3JSOA

Classic protein with a new twist: crystal structure of a lexa repressor dna complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
188
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLGLPLVGRVAAGEPLIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the LexA-DNA complex and implications for SOS box measurement.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase/dna
molecule keywords LexA repressor
total genus 45
structure length 188
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jsoA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3jsoA02
4LJZF 5A2QZ 3HOSA 3GZ5A 4ZYHA 3R4KA 2XIGA 5TJJA 3TQNA 4M72A 4Q5SF 4M71A 2ZCWA 3AAFA 2CW0F 1KCAA 3QPTA 1RNLA 3QU3A 5LEJA 2K4BA 3WU0A 4A0ZA 4OIQF 3E5QA 3TKYA 3IL2A 1U5TB 1STZA 2OZ6A 3VB2A 5E1XA 3HRSA 3I5UA 5ILUA 4CO8A 3R61A 4KN4X 1SFUA 1W4MA 1JHHA 2QENA 3FHZA 3KP6A 3L7WA 4A6DA 4B8XA 2EV0A 1AY9A 4P55A 4OMYA 2K7LA 5CYVA 4LB6B 3ZMUA 2PQ8A 1AOYA 2A69F 1R23A 1QQIA 5K5QA 4I0AA 1FX7A 3K9TA 4EV0A 2WWYA 2DI3A 3L09A 2K27A 1HW1A 3F8FA 4A0YA 2FKDA 4RGUA 1U2WA 1LDJA 5HVQC 2BYVE 3BZ6A 3F72A 1T38A 3O3KA 1B9MA 3SQNA 1LQ1A 3LAPA 2QQAA 4EJTA 3BP8A 2XAJA 2JTVA 1FNNA 1A04A 3M9AA 1RI7A 4L0YB 4FX0A 1ZRDA 1J0RA 1SD4A 3LQRA 3BROA 2EA4A 3ZMTA 3IHUA 4XSXF 2VOPA 5CJ9A 1MD0A 2P5VA 5E17F 4IHTA 4KICA 3LSTA 3F3XA 4Y15A 5AIPA 4GO1A 1T6SA 3HSFA 4HW0A 2VE9A 4MEXF 3P9KA 1D8JA 3BJ6A 3HSRA 5HLIA 4LGWA 2G7HA 2O6GE 2EWNA 1LDDA 4ENKA 4Q48A 4YIFA 1G3TA 3FX3A 3RYRA 3JTGA 5L3CA 2UXXA 1KYWA 2ESNA 2XAFA 1ON2A 4U0YA 3I59B 4UVBA 2W57A 2V79A 2HEOA 2L02A 5E1WA 4HYEA 4BNCA 3MQ0A 4HV5A 2K4JA 2HS5A 4LLLA 2O0YA 2FMLA 3GFMA 3DQVC 4L5JA 4Y17A 2LF7A 1Z7UA 5CVJA 3VEPA 3EYYA 4Q47A 2ZNZA 2CYYA 3F8BA 2MA3A 4HQEA 4GYIA 1W5SA 5HLHA 3I58A 3DKWA 3C18A 2ZFWA 5LGUA 1IF1A 4HV6A 3T1BA 2Z9OA 4ESBA 2KJBA 2FXAA 3V7RA 2Z99A 4B09A 2YU3A 2M1BA 3E5XA 2LNBA 2P7CB 4N31A 1XCBA 1Z05A 1SMYF 1XB4A 3DXJF 3I71A 2VT2A 1HQCA 2W25A 1ULYA 4OIRF 3B73A 1S8NA 1QBJA 3JSPA 2M45A 3MZYA 1HSJA 3R6SA 1XSXA 1ZLKA 1O3RA 3EUHA 3SZPA 2P5LC 2YX7A 3QP6A 2NYXA 3L2CA 5BOXA 3GFLA 2RN7A 2H6CA 4PDKA 5CLSA 4OIPF 2FSWA 2M87A 1TW2A 3O2PE 2VONA 3DF8A 2RNJA 2MD5A 3E5UA 5E8GA 2VBXA 2P4WA 5HDKA 1TQPA 2XUBA 5F6FA 3C1DA 1W5TA 3HRMA 3FZVA 2IVMA 3FXQA 5DCMB 5LRSA 1HW2A 1OYYA 1IUYA 3MEXA 5D8KB 3GFJA 1BC7C 3K69A 3OV8A 3ZMVA 2DAOA 1G3SA 3BJAA 1ZLJA 4CGZA 4KIFA 1XGSA 5HS7A 1ZREA 1IRGA 5DUIA 4KN7X 4LD5A 4UV9A 1F5TA 2QYOA 3N4MA 2VC1A 4PCQA 4ZH4F 3V7SA 1I5ZA 2NS0A 4HA8A 3ZPLA 5K5OA 1JHFA 4M9ZA 3DP7A 1S7OA 5CVVA 3E6MA 2H09A 4G7ZF 3TO6A 5L3BA 1G6NA 4I0BA 4GXOA 4A5NA 2HTJA 2VC0A 3RPQA 3FWEA 5HOOA 3FXUA 1U5TA 1D3YA 4Z2YA 2D1HA 3HIFA 2JSCA 4UHTA 4LFUA 3RI4A 3R60A 1BM9A 2O3FA 4EQQA 4P96A 4R8HA 5ILSA 2D2WA 4XLNF 2IRFG 5K5RA 2PN6A 2XHKA 1NHAA 4MHGA 2A68F 1KQ8A 5E8IA 2P8TA 3ML6A 2DQRA 2L54A 2RKHA 3E6CC 1CGPA 1IN4A 3WGGA 2Z33A 4RS8A 4P9UA 2UZKA 1Z1DA 1W7PA 3KP3A 4L9TA 4AIHA 3IWZA 1WRJA 5D5UB 4DNCA 1K78B 2GIVA 4WCGA 4LLGF 4ENMA 4S05A 1UHWA 5A2QK 3IKVA 3CO6C 1QGPA 1UB9A 2ZMEB 5ICGA 4IRGA 3MWMA 5JFRA 1B4AA 3SZTA 3K2ZA 3E3VA 4L18B 2R3SA 3CLOA 4HX4A 5D5XB 5D6EA 3FMRA 2ZO4A 2NNNA 4RB1A 4I98B 4EGZA 2KRFA 5L3GA 1J59A 4RAZA 4ON0A 1D5VA 1Z6TA 3CTAA 1MZBA 1Y0UA 4UNOA 4P5OA 3D0SA 4RB2C 4M74A 1VTNC 2JT1A 4UVAA 2EFNA 5DCFA 2QZ8A 3J81K 1ZRCA 1BIBA 5L3EA 4KDPA 3GF2A 1S6LA 1XDUA 2FU4A 2FE3A 4HF1A 1PDNC 2J5OA 2CG4A 1T7DA 1ON1A 3QP5A 3F8MA 1UFMA 2O8XA 1S29A 1U6GA 1FY7A 1YQAA 1PUEE 2HFHA 2MH9A 5FFXA 1E2XA 2GQQA 3EDPA 3HTSB 5HS8A 2RV8A 3TOAA 4JK1X 2J5PA 4CXFA 5D4SA 1OPCA 2ISZA 4YFNF 5IT9Z 2YX4A 3REOA 1IRFA 4ZZLA 2PFBA 4BHCA 4KFCA 4EJVA 4ENJA 3WTVC 1BI1A 2FMYA 2MLGA 3WTSC 3N97A 3FMSA 2VODA 3ZMZA 4NB5A 4LB5A 3ZN0A 2PMHA 1SD6A 1V3FA 5BQTA 1KA8A 3KCCA 2LDUA 5LEKA 2Z3YA 1XMAA 3BY6A 4IRHA 1G4DA 5TRDA 1FBSA 1QPMA 5L3FA 1O7FA 2XKOA 5FLXZ 3WE3A 1R1TA 4EJOA 4BHBA 3DFGA 4G7HF 5J6XA 3GX4X 1WI9A 1R58A 4HBLA 4KIGA 2H6BA 4AD9A 2E7WA 4M9XA 2XGXA 2JPCA 1WKMA 3ULQB 1JE8A 3I64A 3ELKA 4F7ZA 1DPRA 1FBUA 3CDHA 2O03A 1T98A 2IA0A 1GXPA 3ABUA 1ZAOA 1L3LA 3OOPA 1R1UA 2F2EA 4HOBA 2L3DA 3R0JA 3GFIA 2ETHA 3RJPA 1ZGAA 1YFHA 2IA1A 4YG2F 1GHCA 1Q1HA 2CQKA 2M30A 4HQMA 2VN2A 2NNYA 4KMUX 5J8FA 1V4RA 5DDGA 3GZ6A 3QRFF 2ZMEA 1TLHB 4LK1F 1R5HA 3JSOA 3ZQ7A 2LKPA 3G3ZA 1ZHFA 1YW7A 2QBYA 3COAC 1QZYA 2V1UA 4LLNA 5D5WB 3ZP5A 5ICFA 2LF8A 1P4WA 1TQMA 2DW4A 3HHGA 4WK8F 1GVJA 3WTWC 1FBQA 4ZYEA 1P4XA 5JHUA 4LK0F 4CYDA 4GYGA 3PFIA 2OQGA 3GLXA 3BWGA 3P9CA 4ZYDA 1LEAA 2IA2A 3J80K 1TTYA 4PGGA 5FGMA 4D0PA 2QQ9A 1ODDA 3DEUA 1Z6RA 2MC3A 4I02A 4G8XA 1FYKA 1YG2A 4M9SA 3KE2A 3IRQA 2DBBA 2FBHA 1YW9A 2OA4A 2FA5A 1UMUA 5D4RA 5ILVA 3K1PA 2STWA 4G6DA 3RIRA 3HYIA 4EMSA 1P4AA 1S7AA 2EA2A 4AVPA 3H3UA 2EJRA 1EV7A 1FP1D 3SHFA 2DLLA 3KEOA 1LNWA 2DT5A 5J8CA 4NHJA 1YLFA 3CUQC 4A2UA 4G94A 3FMQA 2XRNA 2BEOA 3SFZA 2WC2A 5JI6A 1O3TA 1ZRFA 2AS5F 2PMUA 4RAYA 4A0XA 3RPUA 1U8RA 4OOIA 1J2XA 1GXQA 4CZZA 1I6XA 1ONVA 2RVCA 4HX8A 4U0VA 3V8LA 1C0WA 3IC7A 2V1XA 3NEUA 4IRIA 1B6AA 1YW8A 1SMTA 1T2KA 1O3SA 5LBQA 5H20A 1QNTA 3HTUA 2L4MA 2Q8KA 4EM2A 1BI2A 3R0AA 5L3DA 1PP8F 6PAXA 3FM3A 2CGPA 2EFOA 1MGTA 3CJNA 4NQWA 3KP7A 1KU3A 1I4VA 4N0BA 3F8NA 1OYWA 1SFXA 3ZMSA 1FWZA 3TO9A 2KIUA 2P6TA 2HGCA 1TBXA 2EV5A 3H92A 4FX4A 2FOKA 3M8EA 4L9NA 3C7JA 3DPTA 4IHSA 1J75A 2QBYB 1F1ZA 1KU7A 2H94A 1W7PD 3EQLF 1FOKA 2OZUA 2XAGA 4EM1A 2XAQA 1WWXA 2G9WA 1IW7F 4FT8A 1TW3A 1P92A 5FO5A 3RTRA 1EH6A 1BIAA 3E6BA 3JW4A 4WF2A 2FJRA 3IKTA 3KZYA 1IN5A 2FEZA 2D45A 4R79A 1MDMB 3QOPA 2MBFA 3RKWA 5BMZA 1IAWA 5BPIA 1XN7A 1EH8A 4CHUA 5FD5A 2VE8A 1JGSA 4RB0A 4LG0A 1XSVA 4I7HA 4M6YA 2A3SA 3RKXA 1T39A 2GA1A 1IXSB 1R5GA 3K0LA 3I4PA 3IIQA 1FYMA 1XDSA 3GO5A 1BBYA 1YO5C 4O5VA 1B59A 3DPLC 4O3MA 4M73A 2B0LA 4A12A 3V7CA 4IJAA 1LDKB 3LA3A 2X4HA 1MJ9A 3WTTC 4R1HA 1K79A 4ME8A 5LHIA 4BYYA 1J7KA 4G7OF 2YSRA 2R7DA 2LSOA 4LMYA 1OR7A 4S04A 1JHEA 4KT5C 5JR3A 1J5YA 3Q9SA 2XKPA 3MZHA 1R7JA 4L0ZB 2L01A 4BHPA 4UVCA 2R7FA 2XV4S 1SAXA 2EFQA 1DUXC 3ECHA 3H3ZA 4JQFA 1DDNA 5F1RA 4L9JA 1TNSA 4ESFA 2O61A 1L0OC 5ED4A 2EFWA 1PP7U 3BOQA 2XASA 3KP4A 2VBZA 4A6EA 2L4AA 3VODA 3WODF 3MAJA 2HQRA 4UUVA 4KYWA 4L9VA 3I59A 5HLGA 1ZG1A 1ZG3A 4BH9A 4MNUA 2PEXA 5DCMA 1BI0A 5KVRA 1XMKA 5D8LB 4WXCA 3P9IA 1YYVA 2AXLA 4JBAA 3HHHA 4N9IA 4GGGA 3LWFA 2RC4A 1BN5A 5FFZA 3RDIA 2IT0A 4HZFA 2HWVA 2KIMA 3QU6A 3JTHA 2A07F 2FQ3A 1ZN2A 2K02A 4AIJA 3KEQA 5HDGA 2ACJA 2STTA 1EH7A 2HO0A 1SD7A 3HSEA 4P9FA 3BJOA 4EVIA 1FT9A 5HS9A 1O3QA 1XD7A 4HF0A 1KU9A 4Y13A 1DPUA 5LGTA 1P6RA 2C6YA 5AONA 2NRAC 5IT9K 2RGVA 1ZGJA 1KQ0A 5CVRA 2PG4A 2DK8A 1CF7A 1AWCA 4BQAA 4HF2A 1H9GA 3J81Z 3BPXA 3M1EA 2V9VA 4I09A 1UHMA 2OD5A 1HKQA 4G6QA 3PQJA 3GYHX 2M8EA 1O7LA 3KP5A 3GEZA 2OU2A 3WE2A 3ABTA 4AIKA 5ICCA 3E97A 3NRVA 1HKSA 3S2WA 1USTA 1YTYA 2CO5A 2W24A 4KUMA 2QVOA 1K78A 3TOBA 3T0YA 2QM3A 3CUQA 2WV0A 1O57A 2QQBA 2TDXA 1U5TC 4PGHA 3HRUA 4CICA 4IVNA 4ASNA 2CFXA 2WTEA 2MH2A 2FBKA 5CVIA 2FF4A 3TDUC 3WTUC 2HYFA 1IN8A 2E7XA 3CO7C 5AIQA 1KU2A 1I27A 4Q4ZF 3GUDA 2BV6A 4A5MA 5HDNA 5FLXK 2M5WA 4UV8A 2HNFA 3MCZA 1HKTA 4KA4A 1E17A 1MKMA 3HOTA 4HDUA 2EFPA 1J9IA 4PZJA 3WU1B 1F4KA 2FBIA 4XLPF 4HDVA 4I01A 2Q0OA 4YFXF 3D5LA 5DEQA 2RQPA 2VXZA 1T0FA 4G9YA 1FP2A 5LHHA 1K7AA 3J7AO 1MDMA 4ENNA 3BDDA 2CWEA 2G7UA 5D6FA 1SD5A 1ZH5A 2RDPA 2ZKZA 4IPAA 3G73A 2IJLA 1QO0D 5FB2A 1LB2A 1IZ1A 2ELHA 4OMZA 3SXYA 4H0EA 3GWZA 1X3UA 3P7NA 2HDCA 3I53A 1P2FA 2YR2A 1IN7A 3GXOA 4XRFA 4N9HA 1XGNA 1LVAA 5IT3A 3T8RA 3JAMK 2EV6A 3B02A 1USSA 5BPDA 3RYPA 1G3YA 1U3EM 3NQOA 2UWMA 2F5DA 5ICEA 1REPC 3F6VA 3ISPA 2ZJ2A 4FHTA 2X0LA 3VFZA 5FD6A 2BE5F 2IP2A 3LA7A 2CSOA 1FSHA 2A61A 2OQRA 3L00A 4YIIA 3KLNA 5LHGA 2KKOA 4EM0B 1LJ9A 2Y0MA 4RB3C 2GZWA 3K1NA 4HLYA 2DU9A 3CUQB 2H27A 1R00A 2OAZA 4DQ2A 1H9TA 1D8KA 5EEHA 2KIFA 4IF4A 4NV4A 3KZZA 3F6OA 1WQ2A 1U78A 2HZTA 3BPVA 4OU0A 4I2OA 4HLXA 3V8JA 4ETSA 5F64A 3LA2A 3U1DA 1HBXG 4U88A 2ADUA 3WTXC 5E18F 2BBYA 2F5EA 1RIOH 2VBWA 1RUOA 3RKYA 1JHCA 3WGHA 1ZG5A 3GVAA 4QWQA 5DUKA 2HOEA 3WG9A 3C3WA 2PBIA 1BJAA 5H6RA 1FSEA 3KP2A 2DK5A 1I1GA 4WXDA 2DQLA 2DTRA 2F5FA 2HR3A 2Y48A 2A6HF 1BI3A 3Q5FA 1B12A 1OYIA 5E1ZB 1IXRC 1RZ4A 2A6EF 1BC8C 2FNAA 3PQKA 1JXSA 4O6JA 2ESHA 3F22A 3U9GA 1TNTA 2XROA 2D1VA 2ZNYA 3MFKA 2Z5UA 3ECOA 4ZZDA 2IPQX 5LGNA 4MQVA 3BDNA 1XSDA 4K8WA 3V4GA 2F5CA 2UXNA 4HAMA 3QAHA 2PI0A 1KQ9A 2YPRA 1BOAA 1HW5A 3IWFA 1I1SA 2XAHA 3M8FA 3ZN1A 1Z9CA 1MJAA 2PLYA 4TV7A 2VT3A 1S3JA 1F39A 4KIBA 1YS7A 2VBYA 2GAUA 1UCRA 1LEBA 2KJCA 2NAZA 1IXCA 2P7VB 3L9FA 3HUGA 4RGXA 4K2EA 1YIOA 3FF5A 4MEYF 3TGNA 5ERIA 2GWRA 4MGRA 3M7GA 5E20A 4L5IA 4XBFA 2E1CA 2HTSA 4YFKF 4IXAA 2PJPA 5BS6A 3W6JB 2E1NA 1QZZA 2DFIA 2GXGA 3DV8A 2JPBA 4OINF 3ERED 3W6KB 5DV5A 2QUFA 3O6BB 3T5XA 5DD4A 3LQQA 5KK1A 2XVCA 2GXBA 2K86A 3E6DA 3WTYC 2QWWA 4EGYA 2W84A 1RUNA 4MTEA 2EK5A 1FZPB 3Q9VA 1WSUA 1OKRA 1B9NA 3S04A 1R1VA 1W7PB 1K6OA 1XGOA 2MLKA 3FM5A 4EJUA 4E70A 2ISYA 4RGRA 3VOEA 2EB7A 1FLIA 5LLQA 3LFKA 4M6XA 2DO7A 3JAMZ 5K1YA 4WWCA 2BGCA 2Y75A 1ZARA 1XGMA 1F9NA 4QLCU 4WX9A 2V6CA 4LG0B 2P5KA 3FXRA 2W85A 3V8KA 3T8TA 3GW2A 3TO7A 1HXDA 1Z91A 4UXNA 4EJWA 3HRTA 5DYMA 4MTDA 2COMA 3KFWX 2ZBKA 3WTZA 4CDGA 3I0TA 3WGIA 3K1MA 4OIOF 2IW5A 3CUOA 1TQIA 3U2RA 3I54A 2HKOA 5CVUA 1R22A 4BAYA 3KLOA 2HKXA 4U7BA 1G3WA 3EETA 3F8CA 3LAJA 2ZXJA 4ZYGA 3IRRA 1B1BA 4XSZF 1XCVA 2FNPA 1MJBA 4KNYA 5EEGA 4ESJA 1OMIA 2FRHA 2JRTA 3TDZC 1HSTA 4KMFA 5LRRA 5JVTA 1CF7B 5DD8A 2P6SA 1H0MA 2JZYA 2Q2EA 1KN9A 4MQ9F 1FC3A 3EYIA 2HQNA 2QLZA 3KETA 1R36A 1YS6A 5D5VB 5H6QA 4BXUA 2GA2A 1IN6A 4HX7A 1ZYRF 2OBPA 3F21A 1SFEA 3QPHA 2HYGD 2DPUA 4U0WA 3ROUA 4AWXB 1KGSA 4WXHA 4U7DA 2VOOA 3ZMDA 1KYZA 4GCVA 2V1DA 1FPQA 3J80Z 3F23A 2DPDA 1FYLA 1DP7P 4RGSA 2A5YB
chains in the Genus database with same CATH superfamily
1XMXA 4CH7A 2JVHA 4LJZF 5A2QZ 3HOSA 3GZ5A 4IQ4A 4ZYHA 3OS2A 3R4KA 2XIGA 3WU2C 1HOMA 5TJJA 3A03A 3TQNA 4F91B 5IOZA 4M72A 4Y7NJ 4NNJA 4Q5SF 4M71A 4CCJA 5TISC 1WJFA 2ZCWA 2LY2A 3AAFA 2CW0F 3CC2I 1ETYA 1KCAA 3DTEA 3QPTA 3LNQA 1RNLA 2DA3A 3BG3A 3CCUI 4HSRA 3QU3A 4KJZA 4KITB 2E35A 3TW7A 5LEJA 2K4BA 3ASNH 3WU0A 4A0ZA 5JVGF 4OIQF 3E5QA 3TKYA 3IL2A 1UELB 1U5TB 1STZA 1P9QC 2OZ6A 3VB2A 1XS9A 1R71A 5E1XA 3HRSA 3I5UA 5ILUA 1JUPA 4CO8A 3R61A 3AG3H 1BR4A 4KN4X 1SFUA 1LFPA 3OSGA 1W4MA 1JHHA 1LFBA 2QENA 3FHZA 3KP6A 3AG2H 3L7WA 4A6DA 4B8XA 2VQCA 3L2VA 2EV0A 1AY9A 4P55A 4N4OB 4OMYA 2MW8A 4RM2A 1NTCA 1JUMA 3BQYA 1YOVB 1A6IA 4FE7A 2K7LA 3OYBA 5CYVA 4LB6B 3HGYA 2K9MA 1F36A 3ZMUA 2QF7A 2PQ8A 2OCCH 2A69F 3BG5A 1R23A 4PSWA 3J7ZI 1WI3A 1QQIA 1AOYA 5K5QA 4I0AA 1Z77A 1FX7A 3K9TA 3LSRA 1GT0C 4EV0A 4IL6C 1D5YA 2WWYA 4BACA 2DI3A 3L09A 2AHQA 2Y9YA 3BTIA 3JRBA 1MH4A 1ETWA 1ZR4A 4BY1J 3IH3A 3S17J 2MFZA 2K27A 3VSKA 4BJ5C 1HW1A 3F8FA 4A0YA 4BBSJ 2R7XA 2ZJRF 2FKDA 4RGUA 1U2WA 1LDJA 5E3NA 3V42A 4XLEA 5HVQC 2BYVE 3BZ6A 1IV6A 5B66C 3F72A 4E7IA 5FLMJ 3GBGA 4I6ZA 1T38A 1SANA 3O3KA 3S1MJ 1B9MA 3SQNA 1LQ1A 3LAPA 2QQAA 4NC7A 4EJTA 2IS1A 3BP8A 2XAJA 4JX5A 2JTVA 1FNNA 4ZDPA 5K7ZA 1IJWC 1A04A 3M9AA 4A69C 2ZXHA 1RI7A 3E1SA 4CYCA 3K6GA 4L0YB 4FX0A 1ZRDA 2K9SA 3NARA 1J0RA 1SD4A 4BJTA 3PIPF 3LQRA 3BROA 2EA4A 3ZOBA 3ZMTA 1X3WB 4F52A 3IHUA 4XLAA 4XSXF 3TW6A 2VOPA 2KRHA 1ETOA 5IYBJ 5CJ9A 4BBRJ 1MD0A 2ZC2A 3GTPJ 1UG2A 2P5VA 4GFBA 2V4JC 4IHTA 5E17F 4FISA 1UZCA 3ABKH 2Y69H 4KICA 3L2QA 1IV8A 3BQZA 3LSTA 2WB1N 3F3XA 3ZR8X 4Y15A 5AIPA 1V5FA 4GO1A 1T6SA 3HSFA 4HW0A 2VE9A 1X1BA 4MEXF 4PK4A 3P9KA 3J7YJ 5EG0B 3M07A 1VQNI 1D8JA 3BJ6A 3DLAA 3HSRA 5HLIA 4LGWA 4XRSA 4W97A 2G7HA 4X1EA 4Y33A 2O6GE 2EWNA 1FOXA 3WHCA 3U1KA 3QPLA 1LDDA 2BHYA 4ENKA 1YI2I 1R4MB 4M3EA 3BLYA 4Q48A 4XKVA 4YIFA 2XPUA 5KNLA 3OYIA 1G3TA 3KZIC 3FX3A 3RYRA 3JTGA 3M4OJ 5L3CA 2UXXA 2BVLA 1KYWA 2ESNA 2XAFA 1ON2A 1RKWA 3I59B 3ZQIA 4U0YA 1VQPI 1BL0A 4QPQA 4UVBA 3S8PA 2W57A 2CRGA 2DT7B 3S15J 5GAHJ 2V79A 2AXTC 2L02A 3FKIJ 5E1WA 1NG7A 