3JSOA

Classic protein with a new twist: crystal structure of a lexa repressor dna complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
188
Chain Sequence
b'KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLGLPLVGRVAAGEPLIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LexA repressor
publication title Structure of the LexA-DNA complex and implications for SOS box measurement.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase/dna
total genus 45
structure length 188
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jsoA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3jsoA02
1IXSB 1LDDA 1XSXA 4G9YA 1V3FA 2ETHA 2BGCA 4RS8A 4P96A 3N4MA 2H27A 1J59A 1J0RA 3QU3A 2V1XA 1HW2A 1QBJA 1G3SA 3ZMDA 3FXQA 3C1DA 4XBFA 2OU2A 2H6CA 3KP5A 2RVCA 2XIGA 1OPCA 2KIFA 4GCVA 3TQNA 2XGXA 1QNTA 3L9FA 4L0ZB 4BHBA 1ZARA 4IHTA 5H6RA 4EJTA 3F8NA 1USSA 2PMUA 3ABUA 2RDPA 5CJ9A 1TNTA 2QBYB 2HZTA 1P4WA 5IT9Z 2P6TA 3OV8A 2JT1A 4HYEA 5A2QZ 2FJRA 3D0SA 1FSHA 4A6DA 4RGRA 2QLZA 2KIMA 3V8LA 1XSVA 1KA8A 1Q1HA 1LVAA 4F7ZA 1I1GA 4EGZA 5JI6A 4HOBA 1Z91A 3S2WA 1OKRA 2FNPA 2W84A 5LRRA 3I59B 4XLNF 1UMUA 3GFMA 4HW0A 1F5TA 3WG9A 3ISPA 3ECOA 3DQVC 4KUMA 1KGSA 4B09A 2Z99A 3WODF 4IXAA 3N97A 2IT0A 3V8KA 2P7VB 1Z05A 4ZYGA 4FHTA 3EYYA 3M8FA 4FX4A 4ZZDA 2W57A 2LKPA 3T1BA 3KP3A 4B8XA 3BOQA 5LRSA 3FM5A 3P9CA 1ZRDA 3DP7A 2MLGA 1FWZA 3IKTA 5E8GA 3LQQA 2HKOA 3SHFA 4EJWA 4OIPF 1Z7UA 1GVJA 3BDDA 3REOA 1TQIA 2EFOA 2D1HA 2HQNA 3KP2A 5FGMA 3WE2A 1FSEA 3COAC 2F5EA 3JAMZ 2R3SA 2FEZA 1I4VA 2YX7A 3L7WA 4LMYA 3E97A 3P9KA 5L3GA 2GXBA 4ZYHA 3J81Z 1IRGA 4QWQA 4OMZA 1KU7A 3SZTA 1W5SA 5ICFA 5D6EA 3M9AA 1UHMA 4ENNA 2HEOA 3B73A 1R1TA 3K0LA 3LAPA 1WWXA 3WU1B 4EQQA 5DDGA 5LBQA 2GIVA 3TO7A 3DPLC 3FMSA 5ILSA 3GFJA 2IVMA 5D5XB 4BH9A 4MTEA 2ADUA 3HOTA 4U0YA 4AIKA 4I7HA 2GZWA 4YG2F 