3JSOA

Classic protein with a new twist: crystal structure of a lexa repressor dna complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
188
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLGLPLVGRVAAGEPLIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LexA-DNA complex and implications for SOS box measurement.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase/dna
molecule keywords LexA repressor
total genus 45
structure length 188
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jsoA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3jsoA02
1HW1A 5L3BA 1KA8A 4OIQF 4YIIA 1FP1D 2ESHA 2H94A 2CSOA 4GYIA 4HW0A 2QWWA 5HDGA 1D3YA 4RGRA 1WWXA 5E17F 4KNYA 2VOPA 3DEUA 3E3VA 2DK5A 3ZMVA 3I71A 3KP3A 1GXPA 4U0YA 1R1TA 4ENNA 4EM1A 1I5ZA 4CXFA 4UHTA 3K0LA 2P7CB 1O3RA 1IRGA 4HX8A 4I0BA 3H3ZA 4LGWA 2D2WA 1LB2A 2VN2A 1J5YA 3LWFA 1STZA 4CGZA 1J0RA 4KIGA 2BGCA 3T5XA 3LFKA 4OOIA 4OIRF 2DPDA 1W4MA 4O3MA 1YLFA 1YS7A 2ZFWA 2FSWA 4A0YA 3KLNA 1RNLA 3F8NA 1ON1A 1FP2A 1W7PA 3K9TA 1O3TA 1Z9CA 4WXHA 3MZYA 5D5XB 3FMQA 3F3XA 2F2EA 1VTNC 3FX3A 3KP6A 3D0SA 2EFOA 4R79A 1P4AA 1AOYA 2FBIA 1QGPA 5IT9K 2WTEA 1GHCA 4EM0B 2CGPA 3I59A 3GUDA 2HOEA 2FRHA 4CYDA 1U5TA 2EV5A 1TQMA 2COMA 2ZXJA 3DP7A 1JGSA 4ZZDA 2UXNA 4WX9A 2R3SA 2G7UA 3E6DA 3KCCA 1UFMA 4MQ9F 3LA7A 2PFBA 4MQVA 3KETA 2MD5A 3TOAA 4UUVA 1CF7A 1S29A 2XAQA 4LFUA 4NV4A 1HSJA 2DT5A 3WG9A 4ENKA 2IA0A 4O6JA 1S6LA 2YU3A 3C18A 1P92A 3IHUA 3ZMSA 4Q48A 4EMSA 2M45A 3M8FA 4AD9A 1P4WA 3SQNA 4BQAA 3KZZA 3FXUA 1U3EM 1IN7A 4BAYA 4LLNA 5HDKA 1G3WA 5CLSA 2M87A 2KKOA 2XUBA 4Q47A 2DQRA 2IPQX 4I01A 5FB2A 1A04A 3U9GA 3KLOA 1UHMA 2KIUA 2XAJA 2HEOA 4P96A 5E8IA 3K69A 5FLXK 3BY6A 1SMYF 4P55A 5IT3A 4N31A 5CVJA 3TKYA 3KE2A 4K8WA 1T0FA 1ZREA 5FLXZ 2XHKA 1KU7A 3L2CA 4IPAA 2D1HA 1ZRFA 4BNCA 5EEHA 2A61A 1Z1DA 4F7ZA 2ZNYA 1OYYA 4KMFA 2O03A 1QNTA 1NHAA 2FNAA 2CQKA 2DBBA 2P5KA 1ZN2A 3W6KB 3QOPA 4JK1X 3L7WA 4A0ZA 4WXCA 2QLZA 3KP5A 2XKOA 2HZTA 3D5LA 2EFWA 1ZGJA 4N0BA 3WTWC 2F5EA 2OBPA 1ZH5A 4ETSA 2JT1A 3TOBA 3G3ZA 1JE8A 5BS6A 2KJBA 2VT3A 4Q4ZF 4LB5A 2BE5F 3MEXA 4UXNA 1IN6A 1P4XA 2PG4A 2RGVA 2AXLA 1LVAA 3EQLF 2FA5A 3WODF 1Z7UA 2CYYA 2H6CA 3ECHA 3O3KA 4XSZF 3J81K 5A2QK 2P5VA 3E97A 4KA4A 1FC3A 1I1SA 3JAMZ 3RYPA 5KK1A 4GO1A 4Z2YA 4U7BA 5AIQA 2ZMEA 3P9KA 1JXSA 3COAC 2ZKZA 2ZBKA 1XGMA 3CTAA 4M74A 2B0LA 4YFXF 2GZWA 4HYEA 1I27A 3F8BA 2WWYA 2XROA 1T6SA 3VFZA 1FYLA 1B6AA 1YW7A 2A69F 3MFKA 3OV8A 3HYIA 2O61A 5FFXA 1L3LA 2Q8KA 4B8XA 1XN7A 2JSCA 4A5NA 2Q2EA 3ZMZA 4M9ZA 5D6FA 1ONVA 3V4GA 2K7LA 2MA3A 2QYOA 1R00A 2MH2A 2MLGA 2M8EA 1R58A 4LK1F 2IVMA 3U1DA 5CVVA 4HF0A 3GWZA 1USTA 2A3SA 4UV8A 3F22A 3KP2A 3IWFA 2PMHA 3QP5A 1TW2A 4WCGA 4WF2A 3G73A 4YFKF 4P9FA 2F5DA 4RB1A 1W7PB 2VC0A 2H27A 4Y17A 4XLNF 3GO5A 2HFHA 3E5XA 1QQIA 1XB4A 3VB2A 4DQ2A 1ZLJA 2RQPA 3QU6A 1KQ9A 1RUNA 2FEZA 1HKTA 2GAUA 4KDPA 3WE2A 3QAHA 3BDNA 3LQQA 5L3CA 1XCVA 2UWMA 2XRNA 2M5WA 3LQRA 1H9GA 1TBXA 3JSPA 1JHHA 2EFPA 2XAFA 1HKQA 1D8KA 3F21A 3IRQA 2HR3A 1BOAA 2PQ8A 2DK8A 3R0AA 4R1HA 5LGUA 3V8JA 4A6EA 4BH9A 3BP8A 2FOKA 3ZN0A 2W25A 1TW3A 3GLXA 2PN6A 3R60A 3R0JA 1LEAA 1W5SA 2OAZA 4OIPF 3VOEA 5H6QA 5LEKA 3MWMA 4G9YA 5TRDA 2Q0OA 1MJAA 1T38A 3GEZA 2QQ9A 1SAXA 3CJNA 1FT9A 1W5TA 1T2KA 3BWGA 4L9TA 5HVQC 4MHGA 2ZNZA 2LSOA 1Z6RA 2GWRA 2GQQA 4M72A 5A2QZ 3IIQA 3Q5FA 1G3SA 5DD8A 2EV6A 2ESNA 2Z3YA 4FX4A 4MTDA 3CUQA 4A0XA 2ISZA 1OYIA 2VBZA 4XSXF 1S8NA 5DCMB 1YTYA 2NNYA 5FFZA 2VOOA 1U5TB 1FY7A 2ADUA 3KEQA 4ENMA 4EJWA 5JHUA 3ZMDA 2W84A 1U6GA 3DXJF 3BJOA 1YW9A 4G6QA 2UXXA 4S05A 4M6YA 4IRIA 4HZFA 1H0MA 2RN7A 1MKMA 1F39A 2O3FA 4MEYF 1Z05A 3GF2A 4G94A 3ISPA 1BI3A 2V79A 4OMZA 3I64A 5H6RA 3DV8A 1HW2A 2K86A 4CZZA 1ZAOA 1X3UA 2JPCA 4HF2A 1IUYA 4Y15A 3ZN1A 2Y75A 3RPQA 1R1VA 3E5UA 3HUGA 1AWCA 1MDMA 2M1BA 4ZYDA 1ZHFA 2V1UA 2CO5A 4WK8F 5DCFA 2L54A 1V3FA 3HTSB 2A6EF 2RNJA 1R22A 3GFMA 3HIFA 1HW5A 5L3FA 3RKYA 4HAMA 3T8TA 5JVTA 1BN5A 1FWZA 3KP4A 4HBLA 4A12A 2VBXA 1ODDA 1Q1HA 1SFEA 1K78B 3QRFF 4HX4A 3KFWX 2A07F 4KIBA 1Z91A 2J5OA 2L3DA 2VODA 4OU0A 3JAMK 2JPBA 5J8CA 1XDSA 5CJ9A 4EJTA 4EJVA 1I6XA 2F5CA 2IA1A 2P5LC 3J81Z 3S04A 1MDMB 5ILVA 4HDUA 1FNNA 5D5UB 4H0EA 1LDJA 1UMUA 4WWCA 2GA2A 5FD5A 4A6DA 5KVRA 4TV7A 1R5GA 5E20A 4BXUA 1BBYA 2BYVE 2L4MA 2QBYA 2HKOA 4LD5A 2CFXA 3E5QA 3F23A 5J8FA 1CGPA 2V9VA 2MC3A 3BROA 3HSEA 2IW5A 1LDKB 3FF5A 4L0YB 1K6OA 5ILSA 1V4RA 1XGNA 3IWZA 3Q9SA 5D6EA 2W85A 1XD7A 5E1ZB 2EFNA 4HV6A 1K79A 1S7AA 3H92A 4O5VA 2GXBA 3ROUA 3P7NA 1MJ9A 4ME8A 1KYWA 4U7DA 4KN7X 1B1BA 2KIFA 3TO6A 3MAJA 1PDNC 3H3UA 1HXDA 1S3JA 1F4KA 2CW0F 3HSFA 3JTGA 1KQ8A 4N9HA 2QBYB 3GZ6A 3B73A 5EEGA 3GFJA 2R7FA 1FPQA 4EJOA 2RV8A 3L09A 3RI4A 2JZYA 4XBFA 1IAWA 3TO7A 4RB2C 3N97A 1LQ1A 3FMRA 1FOKA 5LHGA 5LGTA 4I98B 5D5VB 2LF7A 4L18B 1BI1A 1BIAA 4EVIA 5FO5A 5BPDA 5BPIA 3EETA 1SD7A 1OPCA 2P4WA 1FBSA 3S2WA 4PZJA 2TDXA 3VODA 2O6GE 1QBJA 1RZ4A 4U88A 3WGIA 1FX7A 1D8JA 4PGHA 3N4MA 2ELHA 2ACJA 2XAHA 4ESFA 2QQBA 3IL2A 2RKHA 1R5HA 2G7HA 1KQ0A 1LNWA 5HLIA 4U0VA 4DNCA 3FM3A 4RB0A 4RS8A 1FSEA 3E6CC 4M9SA 2IA2A 3BPXA 2VONA 3F72A 5K5OA 1XSVA 4CDGA 1FSHA 4QLCU 1J9IA 2L01A 5BQTA 1TQPA 5L3DA 4ESBA 1CF7B 3LAJA 3AAFA 3W6JB 4IF4A 2F5FA 3WTYC 4U0WA 3BZ6A 1OR7A 2OQGA 3V7CA 2LF8A 2JTVA 5LHHA 1O57A 1GXQA 1U78A 2VE8A 4I7HA 3FM5A 4IXAA 1B59A 2FNPA 2FKDA 1XCBA 2RC4A 5HLGA 3CDHA 3FXQA 1IN4A 4HF1A 1SD5A 2ZO4A 2V6CA 3K1NA 2K4BA 3WU1B 3PQKA 1QPMA 2FJRA 1IXSB 3EYYA 2HYGD 3RTRA 5LHIA 1FBQA 3SZTA 3ULQB 1SFXA 2HWVA 2MH9A 1YYVA 1U2WA 4KT5C 3V7RA 4ESJA 2M30A 1ZRDA 2YX4A 4KUMA 3CO6C 4EM2A 1IZ1A 4NQWA 4WXDA 3FXRA 2W24A 3RJPA 5H20A 5D8KB 3RKXA 5DCMA 3SHFA 2LKPA 4IHSA 4L9VA 4AVPA 2O8XA 1ZG1A 3WTTC 2ISYA 1KGSA 2KIMA 3QPHA 4ZYGA 4IVNA 3DPTA 3QU3A 4HQEA 3O2PE 5HOOA 1ZYRF 1B9NA 3DKWA 1UHWA 1KU2A 3DPLC 3TDUC 2Z9OA 4M73A 4FX0A 2PLYA 2BEOA 1SMTA 4LJZF 5AIPA 3I4PA 1WQ2A 3WTUC 1TNTA 5FD6A 3K1PA 5TJJA 3GYHX 2C6YA 4EJUA 4ZYEA 3Q9VA 3PFIA 3F8FA 5E8GA 1YS6A 3BDDA 4LG0B 1J2XA 4LMYA 3WE3A 2FBHA 4I02A 4A2UA 4UVAA 1REPC 3ZMUA 2EA4A 3WGHA 1E17A 6PAXA 1BIBA 5ICEA 3ZMTA 2QUFA 1ZG3A 3F8MA 2LDUA 2P8TA 3F8CA 3HRUA 3CUQB 5HS7A 1OMIA 1Z6TA 1MJBA 2XGXA 4MNUA 2HQNA 2J5PA 1MD0A 2OQRA 1IF1A 1B12A 2NRAC 3I58A 1DDNA 2EB7A 3V8KA 2XAGA 1B4AA 3MQ0A 3GFLA 3NRVA 2OA4A 4RGUA 5DYMA 2YR2A 1U5TC 4HDVA 2IP2A 4XLPF 1EH6A 1S7OA 2X0LA 3FMSA 4ASNA 5CVUA 1BC7C 3T8RA 3SZPA 2JRTA 3V8LA 3L9FA 4ENJA 1W7PD 4RAYA 3REOA 3TGNA 4RAZA 1R7JA 4M6XA 2CG4A 1OKRA 3IKVA 3U2RA 3IKTA 2RVCA 2XASA 1XGSA 3ZP5A 1J75A 1XMAA 4P9UA 2L02A 4I09A 4HX7A 1R23A 3KZYA 2HTJA 1YIOA 2YPRA 2W57A 3LA3A 4JQFA 2P7VB 4LB6B 2DI3A 5D8LB 3NEUA 1D5VA 3IC7A 3V7SA 1TNSA 5LBQA 2E1CA 1G4DA 2IJLA 3R6SA 2K4JA 1G3YA 2PMUA 1YG2A 1O3SA 3ZQ7A 1I1GA 4IRHA 3GVAA 2Z5UA 3QPTA 2Z99A 4YG2F 4IRGA 3MZHA 1SD4A 3R4KA 2QENA 4Q5SF 2VT2A 3T1BA 4BHBA 4L5IA 4MEXF 5BMZA 2P6TA 2K27A 1BJAA 4AIKA 3HOTA 1RUOA 1XGOA 3GX4X 5HS8A 1IXRC 1FZPB 2HGCA 1QO0D 2R7DA 4IHTA 3WTZA 3K2ZA 3MCZA 3TQNA 1GVJA 4FT8A 4I2OA 1XSDA 1KYZA 4HOBA 2BV6A 3QP6A 2E7WA 2PJPA 3WTVC 4XRFA 1XSXA 1RI7A 2A68F 2NAZA 5F6FA 4B09A 4CO8A 1EH8A 1TLHB 5LLQA 1ZGAA 5ED4A 3E6MA 2E7XA 3HTUA 4L9NA 2V1XA 1KU3A 3WTXC 2NNNA 4GCVA 5LGNA 1G3TA 2XKPA 2STWA 4UNOA 3FWEA 4KYWA 4PCQA 1DP7P 2EK5A 2EV0A 2OU2A 1BI0A 4HA8A 3KP7A 3C1DA 1MGTA 1JHFA 2MBFA 4PDKA 2PI0A 2H09A 3RPUA 4M9XA 4AIJA 1HBXG 1QZZA 1UCRA 3I5UA 3SXYA 5E1WA 4OIOF 4D0PA 2D1VA 2IRFG 5K5QA 2XV4S 5DDGA 4KN4X 5LRRA 2FBKA 3ELKA 4HLXA 4OMYA 1H9TA 1J59A 1EV7A 3PQJA 1DPRA 4QWQA 1ZG5A 4GGGA 4LG0A 3BPVA 4AWXB 4IJAA 5JR3A 5K1YA 3HHHA 2FF4A 3RIRA 4JBAA 1UB9A 1XMKA 2IT0A 3JW4A 5L3EA 2VE9A 3HHGA 3DQVC 4L9JA 2OZ6A 4G7ZF 3ML6A 4YIFA 5ICGA 2XIGA 3M8EA 4BYYA 5LEJA 1DPUA 4HQMA 5AONA 2PBIA 3J80K 1HQCA 2HYFA 4RB3C 1IRFA 3HRMA 3GZ5A 4L0ZB 4LK0F 3ERED 1U8RA 4CICA 3EYIA 4CHUA 1IN5A 3I59B 3ZPLA 2X4HA 2A6HF 5BOXA 3RYRA 3JSOA 2VBWA 4BHCA 2L4AA 5D4SA 2EA2A 2DAOA 4KFCA 3HSRA 4A5MA 1YO5C 1JHEA 1OYWA 2VXZA 1HSTA 3F6OA 3K1MA 1T7DA 4HLYA 4G6DA 1WRJA 1MZBA 4BHPA 3P9CA 1FYKA 3GW2A 2ZCWA 1YFHA 1E2XA 3GXOA 4AIHA 1J7KA 1JHCA 1XDUA 1HKSA 4EV0A 5ERIA 2VBYA 3O6BB 2DU9A 2FQ3A 4MTEA 1R36A 2GA1A 4I0AA 2DFIA 5F64A 3FHZA 5E1XA 4EGZA 2A5YB 2DTRA 3HOSA 5E18F 1FLIA 2ZMEB 2FMYA 1P2FA 3B02A 2PEXA 3J80Z 4YFNF 1KN9A 4GXOA 3VEPA 2Y48A 5ICFA 1O7FA 1WI9A 3BJAA 2HO0A 4E70A 3BOQA 3NQOA 3KEOA 3TDZC 4RGXA 1WKMA 4OINF 4G7OF 2QQAA 2NYXA 3EUHA 3CUQC 1LEBA 1ON2A 1LDDA 2DLLA 2DW4A 1IW7F 3T0YA 4K2EA 2G9WA 2Y0MA 3BJ6A 2BBYA 3J7AO 3RDIA 4L5JA 2HDCA 5F1RA 2HS5A 5ILUA 2KRFA 4UVCA 1LJ9A 2OD5A 2GIVA 2RDPA 1EH7A 3M9AA 4EGYA 3JTHA 1KCAA 1SD6A 2HNFA 1T39A 4KIFA 2OZUA 4NB5A 1YQAA 4G7HF 2HTSA 2D45A 3TO9A 3RKWA 2H6BA 2STTA 4LLGF 1P6RA 2UZKA 1L0OC 1R1UA 5JFRA 2EWNA 2P6SA 3DFGA 2EJRA 2QVOA 2FE3A 1G6NA 5ICCA 3F6VA 4LLLA 1IN8A 1TQIA 2O0YA 2HQRA 2Z33A 2GXGA 1USSA 1PP7U 3C3WA 4ZYHA 5DV5A 4KMUX 3DF8A 3OOPA 1O3QA 3HRSA 5CYVA 2VC1A 4KICA 2EFQA 4M71A 3M1EA 4P5OA 2FMLA 1Y0UA 5DD4A 2QZ8A 4G8XA 3I54A 5JI6A 4UVBA 4NHJA 5L3GA 5HLHA 3C7JA 4R8HA 1ZRCA 1RIOH 1AY9A 4HV5A 1TTYA 5DUKA 2KJCA 1IXCA 2ZJ2A 1PUEE 1O7LA 1F1ZA 3LA2A 3CLOA 4ON0A 3WTSC 5HS9A 3L00A 3HRTA 3R61A 2YSRA 2QM3A 2DQLA 1BM9A 5DEQA 3CO7C 2DPUA 2LNBA 5IT9Z 1ULYA 3LAPA 2V1DA 3CUOA 1YW8A 3ABUA 4ZH4F 5FGMA 1BC8C 1QZYA 4RGSA 1F5TA 1C0WA 3SFZA 5K5RA 2MLKA 1DUXC 3P9IA 3M7GA 5D5WB 2AS5F 1ZARA 3FZVA 2ETHA 3GFIA 1K78A 4S04A 1BI2A 5LRSA 2WC2A 1PP8F 4ZZLA 5D4RA 1FYMA 2YX7A 5CVIA 5CVRA 4N9IA 1T98A 2CWEA 1I4VA 4PGGA 4Y13A 2WV0A 3WGGA 5J6XA 3I53A 3ECOA 2FU4A 1K7AA 4UV9A 3E6BA 4GYGA 2K02A 4MGRA 5HDNA 3IRRA 4FHTA 5DUIA 1F9NA 2DO7A 2NS0A 1SFUA 3EDPA 2FXAA 3I0TA 3WU0A 1KU9A 4EQQA 2XVCA 2E1NA 1WSUA 1B9MA 1ZLKA 3LSTA 2HKXA 3ABTA 1FBUA
chains in the Genus database with same CATH superfamily
4BJ5C 1HW1A 5L3BA 1KA8A 4V19K 3Q0VA 4OIQF 2Y31A 4V2GA 4YIIA 1ZTRA 2WA0A 1FP1D 5FKNA 4XORA 2ESHA 2H94A 2CSOA 4GYIA 4HW0A 2L9SA 1Z77A 2QWWA 5TISC 5HDGA 1D3YA 4XQFA 4RGRA 1WWXA 5E17F 3V42A 2IGKA 1YJ9I 4KNYA 2VOPA 3DEUA 3E3VA 3M8JA 2DK5A 2OJED 3I71A 3ZMVA 3KP3A 1GXPA 2JA5J 1ETVA 1SAUA 4U0YA 1VQLI 1R1TA 4BE1A 4ENNA 2DMNA 4EM1A 3SJMA 3B6AA 1Y39A 1I5ZA 4CXFA 5EDNA 4B44A 2OCCH 3BR3A 4UHTA 2WAEA 3K0LA 2P7CB 1P7IA 1ZGWA 1O3RA 1BW6A 1B8IB 1IRGA 1WJEA 1D0YA 1XTAA 3BQYA 4HX8A 3W6VA 1QPIA 4I0BA 3H3ZA 4LGWA 4BKXA 4NQWB 2D2WA 1ETYA 4QSHA 1LB2A 2JWTA 2EZKA 2VN2A 1J5YA 4PJLA 3SDGA 3LWFA 1STZA 2IEKA 1W36D 4CGZA 1J0RA 4KIGA 2PX9A 3F0CA 2BGCA 3SDBA 5GTIC 2EIKH 3T5XA 1Y6IA 1ORKA 2EILH 2XGDA 3LFKA 4OOIA 2X48A 3M1CA 4II2A 4OIRF 3K2AA 2DPDA 1W4MA 4O3MA 3FIWA 3PIOF 1NG7A 1YLFA 1YS7A 2ID6A 3AG1H 2ZFWA 2FSWA 1TT5B 2V4JC 4A0YA 5FLMJ 2K9MA 2HPIA 2PJRA 2UV1A 3KLNA 3OYBA 4RAGA 1MSEC 1RNLA 2DFFA 1Z3YA 3F8NA 1ON1A 1FP2A 5J3LA 5FKKA 1W7PA 2WY7Q 2K9LA 3K9TA 3W3CA 1O3TA 3ZQGA 1Z9CA 1NG6A 4WXHA 3MZYA 5D5XB 4FASD 3FMQA 3F3XA 2F2EA 1FMVA 1VTNC 3FX3A 3KP6A 4CCLA 1DU0A 2JRMA 3D0SA 3GTGJ 2EFOA 1HDDC 2YU9J 1ETWA 1P4AA 1X1PA 4M6VA 4R79A 1AOYA 4AM3A 2FBIA 1QGPA 1HDPA 2R5YB 4RDUA 5IT9K 4PK4A 2X6OA 1MH4A 2WTEA 1V5FA 1GHCA 3MKWB 4EM0B 2CGPA 4BE0A 3I59A 3DTKA 3H0GJ 3CMYA 2IS1A 5EF6A 3K4BA 4XOPA 3VYTB 3GUDA 3VPRA 2HOEA 2FRHA 4CYDA 1U5TA 2EV5A 5F04A 2ME6A 1S72I 1TQMA 2COMA 2ZXJA 3DP7A 2KMUA 5FJ8J 4A3KJ 1JGSA 1FOWA 4ZZDA 2UXNA 4WX9A 2R3SA 2G7UA 2HXIA 2RAEA 3E6DA 3KCCA 4EATA 2M7BA 2DA1A 2IS4A 1UFMA 4MQ9F 4XMYA 1UAAA 3LA7A 2PFBA 2EIJH 4MQVA 3HOUJ 3KETA 4I6ZA 2MD5A 1ZQ3P 3TOAA 4B43A 4UUVA 1CF7A 1S29A 4QPQA 1JUPA 2XAQA 3PM1A 4E4HA 4C2UA 4LFUA 4NV4A 1HSJA 2DT5A 1MNEA 2JK3A 3WG9A 3HL2A 2IA0A 3CCRI 4ENKA 4O6JA 1N75A 3BQZA 1KZHA 4RMNA 1S6LA 2YU3A 3C18A 3JRCA 1P92A 2KFDA 3IHUA 1FIPA 2TRTA 3ZMSA 4Q48A 1MMSA 3JCUC 3ZGKA 4CCJA 2RNGA 4EMSA 2M45A 4HNUA 3M8FA 4AD9A 1P4WA 3SQNA 2LKXA 4BQAA 5IP7J 2HU9A 1RRJA 3KZZA 3FXUA 1U3EM 5FRNA 1IN7A 4BAYA 2XGCA 3L2VA 4LLNA 5GAHJ 5HDKA 2E5NA 1G3WA 2DYRH 5CLSA 2M87A 