4HYEA 2OF7A 2E2IJ 2HEOA 3HC7A 4BNCA 2B63J 2IEKA 2IBDA 1OISA 3MQ0A 4HV5A 2K4JA 2HS5A 2JQ7A 1VZ0A 5M5YJ 4LLLA 2O0YA 2FMLA 1LE8B 1LUJB 1LE8A 5J1YA 3GFMA 3PSIA 3DQVC 4L5JA 4Y17A 2DDAA 2X1EA 3AG1H 2JA7J 2LF7A 5FLVA 1QU3A 3BR1A 3UKGA 1B72B 1Z7UA 5CVJA 3FXMA 1B8IA 3VEPA 2JRMA 3EYYA 4Q47A 1GDTA 2BW3A 1PUFA 2R4GA 2LREA 3RQ4A 2ZNZA 1VQ8I 3RCOA 2CYYA 2KQRA 2IGKA 5GADJ 3HOYJ 3AL0C 3OL4A 1ZKGA 3F8BA 2MA3A 2ZMEC 4HQEA 4GYIA 4F93B 1W5SA 5HLHA 3I58A 3DKWA 2DN0A 3C18A 3BR5A 2ZFWA 3HB9A 3FHNA 2VQGA 2CUFA 1VQKI 3NWTA 2CW7A 5LGUA 1IF1A 4HV6A 2R7VA 1ERDA 3T1BA 4B47A 3S2HJ 2JSPA 2Z9OA 2UV1A 5EGOB 4ESBA 2KJBA 2FXAA 3PUFA 4UUSA 3BG9A 1H88C 3V7RA 2Z99A 4B09A 2YU3A 1ENHA 2M1BA 3E5XA 2LNBA 2P7CB 4N31A 1XCBA 1Z05A 4GRIA 2JMWA 1SMYF 1XB4A 4BE1A 3DXJF 1BJZA 2ME0A 3I71A 3MVPA 2VT2A 1HQCA 2KISA 1FJLA 2W25A 1ULYA 4Z6YA 4OIRF 3B73A 3E0JB 1S8NA 4RDUA 2VI6A 2XB0X 3JSPA 1QBJA 2M45A 3MZYA 1HSJA 2HVRA 3R6SA 1XSXA 1ZLKA 1O3RA 2K9NA 3EUHA 4XICA 3SZPA 2P5LC 3TP0A 2YX7A 3QP6A 2NYXA 1DP3A 3L2CA 5BOXA 4A3BJ 3GFLA 2E60A 2RN7A 2H6CA 2L9RA 3HPHA 4PDKA 4XK4A 5CLSA 4OIPF 3LL7A 2XRLA 1WGXA 2E1MC 2FSWA 2M87A 1QVTA 2OPTA 5C44J 1Z7LA 1TW2A 3O2PE 1VNDA 2VONA 3H3VK 4UUSB 3DF8A 2XAUA 3K2AA 2RNJA 2MD5A 4BGDA 1VQLI 3E5UA 4CCOA 5E8GA 2VBXA 2P4WA 5HDKA 1TQPA 2HOAA 2XUBA 5F6FA 3C1DA 3QODA 1W5TA 3CJRB 3HRMA 1FEXA 3FZVA 3CQZJ 1OCTC 3FK7A 2AO9A 2DA6A 2IVMA 3FXQA 5DCMB 5LRSA 3MKYB 1HW2A 1OYYA 2GIZA 1GUUA 1IUYA 2TCTA 3MEXA 5D8KB 1S72I 4XKCA 2V9KA 3QPSA 2WA0A 3GFJA 1BC7C 3K69A 1TWHJ 3OV8A 2DAOA 1G3SA 3ZMVA 1MMSA 2BY3A 2EPFA 3BJAA 3H5AA 1ZLJA 3IP4B 1G8XA 4ITVA 4KIFA 1XGSA 2Z2SB 5HS7A 1ZREA 4CGZA 1IRGA 1UMQA 5DUIA 4KN7X 4LD5A 3PM1A 2CS3A 4UV9A 1F5TA 2QYOA 2K3PA 4QSHA 3CMEI 3N4MA 2VC1A 1QHGA 2MC4A 4PCQA 4ZH4F 5J40A 5J3LA 4BXXJ 2L7FP 1TT5B 2DA4A 3RPUD 3V7SA 1EF4A 2B7EA 1I5ZA 2L9NA 2NS0A 2X6WA 1HDDC 4HA8A 3ZPLA 5K5OA 3MN2A 1JHFA 4V2GA 4U87A 4RBOA 3H35A 4M9ZA 3DP7A 1S7OA 5CVVA 2FUG2 2XF7A 3E6MA 2H09A 2F4OB 4G7ZF 2HVQA 3TO6A 5L3BA 1G6NA 2VB6A 2ECCA 4GDFA 4I0BA 4GXOA 4JX4A 3O8HA 3QYEA 1QHHD 1Z3XA 4A5NA 3M3YJ 2HTJA 1OJLA 4CSWA 2VC0A 4V19K 3RPQA 3FWEA 3SDGA 5HOOA 5FRMA 2VKHA 4F3QA 3FXUA 1U5TA 1D3YA 3AFHA 4Z2YA 1HDPA 3ZRGA 2D1HA 3HIFA 2HDWA 2JSCA 4UHTA 4A3LJ 4LFUA 3RI4A 3R60A 1BM9A 4XM3A 1T8IA 1MSEC 2L5QA 2PMZA 2O3FA 4XQFA 4EQQA 4P96A 4R8HA 4D1QA 5ILSA 1ZELA 2KL4A 5FJ8J 2D2WA 4DZPA 3CJTB 4PJNA 4XLNF 4F55A 3ZCOA 3VDXA 3JRCA 4A3CJ 2BY0A 2IRFG 2JA8J 2ME6A 5K5RA 2PN6A 2IS2A 2ZB9A 2XHKA 1NHAA 2VJJA 2WADA 2JN6A 4MHGA 2A68F 2ECBA 1KQ8A 5E8IA 2P8TA 1Y6IA 2KZVA 3BR3A 3HJEA 3ML6A 1Z21A 4ZC3A 2DQRA 2L54A 2E19A 5HNHA 2RKHA 3E6CC 1CGPA 1ORKA 2M0CA 2AQFA 1IN4A 4AYBA 1A35A 3DTKA 3WGGA 2Z33A 2JVGA 2NVXJ 4RS8A 4P9UA 2UZKA 2JJ7A 2WBMA 3H9JA 3E7LA 2KHMA 1Z1DA 1W7PA 3KP3A 3I55I 5IPAA 4L9TA 4AIHA 3IWZA 1WRJA 2Y0SA 3ASOH 1XPXA 5D5UB 4DNCA 2VJ5A 2R5ZA 1SVLA 3OYLA 1K78B 2GIVA 4WCGA 4LLGF 3SEZA 1HC8A 4ENMA 3DTIA 4S05A 1W0UA 4QPOA 1UHWA 5A2QK 3OOUA 2X48A 3IKVA 3CO6C 1QGPA 5B3SH 4PJ0C 2COBA 1UB9A 2ZMEB 5ICGA 3GTGJ 4IRGA 3MWMA 5JFRA 1B4AA 5B5EC 2ELJA 3HEFA 3SZTA 1FIAA 2F6CA 1HA8A 3K2ZA 4AIDA 3C2GA 2M7AA 1EA3A 3E3VA 4L18B 2K85A 2R3SA 3CLOA 4HX4A 5D5XB 5D6EA 3FMRA 2ZO4A 4PFPA 2NNNA 1DU6A 1S5LC 4ZTJA 4RB1A 4I98B 2VPLA 1WCMJ 2Y9ZA 1YJ9I 1RC9A 4EGZA 2KRFA 5L3GA 1J59A 4RAZA 4ON0A 1D5VA 2MG4A 1Z6TA 1JUSA 3ZXSA 3CTAA 1QRYA 5HODA 1MZBA 2E36A 4LG3A 4YIRX 4MO7A 1MBFA 1Y0UA 4UNOA 1UJ8A 4P5OA 2I10A 3D0SA 4RB2C 3CC7I 4C2MJ 4M74A 1V55H 3CDIA 4XLCA 1VTNC 2JT1A 3FXLA 4UVAA 4A3MJ 5F0HA 2EFNA 5DCFA 2QZ8A 3TBIA 3J81K 1ZRCA 1VFCA 1BIBA 3DU5A 4G6TB 5L3EA 3VYRB 4KDPA 1TWGJ 2MSYA 2LBFB 3GF2A 3IH2A 4BE2A 1S6LA 2K9QA 1XDUA 2FU4A 2FE3A 2W48A 2X6XA 2X6YA 4HF1A 1PDNC 2J5OA 2QSHX 1FIPA 2CG4A 1T7DA 3RZOJ 1ON1A 3QP5A 3F8MA 1WZ2A 1UFMA 3CZ6A 3H5RA 1MSFC 1X2MA 2QCOA 2O8XA 1S29A 1OLTA 1U6GA 2OJED 2M7BA 3FISA 1FY7A 1T56A 1SVOA 1YQAA 1PUEE 2HFHA 4D5CA 4XRMA 2FJ1A 2MH9A 4NQWB 2R7RA 5FFXA 1E2XA 2GQQA 2A5WA 3EDPA 5IYDJ 2W1OA 2AQEA 3HTSB 4A93J 4MFDA 5HS8A 3PNVA 2RV8A 3EUKL 1WPKA 2K3FA 3TOAA 4JK1X 2J5PA 1RETA 2HQ5A 2L7ZA 3MZ8A 4CXFA 5D4SA 4NDLA 3HKZN 1OPCA 2ISZA 2R0QC 1MBEA 1UHSA 2EZKA 4YFNF 5IT9Z 1D0YA 2YX4A 3REOA 1IRFA 4ZZLA 2PFBA 4BHCA 4ZDLA 4EJVA 4ENJA 4KFCA 2CQXA 3WTVC 1BI1A 2FMYA 2MLGA 3WTSC 3N97A 3FMSA 1ACIA 4UB8C 2VODA 3ZMZA 3LSHA 1YE9A 3H1CA 4NB5A 3IUOA 3UR3C 4LB5A 5EF6A 2EBIA 3ZN0A 3KYCB 4XLHA 2PMHA 2DTZA 1SD6A 1V3FA 5BQTA 2E1MB 2R7QA 1KA8A 3KCCA 3ZQGA 2OC6A 4IQJA 2LDUA 3LSJA 1BR2A 4BEHB 5LEKA 3BR0A 2Z3YA 2FOWA 3LFUA 3H9QA 1XMAA 3BY6A 4IRHA 3OMYA 1G4DA 3BT9A 3A0BC 5TRDA 1HCRA 1FBSA 1QPMA 4QTRA 5L3FA 1O7FA 1K83J 3DKYA 2XKOA 4BQNA 5FLXZ 2ID3A 3WE3A 2R7TA 2BXYA 4CCKA 5CQEA 1R1TA 4EJOA 2B9SA 4BHBA 1LVKA 4ZDOA 3DFGA 4G7HF 3NAUA 5J6XA 2DJNA 4XONA 3GX4X 3JRGA 1WI9A 1X4PA 1R6RA 1R58A 4DYRA 2NOJB 4HBLA 4KIGA 2H6BA 4AD9A 2E7WA 2VKDA 1ETVA 4M9XA 2XGXA 2JPCA 1WKMA 3ULQB 1QPIA 3VWBA 1JE8A 3I64A 3HOWJ 3ELKA 4F7ZA 3OYGA 2M34A 3A01B 5EYRA 1DPRA 1FBUA 3CDHA 3GTQJ 5EEAA 2O03A 1T98A 2IA0A 5TGTA 1GXPA 3S1NJ 3ABUA 1ZAOA 1L3LA 3OOPA 1R1UA 2F2EA 4HOBA 2L3DA 3R0JA 3OR2C 3GFIA 5LD2C 2ETHA 3RJPA 1ZGAA 1YFHA 4XOPA 1JKOC 2IA1A 4YG2F 1GHCA 4ABZA 2BY1A 1Q1HA 2CH0A 3FK6A 5JLXA 5CKTA 3PNTA 2CQKA 3DLLF 2YU9J 4AU7A 2M30A 2KP6A 4HQMA 2VN2A 2NNYA 4KMUX 2L2OA 5J8FA 2RAEA 2X85A 3SZGA 4BS9A 4D7NA 3OIOA 1V4RA 1BW6A 5DDGA 4E7SA 4D5FA 3AL0B 1EJ9A 3GZ6A 1TZLA 2ZMEA 1TLHB 3QRFF 4LK1F 2KRCA 4JP0A 5IP9J 2XF5A 1R5HA 3JSOA 2E2JJ 1VQ5I 3ZQ7A 2LKPA 5GAEJ 3G3ZA 4HSTA 1ZHFA 2PJRA 1YW7A 2H1LA 2HOTA 3HUGB 2QBYA 3COAC 1QZYA 4NC6A 2V1UA 2X9DA 4LLNA 5D5WB 3ZP5A 5ICFA 2LF8A 4PUSA 1P4WA 1WJBA 4FTHA 4IHVA 1TQMA 2DW4A 1WJDA 4B3AA 3HHGA 3GTKJ 1JI8A 4WK8F 1GVJA 3WTWC 1FBQA 5HLTA 1ETQA 4ZYEA 4IHYA 4CUGA 1P4XA 4BUPA 4LK0F 5JHUA 4CYDA 4GYGA 3HOXJ 3PFIA 1G59A 2OQGA 3GLXA 3BWGA 3L2WA 1WJCA 3CCJI 2EIKH 4AM3A 2Y0SN 3P9CA 4ZYDA 2R5YB 3MKWB 1LEAA 1IDZA 2IA2A 2OUMA 3WHBA 3LSIA 5FKLA 3J80K 1TTYA 2EILH 4PGGA 1SVMA 1WFXA 5FGMA 4D0PA 4J19A 3HZJA 2QQ9A 1ODDA 2E34A 3DEUA 1Z6RA 3H36A 2MC3A 2M4GA 4I02A 4HNUA 4IKFA 4G8XA 5C4JJ 2HI3A 4NUBA 5F0FA 1VQ4I 1FYKA 3M1CA 1YG2A 1WH5A 5E3OA 4M9SA 2XB5A 3KE2A 3CD6I 3L2RA 3ESWB 1YJWI 3IRQA 2DBBA 2FBHA 1RKTA 3HM5A 2M3AA 2VPRA 4DW6A 2Z16A 4G12A 1YW9A 2L9SA 3DU6A 2OA4A 2FA5A 3ZQFA 3KYDB 4II2A 5D4RA 1UMUA 5ILVA 3OS1A 2LD5A 1YJNI 3BG7A 2LKSA 3K1PA 3S32A 1AKHA 2STWA 1MBGA 1TWFJ 2DA7A 4G6DA 3RIRA 3TP3A 3VYTB 3HYIA 4EMSA 2R7ZJ 1P4AA 1S7AA 2EA2A 4AVPA 3AG4H 3H3UA 2EJRA 1EV7A 4A3GJ 1FP1D 3SHFA 2DLLA 3KEOA 2IGNA 3W2VA 1LNWA 2DT5A 5J8CA 4NHJA 3ABLH 4BE0A 1YLFA 2CQ7A 3CUQC 4A2UA 4G94A 3S1QJ 1VQ9I 4BQQA 3FMQA 2XRNA 2BEOA 3SFZA 5JLWA 3PO3J 2L9VA 1TC3C 2WC2A 4Y4RA 3OL3A 5JI6A 3MKZA 1O3TA 1ZRFA 2AS5F 2PMUA 3FKJA 4A3JJ 9ANTA 4RLFA 4RAYA 4XNFA 4A0XA 2VASA 4A3EJ 3RPUA 4J01A 4C2TA 2R7WA 1U8RA 4OOIA 3OYMA 3OYEA 1J2XA 1GXQA 3B6AA 4FE4A 3AKZA 4CZZA 1AU7A 1I6XA 2Y30A 1ONVA 4BDZA 3HBLA 2RVCA 4HX8A 1D1BA 4U0VA 3V8LA 1C0WA 5KCMA 1R4NB 3IC7A 2V1XA 3F0CA 3BTLA 3NEUA 4IRIA 2LG4A 4AVZA 3RKQA 2HXOA 3U21A 1B6AA 1YW8A 1SMTA 1T2KA 4LOCA 3H0DA 3CMAI 5J1UA 4B4CA 1O3SA 2QKMB 2YUSA 5LBQA 3BC8A 1QNTA 5H20A 3HTUA 2LFBA 5BNGA 2L4MA 4E6KG 2Q8KA 4EM2A 1A5JA 1BI2A 2CW8A 3R0AA 2DOFA 5L3DA 4B44A 1PP8F 6PAXA 2ZFUA 3I56I 3FM3A 2CGPA 3PL8A 1GV5A 3X2QH 2EFOA 1MGTA 3CJNA 4NQWA 5DTDA 3KP7A 1KU3A 2E5ZA 3PIOF 1I4VA 4XMYA 4N0BA 5GPAA 2KZGA 3JRDA 3JRHA 4H4KC 2LTPA 2FQ4A 5FKOA 3F8NA 1OYWA 3G4SI 2M8GX 1IGNA 5CQGA 2O8KA 3UNGC 3HPGA 4E7KA 2DYSH 1SFXA 1PYVA 3BCBA 2MD0A 2F5VA 1T0FC 2D5VA 1MBKA 3ZMSA 1Q1VA 1FWZA 3TO9A 3KEYA 5E79C 3OYJA 2KIUA 2EZHA 1Y8QB 1XG1A 1NG6A 2P6TA 2LY9A 2CUJA 5K7HA 2HGCA 1YRNB 1TBXA 2EV5A 2RNGA 3DEEA 3K70C 3H92A 4FX4A 2FOKA 3M8EA 4L9NA 3DPTA 3C7JA 4XRSG 4IHSA 2CJJA 3GZNB 2VQHA 1J75A 3DCFA 2QBYB 4E7JA 1F1ZA 1KU7A 2H94A 1W7PD 4AYBN 2CV1A 3EQLF 1FOKA 2OZUA 2XAGA 4EM1A 2XAQA 2Y2ZA 2N8GA 1WWXA 1JT6A 3QYFA 2G9WA 1IW7F 4FT8A 1TW3A 1P92A 3CP2A 1XTAA 5FO5A 3L1PA 2XF6A 3F9KA 3Q3SA 3RTRA 4E7LA 1EH6A 2DFEA 5IY5H 1BIAA 1RR8C 1ZTRA 3E6BA 3JW4A 4WF2A 2FJRA 3IKTA 4Y3OA 5KAIC 1IC8A 3KZYA 3BTCA 3RQIA 3S93A 2DMPA 1IN5A 2FEZA 1ITYA 2D45A 5EJCA 4R79A 1MDMB 3IAM2 3QOPA 5GPCA 2MBFA 1K4SA 2ZSHB 3RKWA 5BMZA 2CV2A 1IAWA 3QWLA 3VYSB 2W00A 5BPIA 1XN7A 3FBIB 1N25A 1EH8A 4A3KJ 1QVUA 2WV1A 3OYFA 4CHUA 4IO9F 3O8GA 5FD5A 2VE8A 3K4LA 1JGSA 3CESA 4RB0A 2HU9A 4LG0A 2LRDA 3SEQA 1JT0A 3S1RJ 1XSVA 4I7HA 1E3OC 4M6YA 1Y39A 1JKPC 2DMUA 3BZKA 2A3SA 1POGA 2MABA 3RKXA 3LSMA 4HNVA 2MYSA 2DT6A 1T39A 2GA1A 1IXSB 1R5GA 3K0LA 3I4PA 3IIQA 1FYMA 1PVEA 1XDSA 1IRXA 1BBYA 3GO5A 4BDYA 1LPQA 3DWLE 2Q1ZB 4IHWA 2F4IA 2KT0A 1YO5C 2VLAA 4O5VA 1B59A 3DPLC 4FCYA 2DMNA 2G0EA 4O3MA 4M73A 5F04A 1MMNA 2LH9A 1Y56A 1N78A 2B0LA 4CZCA 1TWAJ 1WJ5A 2W82A 2DFHA 4A12A 3V7CA 1M1EB 2GOXB 4BJ6C 4IJAA 1LDKB 3LA3A 2X4HA 1MJ9A 1SFKA 2DYRH 3WTTC 1T33A 3ZGKA 4M3GA 3K4KA 3CC4I 5F27A 4R1HA 3IV5A 1K79A 3LOCA 4RAGA 2RREA 2TRTA 4ME8A 2MGQA 1JKRC 5LHIA 4BYYA 1MNDA 1J7KA 1F43A 2HOSA 4G7OF 1X1DA 2YSRA 3JRIA 2IAIA 2JK3A 1JKQC 2R7DA 2BZTA 2LSOA 4ZYAA 4LMYA 2OCEA 2WB1A 4PFOA 1T95A 4B1RA 1IUFA 1OR7A 2HDDA 4V2FA 5CPRB 4S04A 1JHEA 4KT5C 4KT6A 5JR3A 1J5YA 3I4NJ 3M8JA 1VQOI 3GTMJ 3Q9SA 4CCLA 2Q2EB 2XKPA 5K7FA 3MZHA 1R7JA 3CCVI 2LBFA 4L0ZB 2L01A 4BHPA 4UVCA 2R7FA 4LIUA 2XV4S 2NVUB 1SAXA 2EFQA 2QA4I 3G1LA 1DUXC 2DA1A 3ECHA 3H3ZA 1HF0A 4JQFA 5HNFA 1DDNA 3PUBA 5F1RA 4RMNA 2CU7A 4L9JA 1TNSA 3K10A 4MLOA 4ESFA 4XOTA 1A6QA 4A3FJ 2O61A 1L0OC 5ED4A 2EFWA 1PP7U 3BOQA 3HOUJ 2XASA 3KP4A 2VBZA 3OYAA 1YRNA 1SAUA 2EQRA 3K70D 1MMAA 2BOLA 4PSXA 4A6EA 2DFFA 2X51A 2L4AA 2GLOA 1OFCX 3VODA 1PJRA 3WODF 3MAJA 2HQRA 4X6AJ 1Y1VJ 4UUVA 4HPQA 1VQ7I 3QOEA 2RQQA 3SDBA 4IHXA 3EUAA 1Z3YA 4KYWA 4L9VA 2OTJI 1NK2P 3I59A 1X19A 5HLGA 1FTTA 2PX9A 1ZG1A 1ZG3A 4BH9A 2O9LA 4MNUA 3MKLA 2PEXA 2M2EA 5DCMA 1BI0A 5KVRA 1XMKA 5D8LB 4WXCA 3P9IA 3CLQA 1YYVA 2LP0A 1O4XA 2NOGA 4DJAA 2AXLA 1MNMC 3BR2A 3FIWA 4JBAA 3HHHA 3CDLA 4GGGA 4N9IA 4FASD 3CCSI 2R5YA 3LWFA 2RC4A 1BN5A 5FFZA 3RDIA 3SYTA 5J1RA 3HGGA 1K61A 2IT0A 3A2KA 2R7SA 4HZFA 2HWVA 3OYHA 3D5SC 2KIMA 3OSFA 3S3MA 3QU6A 2CV0A 3JTHA 4FETA 2A07F 1IRZA 2FQ3A 1ZN2A 2K02A 4AIJA 4OWRB 3VPRA 4ANJA 3C2BA 3KEQA 5HDGA 2ACJA 1QA6A 2STTA 1EH7A 2HO0A 2JUCA 1NK3P 1SD7A 4RA2A 3HSEA 4IOCF 4P9FA 2LYCA 3OIPA 3BJOA 4EVIA 1FT9A 2DODA 4JOMA 1DU0A 2VKVA 2HPIA 3CP8A 4YELA 1ETKA 5HS9A 2KPMA 2XDVA 2F4MB 5F1JA 1O3QA 2O7OA 1XD7A 2WAFA 1V5GA 4HF0A 1KU9A 4JX6A 4Y13A 5DM7F 3FDYA 3OYDA 1DPUA 1MMGA 1P6RA 5LGTA 2C6YA 5AONA 2HVSA 2NRAC 5IT9K 1D1AA 2KLOA 1YX3A 1ZGJA 2RGVA 4CYCB 3HOZJ 1W1WE 5GP9A 1KQ0A 5CVRA 2PG4A 5JHFA 2DK8A 3G1OA 3GTJJ 1CF7A 1AWCA 4BQAA 4HF2A 1X3ZB 1H9GA 1B8IB 4I76A 3J81Z 3BPXA 3M1EA 1W5CC 2V9VA 4I09A 1UHMA 5IYCJ 1TT0A 2OD5A 3NWSA 2M0MA 1HKQA 1OCCH 4G6QA 2F48A 2QKLB 3I9V2 3PQJA 1GVDA 1K4TA 3GYHX 4XL9A 2M8EA 2GM4A 4LIVA 1YIJI 2V6EA 3P5JA 1D1CA 1O7LA 3KP5A 3PFYA 1XX5A 4CA0A 2CUEA 2LKXA 3GEZA 1OCOH 2OU2A 1ZQ3P 2OV7A 4DYQA 2FX0A 3WE2A 3ABTA 4A3IJ 4AIKA 1MBJA 5ICCA 3JRAA 3E97A 4E4HA 1V5EA 3NRVA 3C2HA 2M9HA 1HKSA 1I50J 2VKEA 3S2WA 3OYNA 2QGUA 1DGRM 2IS4A 1USTA 3B6CA 1YTYA 2CO5A 2W24A 2R93J 4KUMA 2QVOA 1K78A 1XC5A 1E0EA 1FMWA 3TOBA 2NXNB 3T0YA 1SC7A 1BR1A 3N05A 1X1CA 2QM3A 4I99C 2EZLA 3CUQA 3A02A 4NC8A 1E3PA 3LMMA 2WV0A 1O57A 2P81A 2QQBA 3ZQLA 5F0CA 2TDXA 1EKEA 3SJMA 1U5TC 4PGHA 2ZJPF 3GMEA 3HRUA 4CICA 4IVNA 3DKXA 3A4CA 3BCAA 4ASNA 2CFXA 2WTEA 3I3LA 2L0KA 1VF9A 1WHUA 2MH2A 2VQLA 3WG7H 2EIMH 2FBKA 2I8DA 5CVIA 2FF4A 3TDUC 3WTUC 1MH3A 3ONQA 3ZQCA 3TL4X 2HYFA 1X1PA 1IN8A 2E7XA 3CO7C 5AIQA 1H89C 2WAQA 2BHZA 1KU2A 2QSFX 1MW7A 1I27A 3G71I 2JWTA 3PO2J 4Q4ZF 4IEJA 1SFOJ 3GUDA 2BV6A 1UAAA 4AUXA 2X6OA 4A5MA 5HDNA 4OAZA 5FLXK 2M5WA 4UV8A 3HXLA 3MCZA 2HNFA 1HKTA 4KA4A 2HZDA 2XGCA 1E17A 2KMUA 1A31A 1GV2A 5FROA 3K7AJ 1MKMA 2LR8A 3HOTA 4HDUA 2EFPA 1JTYA 4DIQA 