5LHHA 2FSWA 3ABTA 2YSRA 5D6FA 4ON0A 3WU0A 2OZUA 5LHIA 2NAZA 3K9TA 4MHGA 3FF5A 1SD5A 3JTGA 5L3EA 1U78A 1T98A 1FZPB 1OR7A 1FYLA 5JR3A 2COMA 4KIGA 3I53A 3ZN0A 2HFHA 3CUQC 5HLIA 2D1VA 2IW5A 4M9XA 4YFXF 4LG0A 1DPRA 5E1XA 4MEXF 4MNUA 5A2QK 5ICGA 4IHSA 4PDKA 2M30A 4L18B 2AS5F 2OAZA 1LB2A 1STZA 3GFLA 2FBKA 3CJNA 5LHGA 1R58A 1XGMA 4A12A 3MCZA 2P8TA 1D5VA 4K2EA 5E1ZB 1KU2A 5L3CA 1MJBA 1RIOH 2RQPA 4KICA 1XD7A 4GGGA 3E6DA 2IRFG 4BHCA 4CZZA 5F1RA 2ZNZA 4UV8A 4BYYA 2PMHA 2XROA 4KNYA 3LWFA 3W6KB 5J8FA 3NEUA 5E20A 3WTZA 1ZRCA 3WTYC 1TTYA 1G4DA 2DK8A 2NS0A 1V4RA 3FMRA 1B59A 1XDSA 3ZPLA 1X3UA 5HOOA 3NRVA 4IF4A 4JBAA 3D5LA 3T0YA 1WI9A 3LA2A 1MD0A 2JTVA 5CVRA 3GW2A 2VBXA 2EK5A 4A0YA 2GAUA 1ON1A 4U0VA 5IT3A 1ZG1A 3IC7A 4OINF 4KIFA 3JAMK 3M1EA 3P9IA 2RKHA 4PGHA 2A61A 1U3EM 1KQ9A 1FLIA 1YW8A 5E17F 2YX4A 5FD5A 1YLFA 1T6SA 2HNFA 2ZO4A 2VC1A 3HHGA 3E5QA 3J81K 2UXNA 1BIAA 1JGSA 3LFKA 2HTJA 2WC2A 3G73A 1GXQA 5FO5A 4IJAA 2Z33A 3E5UA 2M45A 1B6AA 3V7SA 3R4KA 4MGRA 1SD7A 3ZMUA 4AIHA 4KT5C 3SXYA 2VBWA 1UB9A 4U0WA 1CGPA 5ILVA 1W5TA 2DAOA 2F2EA 4ZZLA 5FFXA 3R0JA 3G3ZA 4I09A 4M71A 3ERED 2ZKZA 2O03A 2OA4A 5JFRA 2P6SA 3IIQA 3Q9VA 1J75A 2V79A 2F5FA 4WXCA 2VODA 1OYIA 2PG4A 2LNBA 4KMUX 2GA2A 3RKXA 1EH7A 3MWMA 2K02A 4CXFA 5HVQC 5D5VB 3TOBA 6PAXA 3ZQ7A 1E17A 3BDNA 2CYYA 2UXXA 2Z5UA 4Y15A 5ERIA 4EV0A 3WTTC 1GXPA 1R00A 5LGNA 4EVIA 1BC8C 2Q0OA 3CLOA 1Z1DA 4EMSA 1BIBA 1P6RA 3O6BB 1S8NA 3K2ZA 2Z9OA 2FF4A 4H0EA 3IRRA 4KFCA 2FQ3A 5DEQA 1ZREA 4UVAA 2QYOA 3U2RA 1D3YA 3TO9A 3MZHA 3U1DA 4Q4ZF 1OYWA 2TDXA 2W24A 3RYPA 3C7JA 1SMTA 4HQMA 2FXAA 1HBXG 4YIFA 1S6LA 4HQEA 1BM9A 3QPHA 4O6JA 1ZLKA 2EFPA 1IUYA 1USTA 1D8JA 3BROA 4M6YA 1T39A 1KCAA 4YFNF 2XVCA 2WWYA 3M7GA 4I2OA 2E7XA 3EUHA 2OBPA 5LLQA 4ENJA 5DCMB 3F6OA 3EQLF 3VODA 3HSFA 2VOPA 4ENMA 2BYVE 5F64A 1MDMA 1R1UA 3GEZA 5AIPA 2LF8A 1XN7A 