1ACIA 2KKOA 4DBRA 2XUBA 4Q47A 2DQRA 4GRIA 2IPQX 2VQGA 3C2BA 2F6CA 3DEEA 4I01A 5FB2A 1A04A 2W1OA 3U9GA 1MBKA 3KLOA 1UHMA 2KIUA 2XAJA 2HEOA 4P96A 5E8IA 3K69A 4XN0A 3I4MJ 5FLXK 3BY6A 4G6TB 4E7LA 1SMYF 4P55A 1YHQI 5GAEJ 5IT3A 4N31A 1MNMC 5CVJA 1UG2A 4FE4A 1WH7A 1HA8A 3TKYA 3KE2A 4K8WA 1T0FA 2ZJQF 1WJCA 1ZREA 2R4GA 3KZIC 2JN6A 5FLXZ 2GLOA 3ESWB 1XC5A 2XHKA 1KU7A 3H3VK 3L2CA 4IPAA 4IZZA 4A3MJ 1TT0A 1PYVA 2D1HA 3VDXA 2LH9A 1ZRFA 4AU7A 4BNCA 3ZQIA 5EEHA 3CDIA 3S1QJ 2A61A 1Z1DA 4F7ZA 2ZNYA 2R0QC 3GTOJ 1OYYA 4KMFA 2O03A 1QNTA 1OISA 1NHAA 2FNAA 1FOXA 4BEHB 5GPAA 2PMZA 2CQKA 2DBBA 2P5KA 1ZN2A 3W6KB 3K4CA 1ETXA 2CQ7A 3QOPA 4JK1X 1DGWY 3L7WA 3OOUA 3HOZJ 5F0FA 4NDLA 4A0ZA 4WXCA 2QLZA 3KP5A 3VWBA 2XKOA 4RM3A 3CJRB 2HZTA 5M5YJ 3D5LA 2EFWA 1YRNA 1ZGJA 4N0BA 3WTWC 2F5EA 2OBPA 5HNHA 3G4SI 2ZSHB 1ZH5A 1LFUP 4IOAF 4D7MA 4A3FJ 3RKQA 1R4MB 4ETSA 4BEHA 2IGOA 2JT1A 3TOBA 2VI6A 3G3ZA 1JE8A 4C2MJ 5BS6A 3BZKA 4IHXA 4NC8A 3L2UA 2KJBA 2VT3A 4Q4ZF 4LB5A 2DFEA 2BE5F 3MEXA 4RA2A 4UXNA 1IN6A 3AL0B 1P4XA 2PG4A 1DP3A 2RGVA 1R71A 1P9QC 2R7TA 4PJNA 2AXLA 5H2FC 3TP0A 1LVAA 3EQLF 4IQJA 1W1WE 2FA5A 3WODF 3RCOA 2NXNB 4IHYA 5IP6A 3DLLF 1Z7UA 2CYYA 2H6CA 3ECHA 1LE8B 1BR2A 3CJQB 2JA2A 3O3KA 4LIVA 4XSZF 3NWSA 3J81K 5A2QK 2P5VA 3E97A 5HLTA 1JUMA 5IY5H 4KA4A 4YRVA 1FC3A 2G0EA 1I1SA 2DA5A 4CCKA 3JAMZ 3RYPA 5KK1A 1Z0XA 4GO1A 4Z2YA 4ZJZA 2DOEA 4U7BA 1D1CA 5AIQA 4CA0A 2AQEA 2ZMEA 5JVGF 3P9KA 4AIDA 5CKTA 3QYEA 1JXSA 3COAC 2F4IA 2ZKZA 2ZBKA 1XGMA 3CTAA 2DCEA 4E7JA 4M74A 1YITI 2B0LA 2KDOA 4YFXF 4D5CA 2GZWA 2ZSIB 4HYEA 4Y3OA 2PMZN 1QVUA 4B48A 4M3DA 5IOZA 1I27A 3F8BA 2WWYA 3GLLA 2XROA 4IQ4A 1T6SA 3VFZA 1X4OA 1FYLA 3OYJA 1B6AA 1YE9A 1YW7A 2A69F 3MFKA 3OV8A 3HYIA 2O61A 1IDYA 1G59A 2VJJA 5FFXA 2DMPA 4HPQA 5C44J 1L3LA 2Q8KA 4B8XA 5B5EC 1XN7A 2JSCA 4A5NA 5IYDJ 3GBGA 3I4NJ 2Q2EA 5DTDA 3ZMZA 4M9ZA 3A2KA 3A02A 4XN3A 5EG0A 4A3IJ 2XPVA 2X1DA 1GDTA 5D6FA 4CYCA 1ONVA 1Z3XA 3V4GA 3A01B 4CCOA 5M5XJ 2K7LA 4EEFG 2MA3A 2I8DA 4XL9A 3CP2A 2L9VA 1FEXA 2QYOA 1R00A 2MH2A 4PSXA 2MLGA 1ETQA 2M8EA 3DTIA 3K4JA 4PFOA 3W2VA 1ERDA 3HPGA 3QODA 5J4YA 1R58A 2LVSA 2K5CA 4LK1F 4FE7A 5DS9A 2IVMA 3U1DA 4C2TA 3H9GA 3LSKA 1VQ4I 5CVVA 3FXOA 2VPLA 4HF0A 1MMGA 3GWZA 2CS3A 1USTA 3WU2C 2A3SA 2YS9A 4UV8A 3AL0C 2IXSA 2BVLA 3JR9A 3AG2H 3F22A 3KP2A 4BY1J 2LTPA 2PMHA 1WJ5A 3IWFA 3BR2A 3QP5A 2CUJA 1TW2A 2IBDA 4WCGA 5FROA 3BTJA 4WF2A 3G73A 4YFKF 2K9NA 4P9FA 2F5DA 1B8IA 5J1UA 4II3A 3VYRB 4D7NA 3A01A 4RB1A 2FQ4A 3HGYA 4XLEA 1W7PB 2L7KA 2VC0A 4A3LJ 2P0WA 1IUFA 2H27A 3ZQQA 5EG0B 4Y17A 1JKPC 2R7ZJ 4XLNF 1G8XA 3MVPA 5F27A 2K3PA 3GO5A 2HFHA 1YJWI 3E5XA 1QQIA 1XB4A 4L5EA 3OYMA 3BTLA 3VB2A 3G2BA 4DQ2A 1A5JA 1ZLJA 2IGNA 2RQPA 1I50J 4LOCA 3QU6A 1KQ9A 3ZQHA 1GT0C 1AKHB 1RUNA 2FEZA 1HKTA 2GAUA 5F08A 1IC8A 4KDPA 3WE2A 3QAHA 3BDNA 1OCRH 3LQQA 5BNGA 5L3CA 1I3QJ 2GBYA 1AHDP 1T56A 1XCVA 2UWMA 4JX4A 3VYSB 2E2IJ 4ZDOA 2XRNA 3S1RJ 2M5WA 3LQRA 1H9GA 1TBXA 1POGA 4BS9A 3JSPA 1UZCA 3OY9A 1JHHA 2EFPA 2XAFA 2NVUB 1HKQA 1D8KA 1LUJB 1VQ9I 3F21A 3IRQA 2HR3A 1BOAA 3CC2I 2PQ8A 2DK8A 3R0AA 4R1HA 4Y4RA 5LGUA 4D1QA 3V8JA 4A6EA 4BH9A 3LSPA 4MFEA 2DXIA 3BP8A 2LD5A 2FOKA 4MFDA 3ZN0A 2W25A 1W0UA 1TW3A 3PSFA 3GLXA 1F43A 2PN6A 3R60A 4FISA 2DA4A 3R0JA 1LEAA 1B72B 1W5SA 4XIDA 2OAZA 4OIPF 3VOEA 5H6QA 3CCVI 3CCLI 5LEKA 1VNDA 1A31A 3PFYA 3MWMA 4G9YA 2R7XA 5TRDA 3VYUB 2Q0OA 1N78A 1MJAA 1T38A 3M07A 1T95A 2DT6A 3GEZA 2QQ9A 3TBIA 1SAXA 2KZGA 1MMDA 1FT9A 3CJNA 3H1CA 5C3EJ 1W5TA 2NS7A 3ZRGA 5K7HA 2R5YA 4X1EA 1T2KA 4HEA2 2CFOA 3BWGA 1MMAA 4L9TA 3EUKL 3HG9A 5HVQC 4XLCA 1MBJA 3CZ6A 4MHGA 2HOAA 3U1KA 2ZNZA 2W00A 3PNYA 2LSOA 2RQQA 1Z6RA 2GWRA 2X51A 3E1SA 3HC7A 1F36A 2GQQA 4M72A 2NVTJ 4DYCA 4XONA 5A2QZ 4IL6C 1X1BA 1BW5A 3IIQA 1OLTA 2N8GA 1LKXA 2VKDA 1G3SA 3Q5FA 4MLOA 1E3HA 3BR1A 5DD8A 2EV6A 2DT7B 4A3DJ 3CMMA 3BCAA 4AYBA 2HI3A 2I10A 2ESNA 2Z3YA 4FX4A 4LG3A 4MTDA 3CUQA 4A0XA 3L2WA 2DDAA 3OWTA 4FQGA 3LSHA 3QQAA 1OCTC 1ZK8A 1OYIA 2ISZA 2VBZA 4XSXF 1S8NA 5DCMB 1YTYA 1DU6A 3CJTB 2NNYA 1WZ2A 4DOZA 5FFZA 2VQLA 3QOEA 2VOOA 3B6CA 4M3BA 1WJAA 2BVMA 1K4TA 1U5TB 1FY7A 2DMQA 2VXDA 2ADUA 4UUTA 1XPXA 1EF4A 3KEQA 3CMEI 4ENMA 3DPUA 4EJWA 5JHUA 2MFZA 1PVEA 3ZMDA 2W84A 1U6GA 1BJZA 1Z21A 3DXJF 1X3ZB 4XLFA 3BJOA 2XF6A 1YW9A 2QSFX 3P5JA 4G6QA 2UXXA 4S05A 4M6YA 1E0EA 2MC4A 4XICA 4PFPA 4IHWA 4IRIA 4HZFA 1H0MA 2RN7A 1MKMA 1F39A 2O3FA 2LKSA 3CP8A 3OS1A 1RR8C 1N77A 4MEYF 3BR6A 1Z05A 4W1UA 2Z2SB 4YIRX 1DQUA 3GF2A 4P1WA 3S17J 4G94A 3RQ4A 1OCZH 3ISPA 4A69C 1BI3A 2V79A 4OMZA 5IPAA 3I64A 5H6RA 3DV8A 1HW2A 2K86A 3K4KA 4CZZA 2OV7A 1ZAOA 1X3UA 2JPCA 2EIMH 4HF2A 1IUYA 2W82A 1T33A 4Y15A 3A1YA 3LSMA 2XB0X 3ZN1A 2Y75A 3RPQA 1R1VA 1UG0A 3E5UA 2Y30A 3HUGA 2E71A 1AWCA 2GIZA 1MDMA 2M1BA 1D5YA 4ZYDA 4IHVA 3SZGA 3FBIB 4BDZA 1ZHFA 2V1UA 3LMMA 2ZFUA 1Z67A 2EPFA 2LYCA 4CSWA 2CO5A 2KL4A 1VQKI 3FISA 4WK8F 3HB9A 5DCFA 2L54A 1FOYA 4JP0A 1V3FA 3HTSB 2RNJA 2A6EF 1R4NB 1R22A 2A5WA 3GFMA 3HIFA 5FRMA 1HW5A 5IP9J 4A3EJ 5L3FA 3HUGB 3RKYA 4HAMA 3T8TA 2QEXI 3CMAI 5JVTA 3OMYA 1BN5A 1FWZA 3TW7A 1V54H 3KP4A 4MO7A 4C3HJ 4QPOA 1MBHA 1WGXA 4HBLA 1SC7A 3MN2A 2GXAA 4A12A 2FJ1A 1Y8RB 1ODDA 1Q1HA 1SFEA 2VBXA 3HGGA 1ZKGA 3MKLA 1K78B 3QRFF 1Z7LA 3KFWX 4HX4A 4KIBA 2A07F 1NK3P 1NTCA 1Z91A 3S16J 2J5OA 2R7WA 2L3DA 3BZCA 3S93A 4OU0A 1TWHJ 3JAMK 2VODA 2JPBA 5J8CA 1XDSA 1WJFA 2OCEA 5CJ9A 3DTEA 4EJTA 3OYHA 3A4CA 2LBFA 4EJVA 1GV2A 1I6XA 3IUOA 2F5CA 2BW3A 2IA1A 2ECCA 3J81Z 2P5LC 2Q2EB 3S04A 4CCNA 1MDMB 2M34A 2LY1A 5ILVA 4HDUA 1YI2I 1FNNA 3ASOH 3G71I 1R9TJ 5D5UB 1PUFA 4H0EA 1TC3C 1RR7A 2VJ5A 1LDJA 1UMUA 3LOCA 4WWCA 2GA2A 3W2AA 5FD5A 4A6DA 2ZXHA 1RC9A 2Z1DA 5KVRA 2RREA 4TV7A 1R5GA 2F48A 5E20A 3GTJJ 1Y8QB 1BBYA 2BYVE 2L4MA 2LBFB 3VSLA 4BXUA 2JVGA 2HKOA 4LD5A 2QBYA 2CFXA 3E5QA 3F23A 5M3FJ 5J8FA 1CGPA 2V9VA 1MBFA 1MW7A 2MC3A 4F3QA 3BROA 3HSEA 1I39A 3PJRA 2IW5A 3O8GA 1LDKB 2ICWG 3FF5A 4CUGA 4PJMA 4E7ZA 5K7ZA 1VI0A 4L0YB 3S32A 4XOTA 1K6OA 5ILSA 1V4RA 1XGNA 3IWZA 3H0DA 2LC2A 3Q9SA 1BA5A 5D6EA 2W85A 5TGTA 3I9V2 1XD7A 1SFOJ 2KRHA 5E1ZB 2EFNA 4HV6A 3EUHC 1R49A 3CD6I 1K79A 4F55A 2BZTA 1S7AA 2XAUA 3BT9A 3H92A 5C4JJ 3OYFA 4O5VA 2GXBA 3ROUA 3P7NA 2Q1ZB 1MJ9A 5IYBJ 5CPRB 4ME8A 2QQ8A 1KYWA 3H9JA 4XM3A 4HNTA 4U7DA 3H5NA 3D5SC 4V2FA 1VQPI 1I3AA 1B1BA 4KN7X 2KIFA 2CMPA 1K6YA 3TO6A 2L5QA 2M3AA 3DKXA 3MAJA 2WBMA 4XLAA 1PDNC 2X1CA 3H3UA 1RKTA 3BC8A 3WHBA 1HXDA 1S3JA 4B4CA 1F4KA 2CW0F 3HSFA 2VKEA 3KYLA 3JTGA 4N9HA 2QBYB 1KQ8A 3GZ6A 3OR1C 3B73A 5EEGA 3GFJA 2R7FA 3JRHA 1U9OA 3FXLA 1OQYA 5B1BH 1FPQA 4EJOA 3SEZA 2RV8A 3L09A 3RI4A 1YRNB 2JZYA 4CCMA 2ID3A 3FKJA 1FIAA 4XBFA 1IAWA 3TO7A 4RB2C 2IGMA 3N97A 1LQ1A 3FMRA 1FOKA 2ZJRF 5LHGA 1SANA 2KLOA 4RLQA 5LGTA 2CW7A 4Y52J 4I98B 2WAQA 3OYDA 2DA3A 5EYRA 1RESA 5D5VB 2E1MB 3S14J 2HDWA 5J40A 3ZQLA 1IJWC 2LF7A 4XKCA 4L18B 4NC7A 1BI1A 1BIAA 1LE8A 3HZJA 5F0CA 5FKOA 4KJZA 4EVIA 5FO5A 3ZCOA 3DEWA 5BPDA 5BPIA 3CCYA 3EETA 3CF2A 2DA7A 1SD7A 2CQQA 3H35A 1OPCA 1H89C 2P4WA 4LIUA 1FBSA 3S2WA 2M7AA 4ANJA 2HVQA 4PZJA 2E5ZA 3FXJA 2TDXA 3VODA 2O6GE 2JJ7A 1QBJA 1VZ0A 4IOCF 3KIOA 1RZ4A 2CJJA 1JT6A 4U88A 2O9LA 3WGIA 2CQNA 3SYTA 3X2QH 2COBA 1FX7A 2B63J 2BXYA 1D8JA 2CUEA 3DLAA 1I6HJ 1E3OC 4PGHA 4RAFA 2OTJI 2KP6A 3N4MA 2M4KA 2ELHA 4CYCB 2ACJA 2XAHA 4ESFA 1T08B 2Y0SA 3FXMA 3NWTA 4NUBA 2QQBA 2L7ZA 3HOVJ 3IL2A 2RKHA 1R5HA 2G7HA 2EZIA 1KQ0A 2DN0A 2LOOA 1LNWA 3PUBA 5HLIA 2HVSA 1LPQA 2VKVA 4U0VA 2VQCA 4DNCA 3BR5A 5GADJ 2X9DA 1OCPA 4M3GA 3FM3A 4RB0A 4RS8A 1FSEA 3E6CC 4M9SA 5LFAA 1MIJA 2IA2A 3BPXA 2VONA 2HQ5A 1U9NA 3F72A 2KQRA 1WHUA 2DTZA 3WG7H 5K5OA 1XSVA 4OAZA 4CDGA 1FSHA 3BG5A 4QLCU 1J9IA 2JSPA 4NBQA 4BQQA 1CQTA 2L01A 2ELJA 2WAQN 5BQTA 3L2QA 3AKZA 1TQPA 5L3DA 4ESBA 1CF7B 3LAJA 3AAFA 2K3FA 3PO2J 1TWAJ 3MMYB 3W6JB 5J1YA 4F93B 5GAGJ 4IF4A 2F5FA 3WTYC 4U0WA 2XRLA 2E60A 4XKWA 1DGRM 1FTZA 3BZ6A 3PNTA 3K70D 1OR7A 2VASA 1IRXA 2A6TA 2OQGA 2LF8A 3NAUA 3V7CA 2B7EA 2JTVA 1UELB 5CQEA 3G1LA 5LHHA 5E79C 3CCUI 1O57A 2K9SA 1GXQA 3UR3C 5EEAA 1D1BA 2KRCA 2VE8A 1U78A 2KISA 2R7OA 3K7AJ 4I7HA 3QYFA 1JUSA 3FM5A 4IXAA 1Y56A 1EA3A 2JUGA 1B59A 2FNPA 3E7LA 2FKDA 3RQIA 3JRGA 1XCBA 2RC4A 5HLGA 1X1AA 4M3FA 3CDHA 3FXQA 4A3CJ 1U0JA 2HXOA 1WI3A 1IN4A 3Q3SA 3TMOA 2E34A 1ETKA 1IG7A 4HF1A 1SD5A 1V5EA 2V6CA 2ZO4A 4E6KG 2FX0A 3HKZN 3HEFA 2CUZA 3K1NA 3JRAA 2R7VA 2K4BA 3WU1B 3PQKA 2CH0A 5EGOA 1QPMA 3W2WA 2MSYA 1BR1A 2FJRA 1IXSB 3EYYA 2HYGD 1RETA 3RTRA 1QA6A 3SFIA 2HQAA 2BHYA 1UMQA 5LHIA 1FBQA 5EGOB 5E3MA 3SZTA 1V55H 3ULQB 4ZDPA 1SFXA 3PUFA 2HWVA 2MH9A 1YYVA 1U2WA 2DOAA 3OYCA 3MD2A 4YELA 4KT5C 3ZQFA 4DGWB 3V7RA 4ESJA 2M30A 1ZRDA 1S9HA 2DMTA 2EH3A 2LREA 3FK6A 2BY2A 1W0TA 2YX4A 4KUMA 3CO6C 4EM2A 1IZ1A 3JREA 4NQWA 2E2JJ 1XMXA 4WXDA 3FXRA 2W24A 3RJPA 5H20A 5D8KB 3RKXA 5DCMA 2OUMA 3CQZJ 3SHFA 2HPMA 2LKPA 3C2HA 4IHSA 3PIPF 4L9VA 4AVPA 2O8XA 1ZG1A 3WTTC 3OYAA 2ISYA 4LITA 3JRBA 1KGSA 5EZHA 2KIMA 3QPHA 2E1MC 4ZYGA 4IVNA 2F4OB 2K9QA 3DPTA 3QU3A 4HQEA 4BJ6C 4HNVA 5KAFC 4J00A 3HBLA 1VQ8I 3O2PE 5HOOA 1ZYRF 1WJBA 1B9NA 3DKWA 2W4SA 2ZXIA 1UHWA 1KU2A 3CCSI 3DPLC 3TDUC 2Z9OA 1MSFC 4M73A 4FX0A 2PLYA 2BEOA 4C3JJ 2X6WA 1SMTA 2Z16A 3BCBA 4QIWN 4LJZF 4IO9F 4E7SA 2XB5A 4RM2A 2EZLA 5AIPA 2HVRA 3I4PA 1QVTA 2X85A 1WQ2A 3WTUC 2CQXA 1TNTA 5FD6A 2DFHA 5E3LA 9ANTA 4ZTJA 3K1PA 5TJJA 2H1KA 3GYHX 2C6YA 4XKBA 4EJUA 4A3GJ 4ZYEA 1R6RA 1X3WB 3Q9VA 3PFIA 3F8FA 2ZMEC 5E8GA 1YS6A 2ME0A 3BDDA 4LG0B 2XPUA 2V6EA 3CCQI 2GOMA 2DMUA 2WB1A 1IV8A 2JUCA 1J2XA 4LMYA 3WE3A 5FKMA 2FBHA 1HLVA 4E7KA 4I02A 2DDBA 4A2UA 4UVAA 1REPC 3ABLH 3BG6A 3ZMUA 1Y1VJ 2EA4A 1OJLA 3WGHA 1E17A 6PAXA 5LD2C 1BIBA 3H9QA 4IKFA 1NH3A 4IX7A 5ICEA 4FTHA 3ZMTA 2IS6A 2QUFA 4JX6A 1ZG3A 3K70C 2BY1A 3F8MA 2LDUA 2P8TA 3J7YJ 1AU7A 3F8CA 5DM6F 1SVOA 1G2HA 3HRUA 3CUQB 5HS7A 3LSJA 1OMIA 1Z6TA 3C2GA 1MJBA 4A3BJ 2D5VA 2XGXA 3FXKA 4MNUA 1XX5A 2HQNA 3H5AA 3HOYJ 1LVKA 2J5PA 3OS2A 3CESA 1MD0A 2OQRA 1IF1A 3DU5A 1SVLA 1B12A 3KYDB 5C4XJ 2I5UA 2NRAC 2M0MA 3GTPJ 3I58A 2O7OA 1DDNA 3D5RC 2BW3B 2EB7A 3K6GA 3OIQA 3V8KA 3LSGA 1K83J 2XAGA 4J01A 1B4AA 3MQ0A 3GFLA 3NRVA 2OA4A 4RGUA 5DYMA 2YR2A 1U5TC 4HDVA 1WVRA 2IP2A 4RLFA 3TEDA 1RKWA 4XLPF 1EH6A 3H5RA 1OCCH 1S7OA 2X0LA 3DBHB 3FMSA 4ASNA 3ZOBA 2JVHA 2V9KA 5CQGA 5CVUA 1BC7C 2LR8A 3T8RA 2XC7A 2O5RA 3SZPA 2JRTA 3V8LA 3ASNH 3L9FA 4PJJA 4ENJA 1W7PD 4D9JA 4RAYA 1VQOI 2MD0A 3REOA 3A0HC 1Y1WJ 2CV2A 2NVXJ 2O8KA 3TGNA 4KT6A 1S7EA 4RAZA 1OCOH 1R7JA 3M3YJ 4M6XA 2CG4A 1A36A 1A6IA 3K4NA 2E36A 1OKRA 2L7FP 3IKVA 3FHNA 4BL0B 3FKIJ 3U2RA 3IKTA 3EUAA 1WCMJ 2RVCA 2XASA 1XG1A 3O8HA 1XGSA 3ZP5A 4GDFA 1J75A 3F9KA 1D0ZA 2A05A 1XMAA 4P9UA 4DZPA 2L02A 4BGDA 4I09A 4HX7A 4DJAA 3DWLE 5EZGA 1YX3A 1R23A 2M2EA 3KZYA 2HTJA 1YIOA 2YPRA 3KYCB 2QKLB 4XR6A 4ZC3A 2W57A 3LA3A 4JQFA 2BY0A 2P7VB 5J1RA 4LB6B 3G6EI 2DI3A 2DOFA 4F92B 5D8LB 3NEUA 1D5VA 2OC6A 1HF0A 3I56I 4J19A 2VJIA 3IC7A 2W7NA 2HDDA 1ZR2A 3V7SA 3OIOA 1TNSA 5JHFA 5LBQA 5HNFA 2E1CA 1G4DA 2IJLA 3R6SA 4DIQA 2K4JA 1G3YA 2PMUA 4XRSG 4S0HB 1MMNA 1YG2A 1O3SA 3ZQ7A 3S15J 2XSJC 1YIJI 2GM4A 1VFCA 1I1GA 2VLAA 2R7SA 3GTMJ 4H4KC 4IRHA 3GVAA 3H36A 2Z5UA 4G12A 1FMWA 1YX5A 1QU3A 2H8WA 5E3NA 3QPTA 3BR0A 3CLQA 2Z99A 4OAYA 4BQOA 4YG2F 3Q0WA 4IRGA 3MZHA 3A03A 1SD4A 1JT0A 3R4KA 4IEJA 1K4SA 4Z6YA 1QHHD 3RZDJ 2QENA 3TW6A 4BBRJ 4Q5SF 2VT2A 3T1BA 4BHBA 3PO3J 2QGUA 4L5IA 4MEXF 1IV6A 5BMZA 1YJNI 2P6TA 3ERMA 1ZELA 1BJAA 1VF9A 2K27A 2Y69H 2AO9A 2IAIA 2K85A 5GTHC 1IGNA 4AIKA 1GLNA 3HOTA 1RUOA 1GVDA 4BBSJ 3G1OA 2LLKA 4D5FA 3HOXJ 1FTTA 1XGOA 4FETA 3GX4X 5HS8A 1JTYA 1IXRC 1FZPB 2HGCA 1D0XA 1QO0D 2R7DA 2JA6J 4IHTA 3WTZA 1BL0A 3K2ZA 2UUZA 1A35A 4JOMA 2DA6A 3MCZA 3S8PA 3TQNA 4AC0A 1GVJA 1TL8A 2JA7J 4FT8A 4I2OA 4OWRB 2NS8A 3OS0A 3DU6A 3HDDA 2M0CA 3HOWJ 2VB6A 1TZLA 4ZDLA 1XSDA 4NNJA 3S3OA 1KYZA 1A6QA 4HOBA 2BV6A 3QP6A 2E7WA 2F5VA 2PJPA 1T0FC 4XRFA 3WTVC 1XSXA 1OR7C 1QZEA 1RI7A 