1J9IA 4PZJA 3WU1B 4N4NB 1F4KA 2V1NA 2FBIA 3CCMI 1LFUP 4B43A 4XLPF 1RESA 3D5RC 4C30A 4HDVA 4L5EA 4I01A 2R92J 2Q0OA 4YFXF 3D5LA 3PSFA 2Z1DA 1J09A 1S7EA 5DEQA 5B1AH 4BY7J 2W4SA 3JRFA 2RQPA 2VXZA 1T0FA 4G9YA 1FP2A 2XPVA 5LHHA 1NH3A 3S14J 1K7AA 3QYBA 3J7AO 1MDMA 4ENNA 3BDDA 2CWEA 2G7UA 2IGOA 5D6FA 1FTZA 1SD5A 2PMZN 2CQNA 1ZH5A 4CCNA 2RDPA 2ZKZA 4IPAA 3G73A 3DBRB 2IJLA 1QO0D 5FB2A 1LB2A 1AKHB 1WH7A 1IZ1A 1FMVA 2ELHA 4OMZA 4XKWA 3SXYA 4H0EA 1B72A 3GWZA 1MIJA 1X3UA 3P7NA 1IDYA 2HDCA 3GTOJ 3I53A 3TMOA 1JJ8C 1FOYA 2CQQA 1VQMI 1P2FA 2YR2A 1IN7A 2DJIA 1OR7C 3GXOA 5DS9A 4XRFA 3OIQA 3Q0UA 4N9HA 2JA2A 4MFEA 5J47A 2LOOA 2HXIA 3KX2A 1XGNA 1LVAA 2BY2A 1W36D 1W36C 5IT3A 3T8RA 3JAMK 1Z67A 2EV6A 3B02A 1USSA 5M3MJ 4B48A 2E1OA 1U8BA 3A0HC 5BPDA 4C3JJ 4HRIA 3RYPA 1G3YA 1U3EM 3NQOA 2UWMA 4M6VA 2ID6A 1YITI 2F5DA 5ICEA 1REPC 2ZXIA 2L7KA 2XC7A 3F6VA 2ZXWH 3ISPA 5E3LA 2ZJ2A 4FHTA 2VL8A 4DOZA 1JGGA 2K5CA 2X0LA 1H8AC 3VFZA 2NVQJ 1R49A 3G1MA 5FD6A 2BE5F 2IP2A 3LA7A 2CSOA 4DZJA 3SFIA 1FSHA 4Y52J 2X1CA 2A61A 2OQRA 3L00A 3I4MJ 4YIIA 3KLNA 4S0HB 2KKOA 5LHGA 1VI0A 4EM0B 1LJ9A 2XGEA 1I39A 2Y0MA 3CCQI 4RB3C 3OYCA 2GZWA 1OCZH 3Q0WA 1AHDP 2NVYJ 3K1NA 4DGWB 4HLYA 1FOWA 2DU9A 3DBLB 5KAFC 3CUQB 5E3MA 2H27A 1R00A 2OAZA 4YEJA 2KDOA 4DQ2A 1H9TA 1D8KA 5EEHA 2KIFA 4IF4A 4CCMA 4NV4A 3KZZA 3F6OA 4C3IJ 4DBQA 3W6VA 4W1UA 3G6EI 4XN3A 4J00A 1WQ2A 3HG9A 1U78A 2NS8A 1I3QJ 2HZTA 3BPVA 4OU0A 5EZGA 3LSPA 3KYLA 2E2HJ 4I2OA 5C3EJ 2EIJH 4HLXA 3V8JA 4ETSA 1TL8A 1IO2A 5F64A 3LA2A 3U1DA 1HBXG 4U88A 2ADUA 3WTXC 5E18F 4X0GA 5M5WJ 1QZEA 2BBYA 2F5EA 2H8RA 1RIOH 2E5NA 1I6HJ 2VBWA 1RUOA 5B1BH 3H9GA 5FKMA 3RKYA 1JHCA 3DBHB 3WGHA 1D0ZA 5GTIC 3W2AA 4D7MA 1U9NA 2DA5A 2EH3A 2GBYA 1ZG5A 3GVAA 4QWQA 5DUKA 2HOEA 3GLLA 2H8WA 2LY1A 3WG9A 5IP6A 2JA5J 2FD5A 3C3WA 2PBIA 4C9YA 1JTXA 2XPWA 1BJAA 2DA2A 5H6RA 2JUGA 1VQ6I 2Y31A 4E7ZA 1FSEA 3KP2A 4M3FA 2DK5A 1I1GA 4WXDA 2DQLA 2DXIA 4QIWN 2DTRA 2F5FA 4A3DJ 1GLNA 1W0TA 2HR3A 2Y48A 1S9HA 3S3NA 2BW3B 2CMPA 1PUFB 2DDBA 2A6HF 1BI3A 3Q5FA 2NS7A 2R5ZB 1B12A 3RSNA 3VYUB 1OYIA 5E1ZB 1IXRC 1RZ4A 2A6EF 1BC8C 2FNAA 3CMMA 3PQKA 4UB6C 4UY8I 3A1YA 1JXSA 1K6YA 2ESHA 4O6JA 3F22A 1YX5A 3U9GA 3CCLI 1TNTA 2XROA 1Y1WJ 1DGWY 2D1VA 5FKKA 3KIOA 4F92B 1R9TJ 2ZNYA 3MFKA 2K9LA 2Z5UA 1ZR2A 3ECOA 4ZZDA 5EDNA 4FQGA 2IPQX 5LGNA 2IS6A 4MQVA 3BDNA 1XSDA 4K8WA 3V4GA 1MMDA 2DMQA 3H0GJ 3OY9A 2F5CA 2UXNA 4HAMA 1T08B 3QAHA 2IGMA 3ABMH 2PI0A 1KQ9A 3PNYA 2XSJC 1RRJA 3K4BA 2YPRA 1BOAA 4PJLA 4IX7A 1HW5A 3IWFA 1I1SA 2XAHA 2GXAA 3M8FA 3HDDA 5M5XJ 3ZN1A 1Z9CA 1KZHA 1MJAA 2LVSA 2PLYA 4B3XA 4TV7A 3OYKA 2L7MP 2VT3A 1S3JA 4MIMA 3K4NA 1F39A 2K40A 1X2NA 3BR6A 2JA6J 4YRVA 4KIBA 4ZTFA 1YS7A 2OTLI 2WY7Q 3LSKA 2VBYA 3IAS2 2GAUA 3EPZA 3G2BA 1RPWA 1UCRA 1LEBA 1DQUA 2KJCA 3DEWA 2NAZA 1IXCA 2P7VB 2LK2A 3L9FA 5FKNA 3HUGA 4RGXA 4K2EA 1YIOA 2LC2A 3FF5A 4MEYF 5J4YA 3TGNA 5ERIA 2BVMA 2O5RA 2GWRA 5DM6F 4MGRA 3CJQB 2ZSIB 3M7GA 2HPMA 5E20A 4C3HJ 2LMDA 3OS0A 4C2UA 3FXKA 2M4KA 3JCUC 3IH4A 3A01A 4L5IA 4XBFA 1ZK8A 2E1CA 2QEXI 2HTSA 4YFKF 3KPHA 4HG2A 4IXAA 3DPUA 2PJPA 2VJIA 5BS6A 3W3CA 4IOAF 5GTHC 4M3DA 2E1NA 3W6JB 2VJ4A 3FXOA 2A6TA 4KISA 1QZZA 5LFAA 2DFIA 2XSDC 2DCEA 3MMYB 2GXGA 4JYKA 3DV8A 2JPBA 3ZQQA 4DYCA 4OINF 2IXSA 2CUZA 4DBRA 3ERED 3W6KB 4BL0B 5DV5A 5KHDA 2QUFA 4BU2A 3O6BB 3T5XA 4RM3A 2EZIA 5DD4A 3LQQA 5KK1A 2XVCA 2V9PA 3K4CA 2GXBA 2K86A 4D9JA 3E6DA 2QWWA 3WTYC 1HLVA 3ERMA 3W2WA 4EGYA 2W84A 1RUNA 4MTEA 3L2UA 1E3HA 1P7IA 2P0WA 1JJ6C 4XN0A 4UUTA 2EK5A 1RR7A 4BEHA 1FZPB 5EZHA 3VSLA 3BZCA 3ZQHA 1TWCJ 3Q9VA 2ICWG 2V7FA 2WY8Q 3JREA 1WSUA 1OKRA 1B9NA 3S04A 3BTJA 3LSGA 3QQAA 1ZGWA 1R1VA 1W7PB 5EG0A 3S2DJ 1K6OA 2HNHA 1XGOA 2MLKA 3FM5A 1OCRH 3EUHC 4EJUA 4E70A 2ISYA 4RGRA 3VOEA 4NBQA 1BA5A 4LITA 4AC0A 2EB7A 1FLIA 5LLQA 1MNEA 3LFKA 1U0JA 4M6XA 4HEA2 2DO7A 5IOYA 1CQTA 2H1KA 3HKZA 4P1WA 1OCPA 1LKXA 3JAMZ 1V54H 5K1YA 3TEDA 4WWCA 2R7OA 5C4XJ 2BGCA 2Y75A 5GAGJ 3D1NI 1ZARA 4E7HA 4M3BA 1BOBA 5EGOA 1XGMA 3GCMA 1F9NA 4QLCU 2DOEA 4RAFA 4WX9A 4IZZA 2V6CA 1UG0A 3CCEI 4LG0B 1KONA 2P5KA 5FRNA 3OWTA 2DMTA 4XR6A 2HQAA 2XGDA 3FXRA 2GOMA 2W85A 1APLC 3V8KA 3T8TA 3GW2A 3TO7A 1R5ID 1HXDA 1Z91A 4RLQA 4XIDA 1WJAA 1ETXA 2E71A 2DOAA 5H2FC 2ZJQF 4PJMA 3J7AY 4UXNA 4EJWA 3HRTA 5DYMA 1D0XA 4MTDA 3OR1C 2COMA 3CCYA 3KFWX 2ZBKA 3FXJA 1Y0NA 1N77A 1MBHA 3BG6A 3WTZA 4CDGA 3I0TA 5J4VA 1X58A 3WGIA 4BKXA 3CF5F 3K1MA 4OIOF 2UUZA 2IW5A 3HOVJ 2PJRB 3CUOA 2A05A 1X4OA 1TQIA 1WVRA 2KFDA 5F08A 1U9OA 3U2RA 3I54A 2HKOA 2VXDA 2WAEA 5CVUA 1R22A 4EEFG 4BAYA 2QSGX 2LLKA 3KLOA 2HKXA 4U7BA 1G3WA 3EETA 3S16J 2R7UA 3F8CA 3LAJA 2ZXJA 4ZYGA 3IRRA 1B1BA 4XSZF 1XCVA 2X1DA 2FNPA 3K4MA 3PJRA 4BQOA 1MJBA 4KNYA 5EEGA 2EINH 4ESJA 1AA7A 1OMIA 3JR9A 2FRHA 1SEUA 1X1AA 2YS9A 2W7NA 3CF2A 2JRTA 3TDZC 1HSTA 4KMFA 4XLFA 5LRRA 5JVTA 1CF7B 5DD8A 2P6SA 3CCRI 3MD2A 1H0MA 2JZYA 1A36A 2Q2EA 1Y8RB 1G2HA 1KN9A 4MQ9F 3FBNB 2CFOA 4EATA 1FC3A 5IP7J 1YHQI 3EYIA 3H5NA 2VIXA 1BW5A 3HL2A 2HQNA 2QLZA 4OAYA 1N75A 4HNTA 3S3OA 3CMYA 3KETA 3Q0VA 1R36A 1YS6A 4XKBA 2V26A 5D5VB 5H6QA 3K4JA 1TP4A 4PJJA 2GA2A 1IN6A 4HX7A 1ZYRF 4BXUA 2WAQN 4ZJZA 2VUMJ 2OBPA 3F21A 1SFEA 3QPHA 2HYGD 2DPUA 1IG7A 2HYJA 2ELKA 4XORA 4U0WA 3ROUA 4AWXB 1KGSA 4WXHA 4U7DA 3GTLJ 4BXFA 2VOOA 2BXZA 2I5UA 4II3A 3ZMDA 1KYZA 4GCVA 2NVTJ 1P7JA 5M3FJ 1Z0XA 2V1DA 3RZDJ 1FPQA 2KIQA 2KDZA 3J80Z 1I3AA 3F23A 2QQ8A 2DPDA 1OQYA 1FYLA 1DP7P 4RGSA 1WJEA 2A5YB
chains in the Genus database with same CATH topology
4LJZF 5A2QZ 3HOSA 3GZ5A 4ZYHA 3R4KA 2XIGA 5TJJA 3TQNA 4M72A 4Q5SF 4M71A 2ZCWA 3AAFA 2CW0F 1KCAA 3QPTA 1RNLA 3QU3A 5LEJA 2K4BA 3WU0A 4A0ZA 4OIQF 3E5QA 3TKYA 3IL2A 1U5TB 1STZA 2OZ6A 3VB2A 5E1XA 3HRSA 3I5UA 5ILUA 4CO8A 3R61A 4KN4X 1SFUA 1W4MA 1JHHA 2QENA 3FHZA 3KP6A 3L7WA 4A6DA 4B8XA 2EV0A 1AY9A 4P55A 4OMYA 2K7LA 5CYVA 4LB6B 3ZMUA 2PQ8A 1AOYA 2A69F 1R23A 1QQIA 5K5QA 4I0AA 1FX7A 3K9TA 4EV0A 2WWYA 2DI3A 3L09A 2K27A 1HW1A 3F8FA 4A0YA 2FKDA 4RGUA 1U2WA 1LDJA 5HVQC 2BYVE 3BZ6A 3F72A 1T38A 3O3KA 1B9MA 3SQNA 1LQ1A 3LAPA 2QQAA 4EJTA 3BP8A 2XAJA 2JTVA 1FNNA 1A04A 3M9AA 1RI7A 4L0YB 4FX0A 1ZRDA 1J0RA 1SD4A 3LQRA 3BROA 2EA4A 3ZMTA 3IHUA 4XSXF 2VOPA 5CJ9A 1MD0A 2P5VA 5E17F 4IHTA 4KICA 3LSTA 3F3XA 4Y15A 5AIPA 4GO1A 1T6SA 3HSFA 4HW0A 2VE9A 4MEXF 3P9KA 1D8JA 3BJ6A 3HSRA 5HLIA 4LGWA 2G7HA 2O6GE 2EWNA 1LDDA 4ENKA 4Q48A 4YIFA 1G3TA 3FX3A 3RYRA 3JTGA 5L3CA 2UXXA 1KYWA 2ESNA 2XAFA 1ON2A 4U0YA 3I59B 4UVBA 2W57A 2V79A 2HEOA 2L02A 5E1WA 4HYEA 4BNCA 3MQ0A 4HV5A 2K4JA 2HS5A 4LLLA 2O0YA 2FMLA 3GFMA 3DQVC 4L5JA 4Y17A 2LF7A 1Z7UA 5CVJA 3VEPA 3EYYA 4Q47A 2ZNZA 2CYYA 3F8BA 2MA3A 4HQEA 4GYIA 1W5SA 5HLHA 3I58A 3DKWA 3C18A 2ZFWA 5LGUA 1IF1A 4HV6A 3T1BA 2Z9OA 4ESBA 2KJBA 2FXAA 3V7RA 2Z99A 4B09A 2YU3A 2M1BA 3E5XA 2LNBA 2P7CB 4N31A 1XCBA 1Z05A 1SMYF 1XB4A 3DXJF 3I71A 2VT2A 1HQCA 2W25A 1ULYA 4OIRF 3B73A 1S8NA 1QBJA 3JSPA 2M45A 3MZYA 1HSJA 3R6SA 1XSXA 1ZLKA 1O3RA 3EUHA 3SZPA 2P5LC 2YX7A 3QP6A 2NYXA 3L2CA 5BOXA 3GFLA 2RN7A 2H6CA 4PDKA 5CLSA 4OIPF 2FSWA 2M87A 1TW2A 3O2PE 2VONA 3DF8A 2RNJA 2MD5A 3E5UA 5E8GA 2VBXA 2P4WA 5HDKA 1TQPA 2XUBA 5F6FA 3C1DA 1W5TA 3HRMA 3FZVA 2IVMA 3FXQA 5DCMB 5LRSA 1HW2A 1OYYA 1IUYA 3MEXA 5D8KB 3GFJA 1BC7C 3K69A 3OV8A 3ZMVA 2DAOA 1G3SA 3BJAA 1ZLJA 4CGZA 4KIFA 1XGSA 5HS7A 1ZREA 1IRGA 5DUIA 4KN7X 4LD5A 4UV9A 1F5TA 2QYOA 3N4MA 2VC1A 4PCQA 4ZH4F 3V7SA 1I5ZA 2NS0A 4HA8A 3ZPLA 5K5OA 1JHFA 4M9ZA 3DP7A 1S7OA 5CVVA 3E6MA 2H09A 4G7ZF 3TO6A 5L3BA 1G6NA 4I0BA 4GXOA 4A5NA 2HTJA 2VC0A 3RPQA 3FWEA 5HOOA 3FXUA 1U5TA 1D3YA 4Z2YA 2D1HA 3HIFA 2JSCA 4UHTA 4LFUA 3RI4A 3R60A 1BM9A 2O3FA 4EQQA 4P96A 4R8HA 5ILSA 2D2WA 4XLNF 2IRFG 5K5RA 2PN6A 2XHKA 1NHAA 4MHGA 2A68F 1KQ8A 5E8IA 2P8TA 3ML6A 2DQRA 2L54A 2RKHA 3E6CC 1CGPA 1IN4A 3WGGA 2Z33A 4RS8A 4P9UA 2UZKA 1Z1DA 1W7PA 3KP3A 4L9TA 4AIHA 3IWZA 1WRJA 5D5UB 4DNCA 1K78B 2GIVA 4WCGA 4LLGF 4ENMA 4S05A 1UHWA 5A2QK 3IKVA 3CO6C 1QGPA 1UB9A 2ZMEB 5ICGA 4IRGA 3MWMA 5JFRA 1B4AA 3SZTA 3K2ZA 3E3VA 4L18B 2R3SA 3CLOA 4HX4A 5D5XB 5D6EA 3FMRA 2ZO4A 2NNNA 4RB1A 4I98B 4EGZA 2KRFA 5L3GA 1J59A 4RAZA 4ON0A 1D5VA 1Z6TA 3CTAA 1MZBA 1Y0UA 4UNOA 4P5OA 3D0SA 4RB2C 4M74A 1VTNC 2JT1A 4UVAA 2EFNA 5DCFA 2QZ8A 3J81K 1ZRCA 1BIBA 5L3EA 4KDPA 3GF2A 1S6LA 1XDUA 2FU4A 2FE3A 4HF1A 1PDNC 2J5OA 2CG4A 1T7DA 1ON1A 3QP5A 3F8MA 1UFMA 2O8XA 1S29A 1U6GA 1FY7A 1YQAA 1PUEE 2HFHA 2MH9A 5FFXA 1E2XA 2GQQA 3EDPA 3HTSB 5HS8A 2RV8A 3TOAA 4JK1X 2J5PA 4CXFA 5D4SA 1OPCA 2ISZA 4YFNF 5IT9Z 2YX4A 3REOA 1IRFA 4ZZLA 2PFBA 4BHCA 4KFCA 4EJVA 4ENJA 3WTVC 1BI1A 2FMYA 2MLGA 3WTSC 3N97A 3FMSA 2VODA 3ZMZA 4NB5A 4LB5A 3ZN0A 2PMHA 1SD6A 1V3FA 5BQTA 1KA8A 3KCCA 2LDUA 5LEKA 2Z3YA 1XMAA 3BY6A 4IRHA 1G4DA 5TRDA 1FBSA 1QPMA 5L3FA 1O7FA 2XKOA 5FLXZ 3WE3A 1R1TA 4EJOA 4BHBA 3DFGA 4G7HF 5J6XA 3GX4X 1WI9A 1R58A 4HBLA 4KIGA 2H6BA 4AD9A 2E7WA 4M9XA 2XGXA 2JPCA 1WKMA 3ULQB 1JE8A 3I64A 3ELKA 4F7ZA 1DPRA 1FBUA 3CDHA 2O03A 1T98A 2IA0A 1GXPA 3ABUA 1ZAOA 1L3LA 3OOPA 1R1UA 2F2EA 4HOBA 2L3DA 3R0JA 3GFIA 2ETHA 3RJPA 1ZGAA 1YFHA 2IA1A 4YG2F 1GHCA 1Q1HA 2CQKA 2M30A 4HQMA 2VN2A 2NNYA 4KMUX 5J8FA 1V4RA 5DDGA 3GZ6A 3QRFF 2ZMEA 1TLHB 4LK1F 1R5HA 3JSOA 3ZQ7A 2LKPA 3G3ZA 1ZHFA 1YW7A 2QBYA 3COAC 1QZYA 2V1UA 4LLNA 5D5WB 3ZP5A 5ICFA 2LF8A 1P4WA 1TQMA 2DW4A 3HHGA 4WK8F 1GVJA 3WTWC 1FBQA 4ZYEA 1P4XA 5JHUA 4LK0F 4CYDA 4GYGA 3PFIA 2OQGA 3GLXA 3BWGA 3P9CA 4ZYDA 1LEAA 2IA2A 3J80K 1TTYA 4PGGA 5FGMA 4D0PA 2QQ9A 1ODDA 3DEUA 1Z6RA 2MC3A 4I02A 4G8XA 1FYKA 1YG2A 4M9SA 3KE2A 3IRQA 2DBBA 2FBHA 1YW9A 2OA4A 2FA5A 1UMUA 5D4RA 5ILVA 3K1PA 2STWA 4G6DA 3RIRA 3HYIA 4EMSA 1P4AA 1S7AA 2EA2A 4AVPA 3H3UA 2EJRA 1EV7A 1FP1D 3SHFA 2DLLA 3KEOA 1LNWA 2DT5A 5J8CA 4NHJA 1YLFA 3CUQC 4A2UA 4G94A 3FMQA 2XRNA 2BEOA 3SFZA 2WC2A 5JI6A 1O3TA 1ZRFA 2AS5F 2PMUA 4RAYA 4A0XA 3RPUA 1U8RA 4OOIA 1J2XA 1GXQA 4CZZA 1I6XA 1ONVA 2RVCA 4HX8A 4U0VA 3V8LA 1C0WA 3IC7A 2V1XA 3NEUA 4IRIA 1B6AA 1YW8A 1SMTA 1T2KA 1O3SA 5LBQA 5H20A 1QNTA 3HTUA 2L4MA 2Q8KA 4EM2A 1BI2A 3R0AA 5L3DA 1PP8F 6PAXA 3FM3A 2CGPA 2EFOA 1MGTA 3CJNA 4NQWA 3KP7A 1KU3A 1I4VA 4N0BA 3F8NA 1OYWA 1SFXA 3ZMSA 1FWZA 3TO9A 2KIUA 2P6TA 2HGCA 1TBXA 2EV5A 3H92A 4FX4A 2FOKA 3M8EA 4L9NA 3C7JA 3DPTA 4IHSA 1J75A 2QBYB 1F1ZA 1KU7A 2H94A 1W7PD 3EQLF 1FOKA 2OZUA 2XAGA 4EM1A 2XAQA 1WWXA 2G9WA 1IW7F 4FT8A 1TW3A 1P92A 5FO5A 3RTRA 1EH6A 1BIAA 3E6BA 3JW4A 4WF2A 2FJRA 3IKTA 3KZYA 1IN5A 2FEZA 2D45A 4R79A 1MDMB 3QOPA 2MBFA 3RKWA 5BMZA 1IAWA 5BPIA 1XN7A 1EH8A 4CHUA 5FD5A 2VE8A 1JGSA 4RB0A 4LG0A 1XSVA 4I7HA 4M6YA 2A3SA 3RKXA 1T39A 2GA1A 1IXSB 1R5GA 3K0LA 3I4PA 3IIQA 1FYMA 1XDSA 3GO5A 1BBYA 1YO5C 4O5VA 1B59A 3DPLC 4O3MA 4M73A 2B0LA 4A12A 3V7CA 4IJAA 1LDKB 3LA3A 2X4HA 1MJ9A 3WTTC 4R1HA 1K79A 4ME8A 5LHIA 4BYYA 1J7KA 4G7OF 2YSRA 2R7DA 2LSOA 4LMYA 1OR7A 4S04A 1JHEA 4KT5C 5JR3A 1J5YA 3Q9SA 2XKPA 3MZHA 1R7JA 4L0ZB 2L01A 4BHPA 4UVCA 2R7FA 2XV4S 1SAXA 2EFQA 1DUXC 3ECHA 3H3ZA 4JQFA 1DDNA 5F1RA 4L9JA 1TNSA 4ESFA 2O61A 1L0OC 5ED4A 2EFWA 1PP7U 3BOQA 2XASA 3KP4A 2VBZA 4A6EA 2L4AA 3VODA 3WODF 3MAJA 2HQRA 4UUVA 4KYWA 4L9VA 3I59A 5HLGA 1ZG1A 1ZG3A 4BH9A 4MNUA 2PEXA 5DCMA 1BI0A 5KVRA 1XMKA 5D8LB 4WXCA 3P9IA 1YYVA 2AXLA 4JBAA 3HHHA 4N9IA 4GGGA 3LWFA 2RC4A 1BN5A 5FFZA 3RDIA 2IT0A 4HZFA 2HWVA 2KIMA 3QU6A 3JTHA 2A07F 2FQ3A 1ZN2A 2K02A 4AIJA 3KEQA 5HDGA 2ACJA 2STTA 1EH7A 2HO0A 1SD7A 3HSEA 4P9FA 3BJOA 4EVIA 1FT9A 5HS9A 1O3QA 1XD7A 4HF0A 1KU9A 4Y13A 1DPUA 5LGTA 1P6RA 2C6YA 5AONA 2NRAC 5IT9K 2RGVA 1ZGJA 1KQ0A 5CVRA 2PG4A 2DK8A 1CF7A 1AWCA 4BQAA 4HF2A 1H9GA 3J81Z 3BPXA 3M1EA 2V9VA 4I09A 1UHMA 2OD5A 1HKQA 4G6QA 3PQJA 3GYHX 2M8EA 1O7LA 3KP5A 3GEZA 2OU2A 3WE2A 3ABTA 4AIKA 5ICCA 3E97A 3NRVA 1HKSA 3S2WA 1USTA 1YTYA 2CO5A 2W24A 4KUMA 2QVOA 1K78A 3TOBA 3T0YA 2QM3A 3CUQA 2WV0A 1O57A 2QQBA 2TDXA 1U5TC 4PGHA 3HRUA 4CICA 4IVNA 4ASNA 2CFXA 2WTEA 2MH2A 2FBKA 5CVIA 2FF4A 3TDUC 3WTUC 2HYFA 1IN8A 2E7XA 3CO7C 5AIQA 