  3WAV A;  3NKR A;  1QAE A;  5DLV A;  2O3B A;  3NKO A;  5IJS A;  5INH A;  4ZG9 A;  3NKP A;  1ZM8 A;  5L0B A;  4GTZ A;  3ISM A;  4QGO A;  3NKM A;  4GTX A;  5L0K A;  3NKQ A;  4B56 A;  5GKC A;  2XR9 A;  4GTW A; 
#chains in the Genus database with same CATH homology
 4QN0 A;  5HRT A;  3OWV A;  5DLT A;  5GKP A;  5LIA A;  5L0E A;  3WAW A;  2XRG A;  4E3Y A;  4ZGA A;  3WAX A;  5IJQ A;  1G8T A;  4ZG6 A;  1SMN A;  4GTY A;  4A1N A;  4ZG7 A;  2XGR A;  4QH0 A;  3NKN A;  3S5B A;  3WAY A;  5KXA A;  2XH3 A;  1QL0 A;  5DLW A;  5LQQ A;  3WAV A;  3NKR A;  1QAE A;  5DLV A;  2O3B A;  3NKO A;  5IJS A;  5INH A;  4ZG9 A;  3NKP A;  1ZM8 A;  5L0B A;  4GTZ A;  3ISM A;  4QGO A;  3NKM A;  4GTX A;  5L0K A;  3NKQ A;  4B56 A;  5GKC A;  2XR9 A;  4GTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...