1ZR4A 1VQ5I 2R7RA 2WY8Q 3RSNA 3HKZA 2A68F 1JGGA 1RPWA 2NAZA 2FUG2 5F6FA 1W5CC 4XNFA 4B09A 4CO8A 1EH8A 1IDZA 5B66C 1UHSA 1TLHB 5LLQA 1ZGAA 1B72A 1TWGJ 5ED4A 3E6MA 2BY3A 2E7XA 3HTUA 4L9NA 4JYKA 2V1XA 1KU3A 2MYSA 3WTXC 2NNNA 4GCVA 5LGNA 1G3TA 2XKPA 2STWA 4UNOA 3FWEA 2KT0A 4KYWA 3CDLA 4C3IJ 2QA4I 2R5ZA 4PCQA 1DP7P 2EK5A 2EV0A 2M8GX 3JRFA 4A3JJ 2E2HJ 2OU2A 3OSFA 1BI0A 4HA8A 2KIQA 3KP7A 1ETOA 3C1DA 1MGTA 1JHFA 2X6YA 1PJRA 2MBFA 3CCJI 2E1OA 3IP4B 4PDKA 3WHCA 2PI0A 1U8BA 2H09A 4BUPA 3CC4I 3FBNB 1OFCX 3RPUA 2KZVA 2L9NA 4M9XA 1IO2A 4HSTA 4AIJA 1HBXG 1QZZA 3FK7A 1UCRA 3I5UA 2VIXA 3UKGA 3SXYA 5E1WA 4OIOF 1HOMA 3IH2A 4JX5A 4D0PA 1R5ID 2D1VA 3AG3H 4BQNA 3LNQA 3QYBA 2IRFG 5K5QA 2R7UA 2B9SA 2XV4S 3GMEA 5DDGA 3KEYA 4KN4X 4E7IA 5LRRA 3S3NA 3A0BC 2FBKA 3ELKA 3CC7I 4PJ0C 4KISA 4HLXA 4OMYA 1H9TA 1J59A 1JJ8C 1EV7A 3PQJA 1DPRA 1O4XA 4QWQA 3OL3A 1ZG5A 4GGGA 4LG0A 3BPVA 4AWXB 4IJAA 5JR3A 5K1YA 3HHHA 2PJRB 2FF4A 3HJEA 3ABKH 3RIRA 5FLVA 2LFBA 2H1LA 4JBAA 1UB9A 3HPHA 2Y9ZA 2MABA 3Q0UA 1XMKA 2IT0A 1X4PA 4C30A 3JW4A 5L3EA 2VE9A 1AKHA 1SVMA 3HHGA 3DQVC 4UB8C 4L9JA 2OZ6A 4G7ZF 4AUXA 1BOBA 4F52A 2L7MP 3ML6A 4YIFA 5ICGA 2VL8A 2XIGA 3M8EA 3QPLA 1APLC 4BYYA 5LEJA 3QPSA 1DPUA 1VQ7I 4HQMA 3DKYA 5AONA 2PBIA 3J80K 1HQCA 4BU2A 2R5ZB 2HYFA 2HNHA 4RB3C 1IRFA 1EKEA 2WV1A 3HRMA 3E0JB 3GZ5A 3LSIA 4L0ZB 4ZTFA 2WAFA 1SEUA 1H88C 4LK0F 3ERED 1U8RA 1JJ6C 3PL8A 4RBOA 4CICA 3BG7A 3EYIA 1IN5A 4CHUA 3I3LA 3I59B 2LMDA 1JKRC 2XF5A 2ELKA 2ZJPF 3GCMA 1K61A 3ZPLA 5E3OA 2X4HA 3PSIA 2A6HF 4UUSB 3K4MA 4BE2A 5BOXA 4QTRA 3RYRA 3JSOA 2VBWA 4XKVA 2L4AA 4BHCA 5DM7F 3MKYB 2LRDA 2EA2A 2XF7A 2DAOA 5D4SA 1H8AC 4KFCA 2VUMJ 2IS2A 3HSRA 5M3MJ 3OSGA 4A5MA 1YO5C 2NOGA 1JHEA 5KHDA 1OYWA 2VXZA 2ZB9A 2H8RA 3GZNB 1HSTA 2TCTA 4CH7A 3F6OA 3K1MA 2VKHA 1TWFJ 1T7DA 4HLYA 4G6DA 1WRJA 1MZBA 1V5GA 3LL7A 1VQNI 4BHPA 3P9CA 1FYKA 2EBIA 3GW2A 2NVQJ 2ZCWA 3VSKA 1VQMI 3GTKJ 2OPTA 1YFHA 1LFPA 1E2XA 1X19A 3GXOA 4AIHA 1J7KA 1MBEA 1JHCA 4UUSA 1XDUA 1HKSA 4EV0A 5ERIA 2VBYA 5FKLA 3O6BB 2DU9A 1X2NA 2FQ3A 2X1EA 2FD5A 4MTEA 4F91B 2GOXB 1MH3A 1R36A 2ZXWH 2GA1A 4I0AA 2DFIA 2MGQA 3NARA 1KONA 5F64A 3S1NJ 3FHZA 2FOWA 5E1XA 4EGZA 4DZJA 3I55I 5IOYA 2A5YB 2DTRA 3HOSA 2HOTA 5E18F 1FLIA 2ZMEB 3ONQA 4BY7J 3UNGC 5B1AH 2FMYA 3KX2A 3D1NI 1P2FA 2Y0SN 3B02A 2PEXA 2KPMA 2HZDA 3J80Z 4YFNF 4BXXJ 2AHQA 1T8IA 1KN9A 3AG4H 4HRIA 2ZC2A 4GXOA 3VEPA 1BR4A 3DBRB 4B3AA 2QKMB 2Y48A 1O7FA 1WI9A 5ICFA 3BJAA 5KAIC 3S2HJ 2HO0A 2WADA 4E70A 3BOQA 2LK2A 2K40A 3NQOA 3CCEI 3KPHA 3KEOA 3TDZC 4B3XA 4RGXA 4HG2A 1WKMA 3IH3A 3FDYA 5JLXA 4OINF 4XRSA 4C9YA 4G7OF 3K4LA 2QQAA 2NYXA 2LP0A 4N4OB 4PUSA 3EUHA 2KDZA 3CUQC 4M3EA 2X6XA 1GUUA 1LEBA 1ON2A 1LDDA 2DLLA 2OF7A 1XS9A 1J09A 2DW4A 1IRZA 1IW7F 2M9HA 3T0YA 3ZQCA 4K2EA 2G9WA 2Y0MA 3BJ6A 2BBYA 4BDYA 3J7AO 3RDIA 4L5JA 4YEJA 5F1RA 3OYNA 2HDCA 2BHZA 2HS5A 5ILUA 2KRFA 4UVCA 1WPKA 1UJ8A 1LJ9A 2OD5A 2Y9YA 1S5LC 1MNDA 2CRGA 4BJTA 2XPWA 2GIVA 1LFBA 2VPRA 1HCRA 3MZ8A 2HOSA 4U87A 2RDPA 1EH7A 2P81A 3M9AA 4EGYA 3JTHA 1KCAA 1SD6A 2HNFA 1T39A 4KIFA 2OZUA 4NB5A 1YQAA 5KNLA 3J7ZI 4A93J 4G7HF 1QRYA 2HTSA 2D45A 4XK4A 3TO9A 2KHMA 3K10A 3OYEA 1E3PA 4X0GA 3RKWA 2H6BA 2STTA 4LLGF 1P6RA 1Y0NA 1JKOC 1D1AA 2UZKA 1L0OC 1R1UA 5JFRA 2EWNA 2P6SA 4ZYAA 5EJCA 3DFGA 2EJRA 2E19A 3GTQJ 2QVOA 2V9PA 4N4NB 2FE3A 1G6NA 5K7FA 5ICCA 3F6VA 2LY2A 4LLLA 1IN8A 1TQIA 2O0YA 3N05A 3DBLB 2HQRA 3TL4X 2Z33A 2GXGA 1USSA 4HSRA 2L0KA 2R7QA 1PP7U 4XRMA 1P7JA 3C3WA 1ENHA 1PUFB 4AYBN 4ZYHA 3BTIA 5DV5A 2DJNA 4KMUX 2DJIA 2JMWA 2R93J 3DF8A 3OOPA 1O3QA 2AQFA 3HRSA 5CYVA 3LSRA 2VC1A 4KICA 3OYKA 2LG4A 2EFQA 2V7FA 4M71A 4Y33A 3M1EA 4P5OA 2JQ7A 2FMLA 1Y0UA 5DD4A 3RPUD 1GV5A 3S1MJ 2QZ8A 5JLWA 2W48A 5F1JA 2DA2A 4G8XA 3CF5F 1EJ9A 3I54A 1X1DA 5JI6A 2OTLI 2XGEA 2L9RA 1WJDA 2V1NA 4AVZA 4UVBA 4NHJA 5L3GA 5HLHA 2QF7A 3S3MA 4UY8I 3C7JA 1WH5A 2AXTC 3ZR8X 2DODA 4R8HA 1ZRCA 3RZOJ 3IAM2 5HODA 3MKZA 3LFUA 5J4VA 1RIOH 4B47A 1FJLA 3OYIA 3BG9A 1JTXA 3CCMI 1AY9A 4HV5A 1TTYA 5DUKA 2EINH 2KJCA 1IXCA 2M4GA 2CUFA 2ZJ2A 1AA7A 1HC8A 1PUEE 1SFKA 3OIPA 3OYGA 1O7LA 1F1ZA 4DBQA 3LA2A 3CLOA 4ON0A 3IH4A 4UB6C 3WTSC 5HS9A 2QSHX 2XDVA 3L00A 3HRTA 1JI8A 1Q1VA 4I99C 4ABZA 3R61A 2YSRA 2MW8A 2QM3A 4BXFA 2V26A 2DQLA 1BM9A 5DEQA 2VJ4A 3CO7C 2DPUA 4DYRA 2LNBA 1VQ6I 5IT9Z 1ULYA 3LAPA 1ITYA 2V1DA 5J47A 3SEQA 3G1MA 4XLHA 2QSGX 2ECBA 3J7AY 2F4MB 3CUOA 5GP9A 4X6AJ 1YW8A 1W36C 3ABUA 4ZH4F 2MG4A 2EZHA 5FGMA 1BC8C 2YUSA 1QZYA 4RGSA 1F5TA 3HM5A 4MIMA 3QWLA 1JKQC 3M4OJ 1C0WA 4CZCA 4DW6A 3DCFA 1QHGA 3SFZA 3U21A 5K5RA 4PSWA 2MLKA 1DUXC 1X58A 3P9IA 3M7GA 3BLYA 5B3SH 5D5WB 2WB1N 2AS5F 3GTLJ 1ZARA 3FZVA 2L2OA 2XSDC 4Y7NJ 3JRIA 2ETHA 3GFIA 5IYCJ 4GFBA 2DYSH 1K78A 4S04A 1BI2A 5LRSA 2WC2A 3PNVA 1PP8F 2E35A 4ZZLA 1N25A 3ABMH 5D4RA 2QCOA 1FYMA 2YX7A 1X2MA 3IAS2 3L1PA 5CVIA 4E7HA 5KCMA 5CVRA 4N9IA 1T98A 2CWEA 1I4VA 3BTCA 4PGGA 4BACA 3BG3A 4Y13A 3IV5A 3EPZA 2WV0A 2CV0A 4FCYA 3WGGA 3OYLA 1TP4A 3HXLA 3S2DJ 1M1EB 1TWCJ 2CU7A 5J6XA 2NVYJ 1MBGA 3I53A 1YOVB 3ZXSA 3ECOA 3L2RA 4ITVA 2FU4A 2HYJA 1K7AA 4UV9A 4KITB 5M5WJ 3E6BA 2BXZA 4GYGA 2K02A 4MGRA 5HDNA 3IRRA 4FHTA 5DUIA 1F9NA 2EQRA 3AFHA 2DO7A 2BOLA 2NOJB 2NS0A 1SFUA 3EDPA 2FXAA 2LY9A 4W97A 4B1RA 3I0TA 3WU0A 3OL4A 4DYQA 1KU9A 4I76A 4EQQA 1X1CA 2R92J 2CV1A 2XVCA 2JA8J 5GPCA 2E1NA 1WSUA 3TP3A 1B9MA 1ZLKA 1WFXA 2VQHA 2Y2ZA 4NC6A 5F0HA 3LSTA 2CW8A 2HKXA 3OR2C 3ABTA 1NK2P 1FBUA 3JRDA
chains in the Genus database with same CATH topology
1HW1A 5L3BA 1KA8A 4OIQF 4YIIA 1FP1D 2ESHA 2H94A 2CSOA 4GYIA 4HW0A 2QWWA 5HDGA 1D3YA 4RGRA 1WWXA 5E17F 4KNYA 2VOPA 3DEUA 3E3VA 2DK5A 3ZMVA 3I71A 3KP3A 1GXPA 4U0YA 1R1TA 4ENNA 4EM1A 1I5ZA 4CXFA 4UHTA 3K0LA 2P7CB 1O3RA 1IRGA 4HX8A 4I0BA 3H3ZA 4LGWA 2D2WA 1LB2A 2VN2A 1J5YA 3LWFA 1STZA 4CGZA 1J0RA 4KIGA 2BGCA 3T5XA 3LFKA 4OOIA 4OIRF 2DPDA 1W4MA 4O3MA 1YLFA 1YS7A 2ZFWA 2FSWA 4A0YA 3KLNA 1RNLA 3F8NA 1ON1A 1FP2A 1W7PA 3K9TA 1O3TA 1Z9CA 4WXHA 3MZYA 5D5XB 3FMQA 3F3XA 2F2EA 1VTNC 3FX3A 3KP6A 3D0SA 2EFOA 4R79A 1P4AA 1AOYA 2FBIA 1QGPA 5IT9K 2WTEA 1GHCA 4EM0B 2CGPA 3I59A 3GUDA 2HOEA 2FRHA 4CYDA 1U5TA 2EV5A 1TQMA 2COMA 2ZXJA 3DP7A 1JGSA 4ZZDA 2UXNA 4WX9A 2R3SA 2G7UA 3E6DA 3KCCA 1UFMA 4MQ9F 3LA7A 2PFBA 4MQVA 3KETA 2MD5A 3TOAA 4UUVA 1CF7A 1S29A 2XAQA 4LFUA 4NV4A 1HSJA 2DT5A 3WG9A 4ENKA 2IA0A 4O6JA 1S6LA 2YU3A 3C18A 1P92A 3IHUA 3ZMSA 4Q48A 4EMSA 2M45A 3M8FA 4AD9A 1P4WA 3SQNA 4BQAA 3KZZA 3FXUA 1U3EM 1IN7A 4BAYA 4LLNA 5HDKA 1G3WA 5CLSA 2M87A 2KKOA 2XUBA 4Q47A 2DQRA 2IPQX 4I01A 5FB2A 1A04A 3U9GA 3KLOA 1UHMA 2KIUA 2XAJA 2HEOA 4P96A 5E8IA 3K69A 5FLXK 3BY6A 1SMYF 4P55A 5IT3A 4N31A 5CVJA 3TKYA 3KE2A 4K8WA 1T0FA 1ZREA 5FLXZ 2XHKA 1KU7A 3L2CA 4IPAA 2D1HA 1ZRFA 4BNCA 5EEHA 2A61A 1Z1DA 4F7ZA 2ZNYA 1OYYA 4KMFA 2O03A 1QNTA 1NHAA 2FNAA 2CQKA 2DBBA 2P5KA 1ZN2A 3W6KB 3QOPA 4JK1X 3L7WA 4A0ZA 4WXCA 2QLZA 3KP5A 2XKOA 2HZTA 3D5LA 2EFWA 1ZGJA 4N0BA 3WTWC 2F5EA 2OBPA 1ZH5A 4ETSA 2JT1A 3TOBA 3G3ZA 1JE8A 5BS6A 2KJBA 2VT3A 4Q4ZF 4LB5A 2BE5F 3MEXA 4UXNA 1IN6A 1P4XA 2PG4A 2RGVA 2AXLA 1LVAA 3EQLF 2FA5A 3WODF 1Z7UA 2CYYA 2H6CA 3ECHA 3O3KA 4XSZF 3J81K 5A2QK 2P5VA 3E97A 4KA4A 1FC3A 1I1SA 3JAMZ 3RYPA 5KK1A 4GO1A 4Z2YA 4U7BA 5AIQA 2ZMEA 3P9KA 1JXSA 3COAC 2ZKZA 2ZBKA 1XGMA 3CTAA 4M74A 2B0LA 4YFXF 2GZWA 4HYEA 1I27A 3F8BA 2WWYA 2XROA 1T6SA 3VFZA 1FYLA 1B6AA 1YW7A 2A69F 3MFKA 3OV8A 3HYIA 2O61A 5FFXA 1L3LA 2Q8KA 4B8XA 1XN7A 2JSCA 4A5NA 2Q2EA 3ZMZA 4M9ZA 5D6FA 1ONVA 3V4GA 2K7LA 2MA3A 2QYOA 1R00A 2MH2A 2MLGA 2M8EA 1R58A 4LK1F 2IVMA 3U1DA 5CVVA 4HF0A 3GWZA 1USTA 2A3SA 4UV8A 3F22A 3KP2A 3IWFA 2PMHA 3QP5A 1TW2A 4WCGA 4WF2A 3G73A 4YFKF 4P9FA 2F5DA 4RB1A 1W7PB 2VC0A 2H27A 4Y17A 4XLNF 3GO5A 2HFHA 3E5XA 1QQIA 1XB4A 3VB2A 4DQ2A 1ZLJA 2RQPA 3QU6A 1KQ9A 1RUNA 2FEZA 1HKTA 2GAUA 4KDPA 3WE2A 3QAHA 3BDNA 3LQQA 5L3CA 1XCVA 2UWMA 2XRNA 2M5WA 3LQRA 1H9GA 1TBXA 3JSPA 1JHHA 2EFPA 2XAFA 1HKQA 1D8KA 3F21A 3IRQA 2HR3A 1BOAA 2PQ8A 2DK8A 3R0AA 4R1HA 5LGUA 3V8JA 4A6EA 4BH9A 3BP8A 2FOKA 3ZN0A 2W25A 1TW3A 3GLXA 2PN6A 3R60A 3R0JA 1LEAA 1W5SA 2OAZA 4OIPF 3VOEA 5H6QA 5LEKA 3MWMA 4G9YA 5TRDA 2Q0OA 1MJAA 1T38A 3GEZA 2QQ9A 1SAXA 3CJNA 1FT9A 1W5TA 1T2KA 3BWGA 4L9TA 5HVQC 4MHGA 2ZNZA 2LSOA 1Z6RA 2GWRA 2GQQA 4M72A 5A2QZ 3IIQA 3Q5FA 1G3SA 5DD8A 2EV6A 2ESNA 2Z3YA 4FX4A 4MTDA 3CUQA 4A0XA 2ISZA 1OYIA 2VBZA 4XSXF 1S8NA 5DCMB 1YTYA 2NNYA 5FFZA 2VOOA 1U5TB 1FY7A 2ADUA 3KEQA 4ENMA 4EJWA 5JHUA 3ZMDA 2W84A 1U6GA 3DXJF 3BJOA 1YW9A 4G6QA 2UXXA 4S05A 4M6YA 4IRIA 4HZFA 1H0MA 2RN7A 1MKMA 1F39A 2O3FA 4MEYF 1Z05A 3GF2A 4G94A 3ISPA 1BI3A 2V79A 4OMZA 3I64A 5H6RA 3DV8A 1HW2A 2K86A 4CZZA 1ZAOA 1X3UA 2JPCA 4HF2A 1IUYA 4Y15A 3ZN1A 2Y75A 3RPQA 1R1VA 3E5UA 3HUGA 1AWCA 1MDMA 2M1BA 4ZYDA 1ZHFA 2V1UA 2CO5A 4WK8F 5DCFA 2L54A 1V3FA 3HTSB 2A6EF 2RNJA 1R22A 3GFMA 3HIFA 1HW5A 5L3FA 3RKYA 4HAMA 3T8TA 5JVTA 1BN5A 1FWZA 3KP4A 4HBLA 4A12A 2VBXA 1ODDA 1Q1HA 1SFEA 1K78B 3QRFF 4HX4A 3KFWX 2A07F 4KIBA 1Z91A 2J5OA 2L3DA 2VODA 4OU0A 3JAMK 2JPBA 5J8CA 1XDSA 5CJ9A 4EJTA 4EJVA 1I6XA 2F5CA 2IA1A 2P5LC 3J81Z 3S04A 1MDMB 5ILVA 4HDUA 1FNNA 5D5UB 4H0EA 1LDJA 1UMUA 4WWCA 2GA2A 5FD5A 4A6DA 5KVRA 4TV7A 1R5GA 5E20A 4BXUA 1BBYA 2BYVE 2L4MA 2QBYA 2HKOA 4LD5A 2CFXA 3E5QA 3F23A 5J8FA 1CGPA 2V9VA 2MC3A 3BROA 3HSEA 2IW5A 1LDKB 3FF5A 4L0YB 1K6OA 5ILSA 1V4RA 1XGNA 3IWZA 3Q9SA 5D6EA 2W85A 1XD7A 5E1ZB 2EFNA 4HV6A 1K79A 1S7AA 3H92A 4O5VA 2GXBA 3ROUA 3P7NA 1MJ9A 4ME8A 1KYWA 4U7DA 4KN7X 1B1BA 2KIFA 3TO6A 3MAJA 1PDNC 3H3UA 1HXDA 1S3JA 1F4KA 2CW0F 3HSFA 3JTGA 1KQ8A 4N9HA 2QBYB 3GZ6A 3B73A 5EEGA 3GFJA 2R7FA 1FPQA 4EJOA 2RV8A 3L09A 3RI4A 2JZYA 4XBFA 1IAWA 3TO7A 4RB2C 3N97A 1LQ1A 3FMRA 1FOKA 5LHGA 5LGTA 4I98B 5D5VB 2LF7A 4L18B 1BI1A 1BIAA 4EVIA 5FO5A 5BPDA 5BPIA 3EETA 1SD7A 1OPCA 2P4WA 1FBSA 3S2WA 4PZJA 2TDXA 3VODA 2O6GE 1QBJA 1RZ4A 4U88A 3WGIA 1FX7A 1D8JA 4PGHA 3N4MA 2ELHA 2ACJA 2XAHA 4ESFA 2QQBA 3IL2A 2RKHA 1R5HA 2G7HA 1KQ0A 1LNWA 5HLIA 4U0VA 4DNCA 3FM3A 4RB0A 4RS8A 1FSEA 3E6CC 4M9SA 2IA2A 3BPXA 2VONA 3F72A 5K5OA 1XSVA 4CDGA 1FSHA 4QLCU 1J9IA 2L01A 5BQTA 1TQPA 5L3DA 4ESBA 1CF7B 3LAJA 3AAFA 3W6JB 4IF4A 2F5FA 3WTYC 4U0WA 3BZ6A 1OR7A 2OQGA 3V7CA 2LF8A 2JTVA 5LHHA 1O57A 1GXQA 1U78A 2VE8A 4I7HA 3FM5A 4IXAA 1B59A 2FNPA 2FKDA 1XCBA 2RC4A 5HLGA 3CDHA 3FXQA 1IN4A 4HF1A 1SD5A 2ZO4A 2V6CA 3K1NA 2K4BA 3WU1B 3PQKA 1QPMA 2FJRA 1IXSB 3EYYA 2HYGD 3RTRA 5LHIA 1FBQA 3SZTA 3ULQB 1SFXA 2HWVA 2MH9A 1YYVA 1U2WA 4KT5C 3V7RA 4ESJA 2M30A 1ZRDA 2YX4A 4KUMA 3CO6C 4EM2A 1IZ1A 4NQWA 4WXDA 3FXRA 2W24A 3RJPA 5H20A 5D8KB 3RKXA 5DCMA 3SHFA 2LKPA 4IHSA 4L9VA 4AVPA 2O8XA 1ZG1A 3WTTC 2ISYA 1KGSA 2KIMA 3QPHA 4ZYGA 4IVNA 3DPTA 3QU3A 4HQEA 3O2PE 5HOOA 1ZYRF 1B9NA 3DKWA 1UHWA 1KU2A 3DPLC 3TDUC 2Z9OA 4M73A 4FX0A 2PLYA 2BEOA 1SMTA 4LJZF 5AIPA 3I4PA 1WQ2A 3WTUC 1TNTA 5FD6A 3K1PA 5TJJA 3GYHX 2C6YA 4EJUA 4ZYEA 3Q9VA 3PFIA 3F8FA 5E8GA 1YS6A 3BDDA 4LG0B 1J2XA 4LMYA 3WE3A 2FBHA 4I02A 4A2UA 4UVAA 1REPC 3ZMUA 2EA4A 3WGHA 1E17A 6PAXA 1BIBA 5ICEA 3ZMTA 2QUFA 1ZG3A 3F8MA 2LDUA 2P8TA 3F8CA 3HRUA 3CUQB 5HS7A 1OMIA 1Z6TA 1MJBA 2XGXA 4MNUA 2HQNA 2J5PA 1MD0A 2OQRA 1IF1A 1B12A 2NRAC 3I58A 1DDNA 2EB7A 3V8KA 2XAGA 1B4AA 3MQ0A 3GFLA 3NRVA 2OA4A 4RGUA 5DYMA 2YR2A 1U5TC 4HDVA 2IP2A 4XLPF 1EH6A 1S7OA 2X0LA 3FMSA 4ASNA 5CVUA 1BC7C 3T8RA 3SZPA 2JRTA 3V8LA 3L9FA 4ENJA 1W7PD 4RAYA 3REOA 3TGNA 4RAZA 1R7JA 4M6XA 2CG4A 1OKRA 3IKVA 3U2RA 3IKTA 2RVCA 2XASA 1XGSA 3ZP5A 1J75A 1XMAA 4P9UA 2L02A 4I09A 4HX7A 1R23A 3KZYA 2HTJA 1YIOA 2YPRA 2W57A 3LA3A 4JQFA 2P7VB 4LB6B 2DI3A 5D8LB 3NEUA 1D5VA 3IC7A 3V7SA 1TNSA 5LBQA 2E1CA 1G4DA 2IJLA 3R6SA 2K4JA 1G3YA 2PMUA 1YG2A 1O3SA 3ZQ7A 1I1GA 4IRHA 3GVAA 2Z5UA 3QPTA 2Z99A 4YG2F 4IRGA 3MZHA 1SD4A 3R4KA 2QENA 4Q5SF 2VT2A 3T1BA 4BHBA 4L5IA 4MEXF 5BMZA 2P6TA 2K27A 1BJAA 4AIKA 3HOTA 1RUOA 1XGOA 3GX4X 5HS8A 1IXRC 1FZPB 2HGCA 1QO0D 2R7DA 4IHTA 3WTZA 3K2ZA 3MCZA 3TQNA 