1KU2A 1I27A 4Q4ZF 3GUDA 2BV6A 4A5MA 5HDNA 5FLXK 2M5WA 4UV8A 2HNFA 3MCZA 1HKTA 4KA4A 1E17A 1MKMA 3HOTA 4HDUA 2EFPA 1J9IA 4PZJA 3WU1B 1F4KA 2FBIA 4XLPF 4HDVA 4I01A 2Q0OA 4YFXF 3D5LA 5DEQA 2RQPA 2VXZA 1T0FA 4G9YA 1FP2A 5LHHA 1K7AA 3J7AO 1MDMA 4ENNA 3BDDA 2CWEA 2G7UA 5D6FA 1SD5A 1ZH5A 2RDPA 2ZKZA 4IPAA 3G73A 2IJLA 1QO0D 5FB2A 1LB2A 1IZ1A 2ELHA 4OMZA 3SXYA 4H0EA 3GWZA 1X3UA 3P7NA 2HDCA 3I53A 1P2FA 2YR2A 1IN7A 3GXOA 4XRFA 4N9HA 1XGNA 1LVAA 5IT3A 3T8RA 3JAMK 2EV6A 3B02A 1USSA 5BPDA 3RYPA 1G3YA 1U3EM 3NQOA 2UWMA 2F5DA 5ICEA 1REPC 3F6VA 3ISPA 2ZJ2A 4FHTA 2X0LA 3VFZA 5FD6A 2BE5F 2IP2A 3LA7A 2CSOA 1FSHA 2A61A 2OQRA 3L00A 4YIIA 3KLNA 5LHGA 2KKOA 4EM0B 1LJ9A 2Y0MA 4RB3C 2GZWA 3K1NA 4HLYA 2DU9A 3CUQB 2H27A 1R00A 2OAZA 4DQ2A 1H9TA 1D8KA 5EEHA 2KIFA 4IF4A 4NV4A 3KZZA 3F6OA 1WQ2A 1U78A 2HZTA 3BPVA 4OU0A 4I2OA 4HLXA 3V8JA 4ETSA 5F64A 3LA2A 3U1DA 1HBXG 4U88A 2ADUA 3WTXC 5E18F 2BBYA 2F5EA 1RIOH 2VBWA 1RUOA 3RKYA 1JHCA 3WGHA 1ZG5A 3GVAA 4QWQA 5DUKA 2HOEA 3WG9A 3C3WA 2PBIA 1BJAA 5H6RA 1FSEA 3KP2A 2DK5A 1I1GA 4WXDA 2DQLA 2DTRA 2F5FA 2HR3A 2Y48A 2A6HF 1BI3A 3Q5FA 1B12A 1OYIA 5E1ZB 1IXRC 1RZ4A 2A6EF 1BC8C 2FNAA 3PQKA 1JXSA 4O6JA 2ESHA 3F22A 3U9GA 1TNTA 2XROA 2D1VA 2ZNYA 3MFKA 2Z5UA 3ECOA 4ZZDA 2IPQX 5LGNA 4MQVA 3BDNA 1XSDA 4K8WA 3V4GA 2F5CA 2UXNA 4HAMA 3QAHA 2PI0A 1KQ9A 2YPRA 1BOAA 1HW5A 3IWFA 1I1SA 2XAHA 3M8FA 3ZN1A 1Z9CA 1MJAA 2PLYA 4TV7A 2VT3A 1S3JA 1F39A 4KIBA 1YS7A 2VBYA 2GAUA 1UCRA 1LEBA 2KJCA 2NAZA 1IXCA 2P7VB 3L9FA 3HUGA 4RGXA 4K2EA 1YIOA 3FF5A 4MEYF 3TGNA 5ERIA 2GWRA 4MGRA 3M7GA 5E20A 4L5IA 4XBFA 2E1CA 2HTSA 4YFKF 4IXAA 2PJPA 5BS6A 3W6JB 2E1NA 1QZZA 2DFIA 2GXGA 3DV8A 2JPBA 4OINF 3ERED 3W6KB 5DV5A 2QUFA 3O6BB 3T5XA 5DD4A 3LQQA 5KK1A 2XVCA 2GXBA 2K86A 3E6DA 3WTYC 2QWWA 4EGYA 2W84A 1RUNA 4MTEA 2EK5A 1FZPB 3Q9VA 1WSUA 1OKRA 1B9NA 3S04A 1R1VA 1W7PB 1K6OA 1XGOA 2MLKA 3FM5A 4EJUA 4E70A 2ISYA 4RGRA 3VOEA 2EB7A 1FLIA 5LLQA 3LFKA 4M6XA 2DO7A 3JAMZ 5K1YA 4WWCA 2BGCA 2Y75A 1ZARA 1XGMA 1F9NA 4QLCU 4WX9A 2V6CA 4LG0B 2P5KA 3FXRA 2W85A 3V8KA 3T8TA 3GW2A 3TO7A 1HXDA 1Z91A 4UXNA 4EJWA 3HRTA 5DYMA 4MTDA 2COMA 3KFWX 2ZBKA 3WTZA 4CDGA 3I0TA 3WGIA 3K1MA 4OIOF 2IW5A 3CUOA 1TQIA 3U2RA 3I54A 2HKOA 5CVUA 1R22A 4BAYA 3KLOA 2HKXA 4U7BA 1G3WA 3EETA 3F8CA 3LAJA 2ZXJA 4ZYGA 3IRRA 1B1BA 4XSZF 1XCVA 2FNPA 1MJBA 4KNYA 5EEGA 4ESJA 1OMIA 2FRHA 2JRTA 3TDZC 1HSTA 4KMFA 5LRRA 5JVTA 1CF7B 5DD8A 2P6SA 1H0MA 2JZYA 2Q2EA 1KN9A 4MQ9F 1FC3A 3EYIA 2HQNA 2QLZA 3KETA 1R36A 1YS6A 5D5VB 5H6QA 4BXUA 2GA2A 1IN6A 4HX7A 1ZYRF 2OBPA 3F21A 1SFEA 3QPHA 2HYGD 2DPUA 4U0WA 3ROUA 4AWXB 1KGSA 4WXHA 4U7DA 2VOOA 3ZMDA 1KYZA 4GCVA 2V1DA 1FPQA 3J80Z 3F23A 2DPDA 1FYLA 1DP7P 4RGSA 2A5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJZ F;  5A2Q Z;  3HOS A;  3GZ5 A;  4ZYH A;  3R4K A;  2XIG A;  5TJJ A;  3TQN A;  4M72 A;  4Q5S F;  4M71 A;  2ZCW A;  3AAF A;  2CW0 F;  1KCA A;  3QPT A;  1RNL A;  3QU3 A;  5LEJ A;  2K4B A;  3WU0 A;  4A0Z A;  4OIQ F;  3E5Q A;  3TKY A;  3IL2 A;  1U5T B;  1STZ A;  2OZ6 A;  3VB2 A;  5E1X A;  3HRS A;  3I5U A;  5ILU A;  4CO8 A;  3R61 A;  4KN4 X;  1SFU A;  1W4M A;  1JHH A;  2QEN A;  3FHZ A;  3KP6 A;  3L7W A;  4A6D A;  4B8X A;  2EV0 A;  1AY9 A;  4P55 A;  4OMY A;  2K7L A;  5CYV A;  4LB6 B;  3ZMU A;  2PQ8 A;  1AOY A;  2A69 F;  1R23 A;  1QQI A;  5K5Q A;  4I0A A;  1FX7 A;  3K9T A;  4EV0 A;  2WWY A;  2DI3 A;  3L09 A;  2K27 A;  1HW1 A;  3F8F A;  4A0Y A;  2FKD A;  4RGU A;  1U2W A;  1LDJ A;  5HVQ C;  2BYV E;  3BZ6 A;  3F72 A;  1T38 A;  3O3K A;  1B9M A;  3SQN A;  1LQ1 A;  3LAP A;  2QQA A;  4EJT A;  3BP8 A;  2XAJ A;  2JTV A;  1FNN A;  1A04 A;  3M9A A;  1RI7 A;  4L0Y B;  4FX0 A;  1ZRD A;  1J0R A;  1SD4 A;  3LQR A;  3BRO A;  2EA4 A;  3ZMT A;  3IHU A;  4XSX F;  2VOP A;  5CJ9 A;  1MD0 A;  2P5V A;  5E17 F;  4IHT A;  4KIC A;  3LST A;  3F3X A;  4Y15 A;  5AIP A;  4GO1 A;  1T6S A;  3HSF A;  4HW0 A;  2VE9 A;  4MEX F;  3P9K A;  1D8J A;  3BJ6 A;  3HSR A;  5HLI A;  4LGW A;  2G7H A;  2O6G E;  2EWN A;  1LDD A;  4ENK A;  4Q48 A;  4YIF A;  1G3T A;  3FX3 A;  3RYR A;  3JTG A;  5L3C A;  2UXX A;  1KYW A;  2ESN A;  2XAF A;  1ON2 A;  4U0Y A;  3I59 B;  4UVB A;  2W57 A;  2V79 A;  2HEO A;  2L02 A;  5E1W A;  4HYE A;  4BNC A;  3MQ0 A;  4HV5 A;  2K4J A;  2HS5 A;  4LLL A;  2O0Y A;  2FML A;  3GFM A;  3DQV C;  4L5J A;  4Y17 A;  2LF7 A;  1Z7U A;  5CVJ A;  3VEP A;  3EYY A;  4Q47 A;  2ZNZ A;  2CYY A;  3F8B A;  2MA3 A;  4HQE A;  4GYI A;  1W5S A;  5HLH A;  3I58 A;  3DKW A;  3C18 A;  2ZFW A;  5LGU A;  1IF1 A;  4HV6 A;  3T1B A;  2Z9O A;  4ESB A;  2KJB A;  2FXA A;  3V7R A;  2Z99 A;  4B09 A;  2YU3 A;  2M1B A;  3E5X A;  2LNB A;  2P7C B;  4N31 A;  1XCB A;  1Z05 A;  1SMY F;  1XB4 A;  3DXJ F;  3I71 A;  2VT2 A;  1HQC A;  2W25 A;  1ULY A;  4OIR F;  3B73 A;  1S8N A;  1QBJ A;  3JSP A;  2M45 A;  3MZY A;  1HSJ A;  3R6S A;  1XSX A;  1ZLK A;  1O3R A;  3EUH A;  3SZP A;  2P5L C;  2YX7 A;  3QP6 A;  2NYX A;  3L2C A;  5BOX A;  3GFL A;  2RN7 A;  2H6C A;  4PDK A;  5CLS A;  4OIP F;  2FSW A;  2M87 A;  1TW2 A;  3O2P E;  2VON A;  3DF8 A;  2RNJ A;  2MD5 A;  3E5U A;  5E8G A;  2VBX A;  2P4W A;  5HDK A;  1TQP A;  2XUB A;  5F6F A;  3C1D A;  1W5T A;  3HRM A;  3FZV A;  2IVM A;  3FXQ A;  5DCM B;  5LRS A;  1HW2 A;  1OYY A;  1IUY A;  3MEX A;  5D8K B;  3GFJ A;  1BC7 C;  3K69 A;  3OV8 A;  3ZMV A;  2DAO A;  1G3S A;  3BJA A;  1ZLJ A;  4CGZ A;  4KIF A;  1XGS A;  5HS7 A;  1ZRE A;  1IRG A;  5DUI A;  4KN7 X;  4LD5 A;  4UV9 A;  1F5T A;  2QYO A;  3N4M A;  2VC1 A;  4PCQ A;  4ZH4 F;  3V7S A;  1I5Z A;  2NS0 A;  4HA8 A;  3ZPL A;  5K5O A;  1JHF A;  4M9Z A;  3DP7 A;  1S7O A;  5CVV A;  3E6M A;  2H09 A;  4G7Z F;  3TO6 A;  5L3B A;  1G6N A;  4I0B A;  4GXO A;  4A5N A;  2HTJ A;  2VC0 A;  3RPQ A;  3FWE A;  5HOO A;  3FXU A;  1U5T A;  1D3Y A;  4Z2Y A;  2D1H A;  3HIF A;  2JSC A;  4UHT A;  4LFU A;  3RI4 A;  3R60 A;  1BM9 A;  2O3F A;  4EQQ A;  4P96 A;  4R8H A;  5ILS A;  2D2W A;  4XLN F;  2IRF G;  5K5R A;  2PN6 A;  2XHK A;  1NHA A;  4MHG A;  2A68 F;  1KQ8 A;  5E8I A;  2P8T A;  3ML6 A;  2DQR A;  2L54 A;  2RKH A;  3E6C C;  1CGP A;  1IN4 A;  3WGG A;  2Z33 A;  4RS8 A;  4P9U A;  2UZK A;  1Z1D A;  1W7P A;  3KP3 A;  4L9T A;  4AIH A;  3IWZ A;  1WRJ A;  5D5U B;  4DNC A;  1K78 B;  2GIV A;  4WCG A;  4LLG F;  4ENM A;  4S05 A;  1UHW A;  5A2Q K;  3IKV A;  3CO6 C;  1QGP A;  1UB9 A;  2ZME B;  5ICG A;  4IRG A;  3MWM A;  5JFR A;  1B4A A;  3SZT A;  3K2Z A;  3E3V A;  4L18 B;  2R3S A;  3CLO A;  4HX4 A;  5D5X B;  5D6E A;  3FMR A;  2ZO4 A;  2NNN A;  4RB1 A;  4I98 B;  4EGZ A;  2KRF A;  5L3G A;  1J59 A;  4RAZ A;  4ON0 A;  1D5V A;  1Z6T A;  3CTA A;  1MZB A;  1Y0U A;  4UNO A;  4P5O A;  3D0S A;  4RB2 C;  4M74 A;  1VTN C;  2JT1 A;  4UVA A;  2EFN A;  5DCF A;  2QZ8 A;  3J81 K;  1ZRC A;  1BIB A;  5L3E A;  4KDP A;  3GF2 A;  1S6L A;  1XDU A;  2FU4 A;  2FE3 A;  4HF1 A;  1PDN C;  2J5O A;  2CG4 A;  1T7D A;  1ON1 A;  3QP5 A;  3F8M A;  1UFM A;  2O8X A;  1S29 A;  1U6G A;  1FY7 A;  1YQA A;  1PUE E;  2HFH A;  2MH9 A;  5FFX A;  1E2X A;  2GQQ A;  3EDP A;  3HTS B;  5HS8 A;  2RV8 A;  3TOA A;  4JK1 X;  2J5P A;  4CXF A;  5D4S A;  1OPC A;  2ISZ A;  4YFN F;  5IT9 Z;  2YX4 A;  3REO A;  1IRF A;  4ZZL A;  2PFB A;  4BHC A;  4KFC A;  4EJV A;  4ENJ A;  3WTV C;  1BI1 A;  2FMY A;  2MLG A;  3WTS C;  3N97 A;  3FMS A;  2VOD A;  3ZMZ A;  4NB5 A;  4LB5 A;  3ZN0 A;  2PMH A;  1SD6 A;  1V3F A;  5BQT A;  1KA8 A;  3KCC A;  2LDU A;  5LEK A;  2Z3Y A;  1XMA A;  3BY6 A;  4IRH A;  1G4D A;  5TRD A;  1FBS A;  1QPM A;  5L3F A;  1O7F A;  2XKO A;  5FLX Z;  3WE3 A;  1R1T A;  4EJO A;  4BHB A;  3DFG A;  4G7H F;  5J6X A;  3GX4 X;  1WI9 A;  1R58 A;  4HBL A;  4KIG A;  2H6B A;  4AD9 A;  2E7W A;  4M9X A;  2XGX A;  2JPC A;  1WKM A;  3ULQ B;  1JE8 A;  3I64 A;  3ELK A;  4F7Z A;  1DPR A;  1FBU A;  3CDH A;  2O03 A;  1T98 A;  2IA0 A;  1GXP A;  3ABU A;  1ZAO A;  1L3L A;  3OOP A;  1R1U A;  2F2E A;  4HOB A;  2L3D A;  3R0J A;  3GFI A;  2ETH A;  3RJP A;  1ZGA A;  1YFH A;  2IA1 A;  4YG2 F;  1GHC A;  1Q1H A;  2CQK A;  2M30 A;  4HQM A;  2VN2 A;  2NNY A;  4KMU X;  5J8F A;  1V4R A;  5DDG A;  3GZ6 A;  3QRF F;  2ZME A;  1TLH B;  4LK1 F;  1R5H A;  3JSO A;  3ZQ7 A;  2LKP A;  3G3Z A;  1ZHF A;  1YW7 A;  2QBY A;  3COA C;  1QZY A;  2V1U A;  4LLN A;  5D5W B;  3ZP5 A;  5ICF A;  2LF8 A;  1P4W A;  1TQM A;  2DW4 A;  3HHG A;  4WK8 F;  1GVJ A;  3WTW C;  1FBQ A;  4ZYE A;  1P4X A;  5JHU A;  4LK0 F;  4CYD A;  4GYG A;  3PFI A;  2OQG A;  3GLX A;  3BWG A;  3P9C A;  4ZYD A;  1LEA A;  2IA2 A;  3J80 K;  1TTY A;  4PGG A;  5FGM A;  4D0P A;  2QQ9 A;  1ODD A;  3DEU A;  1Z6R A;  2MC3 A;  4I02 A;  4G8X A;  1FYK A;  1YG2 A;  4M9S A;  3KE2 A;  3IRQ A;  2DBB A;  2FBH A;  1YW9 A;  2OA4 A;  2FA5 A;  1UMU A;  5D4R A;  5ILV A;  3K1P A;  2STW A;  4G6D A;  3RIR A;  3HYI A;  4EMS A;  1P4A A;  1S7A A;  2EA2 A;  4AVP A;  3H3U A;  2EJR A;  1EV7 A;  1FP1 D;  3SHF A;  2DLL A;  3KEO A;  1LNW A;  2DT5 A;  5J8C A;  4NHJ A;  1YLF A;  3CUQ C;  4A2U A;  4G94 A;  3FMQ A;  2XRN A;  2BEO A;  3SFZ A;  2WC2 A;  5JI6 A;  1O3T A;  1ZRF A;  2AS5 F;  2PMU A;  4RAY A;  4A0X A;  3RPU A;  1U8R A;  4OOI A;  1J2X A;  1GXQ A;  4CZZ A;  1I6X A;  1ONV A;  2RVC A;  4HX8 A;  4U0V A;  3V8L A;  1C0W A;  3IC7 A;  2V1X A;  3NEU A;  4IRI A;  1B6A A;  1YW8 A;  1SMT A;  1T2K A;  1O3S A;  5LBQ A;  5H20 A;  1QNT A;  3HTU A;  2L4M A;  2Q8K A;  4EM2 A;  1BI2 A;  3R0A A;  5L3D A;  1PP8 F;  6PAX A;  3FM3 A;  2CGP A;  2EFO A;  1MGT A;  3CJN A;  4NQW A;  3KP7 A;  1KU3 A;  1I4V A;  4N0B A;  3F8N A;  1OYW A;  1SFX A;  3ZMS A;  1FWZ A;  3TO9 A;  2KIU A;  2P6T A;  2HGC A;  1TBX A;  2EV5 A;  3H92 A;  4FX4 A;  2FOK A;  3M8E A;  4L9N A;  3C7J A;  3DPT A;  4IHS A;  1J75 A;  2QBY B;  1F1Z A;  1KU7 A;  2H94 A;  1W7P D;  3EQL F;  1FOK A;  2OZU A;  2XAG A;  4EM1 A;  2XAQ A;  1WWX A;  2G9W A;  1IW7 F;  4FT8 A;  1TW3 A;  1P92 A;  5FO5 A;  3RTR A;  1EH6 A;  1BIA A;  3E6B A;  3JW4 A;  4WF2 A;  2FJR A;  3IKT A;  3KZY A;  1IN5 A;  2FEZ A;  2D45 A;  4R79 A;  1MDM B;  3QOP A;  2MBF A;  3RKW A;  5BMZ A;  1IAW A;  5BPI A;  1XN7 A;  1EH8 A;  4CHU A;  5FD5 A;  2VE8 A;  1JGS A;  4RB0 A;  4LG0 A;  1XSV A;  4I7H A;  4M6Y A;  2A3S A;  3RKX A;  1T39 A;  2GA1 A;  1IXS B;  1R5G A;  3K0L A;  3I4P A;  3IIQ A;  1FYM A;  1XDS A;  3GO5 A;  1BBY A;  1YO5 C;  4O5V A;  1B59 A;  3DPL C;  4O3M A;  4M73 A;  2B0L A;  4A12 A;  3V7C A;  4IJA A;  1LDK B;  3LA3 A;  2X4H A;  1MJ9 A;  3WTT C;  4R1H A;  1K79 A;  4ME8 A;  5LHI A;  4BYY A;  1J7K A;  4G7O F;  2YSR A;  2R7D A;  2LSO A;  4LMY A;  1OR7 A;  4S04 A;  1JHE A;  4KT5 C;  5JR3 A;  1J5Y A;  3Q9S A;  2XKP A;  3MZH A;  1R7J A;  4L0Z B;  2L01 A;  4BHP A;  4UVC A;  2R7F A;  2XV4 S;  1SAX A;  2EFQ A;  1DUX C;  3ECH A;  3H3Z A;  4JQF A;  1DDN A;  5F1R A;  4L9J A;  1TNS A;  4ESF A;  2O61 A;  1L0O C;  5ED4 A;  2EFW A;  1PP7 U;  3BOQ A;  2XAS A;  3KP4 A;  2VBZ A;  4A6E A;  2L4A A;  3VOD A;  3WOD F;  3MAJ A;  2HQR A;  4UUV A;  4KYW A;  4L9V A;  3I59 A;  5HLG A;  1ZG1 A;  1ZG3 A;  4BH9 A;  4MNU A;  2PEX A;  5DCM A;  1BI0 A;  5KVR A;  1XMK A;  5D8L B;  4WXC A;  3P9I A;  1YYV A;  2AXL A;  4JBA A;  3HHH A;  4N9I A;  4GGG A;  3LWF A;  2RC4 A;  1BN5 A;  5FFZ A;  3RDI A;  2IT0 A;  4HZF A;  2HWV A;  2KIM A;  3QU6 A;  3JTH A;  2A07 F;  2FQ3 A;  1ZN2 A;  2K02 A;  4AIJ A;  3KEQ A;  5HDG A;  2ACJ A;  2STT A;  1EH7 A;  2HO0 A;  1SD7 A;  3HSE A;  4P9F A;  3BJO A;  4EVI A;  1FT9 A;  5HS9 A;  1O3Q A;  1XD7 A;  4HF0 A;  1KU9 A;  4Y13 A;  1DPU A;  5LGT A;  1P6R A;  2C6Y A;  5AON A;  2NRA C;  5IT9 K;  2RGV A;  1ZGJ A;  1KQ0 A;  5CVR A;  2PG4 A;  2DK8 A;  1CF7 A;  1AWC A;  4BQA A;  4HF2 A;  1H9G A;  3J81 Z;  3BPX A;  3M1E A;  2V9V A;  4I09 A;  1UHM A;  2OD5 A;  1HKQ A;  4G6Q A;  3PQJ A;  3GYH X;  2M8E A;  1O7L A;  3KP5 A;  3GEZ A;  2OU2 A;  3WE2 A;  3ABT A;  4AIK A;  5ICC A;  3E97 A;  3NRV A;  1HKS A;  3S2W A;  1UST A;  1YTY A;  2CO5 A;  2W24 A;  4KUM A;  2QVO A;  1K78 A;  3TOB A;  3T0Y A;  2QM3 A;  3CUQ A;  2WV0 A;  1O57 A;  2QQB A;  2TDX A;  1U5T C;  4PGH A;  3HRU A;  4CIC A;  4IVN A;  4ASN A;  2CFX A;  2WTE A;  2MH2 A;  2FBK A;  5CVI A;  2FF4 A;  3TDU C;  3WTU C;  2HYF A;  1IN8 A;  2E7X A;  3CO7 C;  5AIQ A;  1KU2 A;  1I27 A;  4Q4Z F;  3GUD A;  2BV6 A;  4A5M A;  5HDN A;  5FLX K;  2M5W A;  4UV8 A;  2HNF A;  3MCZ A;  1HKT A;  4KA4 A;  1E17 A;  1MKM A;  3HOT A;  4HDU A;  2EFP A;  1J9I A;  4PZJ A;  3WU1 B;  1F4K A;  2FBI A;  4XLP F;  4HDV A;  4I01 A;  2Q0O A;  4YFX F;  3D5L A;  5DEQ A;  2RQP A;  2VXZ A;  1T0F A;  4G9Y A;  1FP2 A;  5LHH A;  1K7A A;  3J7A O;  1MDM A;  4ENN A;  3BDD A;  2CWE A;  2G7U A;  5D6F A;  1SD5 A;  1ZH5 A;  2RDP A;  2ZKZ A;  4IPA A;  3G73 A;  2IJL A;  1QO0 D;  5FB2 A;  1LB2 A;  1IZ1 A;  2ELH A;  4OMZ A;  3SXY A;  4H0E A;  3GWZ A;  1X3U A;  3P7N A;  2HDC A;  3I53 A;  1P2F A;  2YR2 A;  1IN7 A;  3GXO A;  4XRF A;  4N9H A;  1XGN A;  1LVA A;  5IT3 A;  3T8R A;  3JAM K;  2EV6 A;  3B02 A;  1USS A;  5BPD A;  3RYP A;  1G3Y A;  1U3E M;  3NQO A;  2UWM A;  2F5D A;  5ICE A;  1REP C;  3F6V A;  3ISP A;  2ZJ2 A;  4FHT A;  2X0L A;  3VFZ A;  5FD6 A;  2BE5 F;  2IP2 A;  3LA7 A;  2CSO A;  1FSH A;  2A61 A;  2OQR A;  3L00 A;  4YII A;  3KLN A;  5LHG A;  2KKO A;  4EM0 B;  1LJ9 A;  2Y0M A;  4RB3 C;  2GZW A;  3K1N A;  4HLY A;  2DU9 A;  3CUQ B;  2H27 A;  1R00 A;  2OAZ A;  4DQ2 A;  1H9T A;  1D8K A;  5EEH A;  2KIF A;  4IF4 A;  4NV4 A;  3KZZ A;  3F6O A;  1WQ2 A;  1U78 A;  2HZT A;  3BPV A;  4OU0 A;  4I2O A;  4HLX A;  3V8J A;  4ETS A;  5F64 A;  3LA2 A;  3U1D A;  1HBX G;  4U88 A;  2ADU A;  3WTX C;  5E18 F;  2BBY A;  2F5E A;  1RIO H;  2VBW A;  1RUO A;  3RKY A;  1JHC A;  3WGH A;  1ZG5 A;  3GVA A;  4QWQ A;  5DUK A;  2HOE A;  3WG9 A;  3C3W A;  2PBI A;  1BJA A;  5H6R A;  1FSE A;  3KP2 A;  2DK5 A;  1I1G A;  4WXD A;  2DQL A;  2DTR A;  2F5F A;  2HR3 A;  2Y48 A;  2A6H F;  1BI3 A;  3Q5F A;  1B12 A;  1OYI A;  5E1Z B;  1IXR C;  1RZ4 A;  2A6E F;  1BC8 C;  2FNA A;  3PQK A;  1JXS A;  4O6J A;  2ESH A;  3F22 A;  3U9G A;  1TNT A;  2XRO A;  2D1V A;  2ZNY A;  3MFK A;  2Z5U A;  3ECO A;  4ZZD A;  2IPQ X;  5LGN A;  4MQV A;  3BDN A;  1XSD A;  4K8W A;  3V4G A;  2F5C A;  2UXN A;  4HAM A;  3QAH A;  2PI0 A;  1KQ9 A;  2YPR A;  1BOA A;  1HW5 A;  3IWF A;  1I1S A;  2XAH A;  3M8F A;  3ZN1 A;  1Z9C A;  1MJA A;  2PLY A;  4TV7 A;  2VT3 A;  1S3J A;  1F39 A;  4KIB A;  1YS7 A;  2VBY A;  2GAU A;  1UCR A;  1LEB A;  2KJC A;  2NAZ A;  1IXC A;  2P7V B;  3L9F A;  3HUG A;  4RGX A;  4K2E A;  1YIO A;  3FF5 A;  4MEY F;  3TGN A;  5ERI A;  2GWR A;  4MGR A;  3M7G A;  5E20 A;  4L5I A;  4XBF A;  2E1C A;  2HTS A;  4YFK F;  4IXA A;  2PJP A;  5BS6 A;  3W6J B;  2E1N A;  1QZZ A;  2DFI A;  2GXG A;  3DV8 A;  2JPB A;  4OIN F;  3ERE D;  3W6K B;  5DV5 A;  2QUF A;  3O6B B;  3T5X A;  5DD4 A;  3LQQ A;  5KK1 A;  2XVC A;  2GXB A;  2K86 A;  3E6D A;  3WTY C;  2QWW A;  4EGY A;  2W84 A;  1RUN A;  4MTE A;  2EK5 A;  1FZP B;  3Q9V A;  1WSU A;  1OKR A;  1B9N A;  3S04 A;  1R1V A;  1W7P B;  1K6O A;  1XGO A;  2MLK A;  3FM5 A;  4EJU A;  4E70 A;  2ISY A;  4RGR A;  3VOE A;  2EB7 A;  1FLI A;  5LLQ A;  3LFK A;  4M6X A;  2DO7 A;  3JAM Z;  5K1Y A;  4WWC A;  2BGC A;  2Y75 A;  1ZAR A;  1XGM A;  1F9N A;  4QLC U;  4WX9 A;  2V6C A;  4LG0 B;  2P5K A;  3FXR A;  2W85 A;  3V8K A;  3T8T A;  3GW2 A;  3TO7 A;  1HXD A;  1Z91 A;  4UXN A;  4EJW A;  3HRT A;  5DYM A;  4MTD A;  2COM A;  3KFW X;  2ZBK A;  3WTZ A;  4CDG A;  3I0T A;  3WGI A;  3K1M A;  4OIO F;  2IW5 A;  3CUO A;  1TQI A;  3U2R A;  3I54 A;  2HKO A;  5CVU A;  1R22 A;  4BAY A;  3KLO A;  2HKX A;  4U7B A;  1G3W A;  3EET A;  3F8C A;  3LAJ A;  2ZXJ A;  4ZYG A;  3IRR A;  1B1B A;  4XSZ F;  1XCV A;  2FNP A;  1MJB A;  4KNY A;  5EEG A;  4ESJ A;  1OMI A;  2FRH A;  2JRT A;  3TDZ C;  1HST A;  4KMF A;  5LRR A;  5JVT A;  1CF7 B;  5DD8 A;  2P6S A;  1H0M A;  2JZY A;  2Q2E A;  1KN9 A;  4MQ9 F;  1FC3 A;  3EYI A;  2HQN A;  2QLZ A;  3KET A;  1R36 A;  1YS6 A;  5D5V B;  5H6Q A;  4BXU A;  2GA2 A;  1IN6 A;  4HX7 A;  1ZYR F;  2OBP A;  3F21 A;  1SFE A;  3QPH A;  2HYG D;  2DPU A;  4U0W A;  3ROU A;  4AWX B;  1KGS A;  4WXH A;  4U7D A;  2VOO A;  3ZMD A;  1KYZ A;  4GCV A;  2V1D A;  1FPQ A;  3J80 Z;  3F23 A;  2DPD A;  1FYL A;  1DP7 P;  4RGS A;  2A5Y B; 
#chains in the Genus database with same CATH topology
 1XMX A;  4CH7 A;  2JVH A;  4LJZ F;  5A2Q Z;  3HOS A;  3GZ5 A;  4IQ4 A;  4ZYH A;  3OS2 A;  3R4K A;  2XIG A;  3WU2 C;  1HOM A;  5TJJ A;  3A03 A;  3TQN A;  4F91 B;  5IOZ A;  4M72 A;  4Y7N J;  4NNJ A;  4Q5S F;  4M71 A;  4CCJ A;  5TIS C;  1WJF A;  2ZCW A;  2LY2 A;  3AAF A;  2CW0 F;  3CC2 I;  1ETY A;  1KCA A;  3DTE A;  3QPT A;  3LNQ A;  1RNL A;  2DA3 A;  3BG3 A;  3CCU I;  4HSR A;  3QU3 A;  4KJZ A;  4KIT B;  2E35 A;  3TW7 A;  5LEJ A;  2K4B A;  3ASN H;  3WU0 A;  4A0Z A;  5JVG F;  4OIQ F;  3E5Q A;  3TKY A;  3IL2 A;  1UEL B;  1U5T B;  1STZ A;  1P9Q C;  2OZ6 A;  3VB2 A;  1XS9 A;  1R71 A;  5E1X A;  3HRS A;  3I5U A;  5ILU A;  1JUP A;  4CO8 A;  3R61 A;  3AG3 H;  1BR4 A;  4KN4 X;  1SFU A;  1LFP A;  3OSG A;  1W4M A;  1JHH A;  1LFB A;  2QEN A;  3FHZ A;  3KP6 A;  3AG2 H;  3L7W A;  4A6D A;  4B8X A;  2VQC A;  3L2V A;  2EV0 A;  1AY9 A;  4P55 A;  4N4O B;  4OMY A;  2MW8 A;  4RM2 A;  1NTC A;  1JUM A;  3BQY A;  1YOV B;  1A6I A;  4FE7 A;  2K7L A;  3OYB A;  5CYV A;  4LB6 B;  3HGY A;  2K9M A;  1F36 A;  3ZMU A;  2QF7 A;  2PQ8 A;  2OCC H;  2A69 F;  3BG5 A;  1R23 A;  4PSW A;  3J7Z I;  1WI3 A;  1QQI A;  1AOY A;  5K5Q A;  4I0A A;  1Z77 A;  1FX7 A;  3K9T A;  3LSR A;  1GT0 C;  4EV0 A;  4IL6 C;  1D5Y A;  2WWY A;  4BAC A;  2DI3 A;  3L09 A;  2AHQ A;  2Y9Y A;  3BTI A;  3JRB A;  1MH4 A;  1ETW A;  1ZR4 A;  4BY1 J;  3IH3 A;  3S17 J;  2MFZ A;  2K27 A;  3VSK A;  4BJ5 C;  1HW1 A;  3F8F A;  4A0Y A;  4BBS J;  2R7X A;  2ZJR F;  2FKD A;  4RGU A;  1U2W A;  1LDJ A;  5E3N A;  3V42 A;  4XLE A;  5HVQ C;  2BYV E;  3BZ6 A;  1IV6 A;  5B66 C;  3F72 A;  4E7I A;  5FLM J;  3GBG A;  4I6Z A;  1T38 A;  1SAN A;  3O3K A;  3S1M J;  1B9M A;  3SQN A;  1LQ1 A;  3LAP A;  2QQA A;  4NC7 A;  4EJT A;  2IS1 A;  3BP8 A;  2XAJ A;  4JX5 A;  2JTV A;  1FNN A;  4ZDP A;  5K7Z A;  1IJW C;  1A04 A;  3M9A A;  4A69 C;  2ZXH A;  1RI7 A;  3E1S A;  4CYC A;  3K6G A;  4L0Y B;  4FX0 A;  1ZRD A;  2K9S A;  3NAR A;  1J0R A;  1SD4 A;  4BJT A;  3PIP F;  3LQR A;  3BRO A;  2EA4 A;  3ZOB A;  3ZMT A;  1X3W B;  4F52 A;  3IHU A;  4XLA A;  4XSX F;  3TW6 A;  2VOP A;  2KRH A;  1ETO A;  5IYB J;  5CJ9 A;  4BBR J;  1MD0 A;  2ZC2 A;  3GTP J;  1UG2 A;  2P5V A;  4GFB A;  2V4J C;  4IHT A;  5E17 F;  4FIS A;  1UZC A;  3ABK H;  2Y69 H;  4KIC A;  3L2Q A;  1IV8 A;  3BQZ A;  3LST A;  2WB1 N;  3F3X A;  3ZR8 X;  4Y15 A;  5AIP A;  1V5F A;  4GO1 A;  1T6S A;  3HSF A;  4HW0 A;  2VE9 A;  1X1B A;  4MEX F;  4PK4 A;  3P9K A;  3J7Y J;  5EG0 B;  3M07 A;  1VQN I;  1D8J A;  3BJ6 A;  3DLA A;  3HSR A;  5HLI A;  4LGW A;  4XRS A;  4W97 A;  2G7H A;  4X1E A;  4Y33 A;  2O6G E;  2EWN A;  1FOX A;  3WHC A;  3U1K A;  3QPL A;  1LDD A;  2BHY A;  4ENK A;  1YI2 I;  1R4M B;  4M3E A;  3BLY A;  4Q48 A;  4XKV A;  4YIF A;  2XPU A;  5KNL A;  3OYI A;  1G3T A;  3KZI C;  3FX3 A;  3RYR A;  3JTG A;  3M4O J;  5L3C A;  2UXX A;  2BVL A;  1KYW A;  2ESN A;  2XAF A;  1ON2 A;  1RKW A;  3I59 B;  3ZQI A;  4U0Y A;  1VQP I;  1BL0 A;  4QPQ A;  4UVB A;  3S8P A;  2W57 A;  2CRG A;  2DT7 B;  3S15 J;  5GAH J;  2V79 A;  2AXT C;  2L02 A;  3FKI J;  5E1W A;  1NG7 A;  4HYE A;  2OF7 A;  2E2I J;  2HEO A;  3HC7 A;  4BNC A;  2B63 J;  2IEK A;  2IBD A;  1OIS A;  3MQ0 A;  4HV5 A;  2K4J A;  2HS5 A;  2JQ7 A;  1VZ0 A;  5M5Y J;  4LLL A;  2O0Y A;  2FML A;  1LE8 B;  1LUJ B;  1LE8 A;  5J1Y A;  3GFM A;  3PSI A;  3DQV C;  4L5J A;  4Y17 A;  2DDA A;  2X1E A;  3AG1 H;  2JA7 J;  2LF7 A;  5FLV A;  1QU3 A;  3BR1 A;  3UKG A;  1B72 B;  1Z7U A;  5CVJ A;  3FXM A;  1B8I A;  3VEP A;  2JRM A;  3EYY A;  4Q47 A;  1GDT A;  2BW3 A;  1PUF A;  2R4G A;  2LRE A;  3RQ4 A;  2ZNZ A;  1VQ8 I;  3RCO A;  2CYY A;  2KQR A;  2IGK A;  5GAD J;  3HOY J;  3AL0 C;  3OL4 A;  1ZKG A;  3F8B A;  2MA3 A;  2ZME C;  4HQE A;  4GYI A;  4F93 B;  1W5S A;  5HLH A;  3I58 A;  3DKW A;  2DN0 A;  3C18 A;  3BR5 A;  2ZFW A;  3HB9 A;  3FHN A;  2VQG A;  2CUF A;  1VQK I;  3NWT A;  2CW7 A;  5LGU A;  1IF1 A;  4HV6 A;  2R7V A;  1ERD A;  3T1B A;  4B47 A;  3S2H J;  2JSP A;  2Z9O A;  2UV1 A;  5EGO B;  4ESB A;  2KJB A;  2FXA A;  3PUF A;  4UUS A;  3BG9 A;  1H88 C;  3V7R A;  2Z99 A;  4B09 A;  2YU3 A;  1ENH A;  2M1B A;  3E5X A;  2LNB A;  2P7C B;  4N31 A;  1XCB A;  1Z05 A;  4GRI A;  2JMW A;  1SMY F;  1XB4 A;  4BE1 A;  3DXJ F;  1BJZ A;  2ME0 A;  3I71 A;  3MVP A;  2VT2 A;  1HQC A;  2KIS A;  1FJL A;  2W25 A;  1ULY A;  4Z6Y A;  4OIR F;  3B73 A;  3E0J B;  1S8N A;  4RDU A;  2VI6 A;  2XB0 X;  3JSP A;  1QBJ A;  2M45 A;  3MZY A;  1HSJ A;  2HVR A;  3R6S A;  1XSX A;  1ZLK A;  1O3R A;  2K9N A;  3EUH A;  4XIC A;  3SZP A;  2P5L C;  3TP0 A;  2YX7 A;  3QP6 A;  2NYX A;  1DP3 A;  3L2C A;  5BOX A;  4A3B J;  3GFL A;  2E60 A;  2RN7 A;  2H6C A;  2L9R A;  3HPH A;  4PDK A;  4XK4 A;  5CLS A;  4OIP F;  3LL7 A;  2XRL A;  1WGX A;  2E1M C;  2FSW A;  2M87 A;  1QVT A;  2OPT A;  5C44 J;  1Z7L A;  1TW2 A;  3O2P E;  1VND A;  2VON A;  3H3V K;  4UUS B;  3DF8 A;  2XAU A;  3K2A A;  2RNJ A;  2MD5 A;  4BGD A;  1VQL I;  3E5U A;  4CCO A;  5E8G A;  2VBX A;  2P4W A;  5HDK A;  1TQP A;  2HOA A;  2XUB A;  5F6F A;  3C1D A;  3QOD A;  1W5T A;  3CJR B;  3HRM A;  1FEX A;  3FZV A;  3CQZ J;  1OCT C;  3FK7 A;  2AO9 A;  2DA6 A;  2IVM A;  3FXQ A;  5DCM B;  5LRS A;  3MKY B;  1HW2 A;  1OYY A;  2GIZ A;  1GUU A;  1IUY A;  2TCT A;  3MEX A;  5D8K B;  1S72 I;  4XKC A;  2V9K A;  3QPS A;  2WA0 A;  3GFJ A;  1BC7 C;  3K69 A;  1TWH J;  3OV8 A;  2DAO A;  1G3S A;  3ZMV A;  1MMS A;  2BY3 A;  2EPF A;  3BJA A;  3H5A A;  1ZLJ A;  3IP4 B;  1G8X A;  4ITV A;  4KIF A;  1XGS A;  2Z2S B;  5HS7 A;  1ZRE A;  4CGZ A;  1IRG A;  1UMQ A;  5DUI A;  4KN7 X;  4LD5 A;  3PM1 A;  2CS3 A;  4UV9 A;  1F5T A;  2QYO A;  2K3P A;  4QSH A;  3CME I;  3N4M A;  2VC1 A;  1QHG A;  2MC4 A;  4PCQ A;  4ZH4 F;  5J40 A;  5J3L A;  4BXX J;  2L7F P;  1TT5 B;  2DA4 A;  3RPU D;  3V7S A;  1EF4 A;  2B7E A;  1I5Z A;  2L9N A;  2NS0 A;  2X6W A;  1HDD C;  4HA8 A;  3ZPL A;  5K5O A;  3MN2 A;  1JHF A;  4V2G A;  4U87 A;  4RBO A;  3H35 A;  4M9Z A;  3DP7 A;  1S7O A;  5CVV A;  2FUG 2;  2XF7 A;  3E6M A;  2H09 A;  2F4O B;  4G7Z F;  2HVQ A;  3TO6 A;  5L3B A;  1G6N A;  2VB6 A;  2ECC A;  4GDF A;  4I0B A;  4GXO A;  4JX4 A;  3O8H A;  3QYE A;  1QHH D;  1Z3X A;  4A5N A;  3M3Y J;  2HTJ A;  1OJL A;  4CSW A;  2VC0 A;  4V19 K;  3RPQ A;  3FWE A;  3SDG A;  5HOO A;  5FRM A;  2VKH A;  4F3Q A;  3FXU A;  1U5T A;  1D3Y A;  3AFH A;  4Z2Y A;  1HDP A;  3ZRG A;  2D1H A;  3HIF A;  2HDW A;  2JSC A;  4UHT A;  4A3L J;  4LFU A;  3RI4 A;  3R60 A;  1BM9 A;  4XM3 A;  1T8I A;  1MSE C;  2L5Q A;  2PMZ A;  2O3F A;  4XQF A;  4EQQ A;  4P96 A;  4R8H A;  4D1Q A;  5ILS A;  1ZEL A;  2KL4 A;  5FJ8 J;  2D2W A;  4DZP A;  3CJT B;  4PJN A;  4XLN F;  4F55 A;  3ZCO A;  3VDX A;  3JRC A;  4A3C J;  2BY0 A;  2IRF G;  2JA8 J;  2ME6 A;  5K5R A;  2PN6 A;  2IS2 A;  2ZB9 A;  2XHK A;  1NHA A;  2VJJ A;  2WAD A;  2JN6 A;  4MHG A;  2A68 F;  2ECB A;  1KQ8 A;  5E8I A;  2P8T A;  1Y6I A;  2KZV A;  3BR3 A;  3HJE A;  3ML6 A;  1Z21 A;  4ZC3 A;  2DQR A;  2L54 A;  2E19 A;  5HNH A;  2RKH A;  3E6C C;  1CGP A;  1ORK A;  2M0C A;  2AQF A;  1IN4 A;  4AYB A;  1A35 A;  3DTK A;  3WGG A;  2Z33 A;  2JVG A;  2NVX J;  4RS8 A;  4P9U A;  2UZK