The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
168
|
structure length |
168
|
Chain Sequence |
SLPGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNMSLRVCSSCPAGTFTRHENGIERCHDCSQPCPWPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCKAHTDCLGQNLEVVKPGTKETDNVCGMRLF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The crystal structure of DR6 in complex with the amyloid precursor protein provides insight into death receptor activation.
pubmed doi rcsb |
| molecule keywords |
Tumor necrosis factor receptor superfamily member 21
|
| molecule tags |
Apoptosis/cell adhesion
|
| source organism |
Mus musculus
|
| total genus |
27
|
| structure length |
168
|
| sequence length |
168
|
| ec nomenclature | |
| pdb deposition date | 2015-03-08 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00020 | TNFR_c6 | TNFR/NGFR cysteine-rich region |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Tumor Necrosis Factor Receptor, subunit A; domain 2 | Tumor Necrosis Factor Receptor, subunit A, domain 2 | ||
| Mainly Beta | Ribbon | Tumor Necrosis Factor Receptor, subunit A; domain 2 | Tumor Necrosis Factor Receptor, subunit A, domain 2 |
#chains in the Genus database with same CATH superfamily 2HEY R; 3K51 B; 4M4P A; 3ME4 A; 5DMJ A; 3URF Z; 3U3P A; 4OD2 S; 5L36 B; 4N90 R; 3QD6 R; 4GIQ R; 4M4R A; 5IHL A; 4KGG C; 1D4V A; 1NCF A; 2X10 A; 3BUK C; 3IJ2 X; 4FHQ A; 3U3T A; 1EXT A; 3MI8 D; 4BK5 A; 2HEV R; 4YN0 A; 1TNR R; 3ALQ R; 4RSU D; 3THM F; 3QBQ B; 1JMA B; 3QO4 A; 1DU3 A; 4BK4 A; 3FL7 A; 3MHD D; 4KGQ C; 5BNQ R; 4MSV B; 4MXW R; 1FT4 A; 3U3V A; 1SG1 X; 5CIR E; 4J6G C; 2UWI A; 2AW2 B; 2H9G R; 1ZA3 R; 3MBW A; 4I9X C; 3TJE F; 3WVT A; 3X3F A; 4E4D R; 3U3S A; 3ME2 R; 1D0G R; 3U3Q A; #chains in the Genus database with same CATH topology 2HEY R; 3K51 B; 4M4P A; 3ME4 A; 5DMJ A; 3URF Z; 3U3P A; 4OD2 S; 2E4V A; 4N90 R; 5L36 B; 2E4X A; 3QD6 R; 4GIQ R; 4M4R A; 5IHL A; 2E4Y A; 4KGG C; 1D4V A; 1NCF A; 2X10 A; 3BUK C; 2E4U A; 3IJ2 X; 4FHQ A; 3U3T A; 1EXT A; 3MI8 D; 4BK5 A; 2HEV R; 4YN0 A; 1TNR R; 3ALQ R; 4RSU D; 3THM F; 3QBQ B; 1JMA B; 3QO4 A; 1DU3 A; 4BK4 A; 3FL7 A; 3MHD D; 4KGQ C; 5BNQ R; 4MSV B; 2QR6 A; 4MXW R; 1FT4 A; 3U3V A; 1SG1 X; 5CIR E; 4J6G C; 2UWI A; 2AW2 B; 2H9G R; 1ZA3 R; 3MBW A; 4I9X C; 3TJE F; 3WVT A; 3X3F A; 4E4D R; 3U3S A; 3ME2 R; 1D0G R; 2E4W A; 3U3Q A; #chains in the Genus database with same CATH homology 2HEY R; 3K51 B; 4M4P A; 3ME4 A; 5DMJ A; 3URF Z; 3U3P A; 4OD2 S; 5L36 B; 4N90 R; 3QD6 R; 4GIQ R; 4M4R A; 5IHL A; 4KGG C; 1D4V A; 1NCF A; 2X10 A; 3BUK C; 3IJ2 X; 4FHQ A; 3U3T A; 1EXT A; 3MI8 D; 4BK5 A; 2HEV R; 4YN0 A; 1TNR R; 3ALQ R; 4RSU D; 3THM F; 3QBQ B; 1JMA B; 3QO4 A; 1DU3 A; 4BK4 A; 3FL7 A; 3MHD D; 4KGQ C; 5BNQ R; 4MSV B; 4MXW R; 1FT4 A; 3U3V A; 1SG1 X; 5CIR E; 4J6G C; 2UWI A; 2AW2 B; 2H9G R; 1ZA3 R; 3MBW A; 4I9X C; 3TJE F; 3WVT A; 3X3F A; 4E4D R; 3U3S A; 3ME2 R; 1D0G R; 3U3Q A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...