1GVJA 4FT8A 4I2OA 1XSDA 1KYZA 4HOBA 2BV6A 3QP6A 2E7WA 2PJPA 3WTVC 4XRFA 1XSXA 1RI7A 2A68F 2NAZA 5F6FA 4B09A 4CO8A 1EH8A 1TLHB 5LLQA 1ZGAA 5ED4A 3E6MA 2E7XA 3HTUA 4L9NA 2V1XA 1KU3A 3WTXC 2NNNA 4GCVA 5LGNA 1G3TA 2XKPA 2STWA 4UNOA 3FWEA 4KYWA 4PCQA 1DP7P 2EK5A 2EV0A 2OU2A 1BI0A 4HA8A 3KP7A 3C1DA 1MGTA 1JHFA 2MBFA 4PDKA 2PI0A 2H09A 3RPUA 4M9XA 4AIJA 1HBXG 1QZZA 1UCRA 3I5UA 3SXYA 5E1WA 4OIOF 4D0PA 2D1VA 2IRFG 5K5QA 2XV4S 5DDGA 4KN4X 5LRRA 2FBKA 3ELKA 4HLXA 4OMYA 1H9TA 1J59A 1EV7A 3PQJA 1DPRA 4QWQA 1ZG5A 4GGGA 4LG0A 3BPVA 4AWXB 4IJAA 5JR3A 5K1YA 3HHHA 2FF4A 3RIRA 4JBAA 1UB9A 1XMKA 2IT0A 3JW4A 5L3EA 2VE9A 3HHGA 3DQVC 4L9JA 2OZ6A 4G7ZF 3ML6A 4YIFA 5ICGA 2XIGA 3M8EA 4BYYA 5LEJA 1DPUA 4HQMA 5AONA 2PBIA 3J80K 1HQCA 2HYFA 4RB3C 1IRFA 3HRMA 3GZ5A 4L0ZB 4LK0F 3ERED 1U8RA 4CICA 3EYIA 4CHUA 1IN5A 3I59B 3ZPLA 2X4HA 2A6HF 5BOXA 3RYRA 3JSOA 2VBWA 4BHCA 2L4AA 5D4SA 2EA2A 2DAOA 4KFCA 3HSRA 4A5MA 1YO5C 1JHEA 1OYWA 2VXZA 1HSTA 3F6OA 3K1MA 1T7DA 4HLYA 4G6DA 1WRJA 1MZBA 4BHPA 3P9CA 1FYKA 3GW2A 2ZCWA 1YFHA 1E2XA 3GXOA 4AIHA 1J7KA 1JHCA 1XDUA 1HKSA 4EV0A 5ERIA 2VBYA 3O6BB 2DU9A 2FQ3A 4MTEA 1R36A 2GA1A 4I0AA 2DFIA 5F64A 3FHZA 5E1XA 4EGZA 2A5YB 2DTRA 3HOSA 5E18F 1FLIA 2ZMEB 2FMYA 1P2FA 3B02A 2PEXA 3J80Z 4YFNF 1KN9A 4GXOA 3VEPA 2Y48A 5ICFA 1O7FA 1WI9A 3BJAA 2HO0A 4E70A 3BOQA 3NQOA 3KEOA 3TDZC 4RGXA 1WKMA 4OINF 4G7OF 2QQAA 2NYXA 3EUHA 3CUQC 1LEBA 1ON2A 1LDDA 2DLLA 2DW4A 1IW7F 3T0YA 4K2EA 2G9WA 2Y0MA 3BJ6A 2BBYA 3J7AO 3RDIA 4L5JA 2HDCA 5F1RA 2HS5A 5ILUA 2KRFA 4UVCA 1LJ9A 2OD5A 2GIVA 2RDPA 1EH7A 3M9AA 4EGYA 3JTHA 1KCAA 1SD6A 2HNFA 1T39A 4KIFA 2OZUA 4NB5A 1YQAA 4G7HF 2HTSA 2D45A 3TO9A 3RKWA 2H6BA 2STTA 4LLGF 1P6RA 2UZKA 1L0OC 1R1UA 5JFRA 2EWNA 2P6SA 3DFGA 2EJRA 2QVOA 2FE3A 1G6NA 5ICCA 3F6VA 4LLLA 1IN8A 1TQIA 2O0YA 2HQRA 2Z33A 2GXGA 1USSA 1PP7U 3C3WA 4ZYHA 5DV5A 4KMUX 3DF8A 3OOPA 1O3QA 3HRSA 5CYVA 2VC1A 4KICA 2EFQA 4M71A 3M1EA 4P5OA 2FMLA 1Y0UA 5DD4A 2QZ8A 4G8XA 3I54A 5JI6A 4UVBA 4NHJA 5L3GA 5HLHA 3C7JA 4R8HA 1ZRCA 1RIOH 1AY9A 4HV5A 1TTYA 5DUKA 2KJCA 1IXCA 2ZJ2A 1PUEE 1O7LA 1F1ZA 3LA2A 3CLOA 4ON0A 3WTSC 5HS9A 3L00A 3HRTA 3R61A 2YSRA 2QM3A 2DQLA 1BM9A 5DEQA 3CO7C 2DPUA 2LNBA 5IT9Z 1ULYA 3LAPA 2V1DA 3CUOA 1YW8A 3ABUA 4ZH4F 5FGMA 1BC8C 1QZYA 4RGSA 1F5TA 1C0WA 3SFZA 5K5RA 2MLKA 1DUXC 3P9IA 3M7GA 5D5WB 2AS5F 1ZARA 3FZVA 2ETHA 3GFIA 1K78A 4S04A 1BI2A 5LRSA 2WC2A 1PP8F 4ZZLA 5D4RA 1FYMA 2YX7A 5CVIA 5CVRA 4N9IA 1T98A 2CWEA 1I4VA 4PGGA 4Y13A 2WV0A 3WGGA 5J6XA 3I53A 3ECOA 2FU4A 1K7AA 4UV9A 3E6BA 4GYGA 2K02A 4MGRA 5HDNA 3IRRA 4FHTA 5DUIA 1F9NA 2DO7A 2NS0A 1SFUA 3EDPA 2FXAA 3I0TA 3WU0A 1KU9A 4EQQA 2XVCA 2E1NA 1WSUA 1B9MA 1ZLKA 3LSTA 2HKXA 3ABTA 1FBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HW1 A;  5L3B A;  1KA8 A;  4OIQ F;  4YII A;  1FP1 D;  2ESH A;  2H94 A;  2CSO A;  4GYI A;  4HW0 A;  2QWW A;  5HDG A;  1D3Y A;  4RGR A;  1WWX A;  5E17 F;  4KNY A;  2VOP A;  3DEU A;  3E3V A;  2DK5 A;  3ZMV A;  3I71 A;  3KP3 A;  1GXP A;  4U0Y A;  1R1T A;  4ENN A;  4EM1 A;  1I5Z A;  4CXF A;  4UHT A;  3K0L A;  2P7C B;  1O3R A;  1IRG A;  4HX8 A;  4I0B A;  3H3Z A;  4LGW A;  2D2W A;  1LB2 A;  2VN2 A;  1J5Y A;  3LWF A;  1STZ A;  4CGZ A;  1J0R A;  4KIG A;  2BGC A;  3T5X A;  3LFK A;  4OOI A;  4OIR F;  2DPD A;  1W4M A;  4O3M A;  1YLF A;  1YS7 A;  2ZFW A;  2FSW A;  4A0Y A;  3KLN A;  1RNL A;  3F8N A;  1ON1 A;  1FP2 A;  1W7P A;  3K9T A;  1O3T A;  1Z9C A;  4WXH A;  3MZY A;  5D5X B;  3FMQ A;  3F3X A;  2F2E A;  1VTN C;  3FX3 A;  3KP6 A;  3D0S A;  2EFO A;  4R79 A;  1P4A A;  1AOY A;  2FBI A;  1QGP A;  5IT9 K;  2WTE A;  1GHC A;  4EM0 B;  2CGP A;  3I59 A;  3GUD A;  2HOE A;  2FRH A;  4CYD A;  1U5T A;  2EV5 A;  1TQM A;  2COM A;  2ZXJ A;  3DP7 A;  1JGS A;  4ZZD A;  2UXN A;  4WX9 A;  2R3S A;  2G7U A;  3E6D A;  3KCC A;  1UFM A;  4MQ9 F;  3LA7 A;  2PFB A;  4MQV A;  3KET A;  2MD5 A;  3TOA A;  4UUV A;  1CF7 A;  1S29 A;  2XAQ A;  4LFU A;  4NV4 A;  1HSJ A;  2DT5 A;  3WG9 A;  4ENK A;  2IA0 A;  4O6J A;  1S6L A;  2YU3 A;  3C18 A;  1P92 A;  3IHU A;  3ZMS A;  4Q48 A;  4EMS A;  2M45 A;  3M8F A;  4AD9 A;  1P4W A;  3SQN A;  4BQA A;  3KZZ A;  3FXU A;  1U3E M;  1IN7 A;  4BAY A;  4LLN A;  5HDK A;  1G3W A;  5CLS A;  2M87 A;  2KKO A;  2XUB A;  4Q47 A;  2DQR A;  2IPQ X;  4I01 A;  5FB2 A;  1A04 A;  3U9G A;  3KLO A;  1UHM A;  2KIU A;  2XAJ A;  2HEO A;  4P96 A;  5E8I A;  3K69 A;  5FLX K;  3BY6 A;  1SMY F;  4P55 A;  5IT3 A;  4N31 A;  5CVJ A;  3TKY A;  3KE2 A;  4K8W A;  1T0F A;  1ZRE A;  5FLX Z;  2XHK A;  1KU7 A;  3L2C A;  4IPA A;  2D1H A;  1ZRF A;  4BNC A;  5EEH A;  2A61 A;  1Z1D A;  4F7Z A;  2ZNY A;  1OYY A;  4KMF A;  2O03 A;  1QNT A;  1NHA A;  2FNA A;  2CQK A;  2DBB A;  2P5K A;  1ZN2 A;  3W6K B;  3QOP A;  4JK1 X;  3L7W A;  4A0Z A;  4WXC A;  2QLZ A;  3KP5 A;  2XKO A;  2HZT A;  3D5L A;  2EFW A;  1ZGJ A;  4N0B A;  3WTW C;  2F5E A;  2OBP A;  1ZH5 A;  4ETS A;  2JT1 A;  3TOB A;  3G3Z A;  1JE8 A;  5BS6 A;  2KJB A;  2VT3 A;  4Q4Z F;  4LB5 A;  2BE5 F;  3MEX A;  4UXN A;  1IN6 A;  1P4X A;  2PG4 A;  2RGV A;  2AXL A;  1LVA A;  3EQL F;  2FA5 A;  3WOD F;  1Z7U A;  2CYY A;  2H6C A;  3ECH A;  3O3K A;  4XSZ F;  3J81 K;  5A2Q K;  2P5V A;  3E97 A;  4KA4 A;  1FC3 A;  1I1S A;  3JAM Z;  3RYP A;  5KK1 A;  4GO1 A;  4Z2Y A;  4U7B A;  5AIQ A;  2ZME A;  3P9K A;  1JXS A;  3COA C;  2ZKZ A;  2ZBK A;  1XGM A;  3CTA A;  4M74 A;  2B0L A;  4YFX F;  2GZW A;  4HYE A;  1I27 A;  3F8B A;  2WWY A;  2XRO A;  1T6S A;  3VFZ A;  1FYL A;  1B6A A;  1YW7 A;  2A69 F;  3MFK A;  3OV8 A;  3HYI A;  2O61 A;  5FFX A;  1L3L A;  2Q8K A;  4B8X A;  1XN7 A;  2JSC A;  4A5N A;  2Q2E A;  3ZMZ A;  4M9Z A;  5D6F A;  1ONV A;  3V4G A;  2K7L A;  2MA3 A;  2QYO A;  1R00 A;  2MH2 A;  2MLG A;  2M8E A;  1R58 A;  4LK1 F;  2IVM A;  3U1D A;  5CVV A;  4HF0 A;  3GWZ A;  1UST A;  2A3S A;  4UV8 A;  3F22 A;  3KP2 A;  3IWF A;  2PMH A;  3QP5 A;  1TW2 A;  4WCG A;  4WF2 A;  3G73 A;  4YFK F;  4P9F A;  2F5D A;  4RB1 A;  1W7P B;  2VC0 A;  2H27 A;  4Y17 A;  4XLN F;  3GO5 A;  2HFH A;  3E5X A;  1QQI A;  1XB4 A;  3VB2 A;  4DQ2 A;  1ZLJ A;  2RQP A;  3QU6 A;  1KQ9 A;  1RUN A;  2FEZ A;  1HKT A;  2GAU A;  4KDP A;  3WE2 A;  3QAH A;  3BDN A;  3LQQ A;  5L3C A;  1XCV A;  2UWM A;  2XRN A;  2M5W A;  3LQR A;  1H9G A;  1TBX A;  3JSP A;  1JHH A;  2EFP A;  2XAF A;  1HKQ A;  1D8K A;  3F21 A;  3IRQ A;  2HR3 A;  1BOA A;  2PQ8 A;  2DK8 A;  3R0A A;  4R1H A;  5LGU A;  3V8J A;  4A6E A;  4BH9 A;  3BP8 A;  2FOK A;  3ZN0 A;  2W25 A;  1TW3 A;  3GLX A;  2PN6 A;  3R60 A;  3R0J A;  1LEA A;  1W5S A;  2OAZ A;  4OIP F;  3VOE A;  5H6Q A;  5LEK A;  3MWM A;  4G9Y A;  5TRD A;  2Q0O A;  1MJA A;  1T38 A;  3GEZ A;  2QQ9 A;  1SAX A;  3CJN A;  1FT9 A;  1W5T A;  1T2K A;  3BWG A;  4L9T A;  5HVQ C;  4MHG A;  2ZNZ A;  2LSO A;  1Z6R A;  2GWR A;  2GQQ A;  4M72 A;  5A2Q Z;  3IIQ A;  3Q5F A;  1G3S A;  5DD8 A;  2EV6 A;  2ESN A;  2Z3Y A;  4FX4 A;  4MTD A;  3CUQ A;  4A0X A;  2ISZ A;  1OYI A;  2VBZ A;  4XSX F;  1S8N A;  5DCM B;  1YTY A;  2NNY A;  5FFZ A;  2VOO A;  1U5T B;  1FY7 A;  2ADU A;  3KEQ A;  4ENM A;  4EJW A;  5JHU A;  3ZMD A;  2W84 A;  1U6G A;  3DXJ F;  3BJO A;  1YW9 A;  4G6Q A;  2UXX A;  4S05 A;  4M6Y A;  4IRI A;  4HZF A;  1H0M A;  2RN7 A;  1MKM A;  1F39 A;  2O3F A;  4MEY F;  1Z05 A;  3GF2 A;  4G94 A;  3ISP A;  1BI3 A;  2V79 A;  4OMZ A;  3I64 A;  5H6R A;  3DV8 A;  1HW2 A;  2K86 A;  4CZZ A;  1ZAO A;  1X3U A;  2JPC A;  4HF2 A;  1IUY A;  4Y15 A;  3ZN1 A;  2Y75 A;  3RPQ A;  1R1V A;  3E5U A;  3HUG A;  1AWC A;  1MDM A;  2M1B A;  4ZYD A;  1ZHF A;  2V1U A;  2CO5 A;  4WK8 F;  5DCF A;  2L54 A;  1V3F A;  3HTS B;  2A6E F;  2RNJ A;  1R22 A;  3GFM A;  3HIF A;  1HW5 A;  5L3F A;  3RKY A;  4HAM A;  3T8T A;  5JVT A;  1BN5 A;  1FWZ A;  3KP4 A;  4HBL A;  4A12 A;  2VBX A;  1ODD A;  1Q1H A;  1SFE A;  1K78 B;  3QRF F;  4HX4 A;  3KFW X;  2A07 F;  4KIB A;  1Z91 A;  2J5O A;  2L3D A;  2VOD A;  4OU0 A;  3JAM K;  2JPB A;  5J8C A;  1XDS A;  5CJ9 A;  4EJT A;  4EJV A;  1I6X A;  2F5C A;  2IA1 A;  2P5L C;  3J81 Z;  3S04 A;  1MDM B;  5ILV A;  4HDU A;  1FNN A;  5D5U B;  4H0E A;  1LDJ A;  1UMU A;  4WWC A;  2GA2 A;  5FD5 A;  4A6D A;  5KVR A;  4TV7 A;  1R5G A;  5E20 A;  4BXU A;  1BBY A;  2BYV E;  2L4M A;  2QBY A;  2HKO A;  4LD5 A;  2CFX A;  3E5Q A;  3F23 A;  5J8F A;  1CGP A;  2V9V A;  2MC3 A;  3BRO A;  3HSE A;  2IW5 A;  1LDK B;  3FF5 A;  4L0Y B;  1K6O A;  5ILS A;  1V4R A;  1XGN A;  3IWZ A;  3Q9S A;  5D6E A;  2W85 A;  1XD7 A;  5E1Z B;  2EFN A;  4HV6 A;  1K79 A;  1S7A A;  3H92 A;  4O5V A;  2GXB A;  3ROU A;  3P7N A;  1MJ9 A;  4ME8 A;  1KYW A;  4U7D A;  4KN7 X;  1B1B A;  2KIF A;  3TO6 A;  3MAJ A;  1PDN C;  3H3U A;  1HXD A;  1S3J A;  1F4K A;  2CW0 F;  3HSF A;  3JTG A;  1KQ8 A;  4N9H A;  2QBY B;  3GZ6 A;  3B73 A;  5EEG A;  3GFJ A;  2R7F A;  1FPQ A;  4EJO A;  2RV8 A;  3L09 A;  3RI4 A;  2JZY A;  4XBF A;  1IAW A;  3TO7 A;  4RB2 C;  3N97 A;  1LQ1 A;  3FMR A;  1FOK A;  5LHG A;  5LGT A;  4I98 B;  5D5V B;  2LF7 A;  4L18 B;  1BI1 A;  1BIA A;  4EVI A;  5FO5 A;  5BPD A;  5BPI A;  3EET A;  1SD7 A;  1OPC A;  2P4W A;  1FBS A;  3S2W A;  4PZJ A;  2TDX A;  3VOD A;  2O6G E;  1QBJ A;  1RZ4 A;  4U88 A;  3WGI A;  1FX7 A;  1D8J A;  4PGH A;  3N4M A;  2ELH A;  2ACJ A;  2XAH A;  4ESF A;  2QQB A;  3IL2 A;  2RKH A;  1R5H A;  2G7H A;  1KQ0 A;  1LNW A;  5HLI A;  4U0V A;  4DNC A;  3FM3 A;  4RB0 A;  4RS8 A;  1FSE A;  3E6C C;  4M9S A;  2IA2 A;  3BPX A;  2VON A;  3F72 A;  5K5O A;  1XSV A;  4CDG A;  1FSH A;  4QLC U;  1J9I A;  2L01 A;  5BQT A;  1TQP A;  5L3D A;  4ESB A;  1CF7 B;  3LAJ A;  3AAF A;  3W6J B;  4IF4 A;  2F5F A;  3WTY C;  4U0W A;  3BZ6 A;  1OR7 A;  2OQG A;  3V7C A;  2LF8 A;  2JTV A;  5LHH A;  1O57 A;  1GXQ A;  1U78 A;  2VE8 A;  4I7H A;  3FM5 A;  4IXA A;  1B59 A;  2FNP A;  2FKD A;  1XCB A;  2RC4 A;  5HLG A;  3CDH A;  3FXQ A;  1IN4 A;  4HF1 A;  1SD5 A;  2ZO4 A;  2V6C A;  3K1N A;  2K4B A;  3WU1 B;  3PQK A;  1QPM A;  2FJR A;  1IXS B;  3EYY A;  2HYG D;  3RTR A;  5LHI A;  1FBQ A;  3SZT A;  3ULQ B;  1SFX A;  2HWV A;  2MH9 A;  1YYV A;  1U2W A;  4KT5 C;  3V7R A;  4ESJ A;  2M30 A;  1ZRD A;  2YX4 A;  4KUM A;  3CO6 C;  4EM2 A;  1IZ1 A;  4NQW A;  4WXD A;  3FXR A;  2W24 A;  3RJP A;  5H20 A;  5D8K B;  3RKX A;  5DCM A;  3SHF A;  2LKP A;  4IHS A;  4L9V A;  4AVP A;  2O8X A;  1ZG1 A;  3WTT C;  2ISY A;  1KGS A;  2KIM A;  3QPH A;  4ZYG A;  4IVN A;  3DPT A;  3QU3 A;  4HQE A;  3O2P E;  5HOO A;  1ZYR F;  1B9N A;  3DKW A;  1UHW A;  1KU2 A;  3DPL C;  3TDU C;  2Z9O A;  4M73 A;  4FX0 A;  2PLY A;  2BEO A;  1SMT A;  4LJZ F;  5AIP A;  3I4P A;  1WQ2 A;  3WTU C;  1TNT A;  5FD6 A;  3K1P A;  5TJJ A;  3GYH X;  2C6Y A;  4EJU A;  4ZYE A;  3Q9V A;  3PFI A;  3F8F A;  5E8G A;  1YS6 A;  3BDD A;  4LG0 B;  1J2X A;  4LMY A;  3WE3 A;  2FBH A;  4I02 A;  4A2U A;  4UVA A;  1REP C;  3ZMU A;  2EA4 A;  3WGH A;  1E17 A;  6PAX A;  1BIB A;  5ICE A;  3ZMT A;  2QUF A;  1ZG3 A;  3F8M A;  2LDU A;  2P8T A;  3F8C A;  3HRU A;  3CUQ B;  5HS7 A;  1OMI A;  1Z6T A;  1MJB A;  2XGX A;  4MNU A;  2HQN A;  2J5P A;  1MD0 A;  2OQR A;  1IF1 A;  1B12 A;  2NRA C;  3I58 A;  1DDN A;  2EB7 A;  3V8K A;  2XAG A;  1B4A A;  3MQ0 A;  3GFL A;  3NRV A;  2OA4 A;  4RGU A;  5DYM A;  2YR2 A;  1U5T C;  4HDV A;  2IP2 A;  4XLP F;  1EH6 A;  1S7O A;  2X0L A;  3FMS A;  4ASN A;  5CVU A;  1BC7 C;  3T8R A;  3SZP A;  2JRT A;  3V8L A;  3L9F A;  4ENJ A;  1W7P D;  4RAY A;  3REO A;  3TGN A;  4RAZ A;  1R7J A;  4M6X A;  2CG4 A;  1OKR A;  3IKV A;  3U2R A;  3IKT A;  2RVC A;  2XAS A;  1XGS A;  3ZP5 A;  1J75 A;  1XMA A;  4P9U A;  2L02 A;  4I09 A;  4HX7 A;  1R23 A;  3KZY A;  2HTJ A;  1YIO A;  2YPR A;  2W57 A;  3LA3 A;  4JQF A;  2P7V B;  4LB6 B;  2DI3 A;  5D8L B;  3NEU A;  1D5V A;  3IC7 A;  3V7S A;  1TNS A;  5LBQ A;  2E1C A;  1G4D A;  2IJL A;  3R6S A;  2K4J A;  1G3Y A;  2PMU A;  1YG2 A;  1O3S A;  3ZQ7 A;  1I1G A;  4IRH A;  3GVA A;  2Z5U A;  3QPT A;  2Z99 A;  4YG2 F;  4IRG A;  3MZH A;  1SD4 A;  3R4K A;  2QEN A;  4Q5S F;  2VT2 A;  3T1B A;  4BHB A;  4L5I A;  4MEX F;  5BMZ A;  2P6T A;  2K27 A;  1BJA A;  4AIK A;  3HOT A;  1RUO A;  1XGO A;  3GX4 X;  5HS8 A;  1IXR C;  1FZP B;  2HGC A;  1QO0 D;  2R7D A;  4IHT A;  3WTZ A;  3K2Z A;  3MCZ A;  3TQN A;  1GVJ A;  4FT8 A;  4I2O A;  1XSD A;  1KYZ A;  4HOB A;  2BV6 A;  3QP6 A;  2E7W A;  2PJP A;  3WTV C;  4XRF A;  1XSX A;  1RI7 A;  2A68 F;  2NAZ A;  5F6F A;  4B09 A;  4CO8 A;  1EH8 A;  1TLH B;  5LLQ A;  1ZGA A;  5ED4 A;  3E6M A;  2E7X A;  3HTU A;  4L9N A;  2V1X A;  1KU3 A;  3WTX C;  2NNN A;  4GCV A;  5LGN A;  1G3T A;  2XKP A;  2STW A;  4UNO A;  3FWE A;  4KYW A;  4PCQ A;  1DP7 P;  2EK5 A;  2EV0 A;  2OU2 A;  1BI0 A;  4HA8 A;  3KP7 A;  3C1D A;  1MGT A;  1JHF A;  2MBF A;  4PDK A;  2PI0 A;  2H09 A;  3RPU A;  4M9X A;  4AIJ A;  1HBX G;  1QZZ A;  1UCR A;  3I5U A;  3SXY A;  5E1W A;  4OIO F;  4D0P A;  2D1V A;  2IRF G;  5K5Q A;  2XV4 S;  5DDG A;  4KN4 X;  5LRR A;  2FBK A;  3ELK A;  4HLX A;  4OMY A;  1H9T A;  1J59 A;  1EV7 A;  3PQJ A;  1DPR A;  4QWQ A;  1ZG5 A;  4GGG A;  4LG0 A;  3BPV A;  4AWX B;  4IJA A;  5JR3 A;  5K1Y A;  3HHH A;  2FF4 A;  3RIR A;  4JBA A;  1UB9 A;  1XMK A;  2IT0 A;  3JW4 A;  5L3E A;  2VE9 A;  3HHG A;  3DQV C;  4L9J A;  2OZ6 A;  4G7Z F;  3ML6 A;  4YIF A;  5ICG A;  2XIG A;  3M8E A;  4BYY A;  5LEJ A;  1DPU A;  4HQM A;  5AON A;  2PBI A;  3J80 K;  1HQC A;  2HYF A;  4RB3 C;  1IRF A;  3HRM A;  3GZ5 A;  4L0Z B;  4LK0 F;  3ERE D;  1U8R A;  4CIC A;  3EYI A;  4CHU A;  1IN5 A;  3I59 B;  3ZPL A;  2X4H A;  2A6H F;  5BOX A;  3RYR A;  3JSO A;  2VBW A;  4BHC A;  2L4A A;  5D4S A;  2EA2 A;  2DAO A;  4KFC A;  3HSR A;  4A5M A;  1YO5 C;  1JHE A;  1OYW A;  2VXZ A;  1HST A;  3F6O A;  3K1M A;  1T7D A;  4HLY A;  4G6D A;  1WRJ A;  1MZB A;  4BHP A;  3P9C A;  1FYK A;  3GW2 A;  2ZCW A;  1YFH A;  1E2X A;  3GXO A;  4AIH A;  1J7K A;  1JHC A;  1XDU A;  1HKS A;  4EV0 A;  5ERI A;  2VBY A;  3O6B B;  2DU9 A;  2FQ3 A;  4MTE A;  1R36 A;  2GA1 A;  4I0A A;  2DFI A;  5F64 A;  3FHZ A;  5E1X A;  4EGZ A;  2A5Y B;  2DTR A;  3HOS A;  5E18 F;  1FLI A;  2ZME B;  2FMY A;  1P2F A;  3B02 A;  2PEX A;  3J80 Z;  4YFN F;  1KN9 A;  4GXO A;  3VEP A;  2Y48 A;  5ICF A;  1O7F A;  1WI9 A;  3BJA A;  2HO0 A;  4E70 A;  3BOQ A;  3NQO A;  3KEO A;  3TDZ C;  4RGX A;  1WKM A;  4OIN F;  4G7O F;  2QQA A;  2NYX A;  3EUH A;  3CUQ C;  1LEB A;  1ON2 A;  1LDD A;  2DLL A;  2DW4 A;  1IW7 F;  3T0Y A;  4K2E A;  2G9W A;  2Y0M A;  3BJ6 A;  2BBY A;  3J7A O;  3RDI A;  4L5J A;  2HDC A;  5F1R A;  2HS5 A;  5ILU A;  2KRF A;  4UVC A;  1LJ9 A;  2OD5 A;  2GIV A;  2RDP A;  1EH7 A;  3M9A A;  4EGY A;  3JTH A;  1KCA A;  1SD6 A;  2HNF A;  1T39 A;  4KIF A;  2OZU A;  4NB5 A;  1YQA A;  4G7H F;  2HTS A;  2D45 A;  3TO9 A;  3RKW A;  2H6B A;  2STT A;  4LLG F;  1P6R A;  2UZK A;  1L0O C;  1R1U A;  5JFR A;  2EWN A;  2P6S A;  3DFG A;  2EJR A;  2QVO A;  2FE3 A;  1G6N A;  5ICC A;  3F6V A;  4LLL A;  1IN8 A;  1TQI A;  2O0Y A;  2HQR A;  2Z33 A;  2GXG A;  1USS A;  1PP7 U;  3C3W A;  4ZYH A;  5DV5 A;  4KMU X;  3DF8 A;  3OOP A;  1O3Q A;  3HRS A;  5CYV A;  2VC1 A;  4KIC A;  2EFQ A;  4M71 A;  3M1E A;  4P5O A;  2FML A;  1Y0U A;  5DD4 A;  2QZ8 A;  4G8X A;  3I54 A;  5JI6 A;  4UVB A;  4NHJ A;  5L3G A;  5HLH A;  3C7J A;  4R8H A;  1ZRC A;  1RIO H;  1AY9 A;  4HV5 A;  1TTY A;  5DUK A;  2KJC A;  1IXC A;  2ZJ2 A;  1PUE E;  1O7L A;  1F1Z A;  3LA2 A;  3CLO A;  4ON0 A;  3WTS C;  5HS9 A;  3L00 A;  3HRT A;  3R61 A;  2YSR A;  2QM3 A;  2DQL A;  1BM9 A;  5DEQ A;  3CO7 C;  2DPU A;  2LNB A;  5IT9 Z;  1ULY A;  3LAP A;  2V1D A;  3CUO A;  1YW8 A;  3ABU A;  4ZH4 F;  5FGM A;  1BC8 C;  1QZY A;  4RGS A;  1F5T A;  1C0W A;  3SFZ A;  5K5R A;  2MLK A;  1DUX C;  3P9I A;  3M7G A;  5D5W B;  2AS5 F;  1ZAR A;  3FZV A;  2ETH A;  3GFI A;  1K78 A;  4S04 A;  1BI2 A;  5LRS A;  2WC2 A;  1PP8 F;  4ZZL A;  5D4R A;  1FYM A;  2YX7 A;  5CVI A;  5CVR A;  4N9I A;  1T98 A;  2CWE A;  1I4V A;  4PGG A;  4Y13 A;  2WV0 A;  3WGG A;  5J6X A;  3I53 A;  3ECO A;  2FU4 A;  1K7A A;  4UV9 A;  3E6B A;  4GYG A;  2K02 A;  4MGR A;  5HDN A;  3IRR A;  4FHT A;  5DUI A;  1F9N A;  2DO7 A;  2NS0 A;  1SFU A;  3EDP A;  2FXA A;  3I0T A;  3WU0 A;  1KU9 A;  4EQQ A;  2XVC A;  2E1N A;  1WSU A;  1B9M A;  1ZLK A;  3LST A;  2HKX A;  3ABT A;  1FBU A; 
#chains in the Genus database with same CATH topology
 4BJ5 C;  1HW1 A;  5L3B A;  1KA8 A;  4V19 K;  3Q0V A;  4OIQ F;  2Y31 A;  4V2G A;  4YII A;  1ZTR A;  2WA0 A;  1FP1 D;  5FKN A;  4XOR A;  2ESH A;  2H94 A;  2CSO A;  4GYI A;  4HW0 A;  2L9S A;  1Z77 A;  2QWW A;  5TIS C;  5HDG A;  1D3Y A;  4XQF A;  4RGR A;  1WWX A;  5E17 F;  3V42 A;  2IGK A;  1YJ9 I;  4KNY A;  2VOP A;  3DEU A;  3E3V A;  3M8J A;  2DK5 A;  2OJE D;  3I71 A;  3ZMV A;  3KP3 A;  1GXP A;  2JA5 J;  1ETV A;  1SAU A;  4U0Y A;  1VQL I;  1R1T A;  4BE1 A;  4ENN A;  2DMN A;  4EM1 A;  3SJM A;  3B6A A;  1Y39 A;  1I5Z A;  4CXF A;  5EDN A;  4B44 A;  2OCC H;  3BR3 A;  4UHT A;  2WAE A;  3K0L A;  2P7C B;  1P7I A;  1ZGW A;  1O3R A;  1BW6 A;  1B8I B;  1IRG A;  1WJE A;  1D0Y A;  1XTA A;  3BQY A;  4HX8 A;  3W6V A;  1QPI A;  4I0B A;  3H3Z A;  4LGW A;  4BKX A;  4NQW B;  2D2W A;  1ETY A;  4QSH A;  1LB2 A;  2JWT A;  2EZK A;  2VN2 A;  1J5Y A;  4PJL A;  3SDG A;  3LWF A;  1STZ A;  2IEK A;  1W36 D;  4CGZ A;  1J0R A;  4KIG A;  2PX9 A;  3F0C A;  2BGC A;  3SDB A;  5GTI C;  2EIK H;  3T5X A;  1Y6I A;  1ORK A;  2EIL H;  2XGD A;  3LFK A;  4OOI A;  2X48 A;  3M1C A;  4II2 A;  4OIR F;  3K2A A;  2DPD A;  1W4M A;  4O3M A;  3FIW A;  3PIO F;  1NG7 A;  1YLF A;  1YS7 A;  2ID6 A;  3AG1 H;  2ZFW A;  2FSW A;  1TT5 B;  2V4J C;  4A0Y A;  5FLM J;  2K9M A;  2HPI A;  2PJR A;  2UV1 A;  3KLN A;  3OYB A;  4RAG A;  1MSE C;  1RNL A;  2DFF A;  1Z3Y A;  3F8N A;  1ON1 A;  1FP2 A;  5J3L A;  5FKK A;  1W7P A;  2WY7 Q;  2K9L A;  3K9T A;  3W3C A;  1O3T A;  3ZQG A;  1Z9C A;  1NG6 A;  4WXH A;  3MZY A;  5D5X B;  4FAS D;  3FMQ A;  3F3X A;  2F2E A;  1FMV A;  1VTN C;  3FX3 A;  3KP6 A;  4CCL A;  1DU0 A;  2JRM A;  3D0S A;  3GTG J;  2EFO A;  1HDD C;  2YU9 J;  1ETW A;  1P4A A;  1X1P A;  4M6V A;  4R79 A;  1AOY A;  4AM3 A;  2FBI A;  1QGP A;  1HDP A;  2R5Y B;  4RDU A;  5IT9 K;  4PK4 A;  2X6O A;  1MH4 A;  2WTE A;  1V5F A;  1GHC A;  3MKW B;  4EM0 B;  2CGP A;  4BE0 A;  3I59 A;  3DTK A;  3H0G J;  3CMY A;  2IS1 A;  5EF6 A;  3K4B A;  4XOP A;  3VYT B;  3GUD A;  3VPR A;  2HOE A;  2FRH A;  4CYD A;  1U5T A;  2EV5 A;  5F04 A;  2ME6 A;  1S72 I;  1TQM A;  2COM A;  2ZXJ A;  3DP7 A;  2KMU A;  5FJ8 J;  4A3K J;  1JGS A;  1FOW A;  4ZZD A;  2UXN A;  4WX9 A;  2R3S A;  2G7U A;  2HXI A;  2RAE A;  3E6D A;  3KCC A;  4EAT A;  2M7B A;  2DA1 A;  2IS4 A;  1UFM A;  4MQ9 F;  4XMY A;  1UAA A;  3LA7 A;  2PFB A;  2EIJ H;  4MQV A;  3HOU J;  3KET A;  4I6Z A;  2MD5 A;  1ZQ3 P;  3TOA A;  4B43 A;  4UUV A;  1CF7 A;  1S29 A;  4QPQ A;  1JUP A;  2XAQ A;  3PM1 A;  4E4H A;  4C2U A;  4LFU A;  4NV4 A;  1HSJ A;  2DT5 A;  1MNE A;  2JK3 A;  3WG9 A;  3HL2 A;  2IA0 A;  3CCR I;  4ENK A;  4O6J A;  1N75 A;  3BQZ A;  1KZH A;  4RMN A;  1S6L A;  2YU3 A;  3C18 A;  3JRC A;  1P92 A;  2KFD A;  3IHU A;  1FIP A;  2TRT A;  3ZMS A;  4Q48 A;  1MMS A;  3JCU C;  3ZGK A;  4CCJ A;  2RNG A;  4EMS A;  2M45 A;  4HNU A;  3M8F A;  4AD9 A;  1P4W A;  3SQN A;  2LKX A;  4BQA A;  5IP7 J;  2HU9 A;  1RRJ A;  3KZZ A;  3FXU A;  1U3E M;  5FRN A;  1IN7 A;  4BAY A;  2XGC A;  3L2V A;  4LLN A;  5GAH J;  5HDK A;  2E5N A;  1G3W A;  2DYR H;  5CLS A;  2M87 A;  1ACI A;  2KKO A;  4DBR A;  2XUB A;  4Q47 A;  2DQR A;  4GRI A;  2IPQ X;  2VQG A;  3C2B A;  2F6C A;  3DEE A;  4I01 A;  5FB2 A;  1A04 A;  2W1O A;  3U9G A;  1MBK A;  3KLO A;  1UHM A;  2KIU A;  2XAJ A;  2HEO A;  4P96 A;  5E8I A;  3K69 A;  4XN0 A;  3I4M J;  5FLX K;  3BY6 A;  4G6T B;  4E7L A;  1SMY F;  4P55 A;  1YHQ I;  5GAE J;  5IT3 A;  4N31 A;  1MNM C;  5CVJ A;  1UG2 A;  4FE4 A;  1WH7 A;  1HA8 A;  3TKY A;  3KE2 A;  4K8W A;  1T0F A;  2ZJQ F;  1WJC A;  1ZRE A;  2R4G A;  3KZI C;  2JN6 A;  5FLX Z;  2GLO A;  3ESW B;  1XC5 A;  2XHK A;  1KU7 A;  3H3V K;  3L2C A;  4IPA A;  4IZZ A;  4A3M J;  1TT0 A;  1PYV A;  2D1H A;  3VDX A;  2LH9 A;  1ZRF A;  4AU7 A;  4BNC A;  3ZQI A;  5EEH A;  3CDI A;  3S1Q J;  2A61 A;  1Z1D A;  4F7Z A;  2ZNY A;  2R0Q C;  3GTO J;  1OYY A;  4KMF A;  2O03 A;  1QNT A;  1OIS A;  1NHA A;  2FNA A;  1FOX A;  4BEH B;  5GPA A;  2PMZ A;  2CQK A;  2DBB A;  2P5K A;  1ZN2 A;  3W6K B;  3K4C A;  1ETX A;  2CQ7 A;  3QOP A;  4JK1 X;  1DGW Y;  3L7W A;  3OOU A;  3HOZ J;  5F0F A;  4NDL A;  4A0Z A;  4WXC A;  2QLZ A;  3KP5 A;  3VWB A;  2XKO A;  4RM3 A;  3CJR B;  2HZT A;  5M5Y J;  3D5L A;  2EFW A;  1YRN A;  1ZGJ A;  4N0B A;  3WTW C;  2F5E A;  2OBP A;  5HNH A;  3G4S I;  2ZSH B;  1ZH5 A;  1LFU P;  4IOA F;  4D7M A;  4A3F J;  3RKQ A;  1R4M B;  4ETS A;  4BEH A;  2IGO A;  2JT1 A;  3TOB A;  2VI6 A;  3G3Z A;  1JE8 A;  4C2M J;  5BS6 A;  3BZK A;  4IHX A;  4NC8 A;  3L2U A;  2KJB A;  2VT3 A;  4Q4Z F;  4LB5 A;  2DFE A;  2BE5 F;  3MEX A;  4RA2 A;  4UXN A;  1IN6 A;  3AL0 B;  1P4X A;  2PG4 A;  1DP3 A;  2RGV A;  1R71 A;  1P9Q C;  2R7T A;  4PJN A;  2AXL A;  5H2F C;  3TP0 A;  1LVA A;  3EQL F;  4IQJ A;  1W1W E;  2FA5 A;  3WOD F;  3RCO A;  2NXN B;  4IHY A;  5IP6 A;  3DLL F;  1Z7U A;  2CYY A;  2H6C A;  3ECH A;  1LE8 B;  1BR2 A;  3CJQ B;  2JA2 A;  3O3K A;  4LIV A;  4XSZ F;  3NWS A;  3J81 K;  5A2Q K;  2P5V A;  3E97 A;  5HLT A;  1JUM A;  5IY5 H;  4KA4 A;  4YRV A;  1FC3 A;  2G0E A;  1I1S A;  2DA5 A;  4CCK A;  3JAM Z;  3RYP A;  5KK1 A;  1Z0X A;  4GO1 A;  4Z2Y A;  4ZJZ A;  2DOE A;  4U7B A;  1D1C A;  5AIQ A;  4CA0 A;  2AQE A;  2ZME A;  5JVG F;  3P9K A;  4AID A;  5CKT A;  3QYE A;  1JXS A;  3COA C;  2F4I A;  2ZKZ A;  2ZBK A;  1XGM A;  3CTA A;  2DCE A;  4E7J A;  4M74 A;  1YIT I;  2B0L A;  2KDO A;  4YFX F;  4D5C A;  2GZW A;  2ZSI B;  4HYE A;  4Y3O A;  2PMZ N;  1QVU A;  4B48 A;  4M3D A;  5IOZ A;  1I27 A;  3F8B A;  2WWY A;  3GLL A;  2XRO A;  4IQ4 A;  1T6S A;  3VFZ A;  1X4O A;  1FYL A;  3OYJ A;  1B6A A;  1YE9 A;  1YW7 A;  2A69 F;  3MFK A;  3OV8 A;  3HYI A;  2O61 A;  1IDY A;  1G59 A;  2VJJ A;  5FFX A;  2DMP A;  4HPQ A;  5C44 J;  1L3L A;  2Q8K A;  4B8X A;  5B5E C;  1XN7 A;  2JSC A;  4A5N A;  5IYD J;  3GBG A;  3I4N J;  2Q2E A;  5DTD A;  3ZMZ A;  4M9Z A;  3A2K A;  3A02 A;  4XN3 A;  5EG0 A;  4A3I J;  2XPV A;  2X1D A;  1GDT A;  5D6F A;  4CYC A;  1ONV A;  1Z3X A;  3V4G A;  3A01 B;  4CCO A;  5M5X J;  2K7L A;  4EEF G;  2MA3 A;  2I8D A;  4XL9 A;  3CP2 A;  2L9V A;  1FEX A;  2QYO A;  1R00 A;  2MH2 A;  4PSX A;  2MLG A;  1ETQ A;  2M8E A;  3DTI A;  3K4J A;  4PFO A;  3W2V A;  1ERD A;  3HPG A;  3QOD A;  5J4Y A;  1R58 A;  2LVS A;  2K5C A;  4LK1 F;  4FE7 A;  5DS9 A;  2IVM A;  3U1D A;  4C2T A;  3H9G A;  3LSK A;  1VQ4 I;  5CVV A;  3FXO A;  2VPL A;  4HF0 A;  1MMG A;  3GWZ A;  2CS3 A;  1UST A;  3WU2 C;  2A3S A;  2YS9 A;  4UV8 A;  3AL0 C;  2IXS A;  2BVL A;  3JR9 A;  3AG2 H;  3F22 A;  3KP2 A;  4BY1 J;  2LTP A;  2PMH A;  1WJ5 A;  3IWF A;  3BR2 A;  3QP5 A;  2CUJ A;  1TW2 A;  2IBD A;  4WCG A;  5FRO A;  3BTJ A;  4WF2 A;  3G73 A;  4YFK F;  2K9N A;  4P9F A;  2F5D A;  1B8I A;  5J1U A;  4II3 A;  3VYR B;  4D7N A;  3A01 A;  4RB1 A;  2FQ4 A;  3HGY A;  4XLE A;  1W7P B;  2L7K A;  2VC0 A;  4A3L J;  2P0W A;  1IUF A;  2H27 A;  3ZQQ A;  5EG0 B;  4Y17 A;  1JKP C;  2R7Z J;  4XLN F;  1G8X A;  3MVP A;  5F27 A;  2K3P A;  3GO5 A;  2HFH A;  1YJW I;  3E5X A;  1QQI A;  1XB4 A;  4L5E A;  3OYM A;  3BTL A;  3VB2 A;  3G2B A;  4DQ2 A;  1A5J A;  1ZLJ A;  2IGN A;  2RQP A;  1I50 J;  4LOC