A;  2JJ7 A;  2WBM A;  3H9J A;  3E7L A;  2KHM A;  1Z1D A;  1W7P A;  3KP3 A;  3I55 I;  5IPA A;  4L9T A;  4AIH A;  3IWZ A;  1WRJ A;  2Y0S A;  3ASO H;  1XPX A;  5D5U B;  4DNC A;  2VJ5 A;  2R5Z A;  1SVL A;  3OYL A;  1K78 B;  2GIV A;  4WCG A;  4LLG F;  3SEZ A;  1HC8 A;  4ENM A;  3DTI A;  4S05 A;  1W0U A;  4QPO A;  1UHW A;  5A2Q K;  3OOU A;  2X48 A;  3IKV A;  3CO6 C;  1QGP A;  5B3S H;  4PJ0 C;  2COB A;  1UB9 A;  2ZME B;  5ICG A;  3GTG J;  4IRG A;  3MWM A;  5JFR A;  1B4A A;  5B5E C;  2ELJ A;  3HEF A;  3SZT A;  1FIA A;  2F6C A;  1HA8 A;  3K2Z A;  4AID A;  3C2G A;  2M7A A;  1EA3 A;  3E3V A;  4L18 B;  2K85 A;  2R3S A;  3CLO A;  4HX4 A;  5D5X B;  5D6E A;  3FMR A;  2ZO4 A;  4PFP A;  2NNN A;  1DU6 A;  1S5L C;  4ZTJ A;  4RB1 A;  4I98 B;  2VPL A;  1WCM J;  2Y9Z A;  1YJ9 I;  1RC9 A;  4EGZ A;  2KRF A;  5L3G A;  1J59 A;  4RAZ A;  4ON0 A;  1D5V A;  2MG4 A;  1Z6T A;  1JUS A;  3ZXS A;  3CTA A;  1QRY A;  5HOD A;  1MZB A;  2E36 A;  4LG3 A;  4YIR X;  4MO7 A;  1MBF A;  1Y0U A;  4UNO A;  1UJ8 A;  4P5O A;  2I10 A;  3D0S A;  4RB2 C;  3CC7 I;  4C2M J;  4M74 A;  1V55 H;  3CDI A;  4XLC A;  1VTN C;  2JT1 A;  3FXL A;  4UVA A;  4A3M J;  5F0H A;  2EFN A;  5DCF A;  2QZ8 A;  3TBI A;  3J81 K;  1ZRC A;  1VFC A;  1BIB A;  3DU5 A;  4G6T B;  5L3E A;  3VYR B;  4KDP A;  1TWG J;  2MSY A;  2LBF B;  3GF2 A;  3IH2 A;  4BE2 A;  1S6L A;  2K9Q A;  1XDU A;  2FU4 A;  2FE3 A;  2W48 A;  2X6X A;  2X6Y A;  4HF1 A;  1PDN C;  2J5O A;  2QSH X;  1FIP A;  2CG4 A;  1T7D A;  3RZO J;  1ON1 A;  3QP5 A;  3F8M A;  1WZ2 A;  1UFM A;  3CZ6 A;  3H5R A;  1MSF C;  1X2M A;  2QCO A;  2O8X A;  1S29 A;  1OLT A;  1U6G A;  2OJE D;  2M7B A;  3FIS A;  1FY7 A;  1T56 A;  1SVO A;  1YQA A;  1PUE E;  2HFH A;  4D5C A;  4XRM A;  2FJ1 A;  2MH9 A;  4NQW B;  2R7R A;  5FFX A;  1E2X A;  2GQQ A;  2A5W A;  3EDP A;  5IYD J;  2W1O A;  2AQE A;  3HTS B;  4A93 J;  4MFD A;  5HS8 A;  3PNV A;  2RV8 A;  3EUK L;  1WPK A;  2K3F A;  3TOA A;  4JK1 X;  2J5P A;  1RET A;  2HQ5 A;  2L7Z A;  3MZ8 A;  4CXF A;  5D4S A;  4NDL A;  3HKZ N;  1OPC A;  2ISZ A;  2R0Q C;  1MBE A;  1UHS A;  2EZK A;  4YFN F;  5IT9 Z;  1D0Y A;  2YX4 A;  3REO A;  1IRF A;  4ZZL A;  2PFB A;  4BHC A;  4ZDL A;  4EJV A;  4ENJ A;  4KFC A;  2CQX A;  3WTV C;  1BI1 A;  2FMY A;  2MLG A;  3WTS C;  3N97 A;  3FMS A;  1ACI A;  4UB8 C;  2VOD A;  3ZMZ A;  3LSH A;  1YE9 A;  3H1C A;  4NB5 A;  3IUO A;  3UR3 C;  4LB5 A;  5EF6 A;  2EBI A;  3ZN0 A;  3KYC B;  4XLH A;  2PMH A;  2DTZ A;  1SD6 A;  1V3F A;  5BQT A;  2E1M B;  2R7Q A;  1KA8 A;  3KCC A;  3ZQG A;  2OC6 A;  4IQJ A;  2LDU A;  3LSJ A;  1BR2 A;  4BEH B;  5LEK A;  3BR0 A;  2Z3Y A;  2FOW A;  3LFU A;  3H9Q A;  1XMA A;  3BY6 A;  4IRH A;  3OMY A;  1G4D A;  3BT9 A;  3A0B C;  5TRD A;  1HCR A;  1FBS A;  1QPM A;  4QTR A;  5L3F A;  1O7F A;  1K83 J;  3DKY A;  2XKO A;  4BQN A;  5FLX Z;  2ID3 A;  3WE3 A;  2R7T A;  2BXY A;  4CCK A;  5CQE A;  1R1T A;  4EJO A;  2B9S A;  4BHB A;  1LVK A;  4ZDO A;  3DFG A;  4G7H F;  3NAU A;  5J6X A;  2DJN A;  4XON A;  3GX4 X;  3JRG A;  1WI9 A;  1X4P A;  1R6R A;  1R58 A;  4DYR A;  2NOJ B;  4HBL A;  4KIG A;  2H6B A;  4AD9 A;  2E7W A;  2VKD A;  1ETV A;  4M9X A;  2XGX A;  2JPC A;  1WKM A;  3ULQ B;  1QPI A;  3VWB A;  1JE8 A;  3I64 A;  3HOW J;  3ELK A;  4F7Z A;  3OYG A;  2M34 A;  3A01 B;  5EYR A;  1DPR A;  1FBU A;  3CDH A;  3GTQ J;  5EEA A;  2O03 A;  1T98 A;  2IA0 A;  5TGT A;  1GXP A;  3S1N J;  3ABU A;  1ZAO A;  1L3L A;  3OOP A;  1R1U A;  2F2E A;  4HOB A;  2L3D A;  3R0J A;  3OR2 C;  3GFI A;  5LD2 C;  2ETH A;  3RJP A;  1ZGA A;  1YFH A;  4XOP A;  1JKO C;  2IA1 A;  4YG2 F;  1GHC A;  4ABZ A;  2BY1 A;  1Q1H A;  2CH0 A;  3FK6 A;  5JLX A;  5CKT A;  3PNT A;  2CQK A;  3DLL F;  2YU9 J;  4AU7 A;  2M30 A;  2KP6 A;  4HQM A;  2VN2 A;  2NNY A;  4KMU X;  2L2O A;  5J8F A;  2RAE A;  2X85 A;  3SZG A;  4BS9 A;  4D7N A;  3OIO A;  1V4R A;  1BW6 A;  5DDG A;  4E7S A;  4D5F A;  3AL0 B;  1EJ9 A;  3GZ6 A;  1TZL A;  2ZME A;  1TLH B;  3QRF F;  4LK1 F;  2KRC A;  4JP0 A;  5IP9 J;  2XF5 A;  1R5H A;  3JSO A;  2E2J J;  1VQ5 I;  3ZQ7 A;  2LKP A;  5GAE J;  3G3Z A;  4HST A;  1ZHF A;  2PJR A;  1YW7 A;  2H1L A;  2HOT A;  3HUG B;  2QBY A;  3COA C;  1QZY A;  4NC6 A;  2V1U A;  2X9D A;  4LLN A;  5D5W B;  3ZP5 A;  5ICF A;  2LF8 A;  4PUS A;  1P4W A;  1WJB A;  4FTH A;  4IHV A;  1TQM A;  2DW4 A;  1WJD A;  4B3A A;  3HHG A;  3GTK J;  1JI8 A;  4WK8 F;  1GVJ A;  3WTW C;  1FBQ A;  5HLT A;  1ETQ A;  4ZYE A;  4IHY A;  4CUG A;  1P4X A;  4BUP A;  4LK0 F;  5JHU A;  4CYD A;  4GYG A;  3HOX J;  3PFI A;  1G59 A;  2OQG A;  3GLX A;  3BWG A;  3L2W A;  1WJC A;  3CCJ I;  2EIK H;  4AM3 A;  2Y0S N;  3P9C A;  4ZYD A;  2R5Y B;  3MKW B;  1LEA A;  1IDZ A;  2IA2 A;  2OUM A;  3WHB A;  3LSI A;  5FKL A;  3J80 K;  1TTY A;  2EIL H;  4PGG A;  1SVM A;  1WFX A;  5FGM A;  4D0P A;  4J19 A;  3HZJ A;  2QQ9 A;  1ODD A;  2E34 A;  3DEU A;  1Z6R A;  3H36 A;  2MC3 A;  2M4G A;  4I02 A;  4HNU A;  4IKF A;  4G8X A;  5C4J J;  2HI3 A;  4NUB A;  5F0F A;  1VQ4 I;  1FYK A;  3M1C A;  1YG2 A;  1WH5 A;  5E3O A;  4M9S A;  2XB5 A;  3KE2 A;  3CD6 I;  3L2R A;  3ESW B;  1YJW I;  3IRQ A;  2DBB A;  2FBH A;  1RKT A;  3HM5 A;  2M3A A;  2VPR A;  4DW6 A;  2Z16 A;  4G12 A;  1YW9 A;  2L9S A;  3DU6 A;  2OA4 A;  2FA5 A;  3ZQF A;  3KYD B;  4II2 A;  5D4R A;  1UMU A;  5ILV A;  3OS1 A;  2LD5 A;  1YJN I;  3BG7 A;  2LKS A;  3K1P A;  3S32 A;  1AKH A;  2STW A;  1MBG A;  1TWF J;  2DA7 A;  4G6D A;  3RIR A;  3TP3 A;  3VYT B;  3HYI A;  4EMS A;  2R7Z J;  1P4A A;  1S7A A;  2EA2 A;  4AVP A;  3AG4 H;  3H3U A;  2EJR A;  1EV7 A;  4A3G J;  1FP1 D;  3SHF A;  2DLL A;  3KEO A;  2IGN A;  3W2V A;  1LNW A;  2DT5 A;  5J8C A;  4NHJ A;  3ABL H;  4BE0 A;  1YLF A;  2CQ7 A;  3CUQ C;  4A2U A;  4G94 A;  3S1Q J;  1VQ9 I;  4BQQ A;  3FMQ A;  2XRN A;  2BEO A;  3SFZ A;  5JLW A;  3PO3 J;  2L9V A;  1TC3 C;  2WC2 A;  4Y4R A;  3OL3 A;  5JI6 A;  3MKZ A;  1O3T A;  1ZRF A;  2AS5 F;  2PMU A;  3FKJ A;  4A3J J;  9ANT A;  4RLF A;  4RAY A;  4XNF A;  4A0X A;  2VAS A;  4A3E J;  3RPU A;  4J01 A;  4C2T A;  2R7W A;  1U8R A;  4OOI A;  3OYM A;  3OYE A;  1J2X A;  1GXQ A;  3B6A A;  4FE4 A;  3AKZ A;  4CZZ A;  1AU7 A;  1I6X A;  2Y30 A;  1ONV A;  4BDZ A;  3HBL A;  2RVC A;  4HX8 A;  1D1B A;  4U0V A;  3V8L A;  1C0W A;  5KCM A;  1R4N B;  3IC7 A;  2V1X A;  3F0C A;  3BTL A;  3NEU A;  4IRI A;  2LG4 A;  4AVZ A;  3RKQ A;  2HXO A;  3U21 A;  1B6A A;  1YW8 A;  1SMT A;  1T2K A;  4LOC A;  3H0D A;  3CMA I;  5J1U A;  4B4C A;  1O3S A;  2QKM B;  2YUS A;  5LBQ A;  3BC8 A;  1QNT A;  5H20 A;  3HTU A;  2LFB A;  5BNG A;  2L4M A;  4E6K G;  2Q8K A;  4EM2 A;  1A5J A;  1BI2 A;  2CW8 A;  3R0A A;  2DOF A;  5L3D A;  4B44 A;  1PP8 F;  6PAX A;  2ZFU A;  3I56 I;  3FM3 A;  2CGP A;  3PL8 A;  1GV5 A;  3X2Q H;  2EFO A;  1MGT A;  3CJN A;  4NQW A;  5DTD A;  3KP7 A;  1KU3 A;  2E5Z A;  3PIO F;  1I4V A;  4XMY A;  4N0B A;  5GPA A;  2KZG A;  3JRD A;  3JRH A;  4H4K C;  2LTP A;  2FQ4 A;  5FKO A;  3F8N A;  1OYW A;  3G4S I;  2M8G X;  1IGN A;  5CQG A;  2O8K A;  3UNG C;  3HPG A;  4E7K A;  2DYS H;  1SFX A;  1PYV A;  3BCB A;  2MD0 A;  2F5V A;  1T0F C;  2D5V A;  1MBK A;  3ZMS A;  1Q1V A;  1FWZ A;  3TO9 A;  3KEY A;  5E79 C;  3OYJ A;  2KIU A;  2EZH A;  1Y8Q B;  1XG1 A;  1NG6 A;  2P6T A;  2LY9 A;  2CUJ A;  5K7H A;  2HGC A;  1YRN B;  1TBX A;  2EV5 A;  2RNG A;  3DEE A;  3K70 C;  3H92 A;  4FX4 A;  2FOK A;  3M8E A;  4L9N A;  3DPT A;  3C7J A;  4XRS G;  4IHS A;  2CJJ A;  3GZN B;  2VQH A;  1J75 A;  3DCF A;  2QBY B;  4E7J A;  1F1Z A;  1KU7 A;  2H94 A;  1W7P D;  4AYB N;  2CV1 A;  3EQL F;  1FOK A;  2OZU A;  2XAG A;  4EM1 A;  2XAQ A;  2Y2Z A;  2N8G A;  1WWX A;  1JT6 A;  3QYF A;  2G9W A;  1IW7 F;  4FT8 A;  1TW3 A;  1P92 A;  3CP2 A;  1XTA A;  5FO5 A;  3L1P A;  2XF6 A;  3F9K A;  3Q3S A;  3RTR A;  4E7L A;  1EH6 A;  2DFE A;  5IY5 H;  1BIA A;  1RR8 C;  1ZTR A;  3E6B A;  3JW4 A;  4WF2 A;  2FJR A;  3IKT A;  4Y3O A;  5KAI C;  1IC8 A;  3KZY A;  3BTC A;  3RQI A;  3S93 A;  2DMP A;  1IN5 A;  2FEZ A;  1ITY A;  2D45 A;  5EJC A;  4R79 A;  1MDM B;  3IAM 2;  3QOP A;  5GPC A;  2MBF A;  1K4S A;  2ZSH B;  3RKW A;  5BMZ A;  2CV2 A;  1IAW A;  3QWL A;  3VYS B;  2W00 A;  5BPI A;  1XN7 A;  3FBI B;  1N25 A;  1EH8 A;  4A3K J;  1QVU A;  2WV1 A;  3OYF A;  4CHU A;  4IO9 F;  3O8G A;  5FD5 A;  2VE8 A;  3K4L A;  1JGS A;  3CES A;  4RB0 A;  2HU9 A;  4LG0 A;  2LRD A;  3SEQ A;  1JT0 A;  3S1R J;  1XSV A;  4I7H A;  1E3O C;  4M6Y A;  1Y39 A;  1JKP C;  2DMU A;  3BZK A;  2A3S A;  1POG A;  2MAB A;  3RKX A;  3LSM A;  4HNV A;  2MYS A;  2DT6 A;  1T39 A;  2GA1 A;  1IXS B;  1R5G A;  3K0L A;  3I4P A;  3IIQ A;  1FYM A;  1PVE A;  1XDS A;  1IRX A;  1BBY A;  3GO5 A;  4BDY A;  1LPQ A;  3DWL E;  2Q1Z B;  4IHW A;  2F4I A;  2KT0 A;  1YO5 C;  2VLA A;  4O5V A;  1B59 A;  3DPL C;  4FCY A;  2DMN A;  2G0E A;  4O3M A;  4M73 A;  5F04 A;  1MMN A;  2LH9 A;  1Y56 A;  1N78 A;  2B0L A;  4CZC A;  1TWA J;  1WJ5 A;  2W82 A;  2DFH A;  4A12 A;  3V7C A;  1M1E B;  2GOX B;  4BJ6 C;  4IJA A;  1LDK B;  3LA3 A;  2X4H A;  1MJ9 A;  1SFK A;  2DYR H;  3WTT C;  1T33 A;  3ZGK A;  4M3G A;  3K4K A;  3CC4 I;  5F27 A;  4R1H A;  3IV5 A;  1K79 A;  3LOC A;  4RAG A;  2RRE A;  2TRT A;  4ME8 A;  2MGQ A;  1JKR C;  5LHI A;  4BYY A;  1MND A;  1J7K A;  1F43 A;  2HOS A;  4G7O F;  1X1D A;  2YSR A;  3JRI A;  2IAI A;  2JK3 A;  1JKQ C;  2R7D A;  2BZT A;  2LSO A;  4ZYA A;  4LMY A;  2OCE A;  2WB1 A;  4PFO A;  1T95 A;  4B1R A;  1IUF A;  1OR7 A;  2HDD A;  4V2F A;  5CPR B;  4S04 A;  1JHE A;  4KT5 C;  4KT6 A;  5JR3 A;  1J5Y A;  3I4N J;  3M8J A;  1VQO I;  3GTM J;  3Q9S A;  4CCL A;  2Q2E B;  2XKP A;  5K7F A;  3MZH A;  1R7J A;  3CCV I;  2LBF A;  4L0Z B;  2L01 A;  4BHP A;  4UVC A;  2R7F A;  4LIU A;  2XV4 S;  2NVU B;  1SAX A;  2EFQ A;  2QA4 I;  3G1L A;  1DUX C;  2DA1 A;  3ECH A;  3H3Z A;  1HF0 A;  4JQF A;  5HNF A;  1DDN A;  3PUB A;  5F1R A;  4RMN A;  2CU7 A;  4L9J A;  1TNS A;  3K10 A;  4MLO A;  4ESF A;  4XOT A;  1A6Q A;  4A3F J;  2O61 A;  1L0O C;  5ED4 A;  2EFW A;  1PP7 U;  3BOQ A;  3HOU J;  2XAS A;  3KP4 A;  2VBZ A;  3OYA A;  1YRN A;  1SAU A;  2EQR A;  3K70 D;  1MMA A;  2BOL A;  4PSX A;  4A6E A;  2DFF A;  2X51 A;  2L4A A;  2GLO A;  1OFC X;  3VOD A;  1PJR A;  3WOD F;  3MAJ A;  2HQR A;  4X6A J;  1Y1V J;  4UUV A;  4HPQ A;  1VQ7 I;  3QOE A;  2RQQ A;  3SDB A;  4IHX A;  3EUA A;  1Z3Y A;  4KYW A;  4L9V A;  2OTJ I;  1NK2 P;  3I59 A;  1X19 A;  5HLG A;  1FTT A;  2PX9 A;  1ZG1 A;  1ZG3 A;  4BH9 A;  2O9L A;  4MNU A;  3MKL A;  2PEX A;  2M2E A;  5DCM A;  1BI0 A;  5KVR A;  1XMK A;  5D8L B;  4WXC A;  3P9I A;  3CLQ A;  1YYV A;  2LP0 A;  1O4X A;  2NOG A;  4DJA A;  2AXL A;  1MNM C;  3BR2 A;  3FIW A;  4JBA A;  3HHH A;  3CDL A;  4GGG A;  4N9I A;  4FAS D;  3CCS I;  2R5Y A;  3LWF A;  2RC4 A;  1BN5 A;  5FFZ A;  3RDI A;  3SYT A;  5J1R A;  3HGG A;  1K61 A;  2IT0 A;  3A2K A;  2R7S A;  4HZF A;  2HWV A;  3OYH A;  3D5S C;  2KIM A;  3OSF A;  3S3M A;  3QU6 A;  2CV0 A;  3JTH A;  4FET A;  2A07 F;  1IRZ A;  2FQ3 A;  1ZN2 A;  2K02 A;  4AIJ A;  4OWR B;  3VPR A;  4ANJ A;  3C2B A;  3KEQ A;  5HDG A;  2ACJ A;  1QA6 A;  2STT A;  1EH7 A;  2HO0 A;  2JUC A;  1NK3 P;  1SD7 A;  4RA2 A;  3HSE A;  4IOC F;  4P9F A;  2LYC A;  3OIP A;  3BJO A;  4EVI A;  1FT9 A;  2DOD A;  4JOM A;  1DU0 A;  2VKV A;  2HPI A;  3CP8 A;  4YEL A;  1ETK A;  5HS9 A;  2KPM A;  2XDV A;  2F4M B;  5F1J A;  1O3Q A;  2O7O A;  1XD7 A;  2WAF A;  1V5G A;  4HF0 A;  1KU9 A;  4JX6 A;  4Y13 A;  5DM7 F;  3FDY A;  3OYD A;  1DPU A;  1MMG A;  1P6R A;  5LGT A;  2C6Y A;  5AON A;  2HVS A;  2NRA C;  5IT9 K;  1D1A A;  2KLO A;  1YX3 A;  1ZGJ A;  2RGV A;  4CYC B;  3HOZ J;  1W1W E;  5GP9 A;  1KQ0 A;  5CVR A;  2PG4 A;  5JHF A;  2DK8 A;  3G1O A;  3GTJ J;  1CF7 A;  