4RGXA 1LDJA 3E6MA 2VC0A 5J6XA 4MQ9F 4BQAA 2XAFA 4XSXF 1LEBA 2G7HA 1BC7C 3DV8A 1AWCA 4WXHA 1JHFA 1FC3A 2VE9A 2VN2A 3QP5A 1U8RA 5HDGA 4XLPF 3FM3A 1IN7A 4HF1A 1T2KA 4P5OA 4G7HF 1AY9A 1CF7A 3HHHA 3F72A 4GYIA 4O5VA 4ASNA 3BPVA 5FLXZ 3VB2A 3GX4X 2F5DA 3HRUA 3CUQB 3ULQB 2R7DA 2A68F 3BWGA 2ISYA 5TJJA 1B4AA 1P4AA 1LJ9A 4GYGA 1R7JA 4DNCA 2DO7A 1TQPA 2DQLA 2D2WA 4L9JA 3E3VA 3Q5FA 3O2PE 3CTAA 4HF0A 4NV4A 1HXDA 3GF2A 3WGHA 2NRAC 1KU3A 1I6XA 3KP4A 2XAQA 2CO5A 2G7UA 2X4HA 5D5UB 1ZG3A 1FPQA 1XCBA 4ESFA 4AVPA 2WV0A 4HDUA 2EFQA 1W7PB 1FYKA 1U5TA 1UFMA 4L5JA 3KLNA 4UXNA 3B02A 3BJOA 2A07F 1BI0A 1TLHB 2O3FA 2V1UA 5BPIA 4OIQF 3F22A 1YS6A 3DEUA 1BN5A 3MAJA 1B9NA 2MC3A 1FNNA 3EYIA 2K27A 2JZYA 5BOXA 1S7AA 4I0BA 3ZMVA 4Q48A 4NQWA 3T5XA 4HZFA 1JE8A 2DPDA 1R5HA 1JHHA 1H9TA 4P55A 3I54A 4EJVA 2EFNA 5HLGA 4LLNA 3C3WA 3HTSB 2ACJA 1SD6A 4UNOA 4S04A 1MKMA 4EJUA 2D45A 1ZAOA 2FBHA 1BJAA 4HLXA 3R6SA 5AIQA 2K4JA 3DXJF 4CICA 4CYDA 2PN6A 2XRNA 4N9IA 1KQ8A 4PGGA 3HRSA 2ZMEA 3M8EA 5EEHA 2DT5A 2O6GE 1RUNA 5EEGA 4ESBA 1WKMA 1IN6A 1WQ2A 3RI4A 4LFUA 3VFZA 1UCRA 4P9UA 3F3XA 4AD9A 1YIOA 1IAWA 3CDHA 4MEYF 4ENKA 4OIRF 2HDCA 2E1NA 4A0ZA 4G7ZF 5FLXK 2VT2A 1HKTA 4G7OF 3J80Z 2L02A 1ON2A 5K5OA 4G94A 3JSOA 2QBYA 2KKOA 5K1YA 2FNAA 3BY6A 4CO8A 1R5GA 4G6DA 5JHUA 1FBSA 4XRFA 3F23A 4L9VA 3BJ6A 4U7BA 1YW7A 2PBIA 2PI0A 1F1ZA 1D8KA 4A6EA 2XV4S 1BBYA 2KIUA 2M5WA 1L0OC 3I59A 1S3JA 3DPTA 2MA3A 4LB6B 4HF2A 2XAHA 2ZXJA 4I0AA 1T7DA 2DTRA 2PQ8A 1K79A 1P2FA 3MZYA 4I01A 1LEAA 3T8TA 3KZZA 5H20A 3HOSA 2EV0A 2F5CA 2DI3A 2L54A 2HOEA 1I27A 1PUEE 1HKSA 1BOAA 2PFBA 3LQRA 4BAYA 2FE3A 5HS8A 2Y0MA 4LB5A 3HUGA 4KN4X 3MEXA 4HDVA 4GXOA 5BMZA 1ZGJA 4Q47A 2IA0A 2JSCA 2HKXA 3V4GA 3SQNA 3BPXA 2J5PA 2P5VA 2GA1A 4EM2A 4UVBA 5ILUA 2RGVA 1OYYA 2Q8KA 1Y0UA 3QAHA 3F21A 1FX7A 3HSEA 3FX3A 4RGUA 3I5UA 4ETSA 1XSDA 2DU9A 3BZ6A 