A;  3QU6 A;  1KQ9 A;  3ZQH A;  1GT0 C;  1AKH B;  1RUN A;  2FEZ A;  1HKT A;  2GAU A;  5F08 A;  1IC8 A;  4KDP A;  3WE2 A;  3QAH A;  3BDN A;  1OCR H;  3LQQ A;  5BNG A;  5L3C A;  1I3Q J;  2GBY A;  1AHD P;  1T56 A;  1XCV A;  2UWM A;  4JX4 A;  3VYS B;  2E2I J;  4ZDO A;  2XRN A;  3S1R J;  2M5W A;  3LQR A;  1H9G A;  1TBX A;  1POG A;  4BS9 A;  3JSP A;  1UZC A;  3OY9 A;  1JHH A;  2EFP A;  2XAF A;  2NVU B;  1HKQ A;  1D8K A;  1LUJ B;  1VQ9 I;  3F21 A;  3IRQ A;  2HR3 A;  1BOA A;  3CC2 I;  2PQ8 A;  2DK8 A;  3R0A A;  4R1H A;  4Y4R A;  5LGU A;  4D1Q A;  3V8J A;  4A6E A;  4BH9 A;  3LSP A;  4MFE A;  2DXI A;  3BP8 A;  2LD5 A;  2FOK A;  4MFD A;  3ZN0 A;  2W25 A;  1W0U A;  1TW3 A;  3PSF A;  3GLX A;  1F43 A;  2PN6 A;  3R60 A;  4FIS A;  2DA4 A;  3R0J A;  1LEA A;  1B72 B;  1W5S A;  4XID A;  2OAZ A;  4OIP F;  3VOE A;  5H6Q A;  3CCV I;  3CCL I;  5LEK A;  1VND A;  1A31 A;  3PFY A;  3MWM A;  4G9Y A;  2R7X A;  5TRD A;  3VYU B;  2Q0O A;  1N78 A;  1MJA A;  1T38 A;  3M07 A;  1T95 A;  2DT6 A;  3GEZ A;  2QQ9 A;  3TBI A;  1SAX A;  2KZG A;  1MMD A;  1FT9 A;  3CJN A;  3H1C A;  5C3E J;  1W5T A;  2NS7 A;  3ZRG A;  5K7H A;  2R5Y A;  4X1E A;  1T2K A;  4HEA 2;  2CFO A;  3BWG A;  1MMA A;  4L9T A;  3EUK L;  3HG9 A;  5HVQ C;  4XLC A;  1MBJ A;  3CZ6 A;  4MHG A;  2HOA A;  3U1K A;  2ZNZ A;  2W00 A;  3PNY A;  2LSO A;  2RQQ A;  1Z6R A;  2GWR A;  2X51 A;  3E1S A;  3HC7 A;  1F36 A;  2GQQ A;  4M72 A;  2NVT J;  4DYC A;  4XON A;  5A2Q Z;  4IL6 C;  1X1B A;  1BW5 A;  3IIQ A;  1OLT A;  2N8G A;  1LKX A;  2VKD A;  1G3S A;  3Q5F A;  4MLO A;  1E3H A;  3BR1 A;  5DD8 A;  2EV6 A;  2DT7 B;  4A3D J;  3CMM A;  3BCA A;  4AYB A;  2HI3 A;  2I10 A;  2ESN A;  2Z3Y A;  4FX4 A;  4LG3 A;  4MTD A;  3CUQ A;  4A0X A;  3L2W A;  2DDA A;  3OWT A;  4FQG A;  3LSH A;  3QQA A;  1OCT C;  1ZK8 A;  1OYI A;  2ISZ A;  2VBZ A;  4XSX F;  1S8N A;  5DCM B;  1YTY A;  1DU6 A;  3CJT B;  2NNY A;  1WZ2 A;  4DOZ A;  5FFZ A;  2VQL A;  3QOE A;  2VOO A;  3B6C A;  4M3B A;  1WJA A;  2BVM A;  1K4T A;  1U5T B;  1FY7 A;  2DMQ A;  2VXD A;  2ADU A;  4UUT A;  1XPX A;  1EF4 A;  3KEQ A;  3CME I;  4ENM A;  3DPU A;  4EJW A;  5JHU A;  2MFZ A;  1PVE A;  3ZMD A;  2W84 A;  1U6G A;  1BJZ A;  1Z21 A;  3DXJ F;  1X3Z B;  4XLF A;  3BJO A;  2XF6 A;  1YW9 A;  2QSF X;  3P5J A;  4G6Q A;  2UXX A;  4S05 A;  4M6Y A;  1E0E A;  2MC4 A;  4XIC A;  4PFP A;  4IHW A;  4IRI A;  4HZF A;  1H0M A;  2RN7 A;  1MKM A;  1F39 A;  2O3F A;  2LKS A;  3CP8 A;  3OS1 A;  1RR8 C;  1N77 A;  4MEY F;  3BR6 A;  1Z05 A;  4W1U A;  2Z2S B;  4YIR X;  1DQU A;  3GF2 A;  4P1W A;  3S17 J;  4G94 A;  3RQ4 A;  1OCZ H;  3ISP A;  4A69 C;  1BI3 A;  2V79 A;  4OMZ A;  5IPA A;  3I64 A;  5H6R A;  3DV8 A;  1HW2 A;  2K86 A;  3K4K A;  4CZZ A;  2OV7 A;  1ZAO A;  1X3U A;  2JPC A;  2EIM H;  4HF2 A;  1IUY A;  2W82 A;  1T33 A;  4Y15 A;  3A1Y A;  3LSM A;  2XB0 X;  3ZN1 A;  2Y75 A;  3RPQ A;  1R1V A;  1UG0 A;  3E5U A;  2Y30 A;  3HUG A;  2E71 A;  1AWC A;  2GIZ A;  1MDM A;  2M1B A;  1D5Y A;  4ZYD A;  4IHV A;  3SZG A;  3FBI B;  4BDZ A;  1ZHF A;  2V1U A;  3LMM A;  2ZFU A;  1Z67 A;  2EPF A;  2LYC A;  4CSW A;  2CO5 A;  2KL4 A;  1VQK I;  3FIS A;  4WK8 F;  3HB9 A;  5DCF A;  2L54 A;  1FOY A;  4JP0 A;  1V3F A;  3HTS B;  2RNJ A;  2A6E F;  1R4N B;  1R22 A;  2A5W A;  3GFM A;  3HIF A;  5FRM A;  1HW5 A;  5IP9 J;  4A3E J;  5L3F A;  3HUG B;  3RKY A;  4HAM A;  3T8T A;  2QEX I;  3CMA I;  5JVT A;  3OMY A;  1BN5 A;  1FWZ A;  3TW7 A;  1V54 H;  3KP4 A;  4MO7 A;  4C3H J;  4QPO A;  1MBH A;  1WGX A;  4HBL A;  1SC7 A;  3MN2 A;  2GXA A;  4A12 A;  2FJ1 A;  1Y8R B;  1ODD A;  1Q1H A;  1SFE A;  2VBX A;  3HGG A;  1ZKG A;  3MKL A;  1K78 B;  3QRF F;  1Z7L A;  3KFW X;  4HX4 A;  4KIB A;  2A07 F;  1NK3 P;  1NTC A;  1Z91 A;  3S16 J;  2J5O A;  2R7W A;  2L3D A;  3BZC A;  3S93 A;  4OU0 A;  1TWH J;  3JAM K;  2VOD A;  2JPB A;  5J8C A;  1XDS A;  1WJF A;  2OCE A;  5CJ9 A;  3DTE A;  4EJT A;  3OYH A;  3A4C A;  2LBF A;  4EJV A;  1GV2 A;  1I6X A;  3IUO A;  2F5C A;  2BW3 A;  2IA1 A;  2ECC A;  3J81 Z;  2P5L C;  2Q2E B;  3S04 A;  4CCN A;  1MDM B;  2M34 A;  2LY1 A;  5ILV A;  4HDU A;  1YI2 I;  1FNN A;  3ASO H;  3G71 I;  1R9T J;  5D5U B;  1PUF A;  4H0E A;  1TC3 C;  1RR7 A;  2VJ5 A;  1LDJ A;  1UMU A;  3LOC A;  4WWC A;  2GA2 A;  3W2A A;  5FD5 A;  4A6D A;  2ZXH A;  1RC9 A;  2Z1D A;  5KVR A;  2RRE A;  4TV7 A;  1R5G A;  2F48 A;  5E20 A;  3GTJ J;  1Y8Q B;  1BBY A;  2BYV E;  2L4M A;  2LBF B;  3VSL A;  4BXU A;  2JVG A;  2HKO A;  4LD5 A;  2QBY A;  2CFX A;  3E5Q A;  3F23 A;  5M3F J;  5J8F A;  1CGP A;  2V9V A;  1MBF A;  1MW7 A;  2MC3 A;  4F3Q A;  3BRO A;  3HSE A;  1I39 A;  3PJR A;  2IW5 A;  3O8G A;  1LDK B;  2ICW G;  3FF5 A;  4CUG A;  4PJM A;  4E7Z A;  5K7Z A;  1VI0 A;  4L0Y B;  3S32 A;  4XOT A;  1K6O A;  5ILS A;  1V4R A;  1XGN A;  3IWZ A;  3H0D A;  2LC2 A;  3Q9S A;  1BA5 A;  5D6E A;  2W85 A;  5TGT A;  3I9V 2;  1XD7 A;  1SFO J;  2KRH A;  5E1Z B;  2EFN A;  4HV6 A;  3EUH C;  1R49 A;  3CD6 I;  1K79 A;  4F55 A;  2BZT A;  1S7A A;  2XAU A;  3BT9 A;  3H92 A;  5C4J J;  3OYF A;  4O5V A;  2GXB A;  3ROU A;  3P7N A;  2Q1Z B;  1MJ9 A;  5IYB J;  5CPR B;  4ME8 A;  2QQ8 A;  1KYW A;  3H9J A;  4XM3 A;  4HNT A;  4U7D A;  3H5N A;  3D5S C;  4V2F A;  1VQP I;  1I3A A;  1B1B A;  4KN7 X;  2KIF A;  2CMP A;  1K6Y A;  3TO6 A;  2L5Q A;  2M3A A;  3DKX A;  3MAJ A;  2WBM A;  4XLA A;  1PDN C;  2X1C A;  3H3U A;  1RKT A;  3BC8 A;  3WHB A;  1HXD A;  1S3J A;  4B4C A;  1F4K A;  2CW0 F;  3HSF A;  2VKE A;  3KYL A;  3JTG A;  4N9H A;  2QBY B;  1KQ8 A;  3GZ6 A;  3OR1 C;  3B73 A;  5EEG A;  3GFJ A;  2R7F A;  3JRH A;  1U9O A;  3FXL A;  1OQY A;  5B1B H;  1FPQ A;  4EJO A;  3SEZ A;  2RV8 A;  3L09 A;  3RI4 A;  1YRN B;  2JZY A;  4CCM A;  2ID3 A;  3FKJ A;  1FIA A;  4XBF A;  1IAW A;  3TO7 A;  4RB2 C;  2IGM A;  3N97 A;  1LQ1 A;  3FMR A;  1FOK A;  2ZJR F;  5LHG A;  1SAN A;  2KLO A;  4RLQ A;  5LGT A;  2CW7 A;  4Y52 J;  4I98 B;  2WAQ A;  3OYD A;  2DA3 A;  5EYR A;  1RES A;  5D5V B;  2E1M B;  3S14 J;  2HDW A;  5J40 A;  3ZQL A;  1IJW C;  2LF7 A;  4XKC A;  4L18 B;  4NC7 A;  1BI1 A;  1BIA A;  1LE8 A;  3HZJ A;  5F0C A;  5FKO A;  4KJZ A;  4EVI A;  5FO5 A;  3ZCO A;  3DEW A;  5BPD A;  5BPI A;  3CCY A;  3EET A;  3CF2 A;  2DA7 A;  1SD7 A;  2CQQ A;  3H35 A;  1OPC A;  1H89 C;  2P4W A;  4LIU A;  1FBS A;  3S2W A;  2M7A A;  4ANJ A;  2HVQ A;  4PZJ A;  2E5Z A;  3FXJ A;  2TDX A;  3VOD A;  2O6G E;  2JJ7 A;  1QBJ A;  1VZ0 A;  4IOC F;  3KIO A;  1RZ4 A;  2CJJ A;  1JT6 A;  4U88 A;  2O9L A;  3WGI A;  2CQN A;  3SYT A;  3X2Q H;  2COB A;  1FX7 A;  2B63 J;  2BXY A;  1D8J A;  2CUE A;  3DLA A;  1I6H J;  1E3O C;  4PGH A;  4RAF A;  2OTJ I;  2KP6 A;  3N4M A;  2M4K A;  2ELH A;  4CYC B;  2ACJ A;  2XAH A;  4ESF A;  1T08 B;  2Y0S A;  3FXM A;  3NWT A;  4NUB A;  2QQB A;  2L7Z A;  3HOV J;  3IL2 A;  2RKH A;  1R5H A;  2G7H A;  2EZI A;  1KQ0 A;  2DN0 A;  2LOO A;  1LNW A;  3PUB A;  5HLI A;  2HVS A;  1LPQ A;  2VKV A;  4U0V A;  2VQC A;  4DNC A;  3BR5 A;  5GAD J;  2X9D A;  1OCP A;  4M3G A;  3FM3 A;  4RB0 A;  4RS8 A;  1FSE A;  3E6C C;  4M9S A;  5LFA A;  1MIJ A;  2IA2 A;  3BPX A;  2VON A;  2HQ5 A;  1U9N A;  3F72 A;  2KQR A;  1WHU A;  2DTZ A;  3WG7 H;  5K5O A;  1XSV A;  4OAZ A;  4CDG A;  1FSH A;  3BG5 A;  4QLC U;  1J9I A;  2JSP A;  4NBQ A;  4BQQ A;  1CQT A;  2L01 A;  2ELJ A;  2WAQ N;  5BQT A;  3L2Q A;  3AKZ A;  1TQP A;  5L3D A;  4ESB A;  1CF7 B;  3LAJ A;  3AAF A;  2K3F A;  3PO2 J;  1TWA J;  3MMY B;  3W6J B;  5J1Y A;  4F93 B;  5GAG J;  4IF4 A;  2F5F A;  3WTY C;  4U0W A;  2XRL A;  2E60 A;  4XKW A;  1DGR M;  1FTZ A;  3BZ6 A;  3PNT A;  3K70 D;  1OR7 A;  2VAS A;  1IRX A;  2A6T A;  2OQG A;  2LF8 A;  3NAU A;  3V7C A;  2B7E A;  2JTV A;  1UEL B;  5CQE A;  3G1L A;  5LHH A;  5E79 C;  3CCU I;  1O57 A;  2K9S A;  1GXQ A;  3UR3 C;  5EEA A;  1D1B A;  2KRC A;  2VE8 A;  1U78 A;  2KIS A;  2R7O A;  3K7A J;  4I7H A;  3QYF A;  1JUS A;  3FM5 A;  4IXA A;  1Y56 A;  1EA3 A;  2JUG A;  1B59 A;  2FNP A;  3E7L A;  2FKD A;  3RQI A;  3JRG A;  1XCB A;  2RC4 A;  5HLG A;  1X1A A;  4M3F A;  3CDH A;  3FXQ A;  4A3C J;  1U0J A;  2HXO A;  1WI3 A;  1IN4 A;  3Q3S A;  3TMO A;  2E34 A;  1ETK A;  1IG7 A;  4HF1 A;  1SD5 A;  1V5E A;  2V6C A;  2ZO4 A;  4E6K G;  2FX0 A;  3HKZ N;  3HEF A;  2CUZ A;  3K1N A;  3JRA A;  2R7V A;  2K4B A;  3WU1 B;  3PQK A;  2CH0 A;  5EGO A;  1QPM A;  3W2W A;  2MSY A;  1BR1 A;  2FJR A;  1IXS B;  3EYY A;  2HYG D;  1RET A;  3RTR A;  1QA6 A;  3SFI A;  2HQA A;  2BHY A;  1UMQ A;  5LHI A;  1FBQ A;  5EGO B;  5E3M A;  3SZT A;  1V55 H;  3ULQ B;  4ZDP A;  1SFX A;  3PUF A;  2HWV A;  2MH9 A;  1YYV A;  1U2W A;  2DOA A;  3OYC A;  3MD2 A;  4YEL A;  4KT5 C;  3ZQF A;  4DGW B;  3V7R A;  4ESJ A;  2M30 A;  1ZRD A;  1S9H A;  2DMT A;  2EH3 A;  2LRE A;  3FK6 A;  2BY2 A;  1W0T A;  2YX4 A;  4KUM A;  3CO6 C;  4EM2 A;  1IZ1 A;  3JRE A;  4NQW A;  2E2J J;  1XMX A;  4WXD A;  3FXR A;  2W24 A;  3RJP A;  5H20 A;  5D8K B;  3RKX A;  5DCM A;  2OUM A;  3CQZ J;  3SHF A;  2HPM A;  2LKP A;  3C2H A;  4IHS A;  3PIP F;  4L9V A;  4AVP A;  2O8X A;  1ZG1 A;  3WTT C;  3OYA A;  2ISY A;  4LIT A;  3JRB A;  1KGS A;  5EZH A;  2KIM A;  3QPH A;  2E1M C;  4ZYG A;  4IVN A;  2F4O B;  2K9Q A;  3DPT A;  3QU3 A;  4HQE A;  4BJ6 C;  4HNV A;  5KAF C;  4J00 A;  3HBL A;  1VQ8 I;  3O2P E;  5HOO A;  1ZYR F;  1WJB A;  1B9N A;  3DKW A;  2W4S A;  2ZXI A;  1UHW A;  1KU2 A;  3CCS I;  3DPL C;  3TDU C;  2Z9O A;  1MSF C;  4M73 A;  4FX0 A;  2PLY A;  2BEO A;  4C3J J;  2X6W A;  1SMT A;  2Z16 A;  3BCB A;  4QIW N;  4LJZ F;  4IO9 F;  4E7S A;  2XB5 A;  4RM2 A;  2EZL A;  5AIP A;  2HVR A;  3I4P A;  1QVT A;  2X85 A;  1WQ2 A;  3WTU C;  2CQX A;  1TNT A;  5FD6 A;  2DFH A;  5E3L A;  9ANT A;  4ZTJ A;  3K1P A;  5TJJ A;  2H1K A;  3GYH X;  2C6Y A;  4XKB A;  4EJU A;  4A3G J;  4ZYE A;  1R6R A;  1X3W B;  3Q9V A;  3PFI A;  3F8F A;  2ZME C;  5E8G A;  1YS6 A;  2ME0 A;  3BDD A;  4LG0 B;  2XPU A;  2V6E A;  3CCQ I;  2GOM A;  2DMU A;  2WB1 A;  1IV8 A;  2JUC A;  1J2X A;  4LMY A;  3WE3 A;  5FKM A;  2FBH A;  1HLV A;  4E7K A;  4I02 A;  2DDB A;  4A2U A;  4UVA A;  1REP C;  3ABL H;  3BG6 A;  3ZMU A;  1Y1V J;  2EA4 A;  1OJL A;  3WGH A;  1E17 A;  6PAX A;  5LD2 C;  1BIB A;  3H9Q A;  4IKF A;  1NH3 A;  4IX7 A;  5ICE A;  4FTH A;  3ZMT A;  2IS6 A;  2QUF A;  4JX6 A;  1ZG3 A;  3K70 C;  2BY1 A;  3F8M A;  2LDU A;  2P8T A;  3J7Y J;  1AU7 A;  3F8C A;  5DM6 F;  1SVO A;  1G2H A;  3HRU A;  3CUQ B;  5HS7 A;  3LSJ A;  1OMI A;  1Z6T A;  3C2G A;  1MJB A;  4A3B J;  2D5V A;  2XGX A;  3FXK A;  4MNU A;  1XX5 A;  2HQN A;  3H5A A;  3HOY J;  1LVK A;  2J5P A;  3OS2 A;  3CES A;  1MD0 A;  2OQR A;  1IF1 A;  3DU5 A;  1SVL A;  1B12 A;  3KYD B;  5C4X J;  2I5U A;  2NRA C;  2M0M A;  3GTP J;  3I58 A;  2O7O A;  1DDN A;  3D5R C;  2BW3 B;  2EB7 A;  3K6G A;  3OIQ A;  3V8K A;  3LSG A;  1K83 J;  2XAG A;  4J01 A;  1B4A A;  3MQ0 A;  3GFL A;  3NRV A;  2OA4 A;  4RGU A;  5DYM A;  2YR2 A;  1U5T C;  4HDV A;  1WVR A;  2IP2 A;  4RLF A;  3TED A;  1RKW A;  4XLP F;  1EH6 A;  3H5R A;  1OCC H;  1S7O A;  2X0L A;  3DBH B;  3FMS A;  4ASN A;  3ZOB A;  2JVH A;  2V9K A;  5CQG A;  5CVU A;  1BC7 C;  2LR8 A;  3T8R A;  2XC7 A;  2O5R A;  3SZP A;  2JRT A;  3V8L A;  3ASN H;  3L9F A;  4PJJ A;  4ENJ A;  1W7P D;  4D9J A;  4RAY A;  1VQO I;  2MD0 A;  3REO A;  3A0H C;  1Y1W J;  2CV2 A;  2NVX J;  2O8K A;  3TGN A;  4KT6 A;  1S7E A;  4RAZ A;  1OCO H;  1R7J A;  3M3Y J;  4M6X A;  2CG4 A;  1A36 A;  1A6I A;  3K4N A;  2E36 A;  1OKR A;  2L7F P;  3IKV A;  3FHN A;  4BL0 B;  3FKI J;  3U2R A;  3IKT A;  3EUA A;  1WCM J;  2RVC A;  2XAS A;  1XG1 A;  3O8H A;  1XGS A;  3ZP5 A;  4GDF A;  1J75 A;  3F9K A;  1D0Z A;  2A05 A;  1XMA A;  4P9U A;  4DZP A;  2L02 A;  4BGD A;  4I09 A;  4HX7 A;  