1AWC A;  4BQA A;  4HF2 A;  1X3Z B;  1H9G A;  1B8I B;  4I76 A;  3J81 Z;  3BPX A;  3M1E A;  1W5C C;  2V9V A;  4I09 A;  1UHM A;  5IYC J;  1TT0 A;  2OD5 A;  3NWS A;  2M0M A;  1HKQ A;  1OCC H;  4G6Q A;  2F48 A;  2QKL B;  3I9V 2;  3PQJ A;  1GVD A;  1K4T A;  3GYH X;  4XL9 A;  2M8E A;  2GM4 A;  4LIV A;  1YIJ I;  2V6E A;  3P5J A;  1D1C A;  1O7L A;  3KP5 A;  3PFY A;  1XX5 A;  4CA0 A;  2CUE A;  2LKX A;  3GEZ A;  1OCO H;  2OU2 A;  1ZQ3 P;  2OV7 A;  4DYQ A;  2FX0 A;  3WE2 A;  3ABT A;  4A3I J;  4AIK A;  1MBJ A;  5ICC A;  3JRA A;  3E97 A;  4E4H A;  1V5E A;  3NRV A;  3C2H A;  2M9H A;  1HKS A;  1I50 J;  2VKE A;  3S2W A;  3OYN A;  2QGU A;  1DGR M;  2IS4 A;  1UST A;  3B6C A;  1YTY A;  2CO5 A;  2W24 A;  2R93 J;  4KUM A;  2QVO A;  1K78 A;  1XC5 A;  1E0E A;  1FMW A;  3TOB A;  2NXN B;  3T0Y A;  1SC7 A;  1BR1 A;  3N05 A;  1X1C A;  2QM3 A;  4I99 C;  2EZL A;  3CUQ A;  3A02 A;  4NC8 A;  1E3P A;  3LMM A;  2WV0 A;  1O57 A;  2P81 A;  2QQB A;  3ZQL A;  5F0C A;  2TDX A;  1EKE A;  3SJM A;  1U5T C;  4PGH A;  2ZJP F;  3GME A;  3HRU A;  4CIC A;  4IVN A;  3DKX A;  3A4C A;  3BCA A;  4ASN A;  2CFX A;  2WTE A;  3I3L A;  2L0K A;  1VF9 A;  1WHU A;  2MH2 A;  2VQL A;  3WG7 H;  2EIM H;  2FBK A;  2I8D A;  5CVI A;  2FF4 A;  3TDU C;  3WTU C;  1MH3 A;  3ONQ A;  3ZQC A;  3TL4 X;  2HYF A;  1X1P A;  1IN8 A;  2E7X A;  3CO7 C;  5AIQ A;  1H89 C;  2WAQ A;  2BHZ A;  1KU2 A;  2QSF X;  1MW7 A;  1I27 A;  3G71 I;  2JWT A;  3PO2 J;  4Q4Z F;  4IEJ A;  1SFO J;  3GUD A;  2BV6 A;  1UAA A;  4AUX A;  2X6O A;  4A5M A;  5HDN A;  4OAZ A;  5FLX K;  2M5W A;  4UV8 A;  3HXL A;  3MCZ A;  2HNF A;  1HKT A;  4KA4 A;  2HZD A;  2XGC A;  1E17 A;  2KMU A;  1A31 A;  1GV2 A;  5FRO A;  3K7A J;  1MKM A;  2LR8 A;  3HOT A;  4HDU A;  2EFP A;  1JTY A;  4DIQ A;  1J9I A;  4PZJ A;  3WU1 B;  4N4N B;  1F4K A;  2V1N A;  2FBI A;  3CCM I;  1LFU P;  4B43 A;  4XLP F;  1RES A;  3D5R C;  4C30 A;  4HDV A;  4L5E A;  4I01 A;  2R92 J;  2Q0O A;  4YFX F;  3D5L A;  3PSF A;  2Z1D A;  1J09 A;  1S7E A;  5DEQ A;  5B1A H;  4BY7 J;  2W4S A;  3JRF A;  2RQP A;  2VXZ A;  1T0F A;  4G9Y A;  1FP2 A;  2XPV A;  5LHH A;  1NH3 A;  3S14 J;  1K7A A;  3QYB A;  3J7A O;  1MDM A;  4ENN A;  3BDD A;  2CWE A;  2G7U A;  2IGO A;  5D6F A;  1FTZ A;  1SD5 A;  2PMZ N;  2CQN A;  1ZH5 A;  4CCN A;  2RDP A;  2ZKZ A;  4IPA A;  3G73 A;  3DBR B;  2IJL A;  1QO0 D;  5FB2 A;  1LB2 A;  1AKH B;  1WH7 A;  1IZ1 A;  1FMV A;  2ELH A;  4OMZ A;  4XKW A;  3SXY A;  4H0E A;  1B72 A;  3GWZ A;  1MIJ A;  1X3U A;  3P7N A;  1IDY A;  2HDC A;  3GTO J;  3I53 A;  3TMO A;  1JJ8 C;  1FOY A;  2CQQ A;  1VQM I;  1P2F A;  2YR2 A;  1IN7 A;  2DJI A;  1OR7 C;  3GXO A;  5DS9 A;  4XRF A;  3OIQ A;  3Q0U A;  4N9H A;  2JA2 A;  4MFE A;  5J47 A;  2LOO A;  2HXI A;  3KX2 A;  1XGN A;  1LVA A;  2BY2 A;  1W36 D;  1W36 C;  5IT3 A;  3T8R A;  3JAM K;  1Z67 A;  2EV6 A;  3B02 A;  1USS A;  5M3M J;  4B48 A;  2E1O A;  1U8B A;  3A0H C;  5BPD A;  4C3J J;  4HRI A;  3RYP A;  1G3Y A;  1U3E M;  3NQO A;  2UWM A;  4M6V A;  2ID6 A;  1YIT I;  2F5D A;  5ICE A;  1REP C;  2ZXI A;  2L7K A;  2XC7 A;  3F6V A;  2ZXW H;  3ISP A;  5E3L A;  2ZJ2 A;  4FHT A;  2VL8 A;  4DOZ A;  1JGG A;  2K5C A;  2X0L A;  1H8A C;  3VFZ A;  2NVQ J;  1R49 A;  3G1M A;  5FD6 A;  2BE5 F;  2IP2 A;  3LA7 A;  2CSO A;  4DZJ A;  3SFI A;  1FSH A;  4Y52 J;  2X1C A;  2A61 A;  2OQR A;  3L00 A;  3I4M J;  4YII A;  3KLN A;  4S0H B;  2KKO A;  5LHG A;  1VI0 A;  4EM0 B;  1LJ9 A;  2XGE A;  1I39 A;  2Y0M A;  3CCQ I;  4RB3 C;  3OYC A;  2GZW A;  1OCZ H;  3Q0W A;  1AHD P;  2NVY J;  3K1N A;  4DGW B;  4HLY A;  1FOW A;  2DU9 A;  3DBL B;  5KAF C;  3CUQ B;  5E3M A;  2H27 A;  1R00 A;  2OAZ A;  4YEJ A;  2KDO A;  4DQ2 A;  1H9T A;  1D8K A;  5EEH A;  2KIF A;  4IF4 A;  4CCM A;  4NV4 A;  3KZZ A;  3F6O A;  4C3I J;  4DBQ A;  3W6V A;  4W1U A;  3G6E I;  4XN3 A;  4J00 A;  1WQ2 A;  3HG9 A;  1U78 A;  2NS8 A;  1I3Q J;  2HZT A;  3BPV A;  4OU0 A;  5EZG A;  3LSP A;  3KYL A;  2E2H J;  4I2O A;  5C3E J;  2EIJ H;  4HLX A;  3V8J A;  4ETS A;  1TL8 A;  1IO2 A;  5F64 A;  3LA2 A;  3U1D A;  1HBX G;  4U88 A;  2ADU A;  3WTX C;  5E18 F;  4X0G A;  5M5W J;  1QZE A;  2BBY A;  2F5E A;  2H8R A;  1RIO H;  2E5N A;  1I6H J;  2VBW A;  1RUO A;  5B1B H;  3H9G A;  5FKM A;  3RKY A;  1JHC A;  3DBH B;  3WGH A;  1D0Z A;  5GTI C;  3W2A A;  4D7M A;  1U9N A;  2DA5 A;  2EH3 A;  2GBY A;  1ZG5 A;  3GVA A;  4QWQ A;  5DUK A;  2HOE A;  3GLL A;  2H8W A;  2LY1 A;  3WG9 A;  5IP6 A;  2JA5 J;  2FD5 A;  3C3W A;  2PBI A;  4C9Y A;  1JTX A;  2XPW A;  1BJA A;  2DA2 A;  5H6R A;  2JUG A;  1VQ6 I;  2Y31 A;  4E7Z A;  1FSE A;  3KP2 A;  4M3F A;  2DK5 A;  1I1G A;  4WXD A;  2DQL A;  2DXI A;  4QIW N;  2DTR A;  2F5F A;  4A3D J;  1GLN A;  1W0T A;  2HR3 A;  2Y48 A;  1S9H A;  3S3N A;  2BW3 B;  2CMP A;  1PUF B;  2DDB A;  2A6H F;  1BI3 A;  3Q5F A;  2NS7 A;  2R5Z B;  1B12 A;  3RSN A;  3VYU B;  1OYI A;  5E1Z B;  1IXR C;  1RZ4 A;  2A6E F;  1BC8 C;  2FNA A;  3CMM A;  3PQK A;  4UB6 C;  4UY8 I;  3A1Y A;  1JXS A;  1K6Y A;  2ESH A;  4O6J A;  3F22 A;  1YX5 A;  3U9G A;  3CCL I;  1TNT A;  2XRO A;  1Y1W J;  1DGW Y;  2D1V A;  5FKK A;  3KIO A;  4F92 B;  1R9T J;  2ZNY A;  3MFK A;  2K9L A;  2Z5U A;  1ZR2 A;  3ECO A;  4ZZD A;  5EDN A;  4FQG A;  2IPQ X;  5LGN A;  2IS6 A;  4MQV A;  3BDN A;  1XSD A;  4K8W A;  3V4G A;  1MMD A;  2DMQ A;  3H0G J;  3OY9 A;  2F5C A;  2UXN A;  4HAM A;  1T08 B;  3QAH A;  2IGM A;  3ABM H;  2PI0 A;  1KQ9 A;  3PNY A;  2XSJ C;  1RRJ A;  3K4B A;  2YPR A;  1BOA A;  4PJL A;  4IX7 A;  1HW5 A;  3IWF A;  1I1S A;  2XAH A;  2GXA A;  3M8F A;  3HDD A;  5M5X J;  3ZN1 A;  1Z9C A;  1KZH A;  1MJA A;  2LVS A;  2PLY A;  4B3X A;  4TV7 A;  3OYK A;  2L7M P;  2VT3 A;  1S3J A;  4MIM A;  3K4N A;  1F39 A;  2K40 A;  1X2N A;  3BR6 A;  2JA6 J;  4YRV A;  4KIB A;  4ZTF A;  1YS7 A;  2OTL I;  2WY7 Q;  3LSK A;  2VBY A;  3IAS 2;  2GAU A;  3EPZ A;  3G2B A;  1RPW A;  1UCR A;  1LEB A;  1DQU A;  2KJC A;  3DEW A;  2NAZ A;  1IXC A;  2P7V B;  2LK2 A;  3L9F A;  5FKN A;  3HUG A;  4RGX A;  4K2E A;  1YIO A;  2LC2 A;  3FF5 A;  4MEY F;  5J4Y A;  3TGN A;  5ERI A;  2BVM A;  2O5R A;  2GWR A;  5DM6 F;  4MGR A;  3CJQ B;  2ZSI B;  3M7G A;  2HPM A;  5E20 A;  4C3H J;  2LMD A;  3OS0 A;  4C2U A;  3FXK A;  2M4K A;  3JCU C;  3IH4 A;  3A01 A;  4L5I A;  4XBF A;  1ZK8 A;  2E1C A;  2QEX I;  2HTS A;  4YFK F;  3KPH A;  4HG2 A;  4IXA A;  3DPU A;  2PJP A;  2VJI A;  5BS6 A;  3W3C A;  4IOA F;  5GTH C;  4M3D A;  2E1N A;  3W6J B;  2VJ4 A;  3FXO A;  2A6T A;  4KIS A;  1QZZ A;  5LFA A;  2DFI A;  2XSD C;  2DCE A;  3MMY B;  2GXG A;  4JYK A;  3DV8 A;  2JPB A;  3ZQQ A;  4DYC A;  4OIN F;  2IXS A;  2CUZ A;  4DBR A;  3ERE D;  3W6K B;  4BL0 B;  5DV5 A;  5KHD A;  2QUF A;  4BU2 A;  3O6B B;  3T5X A;  4RM3 A;  2EZI A;  5DD4 A;  3LQQ A;  5KK1 A;  2XVC A;  2V9P A;  3K4C A;  2GXB A;  2K86 A;  4D9J A;  3E6D A;  2QWW A;  3WTY C;  1HLV A;  3ERM A;  3W2W A;  4EGY A;  2W84 A;  1RUN A;  4MTE A;  3L2U A;  1E3H A;  1P7I A;  2P0W A;  1JJ6 C;  4XN0 A;  4UUT A;  2EK5 A;  1RR7 A;  4BEH A;  1FZP B;  5EZH A;  3VSL A;  3BZC A;  3ZQH A;  1TWC J;  3Q9V A;  2ICW G;  2V7F A;  2WY8 Q;  3JRE A;  1WSU A;  1OKR A;  1B9N A;  3S04 A;  3BTJ A;  3LSG A;  3QQA A;  1ZGW A;  1R1V A;  1W7P B;  5EG0 A;  3S2D J;  1K6O A;  2HNH A;  1XGO A;  2MLK A;  3FM5 A;  1OCR H;  3EUH C;  4EJU A;  4E70 A;  2ISY A;  4RGR A;  3VOE A;  4NBQ A;  1BA5 A;  4LIT A;  4AC0 A;  2EB7 A;  1FLI A;  5LLQ A;  1MNE A;  3LFK A;  1U0J A;  4M6X A;  4HEA 2;  2DO7 A;  5IOY A;  1CQT A;  2H1K A;  3HKZ A;  4P1W A;  1OCP A;  1LKX A;  3JAM Z;  1V54 H;  5K1Y A;  3TED A;  4WWC A;  2R7O A;  5C4X J;  2BGC A;  2Y75 A;  5GAG J;  3D1N I;  1ZAR A;  4E7H A;  4M3B A;  1BOB A;  5EGO A;  1XGM A;  3GCM A;  1F9N A;  4QLC U;  2DOE A;  4RAF A;  4WX9 A;  4IZZ A;  2V6C A;  1UG0 A;  3CCE I;  4LG0 B;  1KON A;  2P5K A;  5FRN A;  3OWT A;  2DMT A;  4XR6 A;  2HQA A;  2XGD A;  3FXR A;  2GOM A;  2W85 A;  1APL C;  3V8K A;  3T8T A;  3GW2 A;  3TO7 A;  1R5I D;  1HXD A;  1Z91 A;  4RLQ A;  4XID A;  1WJA A;  1ETX A;  2E71 A;  2DOA A;  5H2F C;  2ZJQ F;  4PJM A;  3J7A Y;  4UXN A;  4EJW A;  3HRT A;  5DYM A;  1D0X A;  4MTD A;  3OR1 C;  2COM A;  3CCY A;  3KFW X;  2ZBK A;  3FXJ A;  1Y0N A;  1N77 A;  1MBH A;  3BG6 A;  3WTZ A;  4CDG A;  3I0T A;  5J4V A;  1X58 A;  3WGI A;  4BKX A;  3CF5 F;  3K1M A;  4OIO F;  2UUZ A;  2IW5 A;  3HOV J;  2PJR B;  3CUO A;  2A05 A;  1X4O A;  1TQI A;  1WVR A;  2KFD A;  5F08 A;  1U9O A;  3U2R A;  3I54 A;  2HKO A;  2VXD A;  2WAE A;  5CVU A;  1R22 A;  4EEF G;  4BAY A;  2QSG X;  2LLK A;  3KLO A;  2HKX A;  4U7B A;  1G3W A;  3EET A;  3S16 J;  2R7U A;  3F8C A;  3LAJ A;  2ZXJ A;  4ZYG A;  3IRR A;  1B1B A;  4XSZ F;  1XCV A;  2X1D A;  2FNP A;  3K4M A;  3PJR A;  4BQO A;  1MJB A;  4KNY A;  5EEG A;  2EIN H;  4ESJ A;  1AA7 A;  1OMI A;  3JR9 A;  2FRH A;  1SEU A;  1X1A A;  2YS9 A;  2W7N A;  3CF2 A;  2JRT A;  3TDZ C;  1HST A;  4KMF A;  4XLF A;  5LRR A;  5JVT A;  1CF7 B;  5DD8 A;  2P6S A;  3CCR I;  3MD2 A;  1H0M A;  2JZY A;  1A36 A;  2Q2E A;  1Y8R B;  1G2H A;  1KN9 A;  4MQ9 F;  3FBN B;  2CFO A;  4EAT A;  1FC3 A;  5IP7 J;  1YHQ I;  3EYI A;  3H5N A;  2VIX A;  1BW5 A;  3HL2 A;  2HQN A;  2QLZ A;  4OAY A;  1N75 A;  4HNT A;  3S3O A;  3CMY A;  3KET A;  3Q0V A;  1R36 A;  1YS6 A;  4XKB A;  2V26 A;  5D5V B;  5H6Q A;  3K4J A;  1TP4 A;  4PJJ A;  2GA2 A;  1IN6 A;  4HX7 A;  1ZYR F;  4BXU A;  2WAQ N;  4ZJZ A;  2VUM J;  2OBP A;  3F21 A;  1SFE A;  3QPH A;  2HYG D;  2DPU A;  1IG7 A;  2HYJ A;  2ELK A;  4XOR A;  4U0W A;  3ROU A;  4AWX B;  1KGS A;  4WXH A;  4U7D A;  3GTL J;  4BXF A;  2VOO A;  2BXZ A;  2I5U A;  4II3 A;  3ZMD A;  1KYZ A;  4GCV A;  2NVT J;  1P7J A;  5M3F J;  1Z0X A;  2V1D A;  3RZD J;  1FPQ A;  2KIQ A;  2KDZ A;  3J80 Z;  1I3A A;  3F23 A;  2QQ8 A;  2DPD A;  1OQY A;  1FYL A;  1DP7 P;  4RGS A;  1WJE A;  2A5Y B; 
#chains in the Genus database with same CATH homology
 4LJZ F;  5A2Q Z;  3HOS A;  3GZ5 A;  4ZYH A;  3R4K A;  2XIG A;  5TJJ A;  3TQN A;  4M72 A;  4Q5S F;  4M71 A;  2ZCW A;  3AAF A;  2CW0 F;  1KCA A;  3QPT A;  1RNL A;  3QU3 A;  5LEJ A;  2K4B A;  3WU0 A;  4A0Z A;  4OIQ F;  3E5Q A;  3TKY A;  3IL2 A;  1U5T B;  1STZ A;  2OZ6 A;  3VB2 A;  5E1X A;  3HRS A;  3I5U A;  5ILU A;  4CO8 A;  3R61 A;  4KN4 X;  1SFU A;  1W4M A;  1JHH A;  2QEN A;  3FHZ A;  3KP6 A;  3L7W A;  4A6D A;  4B8X A;  2EV0 A;  1AY9 A;  4P55 A;  4OMY A;  2K7L A;  5CYV A;  4LB6 B;  3ZMU A;  2PQ8 A;  1AOY A;  2A69 F;  1R23 A;  1QQI A;  5K5Q A;  4I0A A;  1FX7 A;  3K9T A;  4EV0 A;  2WWY A;  2DI3 A;  3L09 A;  2K27 A;  1HW1 A;  3F8F A;  4A0Y A;  2FKD A;  4RGU A;  1U2W A;  1LDJ A;  5HVQ C;  2BYV E;  3BZ6 A;  3F72 A;  1T38 A;  3O3K A;  1B9M A;  3SQN A;  1LQ1 A;  3LAP A;  2QQA A;  4EJT A;  3BP8 A;  2XAJ A;  2JTV A;  1FNN A;  1A04 A;  3M9A A;  1RI7 A;  4L0Y B;  4FX0 A;  1ZRD A;  1J0R A;  1SD4 A;  3LQR A;  3BRO A;  2EA4 A;  3ZMT A;  3IHU A;  4XSX F;  2VOP A;  5CJ9 A;  1MD0 A;  2P5V A;  5E17 F;  4IHT A;  4KIC A;  3LST A;  3F3X A;  4Y15 A;  5AIP A;  4GO1 A;  1T6S A;  3HSF A;  4HW0 A;  2VE9 A;  4MEX F;  3P9K A;  1D8J A;  3BJ6 A;  3HSR A;  5HLI A;  4LGW A;  2G7H A;  2O6G E;  2EWN A;  1LDD A;  4ENK A;  4Q48 A;  4YIF A;  1G3T A;  3FX3 A;  3RYR A;  3JTG A;  5L3C A;  2UXX A;  1KYW A;  2ESN A;  2XAF A;  1ON2 A;  4U0Y A;  3I59 B;  4UVB A;  2W57 A;  2V79 A;  2HEO A;  2L02 A;  5E1W A;  4HYE A;  4BNC A;  3MQ0 A;  4HV5 A;  2K4J A;  2HS5 A;  4LLL A;  2O0Y A;  2FML A;  3GFM A;  3DQV C;  4L5J A;  4Y17 A;  2LF7 A;  1Z7U A;  5CVJ A;  3VEP A;  3EYY A;  4Q47 A;  2ZNZ A;  2CYY A;  3F8B A;  2MA3 A;  4HQE A;  4GYI A;  1W5S A;  5HLH A;  3I58 A;  3DKW A;  3C18 A;  2ZFW A;  5LGU A;  1IF1 A;  4HV6 A;  3T1B A;  2Z9O A;  