The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
74
|
sequence length |
241
|
structure length |
241
|
Chain Sequence |
SIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Identification of the Serratia endonuclease dimer: structural basis and implications for catalysis.
pubmed rcsb |
| molecule tags |
Endonuclease
|
| source organism |
Serratia marcescens
|
| molecule keywords |
EXTRACELLULAR ENDONUCLEASE
|
| total genus |
74
|
| structure length |
241
|
| sequence length |
241
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.30.2: Serratia marcescens nuclease. |
| pdb deposition date | 1995-01-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01223 | Endonuclease_NS | DNA/RNA non-specific endonuclease |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Extracellular Endonuclease; Chain A | Extracellular Endonuclease, subunit A |
#chains in the Genus database with same CATH superfamily 3WAV A; 3WAY A; 4ZG7 A; 4QN0 A; 5HRT A; 1SMN A; 4E3Y A; 4ZGA A; 1QAE A; 3NKN A; 3WAX A; 5IJS A; 3WAW A; 5LQQ A; 2XGR A; 5DLW A; 4GTW A; 4QH0 A; 5GKC A; 4A1N A; 5INH A; 4ZG6 A; 3NKO A; 4GTY A; 5LIA A; 4QGO A; 2XRG A; 3OWV A; 1QL0 A; 5L0B A; 3S5B A; 5L0E A; 1G8T A; 3ISM A; 5DLV A; 3NKP A; 5KXA A; 3NKR A; 5IJQ A; 5DLT A; 4GTZ A; 4ZG9 A; 1ZM8 A; 2O3B A; 3NKQ A; 5GKP A; 4GTX A; 5L0K A; 4B56 A; 2XR9 A; 3NKM A; 2XH3 A; #chains in the Genus database with same CATH topology 3WAV A; 3WAY A; 4ZG7 A; 4QN0 A; 5HRT A; 1SMN A; 4E3Y A; 4ZGA A; 1QAE A; 3NKN A; 3WAX A; 5IJS A; 3WAW A; 5LQQ A; 2XGR A; 5DLW A; 4GTW A; 4QH0 A; 5GKC A; 4A1N A; 5INH A; 4ZG6 A; 3NKO A; 4GTY A; 5LIA A; 4QGO A; 2XRG A; 3OWV A; 1QL0 A; 5L0B A; 3S5B A; 5L0E A; 1G8T A; 3ISM A; 5DLV A; 3NKP A; 5KXA A; 3NKR A; 5IJQ A; 5DLT A; 4GTZ A; 4ZG9 A; 1ZM8 A; 2O3B A; 3NKQ A; 5GKP A; 4GTX A; 5L0K A; 4B56 A; 2XR9 A; 3NKM A; 2XH3 A; #chains in the Genus database with same CATH homology 3WAV A; 3WAY A; 4ZG7 A; 4QN0 A; 5HRT A; 1SMN A; 4E3Y A; 4ZGA A; 1QAE A; 3NKN A; 3WAX A; 5IJS A; 3WAW A; 5LQQ A; 2XGR A; 5DLW A; 4GTW A; 4QH0 A; 5GKC A; 4A1N A; 5INH A; 4ZG6 A; 3NKO A; 4GTY A; 5LIA A; 4QGO A; 2XRG A; 3OWV A; 1QL0 A; 5L0B A; 3S5B A; 5L0E A; 1G8T A; 3ISM A; 5DLV A; 3NKP A; 5KXA A; 3NKR A; 5IJQ A; 5DLT A; 4GTZ A; 4ZG9 A; 1ZM8 A; 2O3B A; 3NKQ A; 5GKP A; 4GTX A; 5L0K A; 4B56 A; 2XR9 A; 3NKM A; 2XH3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