4DJA A;  3DWL E;  5EZG A;  1YX3 A;  1R23 A;  2M2E A;  3KZY A;  2HTJ A;  1YIO A;  2YPR A;  3KYC B;  2QKL B;  4XR6 A;  4ZC3 A;  2W57 A;  3LA3 A;  4JQF A;  2BY0 A;  2P7V B;  5J1R A;  4LB6 B;  3G6E I;  2DI3 A;  2DOF A;  4F92 B;  5D8L B;  3NEU A;  1D5V A;  2OC6 A;  1HF0 A;  3I56 I;  4J19 A;  2VJI A;  3IC7 A;  2W7N A;  2HDD A;  1ZR2 A;  3V7S A;  3OIO A;  1TNS A;  5JHF A;  5LBQ A;  5HNF A;  2E1C A;  1G4D A;  2IJL A;  3R6S A;  4DIQ A;  2K4J A;  1G3Y A;  2PMU A;  4XRS G;  4S0H B;  1MMN A;  1YG2 A;  1O3S A;  3ZQ7 A;  3S15 J;  2XSJ C;  1YIJ I;  2GM4 A;  1VFC A;  1I1G A;  2VLA A;  2R7S A;  3GTM J;  4H4K C;  4IRH A;  3GVA A;  3H36 A;  2Z5U A;  4G12 A;  1FMW A;  1YX5 A;  1QU3 A;  2H8W A;  5E3N A;  3QPT A;  3BR0 A;  3CLQ A;  2Z99 A;  4OAY A;  4BQO A;  4YG2 F;  3Q0W A;  4IRG A;  3MZH A;  3A03 A;  1SD4 A;  1JT0 A;  3R4K A;  4IEJ A;  1K4S A;  4Z6Y A;  1QHH D;  3RZD J;  2QEN A;  3TW6 A;  4BBR J;  4Q5S F;  2VT2 A;  3T1B A;  4BHB A;  3PO3 J;  2QGU A;  4L5I A;  4MEX F;  1IV6 A;  5BMZ A;  1YJN I;  2P6T A;  3ERM A;  1ZEL A;  1BJA A;  1VF9 A;  2K27 A;  2Y69 H;  2AO9 A;  2IAI A;  2K85 A;  5GTH C;  1IGN A;  4AIK A;  1GLN A;  3HOT A;  1RUO A;  1GVD A;  4BBS J;  3G1O A;  2LLK A;  4D5F A;  3HOX J;  1FTT A;  1XGO A;  4FET A;  3GX4 X;  5HS8 A;  1JTY A;  1IXR C;  1FZP B;  2HGC A;  1D0X A;  1QO0 D;  2R7D A;  2JA6 J;  4IHT A;  3WTZ A;  1BL0 A;  3K2Z A;  2UUZ A;  1A35 A;  4JOM A;  2DA6 A;  3MCZ A;  3S8P A;  3TQN A;  4AC0 A;  1GVJ A;  1TL8 A;  2JA7 J;  4FT8 A;  4I2O A;  4OWR B;  2NS8 A;  3OS0 A;  3DU6 A;  3HDD A;  2M0C A;  3HOW J;  2VB6 A;  1TZL A;  4ZDL A;  1XSD A;  4NNJ A;  3S3O A;  1KYZ A;  1A6Q A;  4HOB A;  2BV6 A;  3QP6 A;  2E7W A;  2F5V A;  2PJP A;  1T0F C;  4XRF A;  3WTV C;  1XSX A;  1OR7 C;  1QZE A;  1RI7 A;  1ZR4 A;  1VQ5 I;  2R7R A;  2WY8 Q;  3RSN A;  3HKZ A;  2A68 F;  1JGG A;  1RPW A;  2NAZ A;  2FUG 2;  5F6F A;  1W5C C;  4XNF A;  4B09 A;  4CO8 A;  1EH8 A;  1IDZ A;  5B66 C;  1UHS A;  1TLH B;  5LLQ A;  1ZGA A;  1B72 A;  1TWG J;  5ED4 A;  3E6M A;  2BY3 A;  2E7X A;  3HTU A;  4L9N A;  4JYK A;  2V1X A;  1KU3 A;  2MYS A;  3WTX C;  2NNN A;  4GCV A;  5LGN A;  1G3T A;  2XKP A;  2STW A;  4UNO A;  3FWE A;  2KT0 A;  4KYW A;  3CDL A;  4C3I J;  2QA4 I;  2R5Z A;  4PCQ A;  1DP7 P;  2EK5 A;  2EV0 A;  2M8G X;  3JRF A;  4A3J J;  2E2H J;  2OU2 A;  3OSF A;  1BI0 A;  4HA8 A;  2KIQ A;  3KP7 A;  1ETO A;  3C1D A;  1MGT A;  1JHF A;  2X6Y A;  1PJR A;  2MBF A;  3CCJ I;  2E1O A;  3IP4 B;  4PDK A;  3WHC A;  2PI0 A;  1U8B A;  2H09 A;  4BUP A;  3CC4 I;  3FBN B;  1OFC X;  3RPU A;  2KZV A;  2L9N A;  4M9X A;  1IO2 A;  4HST A;  4AIJ A;  1HBX G;  1QZZ A;  3FK7 A;  1UCR A;  3I5U A;  2VIX A;  3UKG A;  3SXY A;  5E1W A;  4OIO F;  1HOM A;  3IH2 A;  4JX5 A;  4D0P A;  1R5I D;  2D1V A;  3AG3 H;  4BQN A;  3LNQ A;  3QYB A;  2IRF G;  5K5Q A;  2R7U A;  2B9S A;  2XV4 S;  3GME A;  5DDG A;  3KEY A;  4KN4 X;  4E7I A;  5LRR A;  3S3N A;  3A0B C;  2FBK A;  3ELK A;  3CC7 I;  4PJ0 C;  4KIS A;  4HLX A;  4OMY A;  1H9T A;  1J59 A;  1JJ8 C;  1EV7 A;  3PQJ A;  1DPR A;  1O4X A;  4QWQ A;  3OL3 A;  1ZG5 A;  4GGG A;  4LG0 A;  3BPV A;  4AWX B;  4IJA A;  5JR3 A;  5K1Y A;  3HHH A;  2PJR B;  2FF4 A;  3HJE A;  3ABK H;  3RIR A;  5FLV A;  2LFB A;  2H1L A;  4JBA A;  1UB9 A;  3HPH A;  2Y9Z A;  2MAB A;  3Q0U A;  1XMK A;  2IT0 A;  1X4P A;  4C30 A;  3JW4 A;  5L3E A;  2VE9 A;  1AKH A;  1SVM A;  3HHG A;  3DQV C;  4UB8 C;  4L9J A;  2OZ6 A;  4G7Z F;  4AUX A;  1BOB A;  4F52 A;  2L7M P;  3ML6 A;  4YIF A;  5ICG A;  2VL8 A;  2XIG A;  3M8E A;  3QPL A;  1APL C;  4BYY A;  5LEJ A;  3QPS A;  1DPU A;  1VQ7 I;  4HQM A;  3DKY A;  5AON A;  2PBI A;  3J80 K;  1HQC A;  4BU2 A;  2R5Z B;  2HYF A;  2HNH A;  4RB3 C;  1IRF A;  1EKE A;  2WV1 A;  3HRM A;  3E0J B;  3GZ5 A;  3LSI A;  4L0Z B;  4ZTF A;  2WAF A;  1SEU A;  1H88 C;  4LK0 F;  3ERE D;  1U8R A;  1JJ6 C;  3PL8 A;  4RBO A;  4CIC A;  3BG7 A;  3EYI A;  1IN5 A;  4CHU A;  3I3L A;  3I59 B;  2LMD A;  1JKR C;  2XF5 A;  2ELK A;  2ZJP F;  3GCM A;  1K61 A;  3ZPL A;  5E3O A;  2X4H A;  3PSI A;  2A6H F;  4UUS B;  3K4M A;  4BE2 A;  5BOX A;  4QTR A;  3RYR A;  3JSO A;  2VBW A;  4XKV A;  2L4A A;  4BHC A;  5DM7 F;  3MKY B;  2LRD A;  2EA2 A;  2XF7 A;  2DAO A;  5D4S A;  1H8A C;  4KFC A;  2VUM J;  2IS2 A;  3HSR A;  5M3M J;  3OSG A;  4A5M A;  1YO5 C;  2NOG A;  1JHE A;  5KHD A;  1OYW A;  2VXZ A;  2ZB9 A;  2H8R A;  3GZN B;  1HST A;  2TCT A;  4CH7 A;  3F6O A;  3K1M A;  2VKH A;  1TWF J;  1T7D A;  4HLY A;  4G6D A;  1WRJ A;  1MZB A;  1V5G A;  3LL7 A;  1VQN I;  4BHP A;  3P9C A;  1FYK A;  2EBI A;  3GW2 A;  2NVQ J;  2ZCW A;  3VSK A;  1VQM I;  3GTK J;  2OPT A;  1YFH A;  1LFP A;  1E2X A;  1X19 A;  3GXO A;  4AIH A;  1J7K A;  1MBE A;  1JHC A;  4UUS A;  1XDU A;  1HKS A;  4EV0 A;  5ERI A;  2VBY A;  5FKL A;  3O6B B;  2DU9 A;  1X2N A;  2FQ3 A;  2X1E A;  2FD5 A;  4MTE A;  4F91 B;  2GOX B;  1MH3 A;  1R36 A;  2ZXW H;  2GA1 A;  4I0A A;  2DFI A;  2MGQ A;  3NAR A;  1KON A;  5F64 A;  3S1N J;  3FHZ A;  2FOW A;  5E1X A;  4EGZ A;  4DZJ A;  3I55 I;  5IOY A;  2A5Y B;  2DTR A;  3HOS A;  2HOT A;  5E18 F;  1FLI A;  2ZME B;  3ONQ A;  4BY7 J;  3UNG C;  5B1A H;  2FMY A;  3KX2 A;  3D1N I;  1P2F A;  2Y0S N;  3B02 A;  2PEX A;  2KPM A;  2HZD A;  3J80 Z;  4YFN F;  4BXX J;  2AHQ A;  1T8I A;  1KN9 A;  3AG4 H;  4HRI A;  2ZC2 A;  4GXO A;  3VEP A;  1BR4 A;  3DBR B;  4B3A A;  2QKM B;  2Y48 A;  1O7F A;  1WI9 A;  5ICF A;  3BJA A;  5KAI C;  3S2H J;  2HO0 A;  2WAD A;  4E70 A;  3BOQ A;  2LK2 A;  2K40 A;  3NQO A;  3CCE I;  3KPH A;  3KEO A;  3TDZ C;  4B3X A;  4RGX A;  4HG2 A;  1WKM A;  3IH3 A;  3FDY A;  5JLX A;  4OIN F;  4XRS A;  4C9Y A;  4G7O F;  3K4L A;  2QQA A;  2NYX A;  2LP0 A;  4N4O B;  4PUS A;  3EUH A;  2KDZ A;  3CUQ C;  4M3E A;  2X6X A;  1GUU A;  1LEB A;  1ON2 A;  1LDD A;  2DLL A;  2OF7 A;  1XS9 A;  1J09 A;  2DW4 A;  1IRZ A;  1IW7 F;  2M9H A;  3T0Y A;  3ZQC A;  4K2E A;  2G9W A;  2Y0M A;  3BJ6 A;  2BBY A;  4BDY A;  3J7A O;  3RDI A;  4L5J A;  4YEJ A;  5F1R A;  3OYN A;  2HDC A;  2BHZ A;  2HS5 A;  5ILU A;  2KRF A;  4UVC A;  1WPK A;  1UJ8 A;  1LJ9 A;  2OD5 A;  2Y9Y A;  1S5L C;  1MND A;  2CRG A;  4BJT A;  2XPW A;  2GIV A;  1LFB A;  2VPR A;  1HCR A;  3MZ8 A;  2HOS A;  4U87 A;  2RDP A;  1EH7 A;  2P81 A;  3M9A A;  4EGY A;  3JTH A;  1KCA A;  1SD6 A;  2HNF A;  1T39 A;  4KIF A;  2OZU A;  4NB5 A;  1YQA A;  5KNL A;  3J7Z I;  4A93 J;  4G7H F;  1QRY A;  2HTS A;  2D45 A;  4XK4 A;  3TO9 A;  2KHM A;  3K10 A;  3OYE A;  1E3P A;  4X0G A;  3RKW A;  2H6B A;  2STT A;  4LLG F;  1P6R A;  1Y0N A;  1JKO C;  1D1A A;  2UZK A;  1L0O C;  1R1U A;  5JFR A;  2EWN A;  2P6S A;  4ZYA A;  5EJC A;  3DFG A;  2EJR A;  2E19 A;  3GTQ J;  2QVO A;  2V9P A;  4N4N B;  2FE3 A;  1G6N A;  5K7F A;  5ICC A;  3F6V A;  2LY2 A;  4LLL A;  1IN8 A;  1TQI A;  2O0Y A;  3N05 A;  3DBL B;  2HQR A;  3TL4 X;  2Z33 A;  2GXG A;  1USS A;  4HSR A;  2L0K A;  2R7Q A;  1PP7 U;  4XRM A;  1P7J A;  3C3W A;  1ENH A;  1PUF B;  4AYB N;  4ZYH A;  3BTI A;  5DV5 A;  2DJN A;  4KMU X;  2DJI A;  2JMW A;  2R93 J;  3DF8 A;  3OOP A;  1O3Q A;  2AQF A;  3HRS A;  5CYV A;  3LSR A;  2VC1 A;  4KIC A;  3OYK A;  2LG4 A;  2EFQ A;  2V7F A;  4M71 A;  4Y33 A;  3M1E A;  4P5O A;  2JQ7 A;  2FML A;  1Y0U A;  5DD4 A;  3RPU D;  1GV5 A;  3S1M J;  2QZ8 A;  5JLW A;  2W48 A;  5F1J A;  2DA2 A;  4G8X A;  3CF5 F;  1EJ9 A;  3I54 A;  1X1D A;  5JI6 A;  2OTL I;  2XGE A;  2L9R A;  1WJD A;  2V1N A;  4AVZ A;  4UVB A;  4NHJ A;  5L3G A;  5HLH A;  2QF7 A;  3S3M A;  4UY8 I;  3C7J A;  1WH5 A;  2AXT C;  3ZR8 X;  2DOD A;  4R8H A;  1ZRC A;  3RZO J;  3IAM 2;  5HOD A;  3MKZ A;  3LFU A;  5J4V A;  1RIO H;  4B47 A;  1FJL A;  3OYI A;  3BG9 A;  1JTX A;  3CCM I;  1AY9 A;  4HV5 A;  1TTY A;  5DUK A;  2EIN H;  2KJC A;  1IXC A;  2M4G A;  2CUF A;  2ZJ2 A;  1AA7 A;  1HC8 A;  1PUE E;  1SFK A;  3OIP A;  3OYG A;  1O7L A;  1F1Z A;  4DBQ A;  3LA2 A;  3CLO A;  4ON0 A;  3IH4 A;  4UB6 C;  3WTS C;  5HS9 A;  2QSH X;  2XDV A;  3L00 A;  3HRT A;  1JI8 A;  1Q1V A;  4I99 C;  4ABZ A;  3R61 A;  2YSR A;  2MW8 A;  2QM3 A;  4BXF A;  2V26 A;  2DQL A;  1BM9 A;  5DEQ A;  2VJ4 A;  3CO7 C;  2DPU A;  4DYR A;  2LNB A;  1VQ6 I;  5IT9 Z;  1ULY A;  3LAP A;  1ITY A;  2V1D A;  5J47 A;  3SEQ A;  3G1M A;  4XLH A;  2QSG X;  2ECB A;  3J7A Y;  2F4M B;  3CUO A;  5GP9 A;  4X6A J;  1YW8 A;  1W36 C;  3ABU A;  4ZH4 F;  2MG4 A;  2EZH A;  5FGM A;  1BC8 C;  2YUS A;  1QZY A;  4RGS A;  1F5T A;  3HM5 A;  4MIM A;  3QWL A;  1JKQ C;  3M4O J;  1C0W A;  4CZC A;  4DW6 A;  3DCF A;  1QHG A;  3SFZ A;  3U21 A;  5K5R A;  4PSW A;  2MLK A;  1DUX C;  1X58 A;  3P9I A;  3M7G A;  3BLY A;  5B3S H;  5D5W B;  2WB1 N;  2AS5 F;  3GTL J;  1ZAR A;  3FZV A;  2L2O A;  2XSD C;  4Y7N J;  3JRI A;  2ETH A;  3GFI A;  5IYC J;  4GFB A;  2DYS H;  1K78 A;  4S04 A;  1BI2 A;  5LRS A;  2WC2 A;  3PNV A;  1PP8 F;  2E35 A;  4ZZL A;  1N25 A;  3ABM H;  5D4R A;  2QCO A;  1FYM A;  2YX7 A;  1X2M A;  3IAS 2;  3L1P A;  5CVI A;  4E7H A;  5KCM A;  5CVR A;  4N9I A;  1T98 A;  2CWE A;  1I4V A;  3BTC A;  4PGG A;  4BAC A;  3BG3 A;  4Y13 A;  3IV5 A;  3EPZ A;  2WV0 A;  2CV0 A;  4FCY A;  3WGG A;  3OYL A;  1TP4 A;  3HXL A;  3S2D J;  1M1E B;  1TWC J;  2CU7 A;  5J6X A;  2NVY J;  1MBG A;  3I53 A;  1YOV B;  3ZXS A;  3ECO A;  3L2R A;  4ITV A;  2FU4 A;  2HYJ A;  1K7A A;  4UV9 A;  4KIT B;  5M5W J;  3E6B A;  2BXZ A;  4GYG A;  2K02 A;  4MGR A;  5HDN A;  3IRR A;  4FHT A;  5DUI A;  1F9N A;  2EQR A;  3AFH A;  2DO7 A;  2BOL A;  2NOJ B;  2NS0 A;  1SFU A;  3EDP A;  2FXA A;  2LY9 A;  4W97 A;  4B1R A;  3I0T A;  3WU0 A;  3OL4 A;  4DYQ A;  1KU9 A;  4I76 A;  4EQQ A;  1X1C A;  2R92 J;  2CV1 A;  2XVC A;  2JA8 J;  5GPC A;  2E1N A;  1WSU A;  3TP3 A;  1B9M A;  1ZLK A;  1WFX A;  2VQH A;  2Y2Z A;  4NC6 A;  5F0H A;  3LST A;  2CW8 A;  2HKX A;  3OR2 C;  3ABT A;  1NK2 P;  1FBU A;  3JRD A; 
#chains in the Genus database with same CATH homology
 1HW1 A;  5L3B A;  1KA8 A;  4OIQ F;  4YII A;  1FP1 D;  2ESH A;  2H94 A;  2CSO A;  4GYI A;  4HW0 A;  2QWW A;  5HDG A;  1D3Y A;  4RGR A;  1WWX A;  5E17 F;  4KNY A;  2VOP A;  3DEU A;  3E3V A;  2DK5 A;  3ZMV A;  3I71 A;  3KP3 A;  1GXP A;  4U0Y A;  1R1T A;  4ENN A;  4EM1 A;  1I5Z A;  4CXF A;  4UHT A;  3K0L A;  2P7C B;  1O3R A;  1IRG A;  4HX8 A;  4I0B A;  3H3Z A;  4LGW A;  2D2W A;  1LB2 A;  2VN2 A;  1J5Y A;  3LWF A;  1STZ A;  4CGZ A;  1J0R A;  4KIG A;  2BGC A;  3T5X A;  3LFK A;  4OOI A;  4OIR F;  2DPD A;  1W4M A;  4O3M A;  1YLF A;  1YS7 A;  2ZFW A;  2FSW A;  4A0Y A;  3KLN A;  1RNL A;  3F8N A;  1ON1 A;  1FP2 A;  1W7P A;  3K9T A;  1O3T A;  1Z9C A;  4WXH A;  3MZY A;  5D5X B;  3FMQ A;  3F3X A;  2F2E A;  1VTN C;  3FX3 A;  3KP6 A;  3D0S A;  2EFO A;  4R79 A;  1P4A A;  1AOY A;  2FBI A;  1QGP A;  5IT9 K;  2WTE A;  1GHC A;  4EM0 B;  2CGP A;  3I59 A;  3GUD A;  2HOE A;  2FRH A;  4CYD A;  1U5T A;  2EV5 A;  1TQM A;  2COM A;  2ZXJ A;  3DP7 A;  1JGS A;  4ZZD A;  2UXN A;  4WX9 A;  2R3S A;  2G7U A;  3E6D A;  3KCC A;  1UFM A;  4MQ9 F;  3LA7 A;  2PFB A;  4MQV A;  3KET A;  2MD5 A;  3TOA A;  4UUV A;  1CF7 A;  1S29 A;  2XAQ A;  4LFU A;  4NV4 A;  1HSJ A;  2DT5 A;  3WG9 A;  4ENK A;  2IA0 A;  4O6J A;  1S6L A;  2YU3 A;  3C18 A;  1P92 A;  3IHU A;  3ZMS A;  4Q48 A;  4EMS A;  2M45 A;  3M8F A;  4AD9 A;  1P4W A;  3SQN A;  4BQA A;  3KZZ A;  3FXU A;  1U3E M;  1IN7 A;  4BAY A;  4LLN A;  5HDK A;  1G3W A;  5CLS A;  2M87 A;  2KKO A;  2XUB A;  4Q47 A;  2DQR A;  2IPQ X;  4I01 A;  5FB2 A;  1A04 A;  3U9G A;  3KLO A;  1UHM A;  2KIU A;  2XAJ A;  2HEO A;  4P96 A;  5E8I A;  3K69 A;  5FLX K;  3BY6 A;  1SMY F;  4P55 A;  5IT3 A;  4N31 A;  5CVJ A;  3TKY A;  3KE2 A;  4K8W A;  1T0F A;  1ZRE A;  5FLX Z;  2XHK A;  1KU7 A;  3L2C A;  4IPA A;  