1F39A

Crystal structure of the lambda repressor c-terminal domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
ASASAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the lambda repressor C-terminal domain provides a model for cooperative operator binding.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
molecule keywords REPRESSOR PROTEIN CI
total genus 14
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1f39A00
1KCAA 1B12A 1KN9A 1JHFA 1JHHA 1F39A 3JSPA 1UMUA 1I4VA 4NV4A 3IIQA 1JHEA 2HO0A 4ME8A 2FJRA 4N31A 1JHCA 1AY9A 2FKDA 3BDNA 3JSOA 4K8WA 3K2ZA 1T7DA 2HNFA 3S04A
chains in the Genus database with same CATH superfamily
1KCAA 1B12A 1KN9A 1JHFA 1JHHA 1F39A 3JSPA 1UMUA 1I4VA 4NV4A 3IIQA 1JHEA 2HO0A 4ME8A 2FJRA 4N31A 1JHCA 1AY9A 2FKDA 3BDNA 3JSOA 4K8WA 3K2ZA 1T7DA 2HNFA 3S04A
chains in the Genus database with same CATH topology
1KCAA 1B12A 1KN9A 1JHFA 1JHHA 1F39A 3JSPA 1UMUA 1I4VA 4NV4A 3IIQA 1JHEA 2HO0A 4ME8A 2FJRA 4N31A 1JHCA 1AY9A 2FKDA 3BDNA 3JSOA 4K8WA 3K2ZA 1T7DA 2HNFA 3S04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KCA A;  1B12 A;  1KN9 A;  1JHF A;  1JHH A;  1F39 A;  3JSP A;  1UMU A;  1I4V A;  4NV4 A;  3IIQ A;  1JHE A;  2HO0 A;  4ME8 A;  2FJR A;  4N31 A;  1JHC A;  1AY9 A;  2FKD A;  3BDN A;  3JSO A;  4K8W A;  3K2Z A;  1T7D A;  2HNF A;  3S04 A; 
#chains in the Genus database with same CATH topology
 1KCA A;  1B12 A;  1KN9 A;  1JHF A;  1JHH A;  1F39 A;  3JSP A;  1UMU A;  1I4V A;  4NV4 A;  3IIQ A;  1JHE A;  2HO0 A;  4ME8 A;  2FJR A;  4N31 A;  1JHC A;  1AY9 A;  2FKD A;  3BDN A;  3JSO A;  4K8W A;  3K2Z A;  1T7D A;  2HNF A;  3S04 A; 
#chains in the Genus database with same CATH homology
 1KCA A;  1B12 A;  1KN9 A;  1JHF A;  1JHH A;  1F39 A;  3JSP A;  1UMU A;  1I4V A;  4NV4 A;  3IIQ A;  1JHE A;  2HO0 A;  4ME8 A;  2FJR A;  4N31 A;  1JHC A;  1AY9 A;  2FKD A;  3BDN A;  3JSO A;  4K8W A;  3K2Z A;  1T7D A;  2HNF A;  3S04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...