1ZRFA 3F8CA 3PQKA 2HYFA 5AONA 1ZG5A 1HSJA 5LGUA 2QQBA 1Z6RA 2Y75A 5TRDA 4ZYEA 1HW5A 2ESHA 2RV8A 1IZ1A 1FP2A 1W4MA 2M8EA 3DKWA 4R8HA 3WE3A 1QZYA 1FYMA 2Y48A 2EJRA 1OMIA 3KETA 4TV7A 2CFXA 4Q5SF 1BI3A 2L3DA 5BQTA 4IRIA 2HS5A 3V8JA 3GZ6A 2VT3A 3QOPA 4EM0B 4WWCA 3R61A 2DK5A 2HR3A 1GHCA 1H9GA 2EB7A 3GFIA 3Q9SA 2B0LA 1XGOA 1SFXA 3WTWC 5ICEA 4BNCA 2ZBKA 2PEXA 4M72A 1YO5C 3LA3A 2HWVA 3TOAA 4RAYA 4JK1X 3IWZA 2CSOA 2CWEA 4D0PA 3DFGA 5DD8A 1J9IA 3J80K 1ZGAA 2P7CB 2IPQX 1R22A 1XB4A 1LDKB 5E18F 1G3TA 5D5WB 4HX8A 4AIJA 2CQKA 3F8FA 4Y17A 1LNWA 4OIOF 3WTVC 5K5QA 2MD5A 3FWEA 2O8XA 3IHUA 1MJAA 3EDPA 2FOKA 3I4PA 3I58A 4KIBA 1ZLJA 1E2XA 1U2WA 1WRJA 3JSPA 3H92A 1O3TA 4R79A 2FMYA 3GO5A 1NHAA 3ROUA 1J5YA 3ELKA 4ESJA 2EV5A 2P5KA 1KYWA 2V9VA 1PDNC 3F8MA 2FBIA 2ZJ2A 3WTSC 4M9SA 5CVVA 3JTHA 1JHEA 2JPBA 2QUFA 5DV5A 3JW4A 5ICCA 2M1BA 2YU3A 2FKDA 2QENA 5DCFA 2K7LA 4KYWA 1SD4A 3K69A 4KDPA 3KP6A 4HLYA 4A5MA 2HTSA 3HIFA 2FU4A 2IA2A 4IRGA 5DUKA 1MGTA 2Q2EA 2OZ6A 5L3DA 3V7CA 4KN7X 1FT9A 3OOPA 4IVNA 3KZYA 5KK1A 4K8WA 5FD6A 4YFKF 4L5IA 3QU6A 3BJAA 1ODDA 1RUOA 3RPQA 4G8XA 3E6BA 1FY7A 4U7DA 1HSTA 5CLSA 4Y13A 2IJLA 2EFWA 5E8IA 1U6GA 4RB2C 4HBLA 3F6VA 1QQIA 2KJBA 1SAXA 5DYMA 5BPDA 3GXOA 4U88A 4XSZF 4LG0B 4A5NA 1O3SA 1TBXA 1JHCA 2Z3YA 5D8KB 1RNLA 3I71A 3TDZC 2L4AA 4LD5A 5L3FA 2BV6A 4WX9A 2CG4A 2NYXA 5CVUA 4M74A 2YR2A 2W25A 1O3QA 2L01A 4HX7A 3SFZA 4HV6A 2XKPA 5JVTA 3WTXC 4ME8A 3LAJA 1T38A 3K1MA 1QGPA 1U5TC 3VOEA 3J7AO 3GUDA 5DD4A 2H6BA 4UV9A 1XMKA 1QPMA 4YIIA 4CDGA 1ZH5A 2QVOA 1XMAA 1F39A 2VOOA 2NNYA 2XASA 1HQCA 2QM3A 3DF8A 2VE8A 2A5YB 2RN7A 2V6CA 1SFEA 4LLLA 4S05A 2EA2A 1A04A 2BEOA 4M9ZA 1S7OA 2IA1A 2O0YA 1G6NA 1W7PD 4OOIA 1L3LA 1DP7P 3L09A 3MQ0A 2GQQA 1B1BA 1IN4A 4LK0F 3HRTA 4N31A 2ZNYA 2QWWA 1KYZA 3KLOA 1IW7F 2ESNA 3RDIA 2A6HF 3P7NA 2H94A 2DPUA 1O3RA 1T0FA 4DQ2A 1TW2A 