2D1H A;  1ZRF A;  4BNC A;  5EEH A;  2A61 A;  1Z1D A;  4F7Z A;  2ZNY A;  1OYY A;  4KMF A;  2O03 A;  1QNT A;  1NHA A;  2FNA A;  2CQK A;  2DBB A;  2P5K A;  1ZN2 A;  3W6K B;  3QOP A;  4JK1 X;  3L7W A;  4A0Z A;  4WXC A;  2QLZ A;  3KP5 A;  2XKO A;  2HZT A;  3D5L A;  2EFW A;  1ZGJ A;  4N0B A;  3WTW C;  2F5E A;  2OBP A;  1ZH5 A;  4ETS A;  2JT1 A;  3TOB A;  3G3Z A;  1JE8 A;  5BS6 A;  2KJB A;  2VT3 A;  4Q4Z F;  4LB5 A;  2BE5 F;  3MEX A;  4UXN A;  1IN6 A;  1P4X A;  2PG4 A;  2RGV A;  2AXL A;  1LVA A;  3EQL F;  2FA5 A;  3WOD F;  1Z7U A;  2CYY A;  2H6C A;  3ECH A;  3O3K A;  4XSZ F;  3J81 K;  5A2Q K;  2P5V A;  3E97 A;  4KA4 A;  1FC3 A;  1I1S A;  3JAM Z;  3RYP A;  5KK1 A;  4GO1 A;  4Z2Y A;  4U7B A;  5AIQ A;  2ZME A;  3P9K A;  1JXS A;  3COA C;  2ZKZ A;  2ZBK A;  1XGM A;  3CTA A;  4M74 A;  2B0L A;  4YFX F;  2GZW A;  4HYE A;  1I27 A;  3F8B A;  2WWY A;  2XRO A;  1T6S A;  3VFZ A;  1FYL A;  1B6A A;  1YW7 A;  2A69 F;  3MFK A;  3OV8 A;  3HYI A;  2O61 A;  5FFX A;  1L3L A;  2Q8K A;  4B8X A;  1XN7 A;  2JSC A;  4A5N A;  2Q2E A;  3ZMZ A;  4M9Z A;  5D6F A;  1ONV A;  3V4G A;  2K7L A;  2MA3 A;  2QYO A;  1R00 A;  2MH2 A;  2MLG A;  2M8E A;  1R58 A;  4LK1 F;  2IVM A;  3U1D A;  5CVV A;  4HF0 A;  3GWZ A;  1UST A;  2A3S A;  4UV8 A;  3F22 A;  3KP2 A;  3IWF A;  2PMH A;  3QP5 A;  1TW2 A;  4WCG A;  4WF2 A;  3G73 A;  4YFK F;  4P9F A;  2F5D A;  4RB1 A;  1W7P B;  2VC0 A;  2H27 A;  4Y17 A;  4XLN F;  3GO5 A;  2HFH A;  3E5X A;  1QQI A;  1XB4 A;  3VB2 A;  4DQ2 A;  1ZLJ A;  2RQP A;  3QU6 A;  1KQ9 A;  1RUN A;  2FEZ A;  1HKT A;  2GAU A;  4KDP A;  3WE2 A;  3QAH A;  3BDN A;  3LQQ A;  5L3C A;  1XCV A;  2UWM A;  2XRN A;  2M5W A;  3LQR A;  1H9G A;  1TBX A;  3JSP A;  1JHH A;  2EFP A;  2XAF A;  1HKQ A;  1D8K A;  3F21 A;  3IRQ A;  2HR3 A;  1BOA A;  2PQ8 A;  2DK8 A;  3R0A A;  4R1H A;  5LGU A;  3V8J A;  4A6E A;  4BH9 A;  3BP8 A;  2FOK A;  3ZN0 A;  2W25 A;  1TW3 A;  3GLX A;  2PN6 A;  3R60 A;  3R0J A;  1LEA A;  1W5S A;  2OAZ A;  4OIP F;  3VOE A;  5H6Q A;  5LEK A;  3MWM A;  4G9Y A;  5TRD A;  2Q0O A;  1MJA A;  1T38 A;  3GEZ A;  2QQ9 A;  1SAX A;  3CJN A;  1FT9 A;  1W5T A;  1T2K A;  3BWG A;  4L9T A;  5HVQ C;  4MHG A;  2ZNZ A;  2LSO A;  1Z6R A;  2GWR A;  2GQQ A;  4M72 A;  5A2Q Z;  3IIQ A;  3Q5F A;  1G3S A;  5DD8 A;  2EV6 A;  2ESN A;  2Z3Y A;  4FX4 A;  4MTD A;  3CUQ A;  4A0X A;  2ISZ A;  1OYI A;  2VBZ A;  4XSX F;  1S8N A;  5DCM B;  1YTY A;  2NNY A;  5FFZ A;  2VOO A;  1U5T B;  1FY7 A;  2ADU A;  3KEQ A;  4ENM A;  4EJW A;  5JHU A;  3ZMD A;  2W84 A;  1U6G A;  3DXJ F;  3BJO A;  1YW9 A;  4G6Q A;  2UXX A;  4S05 A;  4M6Y A;  4IRI A;  4HZF A;  1H0M A;  2RN7 A;  1MKM A;  1F39 A;  2O3F A;  4MEY F;  1Z05 A;  3GF2 A;  4G94 A;  3ISP A;  1BI3 A;  2V79 A;  4OMZ A;  3I64 A;  5H6R A;  3DV8 A;  1HW2 A;  2K86 A;  4CZZ A;  1ZAO A;  1X3U A;  2JPC A;  4HF2 A;  1IUY A;  4Y15 A;  3ZN1 A;  2Y75 A;  3RPQ A;  1R1V A;  3E5U A;  3HUG A;  1AWC A;  1MDM A;  2M1B A;  4ZYD A;  1ZHF A;  2V1U A;  2CO5 A;  4WK8 F;  5DCF A;  2L54 A;  1V3F A;  3HTS B;  2A6E F;  2RNJ A;  1R22 A;  3GFM A;  3HIF A;  1HW5 A;  5L3F A;  3RKY A;  4HAM A;  3T8T A;  5JVT A;  1BN5 A;  1FWZ A;  3KP4 A;  4HBL A;  4A12 A;  2VBX A;  1ODD A;  1Q1H A;  1SFE A;  1K78 B;  3QRF F;  4HX4 A;  3KFW X;  2A07 F;  4KIB A;  1Z91 A;  2J5O A;  2L3D A;  2VOD A;  4OU0 A;  3JAM K;  2JPB A;  5J8C A;  1XDS A;  5CJ9 A;  4EJT A;  4EJV A;  1I6X A;  2F5C A;  2IA1 A;  2P5L C;  3J81 Z;  3S04 A;  1MDM B;  5ILV A;  4HDU A;  1FNN A;  5D5U B;  4H0E A;  1LDJ A;  1UMU A;  4WWC A;  2GA2 A;  5FD5 A;  4A6D A;  5KVR A;  4TV7 A;  1R5G A;  5E20 A;  4BXU A;  1BBY A;  2BYV E;  2L4M A;  2QBY A;  2HKO A;  4LD5 A;  2CFX A;  3E5Q A;  3F23 A;  5J8F A;  1CGP A;  2V9V A;  2MC3 A;  3BRO A;  3HSE A;  2IW5 A;  1LDK B;  3FF5 A;  4L0Y B;  1K6O A;  5ILS A;  1V4R A;  1XGN A;  3IWZ A;  3Q9S A;  5D6E A;  2W85 A;  1XD7 A;  5E1Z B;  2EFN A;  4HV6 A;  1K79 A;  1S7A A;  3H92 A;  4O5V A;  2GXB A;  3ROU A;  3P7N A;  1MJ9 A;  4ME8 A;  1KYW A;  4U7D A;  4KN7 X;  1B1B A;  2KIF A;  3TO6 A;  3MAJ A;  1PDN C;  3H3U A;  1HXD A;  1S3J A;  1F4K A;  2CW0 F;  3HSF A;  3JTG A;  1KQ8 A;  4N9H A;  2QBY B;  3GZ6 A;  3B73 A;  5EEG A;  3GFJ A;  2R7F A;  1FPQ A;  4EJO A;  2RV8 A;  3L09 A;  3RI4 A;  2JZY A;  4XBF A;  1IAW A;  3TO7 A;  4RB2 C;  3N97 A;  1LQ1 A;  3FMR A;  1FOK A;  5LHG A;  5LGT A;  4I98 B;  5D5V B;  2LF7 A;  4L18 B;  1BI1 A;  1BIA A;  4EVI A;  5FO5 A;  5BPD A;  5BPI A;  3EET A;  1SD7 A;  1OPC A;  2P4W A;  1FBS A;  3S2W A;  4PZJ A;  2TDX A;  3VOD A;  2O6G E;  1QBJ A;  1RZ4 A;  4U88 A;  3WGI A;  1FX7 A;  1D8J A;  4PGH A;  3N4M A;  2ELH A;  2ACJ A;  2XAH A;  4ESF A;  2QQB A;  3IL2 A;  2RKH A;  1R5H A;  2G7H A;  1KQ0 A;  1LNW A;  5HLI A;  4U0V A;  4DNC A;  3FM3 A;  4RB0 A;  4RS8 A;  1FSE A;  3E6C C;  4M9S A;  2IA2 A;  3BPX A;  2VON A;  3F72 A;  5K5O A;  1XSV A;  4CDG A;  1FSH A;  4QLC U;  1J9I A;  2L01 A;  5BQT A;  1TQP A;  5L3D A;  4ESB A;  1CF7 B;  3LAJ A;  3AAF A;  3W6J B;  4IF4 A;  2F5F A;  3WTY C;  4U0W A;  3BZ6 A;  1OR7 A;  2OQG A;  3V7C A;  2LF8 A;  2JTV A;  5LHH A;  1O57 A;  1GXQ A;  1U78 A;  2VE8 A;  4I7H A;  3FM5 A;  4IXA A;  1B59 A;  2FNP A;  2FKD A;  1XCB A;  2RC4 A;  5HLG A;  3CDH A;  3FXQ A;  1IN4 A;  4HF1 A;  1SD5 A;  2ZO4 A;  2V6C A;  3K1N A;  2K4B A;  3WU1 B;  3PQK A;  1QPM A;  2FJR A;  1IXS B;  3EYY A;  2HYG D;  3RTR A;  5LHI A;  1FBQ A;  3SZT A;  3ULQ B;  1SFX A;  2HWV A;  2MH9 A;  1YYV A;  1U2W A;  4KT5 C;  3V7R A;  4ESJ A;  2M30 A;  1ZRD A;  2YX4 A;  4KUM A;  3CO6 C;  4EM2 A;  1IZ1 A;  4NQW A;  4WXD A;  3FXR A;  2W24 A;  3RJP A;  5H20 A;  5D8K B;  3RKX A;  5DCM A;  3SHF A;  2LKP A;  4IHS A;  4L9V A;  4AVP A;  2O8X A;  1ZG1 A;  3WTT C;  2ISY A;  1KGS A;  2KIM A;  3QPH A;  4ZYG A;  4IVN A;  3DPT A;  3QU3 A;  4HQE A;  3O2P E;  5HOO A;  1ZYR F;  1B9N A;  3DKW A;  1UHW A;  1KU2 A;  3DPL C;  3TDU C;  2Z9O A;  4M73 A;  4FX0 A;  2PLY A;  2BEO A;  1SMT A;  4LJZ F;  5AIP A;  3I4P A;  1WQ2 A;  3WTU C;  1TNT A;  5FD6 A;  3K1P A;  5TJJ A;  3GYH X;  2C6Y A;  4EJU A;  4ZYE A;  3Q9V A;  3PFI A;  3F8F A;  5E8G A;  1YS6 A;  3BDD A;  4LG0 B;  1J2X A;  4LMY A;  3WE3 A;  2FBH A;  4I02 A;  4A2U A;  4UVA A;  1REP C;  3ZMU A;  2EA4 A;  3WGH A;  1E17 A;  6PAX A;  1BIB A;  5ICE A;  3ZMT A;  2QUF A;  1ZG3 A;  3F8M A;  2LDU A;  2P8T A;  3F8C A;  3HRU A;  3CUQ B;  5HS7 A;  1OMI A;  1Z6T A;  1MJB A;  2XGX A;  4MNU A;  2HQN A;  2J5P A;  1MD0 A;  2OQR A;  1IF1 A;  1B12 A;  2NRA C;  3I58 A;  1DDN A;  2EB7 A;  3V8K A;  2XAG A;  1B4A A;  3MQ0 A;  3GFL A;  3NRV A;  2OA4 A;  4RGU A;  5DYM A;  2YR2 A;  1U5T C;  4HDV A;  2IP2 A;  4XLP F;  1EH6 A;  1S7O A;  2X0L A;  3FMS A;  4ASN A;  5CVU A;  1BC7 C;  3T8R A;  3SZP A;  2JRT A;  3V8L A;  3L9F A;  4ENJ A;  1W7P D;  4RAY A;  3REO A;  3TGN A;  4RAZ A;  1R7J A;  4M6X A;  2CG4 A;  1OKR A;  3IKV A;  3U2R A;  3IKT A;  2RVC A;  2XAS A;  1XGS A;  3ZP5 A;  1J75 A;  1XMA A;  4P9U A;  2L02 A;  4I09 A;  4HX7 A;  1R23 A;  3KZY A;  2HTJ A;  1YIO A;  2YPR A;  2W57 A;  3LA3 A;  4JQF A;  2P7V B;  4LB6 B;  2DI3 A;  5D8L B;  3NEU A;  1D5V A;  3IC7 A;  3V7S A;  1TNS A;  5LBQ A;  2E1C A;  1G4D A;  2IJL A;  3R6S A;  2K4J A;  1G3Y A;  2PMU A;  1YG2 A;  1O3S A;  3ZQ7 A;  1I1G A;  4IRH A;  3GVA A;  2Z5U A;  3QPT A;  2Z99 A;  4YG2 F;  4IRG A;  3MZH A;  1SD4 A;  3R4K A;  2QEN A;  4Q5S F;  2VT2 A;  3T1B A;  4BHB A;  4L5I A;  4MEX F;  5BMZ A;  2P6T A;  2K27 A;  1BJA A;  4AIK A;  3HOT A;  1RUO A;  1XGO A;  3GX4 X;  5HS8 A;  1IXR C;  1FZP B;  2HGC A;  1QO0 D;  2R7D A;  4IHT A;  3WTZ A;  3K2Z A;  3MCZ A;  3TQN A;  1GVJ A;  4FT8 A;  4I2O A;  1XSD A;  1KYZ A;  4HOB A;  2BV6 A;  3QP6 A;  2E7W A;  2PJP A;  3WTV C;  4XRF A;  1XSX A;  1RI7 A;  2A68 F;  2NAZ A;  5F6F A;  4B09 A;  4CO8 A;  1EH8 A;  1TLH B;  5LLQ A;  1ZGA A;  5ED4 A;  3E6M A;  2E7X A;  3HTU A;  4L9N A;  2V1X A;  1KU3 A;  3WTX C;  2NNN A;  4GCV A;  5LGN A;  1G3T A;  2XKP A;  2STW A;  4UNO A;  3FWE A;  4KYW A;  4PCQ A;  1DP7 P;  2EK5 A;  2EV0 A;  2OU2 A;  1BI0 A;  4HA8 A;  3KP7 A;  3C1D A;  1MGT A;  1JHF A;  2MBF A;  4PDK A;  2PI0 A;  2H09 A;  3RPU A;  4M9X A;  4AIJ A;  1HBX G;  1QZZ A;  1UCR A;  3I5U A;  3SXY A;  5E1W A;  4OIO F;  4D0P A;  2D1V A;  2IRF G;  5K5Q A;  2XV4 S;  5DDG A;  4KN4 X;  5LRR A;  2FBK A;  3ELK A;  4HLX A;  4OMY A;  1H9T A;  1J59 A;  1EV7 A;  3PQJ A;  1DPR A;  4QWQ A;  1ZG5 A;  4GGG A;  4LG0 A;  3BPV A;  4AWX B;  4IJA A;  5JR3 A;  5K1Y A;  3HHH A;  2FF4 A;  3RIR A;  4JBA A;  1UB9 A;  1XMK A;  2IT0 A;  3JW4 A;  5L3E A;  2VE9 A;  3HHG A;  3DQV C;  4L9J A;  2OZ6 A;  4G7Z F;  3ML6 A;  4YIF A;  5ICG A;  2XIG A;  3M8E A;  4BYY A;  5LEJ A;  1DPU A;  4HQM A;  5AON A;  2PBI A;  3J80 K;  1HQC A;  2HYF A;  4RB3 C;  1IRF A;  3HRM A;  3GZ5 A;  4L0Z B;  4LK0 F;  3ERE D;  1U8R A;  4CIC A;  3EYI A;  4CHU A;  1IN5 A;  3I59 B;  3ZPL A;  2X4H A;  2A6H F;  5BOX A;  3RYR A;  3JSO A;  2VBW A;  4BHC A;  2L4A A;  5D4S A;  2EA2 A;  2DAO A;  4KFC A;  3HSR A;  4A5M A;  1YO5 C;  1JHE A;  1OYW A;  2VXZ A;  1HST A;  3F6O A;  3K1M A;  1T7D A;  4HLY A;  4G6D A;  1WRJ A;  1MZB A;  4BHP A;  3P9C A;  1FYK A;  3GW2 A;  2ZCW A;  1YFH A;  1E2X A;  3GXO A;  4AIH A;  1J7K A;  1JHC A;  1XDU A;  1HKS A;  4EV0 A;  5ERI A;  2VBY A;  3O6B B;  2DU9 A;  2FQ3 A;  4MTE A;  1R36 A;  2GA1 A;  4I0A A;  2DFI A;  5F64 A;  3FHZ A;  5E1X A;  4EGZ A;  2A5Y B;  2DTR A;  3HOS A;  5E18 F;  1FLI A;  2ZME B;  2FMY A;  1P2F A;  3B02 A;  2PEX A;  3J80 Z;  4YFN F;  1KN9 A;  4GXO A;  3VEP A;  2Y48 A;  5ICF A;  1O7F A;  1WI9 A;  3BJA A;  2HO0 A;  4E70 A;  3BOQ A;  3NQO A;  3KEO A;  3TDZ C;  4RGX A;  1WKM A;  4OIN F;  4G7O F;  2QQA A;  2NYX A;  3EUH A;  3CUQ C;  1LEB A;  1ON2 A;  1LDD A;  2DLL A;  2DW4 A;  1IW7 F;  3T0Y A;  4K2E A;  2G9W A;  2Y0M A;  3BJ6 A;  2BBY A;  3J7A O;  3RDI A;  4L5J A;  2HDC A;  5F1R A;  2HS5 A;  5ILU A;  2KRF A;  4UVC A;  1LJ9 A;  2OD5 A;  2GIV A;  2RDP A;  1EH7 A;  3M9A A;  4EGY A;  3JTH A;  1KCA A;  1SD6 A;  2HNF A;  1T39 A;  4KIF A;  2OZU A;  4NB5 A;  1YQA A;  4G7H F;  2HTS A;  2D45 A;  3TO9 A;  3RKW A;  2H6B A;  2STT A;  4LLG F;  1P6R A;  2UZK A;  1L0O C;  1R1U A;  5JFR A;  2EWN A;  2P6S A;  3DFG A;  2EJR A;  2QVO A;  2FE3 A;  1G6N A;  5ICC A;  3F6V A;  4LLL A;  1IN8 A;  1TQI A;  2O0Y A;  2HQR A;  2Z33 A;  2GXG A;  1USS A;  1PP7 U;  3C3W A;  4ZYH A;  5DV5 A;  4KMU X;  3DF8 A;  3OOP A;  1O3Q A;  3HRS A;  5CYV A;  2VC1 A;  4KIC A;  2EFQ A;  4M71 A;  3M1E A;  4P5O A;  2FML A;  1Y0U A;  5DD4 A;  2QZ8 A;  4G8X A;  3I54 A;  5JI6 A;  4UVB A;  4NHJ A;  5L3G A;  5HLH A;  3C7J A;  4R8H A;  1ZRC A;  1RIO H;  1AY9 A;  4HV5 A;  1TTY A;  5DUK A;  2KJC A;  1IXC A;  2ZJ2 A;  1PUE E;  1O7L A;  1F1Z A;  3LA2 A;  3CLO A;  4ON0 A;  3WTS C;  5HS9 A;  3L00 A;  3HRT A;  3R61 A;  2YSR A;  2QM3 A;  2DQL A;  1BM9 A;  5DEQ A;  3CO7 C;  2DPU A;  2LNB A;  5IT9 Z;  1ULY A;  3LAP A;  2V1D A;  3CUO A;  1YW8 A;  3ABU A;  4ZH4 F;  5FGM A;  1BC8 C;  1QZY A;  4RGS A;  1F5T A;  1C0W A;  3SFZ A;  5K5R A;  2MLK A;  1DUX C;  3P9I A;  3M7G A;  5D5W B;  2AS5 F;  1ZAR A;  3FZV A;  2ETH A;  3GFI A;  1K78 A;  4S04 A;  1BI2 A;  5LRS A;  2WC2 A;  1PP8 F;  4ZZL A;  5D4R A;  1FYM A;  2YX7 A;  5CVI A;  5CVR A;  4N9I A;  1T98 A;  2CWE A;  1I4V A;  4PGG A;  4Y13 A;  2WV0 A;  3WGG A;  5J6X A;  3I53 A;  3ECO A;  2FU4 A;  1K7A A;  4UV9 A;  3E6B A;  4GYG A;  2K02 A;  4MGR A;  5HDN A;  3IRR A;  4FHT A;  5DUI A;  1F9N A;  2DO7 A;  2NS0 A;  1SFU A;  3EDP A;  2FXA A;  3I0T A;  3WU0 A;  1KU9 A;  4EQQ A;  2XVC A;  2E1N A;  1WSU A;  1B9M A;  1ZLK A;  3LST A;  2HKX A;  3ABT A;  1FBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...