4E3YA

X-ray structure of the serratia marcescens endonuclease at 0.95 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
240
structure length
240
Chain Sequence
SIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Nuclease
publication title X-ray structure of the Serratia marcescens endonuclease at 0.95 A resolution
rcsb
total genus 69
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 4e3yA00
4ZG7A 4ZGAA 5DLTA 5IJSA 4A1NA 5LIAA 4GTWA 4GTYA 3WAWA 4E3YA 2XGRA 3NKPA 4QH0A 5INHA 5HRTA 5L0BA 3NKRA 3NKMA 5DLWA 1QL0A 4QGOA 1G8TA 3WAXA 5GKPA 5L0KA 1QAEA 4QN0A 3NKNA 2XRGA 3NKQA 4ZG9A 4GTXA 3OWVA 3ISMA 5DLVA 4GTZA 3WAVA 1SMNA 4ZG6A 5KXAA 2XH3A 3S5BA 5LQQA 2XR9A 1ZM8A 2O3BA 5L0EA 4B56A 3NKOA 5IJQA 5GKCA 3WAYA
chains in the Genus database with same CATH superfamily
4ZG7A 4ZGAA 5DLTA 5IJSA 4A1NA 5LIAA 4GTWA 4GTYA 3WAWA 4E3YA 2XGRA 3NKPA 4QH0A 5INHA 5HRTA 5L0BA 3NKRA 3NKMA 5DLWA 1QL0A 4QGOA 1G8TA 3WAXA 5GKPA 5L0KA 1QAEA 4QN0A 3NKNA 2XRGA 3NKQA 4ZG9A 4GTXA 3OWVA 3ISMA 5DLVA 4GTZA 3WAVA 1SMNA 4ZG6A 5KXAA 2XH3A 3S5BA 5LQQA 2XR9A 1ZM8A 2O3BA 5L0EA 4B56A 3NKOA 5IJQA 5GKCA 3WAYA
chains in the Genus database with same CATH topology
4ZG7A 4ZGAA 5DLTA 5IJSA 4A1NA 5LIAA 4GTWA 4GTYA 3WAWA 4E3YA 2XGRA 3NKPA 4QH0A 5INHA 5HRTA 5L0BA 3NKRA 3NKMA 5DLWA 1QL0A 4QGOA 1G8TA 3WAXA 5GKPA 5L0KA 1QAEA 4QN0A 3NKNA 2XRGA 3NKQA 4ZG9A 4GTXA 3OWVA 3ISMA 5DLVA 4GTZA 3WAVA 1SMNA 4ZG6A 5KXAA 2XH3A 3S5BA 5LQQA 2XR9A 1ZM8A 2O3BA 5L0EA 4B56A 3NKOA 5IJQA 5GKCA 3WAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG7 A;  4ZGA A;  5DLT A;  5IJS A;  4A1N A;  5LIA A;  4GTW A;  4GTY A;  3WAW A;  4E3Y A;  2XGR A;  3NKP A;  4QH0 A;  5INH A;  5HRT A;  5L0B A;  3NKR A;  3NKM A;  5DLW A;  1QL0 A;  4QGO A;  1G8T A;  3WAX A;  5GKP A;  5L0K A;  1QAE A;  4QN0 A;  3NKN A;  2XRG A;  3NKQ A;  4ZG9 A;  4GTX A;  3OWV A;  3ISM A;  5DLV A;  4GTZ A;  3WAV A;  1SMN A;  4ZG6 A;  5KXA A;  2XH3 A;  3S5B A;  5LQQ A;  2XR9 A;  1ZM8 A;  2O3B A;  5L0E A;  4B56 A;  3NKO A;  5IJQ A;  5GKC A;  3WAY A; 
#chains in the Genus database with same CATH topology
 4ZG7 A;  4ZGA A;  5DLT A;  5IJS A;  4A1N A;  5LIA A;  4GTW A;  4GTY A;  3WAW A;  4E3Y A;  2XGR A;  3NKP A;  4QH0 A;  5INH A;  5HRT A;  5L0B A;  3NKR A;  3NKM A;  5DLW A;  1QL0 A;  4QGO A;  1G8T A;  3WAX A;  5GKP A;  5L0K A;  1QAE A;  4QN0 A;  3NKN A;  2XRG A;  3NKQ A;  4ZG9 A;  4GTX A;  3OWV A;  3ISM A;  5DLV A;  4GTZ A;  3WAV A;  1SMN A;  4ZG6 A;  5KXA A;  2XH3 A;  3S5B A;  5LQQ A;  2XR9 A;  1ZM8 A;  2O3B A;  5L0E A;  4B56 A;  3NKO A;  5IJQ A;  5GKC A;  3WAY A; 
#chains in the Genus database with same CATH homology
 4ZG7 A;  4ZGA A;  5DLT A;  5IJS A;  4A1N A;  5LIA A;  4GTW A;  4GTY A;  3WAW A;  4E3Y A;  2XGR A;  3NKP A;  4QH0 A;  5INH A;  5HRT A;  5L0B A;  3NKR A;  3NKM A;  5DLW A;  1QL0 A;  4QGO A;  1G8T A;  3WAX A;  5GKP A;  5L0K A;  1QAE A;  4QN0 A;  3NKN A;  2XRG A;  3NKQ A;  4ZG9 A;  4GTX A;  3OWV A;  3ISM A;  5DLV A;  4GTZ A;  3WAV A;  1SMN A;  4ZG6 A;  5KXA A;  2XH3 A;  3S5B A;  5LQQ A;  2XR9 A;  1ZM8 A;  2O3B A;  5L0E A;  4B56 A;  3NKO A;  5IJQ A;  5GKC A;  3WAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...