The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
228
|
structure length |
228
|
Chain Sequence |
PQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKDPE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The crystal structure of the yeast Hsp40 Ydj1 complexed with its peptide substrate.
pubmed doi rcsb |
molecule tags |
Protein transport
|
source organism |
Saccharomyces cerevisiae
|
molecule keywords |
Mitochondrial protein import protein MAS5
|
total genus |
36
|
structure length |
228
|
sequence length |
228
|
ec nomenclature | |
pdb deposition date | 2003-01-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00684 | DnaJ_CXXCXGXG | DnaJ central domain |
A | PF01556 | DnaJ_C | DnaJ C terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | Chaperone, DNAj Protein; Chain A | Heat shock protein DnaJ, cysteine-rich domain | ||
Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | Urease metallochaperone UreE, N-terminal domain | ||
Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | Urease metallochaperone UreE, N-terminal domain |
#chains in the Genus database with same CATH superfamily 4J80 A; 3LZ8 A; 3TJ8 A; 3NY0 A; 1GMV A; 3NXZ A; 1GMW A; 3TJ9 A; 2Q2G A; 3LA0 A; 2CTT A; 1GMW D; 1XAO A; 1C3G A; 4L3K A; 3TJA A; 3L9Z A; 3AGY A; 1NLT A; 1EB0 A; 1EAR A; 3I38 A; 2B26 A; 3AGX A; 1EXK A; 2QLD A; 1GMU A; 3AGZ A; #chains in the Genus database with same CATH topology 3LCZ A; 4J80 A; 3LZ8 A; 3TJ8 A; 3NY0 A; 1GMV A; 2KO8 A; 3C6E C; 3NXZ A; 1GMW A; 3C5X C; 2Q2G A; 3TJ9 A; 2JRR A; 3LA0 A; 2CTT A; 1GMW D; 2ODX A; 1XAO A; 1C3G A; 4L3K A; 3TJA A; 3L9Z A; 2JVM A; 3AGY A; 2BX9 A; 1NLT A; 2ZP8 E; 1EB0 A; 1EAR A; 2ZP9 C; 3I38 A; 2B26 A; 3AGX A; 3LD0 1; 1EXK A; 2QLD A; 1GMU A; 3AGZ A; 3AKO B; 2JZ8 A; #chains in the Genus database with same CATH homology 4J80 A; 3LZ8 A; 3TJ8 A; 3NY0 A; 1GMV A; 3NXZ A; 1GMW A; 3TJ9 A; 2Q2G A; 3LA0 A; 2CTT A; 1GMW D; 1XAO A; 1C3G A; 4L3K A; 3TJA A; 3L9Z A; 3AGY A; 1NLT A; 1EB0 A; 1EAR A; 3I38 A; 2B26 A; 3AGX A; 1EXK A; 2QLD A; 1GMU A; 3AGZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...