3S04A

Crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
245
structure length
209
Chain Sequence
FIYEPFQIPSGSMMPTLLIGDFILVEKFAHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSACENALPVTYSNVEPSDFVQTFTSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDLRLSRIGGIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and characterization of the arylomycin lipoglycopeptide antibiotics and the crystallographic analysis of their complex with signal peptidase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords Signal peptidase I
total genus 47
structure length 209
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.89: Signal peptidase I.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF10502 Peptidase_S26 Signal peptidase, peptidase S26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3s04A01
2.170.230.10 Mainly Beta Beta Complex Signal Peptidase I; Chain: A, domain 2 Signal Peptidase I; Chain: A, domain 2 3s04A02
1UMUA 3IIQA 3K2ZA 1B12A 1I4VA 4K8WA 1AY9A 1JHFA 1KCAA 4NV4A 1F39A 1JHEA 1KN9A 2FJRA 3S04A 4ME8A 1JHCA 3JSPA 2HNFA 3JSOA 3BDNA 2FKDA 4N31A 1T7DA 1JHHA 2HO0A
chains in the Genus database with same CATH superfamily
1UMUA 3IIQA 3K2ZA 1B12A 1I4VA 4K8WA 1AY9A 1JHFA 1KCAA 4NV4A 1F39A 1JHEA 1KN9A 2FJRA 3S04A 4ME8A 1JHCA 3JSPA 2HNFA 3JSOA 3BDNA 2FKDA 4N31A 1T7DA 1JHHA 2HO0A
chains in the Genus database with same CATH topology
1UMUA 3IIQA 3K2ZA 1B12A 1I4VA 4K8WA 1AY9A 1JHFA 1KCAA 4NV4A 1F39A 1JHEA 1KN9A 2FJRA 3S04A 4ME8A 1JHCA 3JSPA 2HNFA 3JSOA 3BDNA 2FKDA 4N31A 1T7DA 1JHHA 2HO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMU A;  3IIQ A;  3K2Z A;  1B12 A;  1I4V A;  4K8W A;  1AY9 A;  1JHF A;  1KCA A;  4NV4 A;  1F39 A;  1JHE A;  1KN9 A;  2FJR A;  3S04 A;  4ME8 A;  1JHC A;  3JSP A;  2HNF A;  3JSO A;  3BDN A;  2FKD A;  4N31 A;  1T7D A;  1JHH A;  2HO0 A; 
#chains in the Genus database with same CATH topology
 1UMU A;  3IIQ A;  3K2Z A;  1B12 A;  1I4V A;  4K8W A;  1AY9 A;  1JHF A;  1KCA A;  4NV4 A;  1F39 A;  1JHE A;  1KN9 A;  2FJR A;  3S04 A;  4ME8 A;  1JHC A;  3JSP A;  2HNF A;  3JSO A;  3BDN A;  2FKD A;  4N31 A;  1T7D A;  1JHH A;  2HO0 A; 
#chains in the Genus database with same CATH homology
 1UMU A;  3IIQ A;  3K2Z A;  1B12 A;  1I4V A;  4K8W A;  1AY9 A;  1JHF A;  1KCA A;  4NV4 A;  1F39 A;  1JHE A;  1KN9 A;  2FJR A;  3S04 A;  4ME8 A;  1JHC A;  3JSP A;  2HNF A;  3JSO A;  3BDN A;  2FKD A;  4N31 A;  1T7D A;  1JHH A;  2HO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...