The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
7
|
sequence length |
87
|
structure length |
87
|
Chain Sequence |
MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMGSTDEKICPYCSTLYRYDPSLSYNQTNPTGCLYNPKLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution NMR structure of BH09830 from Bartonella henselae modeled with one Zn+2 bound.
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Bartonella henselae str. houston-1
|
| molecule keywords |
Uncharacterized protein BH09830
|
| total genus |
7
|
| structure length |
87
|
| sequence length |
87
|
| ec nomenclature | |
| pdb deposition date | 2007-12-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF10276 | zf-CHCC | Zinc-finger domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | q5lls5 like domains |
#chains in the Genus database with same CATH superfamily 2JRR A; 2ODX A; 2JZ8 A; 2JVM A; #chains in the Genus database with same CATH topology 2JRR A; 2ODX A; 1EB0 A; 1NLT A; 2JVM A; 3AGZ A; 1XAO A; 4L3K A; 3LA0 A; 1GMV A; 3AKO B; 3AGY A; 2JZ8 A; 3TJA A; 2B26 A; 1GMU A; 1EAR A; 3C6E C; 3C5X C; 3NY0 A; 1C3G A; 1GMW A; 2Q2G A; 2QLD A; 3NXZ A; 3AGX A; 3LZ8 A; 4J80 A; 1GMW D; 3TJ8 A; 3L9Z A; 3TJ9 A; 3I38 A; #chains in the Genus database with same CATH homology 2JRR A; 2ODX A; 2JZ8 A; 2JVM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
