4E3YA

X-ray structure of the serratia marcescens endonuclease at 0.95 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
240
structure length
240
Chain Sequence
SIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclease
publication title X-ray structure of the Serratia marcescens endonuclease at 0.95 A resolution
rcsb
molecule tags Hydrolase
total genus 69
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature ec 3.1.30.2: Serratia marcescens nuclease.
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.570.10 Alpha Beta 3-Layer(aba) Sandwich Extracellular Endonuclease; Chain A Extracellular Endonuclease, subunit A 4e3yA00
3S5BA 1SMNA 4GTZA 5L0EA 3NKOA 2XGRA 4QGOA 5INHA 2XRGA 4ZGAA 1QL0A 3WAXA 4E3YA 4ZG7A 5DLVA 3NKMA 5GKPA 1G8TA 3NKRA 3OWVA 4QH0A 5L0BA 4GTWA 4QN0A 3NKNA 2O3BA 2XR9A 5L0KA 3WAVA 5HRTA 5IJQA 5IJSA 5KXAA 5DLTA 3WAWA 4A1NA 5DLWA 4GTYA 2XH3A 3NKPA 4ZG9A 3NKQA 5LIAA 1QAEA 5GKCA 5LQQA 3ISMA 4GTXA 4ZG6A 1ZM8A 3WAYA 4B56A
chains in the Genus database with same CATH superfamily
3S5BA 1SMNA 4GTZA 5L0EA 3NKOA 2XGRA 4QGOA 5INHA 2XRGA 4ZGAA 1QL0A 3WAXA 4E3YA 4ZG7A 5DLVA 3NKMA 5GKPA 1G8TA 3NKRA 3OWVA 4QH0A 5L0BA 4GTWA 4QN0A 3NKNA 2O3BA 2XR9A 5L0KA 3WAVA 5HRTA 5IJQA 5IJSA 5KXAA 5DLTA 3WAWA 4A1NA 5DLWA 4GTYA 2XH3A 3NKPA 4ZG9A 3NKQA 5LIAA 1QAEA 5GKCA 5LQQA 3ISMA 4GTXA 4ZG6A 1ZM8A 3WAYA 4B56A
chains in the Genus database with same CATH topology
3S5BA 1SMNA 4GTZA 5L0EA 3NKOA 2XGRA 4QGOA 5INHA 2XRGA 4ZGAA 1QL0A 3WAXA 4E3YA 4ZG7A 5DLVA 3NKMA 5GKPA 1G8TA 3NKRA 3OWVA 4QH0A 5L0BA 4GTWA 4QN0A 3NKNA 2O3BA 2XR9A 5L0KA 3WAVA 5HRTA 5IJQA 5IJSA 5KXAA 5DLTA 3WAWA 4A1NA 5DLWA 4GTYA 2XH3A 3NKPA 4ZG9A 3NKQA 5LIAA 1QAEA 5GKCA 5LQQA 3ISMA 4GTXA 4ZG6A 1ZM8A 3WAYA 4B56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5B A;  1SMN A;  4GTZ A;  5L0E A;  3NKO A;  2XGR A;  4QGO A;  5INH A;  2XRG A;  4ZGA A;  1QL0 A;  3WAX A;  4E3Y A;  4ZG7 A;  5DLV A;  3NKM A;  5GKP A;  1G8T A;  3NKR A;  3OWV A;  4QH0 A;  5L0B A;  4GTW A;  4QN0 A;  3NKN A;  2O3B A;  2XR9 A;  5L0K A;  3WAV A;  5HRT A;  5IJQ A;  5IJS A;  5KXA A;  5DLT A;  3WAW A;  4A1N A;  5DLW A;  4GTY A;  2XH3 A;  3NKP A;  4ZG9 A;  3NKQ A;  5LIA A;  1QAE A;  5GKC A;  5LQQ A;  3ISM A;  4GTX A;  4ZG6 A;  1ZM8 A;  3WAY A;  4B56 A; 
#chains in the Genus database with same CATH topology
 3S5B A;  1SMN A;  4GTZ A;  5L0E A;  3NKO A;  2XGR A;  4QGO A;  5INH A;  2XRG A;  4ZGA A;  1QL0 A;  3WAX A;  4E3Y A;  4ZG7 A;  5DLV A;  3NKM A;  5GKP A;  1G8T A;  3NKR A;  3OWV A;  4QH0 A;  5L0B A;  4GTW A;  4QN0 A;  3NKN A;  2O3B A;  2XR9 A;  5L0K A;  3WAV A;  5HRT A;  5IJQ A;  5IJS A;  5KXA A;  5DLT A;  3WAW A;  4A1N A;  5DLW A;  4GTY A;  2XH3 A;  3NKP A;  4ZG9 A;  3NKQ A;  5LIA A;  1QAE A;  5GKC A;  5LQQ A;  3ISM A;  4GTX A;  4ZG6 A;  1ZM8 A;  3WAY A;  4B56 A; 
#chains in the Genus database with same CATH homology
 3S5B A;  1SMN A;  4GTZ A;  5L0E A;  3NKO A;  2XGR A;  4QGO A;  5INH A;  2XRG A;  4ZGA A;  1QL0 A;  3WAX A;  4E3Y A;  4ZG7 A;  5DLV A;  3NKM A;  5GKP A;  1G8T A;  3NKR A;  3OWV A;  4QH0 A;  5L0B A;  4GTW A;  4QN0 A;  3NKN A;  2O3B A;  2XR9 A;  5L0K A;  3WAV A;  5HRT A;  5IJQ A;  5IJS A;  5KXA A;  5DLT A;  3WAW A;  4A1N A;  5DLW A;  4GTY A;  2XH3 A;  3NKP A;  4ZG9 A;  3NKQ A;  5LIA A;  1QAE A;  5GKC A;  5LQQ A;  3ISM A;  4GTX A;  4ZG6 A;  1ZM8 A;  3WAY A;  4B56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...