4E3YA

X-ray structure of the serratia marcescens endonuclease at 0.95 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
240
structure length
240
Chain Sequence
SIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of the Serratia marcescens endonuclease at 0.95 A resolution
rcsb
molecule tags Hydrolase
molecule keywords Nuclease
total genus 69
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 4e3yA00
3OWVA 5LQQA 3NKPA 4GTYA 5L0EA 4GTWA 3WAWA 5DLVA 4QH0A 1SMNA 4GTXA 5INHA 5GKPA 5L0KA 5IJQA 3NKMA 4B56A 2XR9A 1G8TA 3S5BA 5HRTA 4ZG9A 3WAVA 4ZGAA 5L0BA 5DLWA 1ZM8A 4QN0A 4A1NA 4ZG7A 5KXAA 2XGRA 5GKCA 3NKRA 2XRGA 3NKQA 2O3BA 3WAYA 1QL0A 3NKOA 5DLTA 4ZG6A 3ISMA 1QAEA 2XH3A 4E3YA 4QGOA 3NKNA 5IJSA 3WAXA 4GTZA 5LIAA
chains in the Genus database with same CATH superfamily
3OWVA 5LQQA 3NKPA 4GTYA 5L0EA 4GTWA 3WAWA 5DLVA 4QH0A 1SMNA 4GTXA 5INHA 5GKPA 5L0KA 5IJQA 3NKMA 4B56A 2XR9A 1G8TA 3S5BA 5HRTA 4ZG9A 3WAVA 4ZGAA 5L0BA 5DLWA 1ZM8A 4QN0A 4A1NA 4ZG7A 5KXAA 2XGRA 5GKCA 3NKRA 2XRGA 3NKQA 2O3BA 3WAYA 1QL0A 3NKOA 5DLTA 4ZG6A 3ISMA 1QAEA 2XH3A 4E3YA 4QGOA 3NKNA 5IJSA 3WAXA 4GTZA 5LIAA
chains in the Genus database with same CATH topology
3OWVA 5LQQA 3NKPA 4GTYA 5L0EA 4GTWA 3WAWA 5DLVA 4QH0A 1SMNA 4GTXA 5INHA 5GKPA 5L0KA 5IJQA 3NKMA 4B56A 2XR9A 1G8TA 3S5BA 5HRTA 4ZG9A 3WAVA 4ZGAA 5L0BA 5DLWA 1ZM8A 4QN0A 4A1NA 4ZG7A 5KXAA 2XGRA 5GKCA 3NKRA 2XRGA 3NKQA 2O3BA 3WAYA 1QL0A 3NKOA 5DLTA 4ZG6A 3ISMA 1QAEA 2XH3A 4E3YA 4QGOA 3NKNA 5IJSA 3WAXA 4GTZA 5LIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWV A;  5LQQ A;  3NKP A;  4GTY A;  5L0E A;  4GTW A;  3WAW A;  5DLV A;  4QH0 A;  1SMN A;  4GTX A;  5INH A;  5GKP A;  5L0K A;  5IJQ A;  3NKM A;  4B56 A;  2XR9 A;  1G8T A;  3S5B A;  5HRT A;  4ZG9 A;  3WAV A;  4ZGA A;  5L0B A;  5DLW A;  1ZM8 A;  4QN0 A;  4A1N A;  4ZG7 A;  5KXA A;  2XGR A;  5GKC A;  3NKR A;  2XRG A;  3NKQ A;  2O3B A;  3WAY A;  1QL0 A;  3NKO A;  5DLT A;  4ZG6 A;  3ISM A;  1QAE A;  2XH3 A;  4E3Y A;  4QGO A;  3NKN A;  5IJS A;  3WAX A;  4GTZ A;  5LIA A; 
#chains in the Genus database with same CATH topology
 3OWV A;  5LQQ A;  3NKP A;  4GTY A;  5L0E A;  4GTW A;  3WAW A;  5DLV A;  4QH0 A;  1SMN A;  4GTX A;  5INH A;  5GKP A;  5L0K A;  5IJQ A;  3NKM A;  4B56 A;  2XR9 A;  1G8T A;  3S5B A;  5HRT A;  4ZG9 A;  3WAV A;  4ZGA A;  5L0B A;  5DLW A;  1ZM8 A;  4QN0 A;  4A1N A;  4ZG7 A;  5KXA A;  2XGR A;  5GKC A;  3NKR A;  2XRG A;  3NKQ A;  2O3B A;  3WAY A;  1QL0 A;  3NKO A;  5DLT A;  4ZG6 A;  3ISM A;  1QAE A;  2XH3 A;  4E3Y A;  4QGO A;  3NKN A;  5IJS A;  3WAX A;  4GTZ A;  5LIA A; 
#chains in the Genus database with same CATH homology
 3OWV A;  5LQQ A;  3NKP A;  4GTY A;  5L0E A;  4GTW A;  3WAW A;  5DLV A;  4QH0 A;  1SMN A;  4GTX A;  5INH A;  5GKP A;  5L0K A;  5IJQ A;  3NKM A;  4B56 A;  2XR9 A;  1G8T A;  3S5B A;  5HRT A;  4ZG9 A;  3WAV A;  4ZGA A;  5L0B A;  5DLW A;  1ZM8 A;  4QN0 A;  4A1N A;  4ZG7 A;  5KXA A;  2XGR A;  5GKC A;  3NKR A;  2XRG A;  3NKQ A;  2O3B A;  3WAY A;  1QL0 A;  3NKO A;  5DLT A;  4ZG6 A;  3ISM A;  1QAE A;  2XH3 A;  4E3Y A;  4QGO A;  3NKN A;  5IJS A;  3WAX A;  4GTZ A;  5LIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...