3U3TA

The s-sad phased crystal structure of the ecto-domain of death receptor 6 (dr6)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
164
structure length
164
Chain Sequence
IGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S-SAD phasing study of death receptor 6 and its solution conformation revealed by SAXS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 21
total genus 27
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2011-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00020 TNFR_c6 TNFR/NGFR cysteine-rich region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3u3tA02
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3u3tA01
1DU3A 2AW2B 4OD2S 4BK4A 3MI8D 3TJEF 3QD6R 5CIRE 3MHDD 1JMAB 1D4VA 4MSVB 1SG1X 4KGQC 5IHLA 3U3PA 3IJ2X 3K51B 3U3VA 2X10A 3ME4A 2HEYR 3X3FA 3QBQB 4N90R 3ALQR 3FL7A 4J6GC 3URFZ 5L36B 4FHQA 3U3TA 1D0GR 1FT4A 4KGGC 4BK5A 2HEVR 4M4RA 3ME2R 4GIQR 5BNQR 1ZA3R 3QO4A 4E4DR 4YN0A 1EXTA 2H9GR 4M4PA 3MBWA 4I9XC 4RSUD 1NCFA 5DMJA 3U3SA 1TNRR 3THMF 3WVTA 4MXWR 3U3QA 2UWIA 3BUKC
chains in the Genus database with same CATH superfamily
1DU3A 2AW2B 4OD2S 4BK4A 3MI8D 3TJEF 3QD6R 5CIRE 3MHDD 1JMAB 1D4VA 4MSVB 1SG1X 4KGQC 5IHLA 3U3PA 2QR6A 3IJ2X 3K51B 3U3VA 2X10A 3ME4A 2HEYR 2E4UA 3X3FA 3QBQB 4N90R 3ALQR 3FL7A 4J6GC 3URFZ 5L36B 4FHQA 3U3TA 1D0GR 1FT4A 4KGGC 4BK5A 2E4WA 2HEVR 4M4RA 3ME2R 4GIQR 5BNQR 2E4XA 1ZA3R 3QO4A 2E4YA 4E4DR 4YN0A 1EXTA 2H9GR 4M4PA 3MBWA 4I9XC 4RSUD 1NCFA 5DMJA 3U3SA 1TNRR 3THMF 3WVTA 4MXWR 3U3QA 2E4VA 2UWIA 3BUKC
chains in the Genus database with same CATH topology
1DU3A 2AW2B 4OD2S 4BK4A 3MI8D 3TJEF 3QD6R 5CIRE 3MHDD 1JMAB 1D4VA 4MSVB 1SG1X 4KGQC 5IHLA 3U3PA 3IJ2X 3K51B 3U3VA 2X10A 3ME4A 2HEYR 3X3FA 3QBQB 4N90R 3ALQR 3FL7A 4J6GC 3URFZ 5L36B 4FHQA 3U3TA 1D0GR 1FT4A 4KGGC 4BK5A 2HEVR 4M4RA 3ME2R 4GIQR 5BNQR 1ZA3R 3QO4A 4E4DR 4YN0A 1EXTA 2H9GR 4M4PA 3MBWA 4I9XC 4RSUD 1NCFA 5DMJA 3U3SA 1TNRR 3THMF 3WVTA 4MXWR 3U3QA 2UWIA 3BUKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU3 A;  2AW2 B;  4OD2 S;  4BK4 A;  3MI8 D;  3TJE F;  3QD6 R;  5CIR E;  3MHD D;  1JMA B;  1D4V A;  4MSV B;  1SG1 X;  4KGQ C;  5IHL A;  3U3P A;  3IJ2 X;  3K51 B;  3U3V A;  2X10 A;  3ME4 A;  2HEY R;  3X3F A;  3QBQ B;  4N90 R;  3ALQ R;  3FL7 A;  4J6G C;  3URF Z;  5L36 B;  4FHQ A;  3U3T A;  1D0G R;  1FT4 A;  4KGG C;  4BK5 A;  2HEV R;  4M4R A;  3ME2 R;  4GIQ R;  5BNQ R;  1ZA3 R;  3QO4 A;  4E4D R;  4YN0 A;  1EXT A;  2H9G R;  4M4P A;  3MBW A;  4I9X C;  4RSU D;  1NCF A;  5DMJ A;  3U3S A;  1TNR R;  3THM F;  3WVT A;  4MXW R;  3U3Q A;  2UWI A;  3BUK C; 
#chains in the Genus database with same CATH topology
 1DU3 A;  2AW2 B;  4OD2 S;  4BK4 A;  3MI8 D;  3TJE F;  3QD6 R;  5CIR E;  3MHD D;  1JMA B;  1D4V A;  4MSV B;  1SG1 X;  4KGQ C;  5IHL A;  3U3P A;  2QR6 A;  3IJ2 X;  3K51 B;  3U3V A;  2X10 A;  3ME4 A;  2HEY R;  2E4U A;  3X3F A;  3QBQ B;  4N90 R;  3ALQ R;  3FL7 A;  4J6G C;  3URF Z;  5L36 B;  4FHQ A;  3U3T A;  1D0G R;  1FT4 A;  4KGG C;  4BK5 A;  2E4W A;  2HEV R;  4M4R A;  3ME2 R;  4GIQ R;  5BNQ R;  2E4X A;  1ZA3 R;  3QO4 A;  2E4Y A;  4E4D R;  4YN0 A;  1EXT A;  2H9G R;  4M4P A;  3MBW A;  4I9X C;  4RSU D;  1NCF A;  5DMJ A;  3U3S A;  1TNR R;  3THM F;  3WVT A;  4MXW R;  3U3Q A;  2E4V A;  2UWI A;  3BUK C; 
#chains in the Genus database with same CATH homology
 1DU3 A;  2AW2 B;  4OD2 S;  4BK4 A;  3MI8 D;  3TJE F;  3QD6 R;  5CIR E;  3MHD D;  1JMA B;  1D4V A;  4MSV B;  1SG1 X;  4KGQ C;  5IHL A;  3U3P A;  3IJ2 X;  3K51 B;  3U3V A;  2X10 A;  3ME4 A;  2HEY R;  3X3F A;  3QBQ B;  4N90 R;  3ALQ R;  3FL7 A;  4J6G C;  3URF Z;  5L36 B;  4FHQ A;  3U3T A;  1D0G R;  1FT4 A;  4KGG C;  4BK5 A;  2HEV R;  4M4R A;  3ME2 R;  4GIQ R;  5BNQ R;  1ZA3 R;  3QO4 A;  4E4D R;  4YN0 A;  1EXT A;  2H9G R;  4M4P A;  3MBW A;  4I9X C;  4RSU D;  1NCF A;  5DMJ A;  3U3S A;  1TNR R;  3THM F;  3WVT A;  4MXW R;  3U3Q A;  2UWI A;  3BUK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...