2AW2B

Crystal structure of the human btla-hvem complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
102
structure length
100
Chain Sequence
PSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDHCAACRAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Attenuating Lymphocyte Activity: the crystal structure of the BTLA-HVEM complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords B and T lymphocyte attenuator
total genus 13
structure length 100
sequence length 102
chains with identical sequence Y
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00020 TNFR_c6 TNFR/NGFR cysteine-rich region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 2aw2B01
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 2aw2B02
3U3PA 3K51B 4I9XC 4MSVB 3MBWA 1ZA3R 4MXWR 5CIRE 3THMF 3TJEF 4KGQC 3X3FA 1D4VA 3WVTA 3U3SA 1TNRR 3QD6R 4FHQA 5BNQR 3MI8D 4BK5A 4M4PA 3BUKC 3U3QA 4OD2S 4YN0A 3IJ2X 3FL7A 3QBQB 4E4DR 2HEVR 1SG1X 3ALQR 3ME4A 2X10A 1D0GR 3U3TA 3URFZ 2UWIA 5IHLA 2HEYR 1FT4A 5DMJA 3MHDD 4GIQR 1NCFA 4M4RA 3U3VA 3QO4A 3ME2R 2H9GR 4J6GC 4BK4A 1DU3A 4KGGC 4RSUD 5L36B 1EXTA 1JMAB 4N90R 2AW2B
chains in the Genus database with same CATH superfamily
3U3PA 2E4VA 3K51B 4I9XC 4MSVB 3MBWA 1ZA3R 4MXWR 2E4YA 5CIRE 3TJEF 3THMF 4KGQC 3X3FA 1D4VA 3WVTA 2E4XA 3U3SA 1TNRR 3QD6R 2E4WA 4FHQA 5BNQR 3MI8D 4BK5A 4M4PA 3BUKC 3U3QA 4OD2S 4YN0A 3IJ2X 3FL7A 3QBQB 4E4DR 2HEVR 1SG1X 3ALQR 3ME4A 2X10A 1D0GR 3U3TA 3URFZ 2UWIA 5IHLA 2HEYR 1FT4A 5DMJA 3MHDD 4GIQR 1NCFA 4M4RA 3U3VA 3QO4A 3ME2R 2H9GR 4J6GC 4BK4A 1DU3A 4KGGC 4RSUD 5L36B 1EXTA 2E4UA 1JMAB 2QR6A 4N90R 2AW2B
chains in the Genus database with same CATH topology
3U3PA 3K51B 4I9XC 4MSVB 3MBWA 1ZA3R 4MXWR 5CIRE 3THMF 3TJEF 4KGQC 3X3FA 1D4VA 3WVTA 3U3SA 1TNRR 3QD6R 4FHQA 5BNQR 3MI8D 4BK5A 4M4PA 3BUKC 3U3QA 4OD2S 4YN0A 3IJ2X 3FL7A 3QBQB 4E4DR 2HEVR 1SG1X 3ALQR 3ME4A 2X10A 1D0GR 3U3TA 3URFZ 2UWIA 5IHLA 2HEYR 1FT4A 5DMJA 3MHDD 4GIQR 1NCFA 4M4RA 3U3VA 3QO4A 3ME2R 2H9GR 4J6GC 4BK4A 1DU3A 4KGGC 4RSUD 5L36B 1EXTA 1JMAB 4N90R 2AW2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3P A;  3K51 B;  4I9X C;  4MSV B;  3MBW A;  1ZA3 R;  4MXW R;  5CIR E;  3THM F;  3TJE F;  4KGQ C;  3X3F A;  1D4V A;  3WVT A;  3U3S A;  1TNR R;  3QD6 R;  4FHQ A;  5BNQ R;  3MI8 D;  4BK5 A;  4M4P A;  3BUK C;  3U3Q A;  4OD2 S;  4YN0 A;  3IJ2 X;  3FL7 A;  3QBQ B;  4E4D R;  2HEV R;  1SG1 X;  3ALQ R;  3ME4 A;  2X10 A;  1D0G R;  3U3T A;  3URF Z;  2UWI A;  5IHL A;  2HEY R;  1FT4 A;  5DMJ A;  3MHD D;  4GIQ R;  1NCF A;  4M4R A;  3U3V A;  3QO4 A;  3ME2 R;  2H9G R;  4J6G C;  4BK4 A;  1DU3 A;  4KGG C;  4RSU D;  5L36 B;  1EXT A;  1JMA B;  4N90 R;  2AW2 B; 
#chains in the Genus database with same CATH topology
 3U3P A;  2E4V A;  3K51 B;  4I9X C;  4MSV B;  3MBW A;  1ZA3 R;  4MXW R;  2E4Y A;  5CIR E;  3TJE F;  3THM F;  4KGQ C;  3X3F A;  1D4V A;  3WVT A;  2E4X A;  3U3S A;  1TNR R;  3QD6 R;  2E4W A;  4FHQ A;  5BNQ R;  3MI8 D;  4BK5 A;  4M4P A;  3BUK C;  3U3Q A;  4OD2 S;  4YN0 A;  3IJ2 X;  3FL7 A;  3QBQ B;  4E4D R;  2HEV R;  1SG1 X;  3ALQ R;  3ME4 A;  2X10 A;  1D0G R;  3U3T A;  3URF Z;  2UWI A;  5IHL A;  2HEY R;  1FT4 A;  5DMJ A;  3MHD D;  4GIQ R;  1NCF A;  4M4R A;  3U3V A;  3QO4 A;  3ME2 R;  2H9G R;  4J6G C;  4BK4 A;  1DU3 A;  4KGG C;  4RSU D;  5L36 B;  1EXT A;  2E4U A;  1JMA B;  2QR6 A;  4N90 R;  2AW2 B; 
#chains in the Genus database with same CATH homology
 3U3P A;  3K51 B;  4I9X C;  4MSV B;  3MBW A;  1ZA3 R;  4MXW R;  5CIR E;  3THM F;  3TJE F;  4KGQ C;  3X3F A;  1D4V A;  3WVT A;  3U3S A;  1TNR R;  3QD6 R;  4FHQ A;  5BNQ R;  3MI8 D;  4BK5 A;  4M4P A;  3BUK C;  3U3Q A;  4OD2 S;  4YN0 A;  3IJ2 X;  3FL7 A;  3QBQ B;  4E4D R;  2HEV R;  1SG1 X;  3ALQ R;  3ME4 A;  2X10 A;  1D0G R;  3U3T A;  3URF Z;  2UWI A;  5IHL A;  2HEY R;  1FT4 A;  5DMJ A;  3MHD D;  4GIQ R;  1NCF A;  4M4R A;  3U3V A;  3QO4 A;  3ME2 R;  2H9G R;  4J6G C;  4BK4 A;  1DU3 A;  4KGG C;  4RSU D;  5L36 B;  1EXT A;  1JMA B;  4N90 R;  2AW2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...