The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
169
|
structure length |
169
|
Chain Sequence |
PPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Signaling protein
|
| source organism |
Mus musculus
|
| publication title |
Structural and Functional Insights of RANKL-RANK Interaction and Signaling.
pubmed doi rcsb |
| molecule keywords |
Tumor necrosis factor receptor superfamily member 11A
|
| total genus |
33
|
| structure length |
169
|
| sequence length |
169
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-03-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00020 | TNFR_c6 | TNFR/NGFR cysteine-rich region |
| A | PF18278 | RANK_CRD_2 | Receptor activator of the NF-KB cysteine-rich repeat domain 2 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Tumor Necrosis Factor Receptor, subunit A; domain 2 | Tumor Necrosis Factor Receptor, subunit A, domain 2 | ||
| Mainly Beta | Ribbon | Tumor Necrosis Factor Receptor, subunit A; domain 2 | Tumor Necrosis Factor Receptor, subunit A, domain 2 |
#chains in the Genus database with same CATH superfamily 3MBW A; 1JMA B; 3WVT A; 3X3F A; 2HEV R; 3TJE F; 3QBQ B; 4N90 R; 4RSU D; 1D4V A; 3BUK C; 4BK4 A; 4M4R A; 4I9X C; 4OD2 S; 3MI8 D; 5CIR E; 3U3P A; 1DU3 A; 2HEY R; 3FL7 A; 3IJ2 X; 3K51 B; 5BNQ R; 4KGQ C; 4J6G C; 3U3T A; 1D0G R; 2H9G R; 3THM F; 3U3S A; 5IHL A; 3ALQ R; 5L36 B; 1SG1 X; 4BK5 A; 3ME4 A; 1EXT A; 3URF Z; 1NCF A; 1ZA3 R; 4GIQ R; 4E4D R; 3QD6 R; 4FHQ A; 2AW2 B; 1TNR R; 3QO4 A; 3U3V A; 4KGG C; 3ME2 R; 3U3Q A; 4M4P A; 4MSV B; 5DMJ A; 2X10 A; 3MHD D; 1FT4 A; 4MXW R; 2UWI A; 4YN0 A; #chains in the Genus database with same CATH topology 3MBW A; 1JMA B; 3WVT A; 3X3F A; 2HEV R; 3TJE F; 3QBQ B; 4N90 R; 4RSU D; 1D4V A; 3BUK C; 4BK4 A; 2E4Y A; 4M4R A; 4I9X C; 4OD2 S; 3MI8 D; 5CIR E; 3U3P A; 1DU3 A; 2E4V A; 2HEY R; 3FL7 A; 3IJ2 X; 3K51 B; 4KGQ C; 4J6G C; 3U3T A; 1D0G R; 2H9G R; 3THM F; 3U3S A; 5BNQ R; 3ALQ R; 5IHL A; 5L36 B; 1SG1 X; 4BK5 A; 3ME4 A; 2E4U A; 1EXT A; 3URF Z; 1NCF A; 1ZA3 R; 4GIQ R; 4E4D R; 3QD6 R; 4FHQ A; 2AW2 B; 1TNR R; 2E4X A; 3QO4 A; 3U3V A; 4KGG C; 2QR6 A; 3ME2 R; 3U3Q A; 4M4P A; 4MSV B; 5DMJ A; 2X10 A; 3MHD D; 1FT4 A; 4MXW R; 2UWI A; 4YN0 A; 2E4W A; #chains in the Genus database with same CATH homology 3MBW A; 1JMA B; 3WVT A; 3X3F A; 2HEV R; 3TJE F; 3QBQ B; 4N90 R; 4RSU D; 1D4V A; 3BUK C; 4BK4 A; 4M4R A; 4I9X C; 4OD2 S; 3MI8 D; 5CIR E; 3U3P A; 1DU3 A; 2HEY R; 3FL7 A; 3IJ2 X; 3K51 B; 5BNQ R; 4KGQ C; 4J6G C; 3U3T A; 1D0G R; 2H9G R; 3THM F; 3U3S A; 5IHL A; 3ALQ R; 5L36 B; 1SG1 X; 4BK5 A; 3ME4 A; 1EXT A; 3URF Z; 1NCF A; 1ZA3 R; 4GIQ R; 4E4D R; 3QD6 R; 4FHQ A; 2AW2 B; 1TNR R; 3QO4 A; 3U3V A; 4KGG C; 3ME2 R; 3U3Q A; 4M4P A; 4MSV B; 5DMJ A; 2X10 A; 3MHD D; 1FT4 A; 4MXW R; 2UWI A; 4YN0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