4ESB A;  2KJB A;  2FXA A;  3V7R A;  2Z99 A;  4B09 A;  2YU3 A;  2M1B A;  3E5X A;  2LNB A;  2P7C B;  4N31 A;  1XCB A;  1Z05 A;  1SMY F;  1XB4 A;  3DXJ F;  3I71 A;  2VT2 A;  1HQC A;  2W25 A;  1ULY A;  4OIR F;  3B73 A;  1S8N A;  1QBJ A;  3JSP A;  2M45 A;  3MZY A;  1HSJ A;  3R6S A;  1XSX A;  1ZLK A;  1O3R A;  3EUH A;  3SZP A;  2P5L C;  2YX7 A;  3QP6 A;  2NYX A;  3L2C A;  5BOX A;  3GFL A;  2RN7 A;  2H6C A;  4PDK A;  5CLS A;  4OIP F;  2FSW A;  2M87 A;  1TW2 A;  3O2P E;  2VON A;  3DF8 A;  2RNJ A;  2MD5 A;  3E5U A;  5E8G A;  2VBX A;  2P4W A;  5HDK A;  1TQP A;  2XUB A;  5F6F A;  3C1D A;  1W5T A;  3HRM A;  3FZV A;  2IVM A;  3FXQ A;  5DCM B;  5LRS A;  1HW2 A;  1OYY A;  1IUY A;  3MEX A;  5D8K B;  3GFJ A;  1BC7 C;  3K69 A;  3OV8 A;  3ZMV A;  2DAO A;  1G3S A;  3BJA A;  1ZLJ A;  4CGZ A;  4KIF A;  1XGS A;  5HS7 A;  1ZRE A;  1IRG A;  5DUI A;  4KN7 X;  4LD5 A;  4UV9 A;  1F5T A;  2QYO A;  3N4M A;  2VC1 A;  4PCQ A;  4ZH4 F;  3V7S A;  1I5Z A;  2NS0 A;  4HA8 A;  3ZPL A;  5K5O A;  1JHF A;  4M9Z A;  3DP7 A;  1S7O A;  5CVV A;  3E6M A;  2H09 A;  4G7Z F;  3TO6 A;  5L3B A;  1G6N A;  4I0B A;  4GXO A;  4A5N A;  2HTJ A;  2VC0 A;  3RPQ A;  3FWE A;  5HOO A;  3FXU A;  1U5T A;  1D3Y A;  4Z2Y A;  2D1H A;  3HIF A;  2JSC A;  4UHT A;  4LFU A;  3RI4 A;  3R60 A;  1BM9 A;  2O3F A;  4EQQ A;  4P96 A;  4R8H A;  5ILS A;  2D2W A;  4XLN F;  2IRF G;  5K5R A;  2PN6 A;  2XHK A;  1NHA A;  4MHG A;  2A68 F;  1KQ8 A;  5E8I A;  2P8T A;  3ML6 A;  2DQR A;  2L54 A;  2RKH A;  3E6C C;  1CGP A;  1IN4 A;  3WGG A;  2Z33 A;  4RS8 A;  4P9U A;  2UZK A;  1Z1D A;  1W7P A;  3KP3 A;  4L9T A;  4AIH A;  3IWZ A;  1WRJ A;  5D5U B;  4DNC A;  1K78 B;  2GIV A;  4WCG A;  4LLG F;  4ENM A;  4S05 A;  1UHW A;  5A2Q K;  3IKV A;  3CO6 C;  1QGP A;  1UB9 A;  2ZME B;  5ICG A;  4IRG A;  3MWM A;  5JFR A;  1B4A A;  3SZT A;  3K2Z A;  3E3V A;  4L18 B;  2R3S A;  3CLO A;  4HX4 A;  5D5X B;  5D6E A;  3FMR A;  2ZO4 A;  2NNN A;  4RB1 A;  4I98 B;  4EGZ A;  2KRF A;  5L3G A;  1J59 A;  4RAZ A;  4ON0 A;  1D5V A;  1Z6T A;  3CTA A;  1MZB A;  1Y0U A;  4UNO A;  4P5O A;  3D0S A;  4RB2 C;  4M74 A;  1VTN C;  2JT1 A;  4UVA A;  2EFN A;  5DCF A;  2QZ8 A;  3J81 K;  1ZRC A;  1BIB A;  5L3E A;  4KDP A;  3GF2 A;  1S6L A;  1XDU A;  2FU4 A;  2FE3 A;  4HF1 A;  1PDN C;  2J5O A;  2CG4 A;  1T7D A;  1ON1 A;  3QP5 A;  3F8M A;  1UFM A;  2O8X A;  1S29 A;  1U6G A;  1FY7 A;  1YQA A;  1PUE E;  2HFH A;  2MH9 A;  5FFX A;  1E2X A;  2GQQ A;  3EDP A;  3HTS B;  5HS8 A;  2RV8 A;  3TOA A;  4JK1 X;  2J5P A;  4CXF A;  5D4S A;  1OPC A;  2ISZ A;  4YFN F;  5IT9 Z;  2YX4 A;  3REO A;  1IRF A;  4ZZL A;  2PFB A;  4BHC A;  4KFC A;  4EJV A;  4ENJ A;  3WTV C;  1BI1 A;  2FMY A;  2MLG A;  3WTS C;  3N97 A;  3FMS A;  2VOD A;  3ZMZ A;  4NB5 A;  4LB5 A;  3ZN0 A;  2PMH A;  1SD6 A;  1V3F A;  5BQT A;  1KA8 A;  3KCC A;  2LDU A;  5LEK A;  2Z3Y A;  1XMA A;  3BY6 A;  4IRH A;  1G4D A;  5TRD A;  1FBS A;  1QPM A;  5L3F A;  1O7F A;  2XKO A;  5FLX Z;  3WE3 A;  1R1T A;  4EJO A;  4BHB A;  3DFG A;  4G7H F;  5J6X A;  3GX4 X;  1WI9 A;  1R58 A;  4HBL A;  4KIG A;  2H6B A;  4AD9 A;  2E7W A;  4M9X A;  2XGX A;  2JPC A;  1WKM A;  3ULQ B;  1JE8 A;  3I64 A;  3ELK A;  4F7Z A;  1DPR A;  1FBU A;  3CDH A;  2O03 A;  1T98 A;  2IA0 A;  1GXP A;  3ABU A;  1ZAO A;  1L3L A;  3OOP A;  1R1U A;  2F2E A;  4HOB A;  2L3D A;  3R0J A;  3GFI A;  2ETH A;  3RJP A;  1ZGA A;  1YFH A;  2IA1 A;  4YG2 F;  1GHC A;  1Q1H A;  2CQK A;  2M30 A;  4HQM A;  2VN2 A;  2NNY A;  4KMU X;  5J8F A;  1V4R A;  5DDG A;  3GZ6 A;  3QRF F;  2ZME A;  1TLH B;  4LK1 F;  1R5H A;  3JSO A;  3ZQ7 A;  2LKP A;  3G3Z A;  1ZHF A;  1YW7 A;  2QBY A;  3COA C;  1QZY A;  2V1U A;  4LLN A;  5D5W B;  3ZP5 A;  5ICF A;  2LF8 A;  1P4W A;  1TQM A;  2DW4 A;  3HHG A;  4WK8 F;  1GVJ A;  3WTW C;  1FBQ A;  4ZYE A;  1P4X A;  5JHU A;  4LK0 F;  4CYD A;  4GYG A;  3PFI A;  2OQG A;  3GLX A;  3BWG A;  3P9C A;  4ZYD A;  1LEA A;  2IA2 A;  3J80 K;  1TTY A;  4PGG A;  5FGM A;  4D0P A;  2QQ9 A;  1ODD A;  3DEU A;  1Z6R A;  2MC3 A;  4I02 A;  4G8X A;  1FYK A;  1YG2 A;  4M9S A;  3KE2 A;  3IRQ A;  2DBB A;  2FBH A;  1YW9 A;  2OA4 A;  2FA5 A;  1UMU A;  5D4R A;  5ILV A;  3K1P A;  2STW A;  4G6D A;  3RIR A;  3HYI A;  4EMS A;  1P4A A;  1S7A A;  2EA2 A;  4AVP A;  3H3U A;  2EJR A;  1EV7 A;  1FP1 D;  3SHF A;  2DLL A;  3KEO A;  1LNW A;  2DT5 A;  5J8C A;  4NHJ A;  1YLF A;  3CUQ C;  4A2U A;  4G94 A;  3FMQ A;  2XRN A;  2BEO A;  3SFZ A;  2WC2 A;  5JI6 A;  1O3T A;  1ZRF A;  2AS5 F;  2PMU A;  4RAY A;  4A0X A;  3RPU A;  1U8R A;  4OOI A;  1J2X A;  1GXQ A;  4CZZ A;  1I6X A;  1ONV A;  2RVC A;  4HX8 A;  4U0V A;  3V8L A;  1C0W A;  3IC7 A;  2V1X A;  3NEU A;  4IRI A;  1B6A A;  1YW8 A;  1SMT A;  1T2K A;  1O3S A;  5LBQ A;  5H20 A;  1QNT A;  3HTU A;  2L4M A;  2Q8K A;  4EM2 A;  1BI2 A;  3R0A A;  5L3D A;  1PP8 F;  6PAX A;  3FM3 A;  2CGP A;  2EFO A;  1MGT A;  3CJN A;  4NQW A;  3KP7 A;  1KU3 A;  1I4V A;  4N0B A;  3F8N A;  1OYW A;  1SFX A;  3ZMS A;  1FWZ A;  3TO9 A;  2KIU A;  2P6T A;  2HGC A;  1TBX A;  2EV5 A;  3H92 A;  4FX4 A;  2FOK A;  3M8E A;  4L9N A;  3C7J A;  3DPT A;  4IHS A;  1J75 A;  2QBY B;  1F1Z A;  1KU7 A;  2H94 A;  1W7P D;  3EQL F;  1FOK A;  2OZU A;  2XAG A;  4EM1 A;  2XAQ A;  1WWX A;  2G9W A;  1IW7 F;  4FT8 A;  1TW3 A;  1P92 A;  5FO5 A;  3RTR A;  1EH6 A;  1BIA A;  3E6B A;  3JW4 A;  4WF2 A;  2FJR A;  3IKT A;  3KZY A;  1IN5 A;  2FEZ A;  2D45 A;  4R79 A;  1MDM B;  3QOP A;  2MBF A;  3RKW A;  5BMZ A;  1IAW A;  5BPI A;  1XN7 A;  1EH8 A;  4CHU A;  5FD5 A;  2VE8 A;  1JGS A;  4RB0 A;  4LG0 A;  1XSV A;  4I7H A;  4M6Y A;  2A3S A;  3RKX A;  1T39 A;  2GA1 A;  1IXS B;  1R5G A;  3K0L A;  3I4P A;  3IIQ A;  1FYM A;  1XDS A;  3GO5 A;  1BBY A;  1YO5 C;  4O5V A;  1B59 A;  3DPL C;  4O3M A;  4M73 A;  2B0L A;  4A12 A;  3V7C A;  4IJA A;  1LDK B;  3LA3 A;  2X4H A;  1MJ9 A;  3WTT C;  4R1H A;  1K79 A;  4ME8 A;  5LHI A;  4BYY A;  1J7K A;  4G7O F;  2YSR A;  2R7D A;  2LSO A;  4LMY A;  1OR7 A;  4S04 A;  1JHE A;  4KT5 C;  5JR3 A;  1J5Y A;  3Q9S A;  2XKP A;  3MZH A;  1R7J A;  4L0Z B;  2L01 A;  4BHP A;  4UVC A;  2R7F A;  2XV4 S;  1SAX A;  2EFQ A;  1DUX C;  3ECH A;  3H3Z A;  4JQF A;  1DDN A;  5F1R A;  4L9J A;  1TNS A;  4ESF A;  2O61 A;  1L0O C;  5ED4 A;  2EFW A;  1PP7 U;  3BOQ A;  2XAS A;  3KP4 A;  2VBZ A;  4A6E A;  2L4A A;  3VOD A;  3WOD F;  3MAJ A;  2HQR A;  4UUV A;  4KYW A;  4L9V A;  3I59 A;  5HLG A;  1ZG1 A;  1ZG3 A;  4BH9 A;  4MNU A;  2PEX A;  5DCM A;  1BI0 A;  5KVR A;  1XMK A;  5D8L B;  4WXC A;  3P9I A;  1YYV A;  2AXL A;  4JBA A;  3HHH A;  4N9I A;  4GGG A;  3LWF A;  2RC4 A;  1BN5 A;  5FFZ A;  3RDI A;  2IT0 A;  4HZF A;  2HWV A;  2KIM A;  3QU6 A;  3JTH A;  2A07 F;  2FQ3 A;  1ZN2 A;  2K02 A;  4AIJ A;  3KEQ A;  5HDG A;  2ACJ A;  2STT A;  1EH7 A;  2HO0 A;  1SD7 A;  3HSE A;  4P9F A;  3BJO A;  4EVI A;  1FT9 A;  5HS9 A;  1O3Q A;  1XD7 A;  4HF0 A;  1KU9 A;  4Y13 A;  1DPU A;  5LGT A;  1P6R A;  2C6Y A;  5AON A;  2NRA C;  5IT9 K;  2RGV A;  1ZGJ A;  1KQ0 A;  5CVR A;  2PG4 A;  2DK8 A;  1CF7 A;  1AWC A;  4BQA A;  4HF2 A;  1H9G A;  3J81 Z;  3BPX A;  3M1E A;  2V9V A;  4I09 A;  1UHM A;  2OD5 A;  1HKQ A;  4G6Q A;  3PQJ A;  3GYH X;  2M8E A;  1O7L A;  3KP5 A;  3GEZ A;  2OU2 A;  3WE2 A;  3ABT A;  4AIK A;  5ICC A;  3E97 A;  3NRV A;  1HKS A;  3S2W A;  1UST A;  1YTY A;  2CO5 A;  2W24 A;  4KUM A;  2QVO A;  1K78 A;  3TOB A;  3T0Y A;  2QM3 A;  3CUQ A;  2WV0 A;  1O57 A;  2QQB A;  2TDX A;  1U5T C;  4PGH A;  3HRU A;  4CIC A;  4IVN A;  4ASN A;  2CFX A;  2WTE A;  2MH2 A;  2FBK A;  5CVI A;  2FF4 A;  3TDU C;  3WTU C;  2HYF A;  1IN8 A;  2E7X A;  3CO7 C;  5AIQ A;  1KU2 A;  1I27 A;  4Q4Z F;  3GUD A;  2BV6 A;  4A5M A;  5HDN A;  5FLX K;  2M5W A;  4UV8 A;  2HNF A;  3MCZ A;  1HKT A;  4KA4 A;  1E17 A;  1MKM A;  3HOT A;  4HDU A;  2EFP A;  1J9I A;  4PZJ A;  3WU1 B;  1F4K A;  2FBI A;  4XLP F;  4HDV A;  4I01 A;  2Q0O A;  4YFX F;  3D5L A;  5DEQ A;  2RQP A;  2VXZ A;  1T0F A;  4G9Y A;  1FP2 A;  5LHH A;  1K7A A;  3J7A O;  1MDM A;  4ENN A;  3BDD A;  2CWE A;  2G7U A;  5D6F A;  1SD5 A;  1ZH5 A;  2RDP A;  2ZKZ A;  4IPA A;  3G73 A;  2IJL A;  1QO0 D;  5FB2 A;  1LB2 A;  1IZ1 A;  2ELH A;  4OMZ A;  3SXY A;  4H0E A;  3GWZ A;  1X3U A;  3P7N A;  2HDC A;  3I53 A;  1P2F A;  2YR2 A;  1IN7 A;  3GXO A;  4XRF A;  4N9H A;  1XGN A;  1LVA A;  5IT3 A;  3T8R A;  3JAM K;  2EV6 A;  3B02 A;  1USS A;  5BPD A;  3RYP A;  1G3Y A;  1U3E M;  3NQO A;  2UWM A;  2F5D A;  5ICE A;  1REP C;  3F6V A;  3ISP A;  2ZJ2 A;  4FHT A;  2X0L A;  3VFZ A;  5FD6 A;  2BE5 F;  2IP2 A;  3LA7 A;  2CSO A;  1FSH A;  2A61 A;  2OQR A;  3L00 A;  4YII A;  3KLN A;  5LHG A;  2KKO A;  4EM0 B;  1LJ9 A;  2Y0M A;  4RB3 C;  2GZW A;  3K1N A;  4HLY A;  2DU9 A;  3CUQ B;  2H27 A;  1R00 A;  2OAZ A;  4DQ2 A;  1H9T A;  1D8K A;  5EEH A;  2KIF A;  4IF4 A;  4NV4 A;  3KZZ A;  3F6O A;  1WQ2 A;  1U78 A;  2HZT A;  3BPV A;  4OU0 A;  4I2O A;  4HLX A;  3V8J A;  4ETS A;  5F64 A;  3LA2 A;  3U1D A;  1HBX G;  4U88 A;  2ADU A;  3WTX C;  5E18 F;  2BBY A;  2F5E A;  1RIO H;  2VBW A;  1RUO A;  3RKY A;  1JHC A;  3WGH A;  1ZG5 A;  3GVA A;  4QWQ A;  5DUK A;  2HOE A;  3WG9 A;  3C3W A;  2PBI A;  1BJA A;  5H6R A;  1FSE A;  3KP2 A;  2DK5 A;  1I1G A;  4WXD A;  2DQL A;  2DTR A;  2F5F A;  2HR3 A;  2Y48 A;  2A6H F;  1BI3 A;  3Q5F A;  1B12 A;  1OYI A;  5E1Z B;  1IXR C;  1RZ4 A;  2A6E F;  1BC8 C;  2FNA A;  3PQK A;  1JXS A;  4O6J A;  2ESH A;  3F22 A;  3U9G A;  1TNT A;  2XRO A;  2D1V A;  2ZNY A;  3MFK A;  2Z5U A;  3ECO A;  4ZZD A;  2IPQ X;  5LGN A;  4MQV A;  3BDN A;  1XSD A;  4K8W A;  3V4G A;  2F5C A;  2UXN A;  4HAM A;  3QAH A;  2PI0 A;  1KQ9 A;  2YPR A;  1BOA A;  1HW5 A;  3IWF A;  1I1S A;  2XAH A;  3M8F A;  3ZN1 A;  1Z9C A;  1MJA A;  2PLY A;  4TV7 A;  2VT3 A;  1S3J A;  1F39 A;  4KIB A;  1YS7 A;  2VBY A;  2GAU A;  1UCR A;  1LEB A;  2KJC A;  2NAZ A;  1IXC A;  2P7V B;  3L9F A;  3HUG A;  4RGX A;  4K2E A;  1YIO A;  3FF5 A;  4MEY F;  3TGN A;  5ERI A;  2GWR A;  4MGR A;  3M7G A;  5E20 A;  4L5I A;  4XBF A;  2E1C A;  2HTS A;  4YFK F;  4IXA A;  2PJP A;  5BS6 A;  3W6J B;  2E1N A;  1QZZ A;  2DFI A;  2GXG A;  3DV8 A;  2JPB A;  4OIN F;  3ERE D;  3W6K B;  5DV5 A;  2QUF A;  3O6B B;  3T5X A;  5DD4 A;  3LQQ A;  5KK1 A;  2XVC A;  2GXB A;  2K86 A;  3E6D A;  3WTY C;  2QWW A;  4EGY A;  2W84 A;  1RUN A;  4MTE A;  2EK5 A;  1FZP B;  3Q9V A;  1WSU A;  1OKR A;  1B9N A;  3S04 A;  1R1V A;  1W7P B;  1K6O A;  1XGO A;  2MLK A;  3FM5 A;  4EJU A;  4E70 A;  2ISY A;  4RGR A;  3VOE A;  2EB7 A;  1FLI A;  5LLQ A;  3LFK A;  4M6X A;  2DO7 A;  3JAM Z;  5K1Y A;  4WWC A;  2BGC A;  2Y75 A;  1ZAR A;  1XGM A;  1F9N A;  4QLC U;  4WX9 A;  2V6C A;  4LG0 B;  2P5K A;  3FXR A;  2W85 A;  3V8K A;  3T8T A;  3GW2 A;  3TO7 A;  1HXD A;  1Z91 A;  4UXN A;  4EJW A;  3HRT A;  5DYM A;  4MTD A;  2COM A;  3KFW X;  2ZBK A;  3WTZ A;  4CDG A;  3I0T A;  3WGI A;  3K1M A;  4OIO F;  2IW5 A;  3CUO A;  1TQI A;  3U2R A;  3I54 A;  2HKO A;  5CVU A;  1R22 A;  4BAY A;  3KLO A;  2HKX A;  4U7B A;  1G3W A;  3EET A;  3F8C A;  3LAJ A;  2ZXJ A;  4ZYG A;  3IRR A;  1B1B A;  4XSZ F;  1XCV A;  2FNP A;  1MJB A;  4KNY A;  5EEG A;  4ESJ A;  1OMI A;  2FRH A;  2JRT A;  3TDZ C;  1HST A;  4KMF A;  5LRR A;  5JVT A;  1CF7 B;  5DD8 A;  2P6S A;  1H0M A;  2JZY A;  2Q2E A;  1KN9 A;  4MQ9 F;  1FC3 A;  3EYI A;  2HQN A;  2QLZ A;  3KET A;  1R36 A;  1YS6 A;  5D5V B;  5H6Q A;  4BXU A;  2GA2 A;  1IN6 A;  4HX7 A;  1ZYR F;  2OBP A;  3F21 A;  1SFE A;  3QPH A;  2HYG D;  2DPU A;  4U0W A;  3ROU A;  4AWX B;  1KGS A;  4WXH A;  4U7D A;  2VOO A;  3ZMD A;  1KYZ A;  4GCV A;  2V1D A;  1FPQ A;  3J80 Z;  3F23 A;  2DPD A;  1FYL A;  1DP7 P;  4RGS A;  2A5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...