1QL0A

Sm endonuclease from seratia marcenscens at atomic resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
241
structure length
241
Chain Sequence
SIDNCAVGCPTGGSSKVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Serratia Marcescens Endonuclease at 1.1 A Resolution and the Enzyme Reaction Mechanism.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords NUCLEASE
total genus 79
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 1999-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 1ql0A00
4A1NA 5DLTA 4ZG9A 4GTXA 1SMNA 2XGRA 3OWVA 4GTWA 5GKCA 5L0BA 4QH0A 1ZM8A 4GTYA 5LQQA 5IJQA 2XH3A 4E3YA 5HRTA 4GTZA 3WAWA 3NKRA 5L0EA 4QN0A 1QL0A 1G8TA 5IJSA 5LIAA 4B56A 3S5BA 5L0KA 4ZG7A 3ISMA 3NKOA 3WAVA 3WAYA 1QAEA 3WAXA 4ZGAA 2XR9A 3NKPA 2O3BA 4QGOA 5DLVA 5GKPA 2XRGA 4ZG6A 5KXAA 3NKNA 3NKQA 5DLWA 5INHA 3NKMA
chains in the Genus database with same CATH superfamily
4A1NA 5DLTA 4ZG9A 4GTXA 1SMNA 2XGRA 3OWVA 4GTWA 5GKCA 5L0BA 4QH0A 1ZM8A 4GTYA 5LQQA 5IJQA 2XH3A 4E3YA 5HRTA 4GTZA 3WAWA 3NKRA 5L0EA 4QN0A 1QL0A 1G8TA 5IJSA 5LIAA 4B56A 3S5BA 5L0KA 4ZG7A 3ISMA 3NKOA 3WAVA 3WAYA 1QAEA 3WAXA 4ZGAA 2XR9A 3NKPA 2O3BA 4QGOA 5DLVA 5GKPA 2XRGA 4ZG6A 5KXAA 3NKNA 3NKQA 5DLWA 5INHA 3NKMA
chains in the Genus database with same CATH topology
4A1NA 5DLTA 4ZG9A 4GTXA 1SMNA 2XGRA 3OWVA 4GTWA 5GKCA 5L0BA 4QH0A 1ZM8A 4GTYA 5LQQA 5IJQA 2XH3A 4E3YA 5HRTA 4GTZA 3WAWA 3NKRA 5L0EA 4QN0A 1QL0A 1G8TA 5IJSA 5LIAA 4B56A 3S5BA 5L0KA 4ZG7A 3ISMA 3NKOA 3WAVA 3WAYA 1QAEA 3WAXA 4ZGAA 2XR9A 3NKPA 2O3BA 4QGOA 5DLVA 5GKPA 2XRGA 4ZG6A 5KXAA 3NKNA 3NKQA 5DLWA 5INHA 3NKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1N A;  5DLT A;  4ZG9 A;  4GTX A;  1SMN A;  2XGR A;  3OWV A;  4GTW A;  5GKC A;  5L0B A;  4QH0 A;  1ZM8 A;  4GTY A;  5LQQ A;  5IJQ A;  2XH3 A;  4E3Y A;  5HRT A;  4GTZ A;  3WAW A;  3NKR A;  5L0E A;  4QN0 A;  1QL0 A;  1G8T A;  5IJS A;  5LIA A;  4B56 A;  3S5B A;  5L0K A;  4ZG7 A;  3ISM A;  3NKO A;  3WAV A;  3WAY A;  1QAE A;  3WAX A;  4ZGA A;  2XR9 A;  3NKP A;  2O3B A;  4QGO A;  5DLV A;  5GKP A;  2XRG A;  4ZG6 A;  5KXA A;  3NKN A;  3NKQ A;  5DLW A;  5INH A;  3NKM A; 
#chains in the Genus database with same CATH topology
 4A1N A;  5DLT A;  4ZG9 A;  4GTX A;  1SMN A;  2XGR A;  3OWV A;  4GTW A;  5GKC A;  5L0B A;  4QH0 A;  1ZM8 A;  4GTY A;  5LQQ A;  5IJQ A;  2XH3 A;  4E3Y A;  5HRT A;  4GTZ A;  3WAW A;  3NKR A;  5L0E A;  4QN0 A;  1QL0 A;  1G8T A;  5IJS A;  5LIA A;  4B56 A;  3S5B A;  5L0K A;  4ZG7 A;  3ISM A;  3NKO A;  3WAV A;  3WAY A;  1QAE A;  3WAX A;  4ZGA A;  2XR9 A;  3NKP A;  2O3B A;  4QGO A;  5DLV A;  5GKP A;  2XRG A;  4ZG6 A;  5KXA A;  3NKN A;  3NKQ A;  5DLW A;  5INH A;  3NKM A; 
#chains in the Genus database with same CATH homology
 4A1N A;  5DLT A;  4ZG9 A;  4GTX A;  1SMN A;  2XGR A;  3OWV A;  4GTW A;  5GKC A;  5L0B A;  4QH0 A;  1ZM8 A;  4GTY A;  5LQQ A;  5IJQ A;  2XH3 A;  4E3Y A;  5HRT A;  4GTZ A;  3WAW A;  3NKR A;  5L0E A;  4QN0 A;  1QL0 A;  1G8T A;  5IJS A;  5LIA A;  4B56 A;  3S5B A;  5L0K A;  4ZG7 A;  3ISM A;  3NKO A;  3WAV A;  3WAY A;  1QAE A;  3WAX A;  4ZGA A;  2XR9 A;  3NKP A;  2O3B A;  4QGO A;  5DLV A;  5GKP A;  2XRG A;  4ZG6 A;  5KXA A;  3NKN A;  3NKQ A;  5DLW A;  5INH A;  3NKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...