2MH2A 2E1CA 3E5XA 5FB2A 1DPUA 3HRMA 3IKVA 4NB5A 4ZH4F 2P4WA 3CO6C 2VBYA 1IN8A 3ZP5A 1B12A 3GWZA 5H6QA 4MTDA 3WTUC 4IPAA 2XAGA 2O61A 4P9FA 2EV6A 5DCMA 1XGSA 5HS7A 2RNJA 4WK8F 2BBYA 2R7FA 3U9GA 2MH9A 1S29A 1UHWA 1K78B 3QRFF 3RYRA 4KA4A 2V1DA 2VXZA 1Z9CA 2QZ8A 4OU0A 1FOKA 4LGWA 4A2UA 1TNSA 1IN5A 4L9TA 3H3UA 3BP8A 2MBFA 2VONA 1MJ9A 3RIRA 4RGSA 3GZ5A 4O3MA 2DLLA 1FBUA 2KJCA 5DUIA 2J5OA 2XHKA 2HO0A 4LLGF 2HYGD 4HX4A 3QP6A 1EV7A 1DDNA 3CUQA 5IT9K 2W85A 3GYHX 3AAFA 3W6JB 3I64A 2UWMA 5CVJA 2PJPA 1ZYRF 3K1NA 1XDUA 3KP7A 2C6YA 4HV5A 1K7AA 3E6CC 2KRFA 2LSOA 3RKYA 2HGCA 3LA7A 1PP8F 3FMQA 1R1VA 1R36A 5CVIA 3O3KA 1Z6TA 1O7LA 3C18A 5L3BA 3IWFA 5HLHA 1B9MA 1IRFA 1FBQA 2JRTA 2FRHA 3ZMSA 4RB1A 1G3YA 3ML6A 4NHJA 2K86A 4WXDA 4MQVA 1IXRC 1VTNC 2YPRA 3TKYA 4ZYDA 1BI1A 2DBBA 3L2CA 3FZVA 1W7PA 3TGNA 3CUOA 1REPC 3GLXA 1H0MA 2A69F 2JPCA 2G9WA 2XUBA 3QPTA 5J8CA 1P92A 1O7FA 3I0TA 3KFWX 2STWA 1IXCA 2DW4A 1MDMB 2QQ9A 1IF1A 3FXUA 1HW1A 3L00A 1C0WA 2ZCWA 1ULYA 4M6XA 2X0LA 2XAJA 2L4MA 3ECHA 2EA4A 2RC4A 2MLKA 4E70A 3WGIA 1KQ0A 2ISZA 5CYVA 2CW0F 3RKWA 3S04A 2GXGA 2H09A 3KEQA 3WGGA 4I98B 1G3WA 1CF7B 1BI2A 1MZBA 2STTA 2LF7A 5LEJA 4HAMA 1YYVA 3PFIA 2XKOA 1TQMA 1YW9A 4UHTA 1KN9A 2BE5F 4N0BA 5K5RA 4HA8A 4FT8A 5ED4A 3H3ZA 4EJOA 1ONVA 1EH6A 2OD5A 1P4XA 3FXRA 5HDKA 1J7KA 3MFKA 5KVRA 4WF2A 1YS7A 2GWRA 4GO1A 4L0YB 2VBZA 3VEPA 1ZHFA 4AWXB 1O57A 2E7WA 4Z2YA 3KCCA 4KMFA 4EGYA 1ZN2A 2FA5A 4A0XA 1K78A 1FP1D 2ELHA 1EH8A 2QQAA 1F9NA 1RZ4A 3GVAA 1WSUA 5LEKA 1YQAA 2FMLA 4RAZA 4FX0A 5FFZA 4WCGA 2ZFWA 1PP7U 1YG2A 3KEOA 1J2XA 3HTUA 3EETA 2CGPA 2K4BA 2A6EF 3RTRA 4OMYA 4LK1F 3LSTA 3T8RA 3HSRA 4N9HA 5LGTA 3F8BA 1R23A 3TO6A 2PLYA 3PQJA 1U5TB 5HDNA 1DUXC 2OQGA 4CHUA 3K1PA 1F4KA 1QZZA 2NNNA 1SFUA 2IP2A 1JXSA 2A3SA 1LQ1A 3ZN1A 1TW3A 5F6FA 3R0AA 5HS9A 1HKQA 2OQRA 4RB3C 5D4RA 4L9NA 2M87A 1XCVA 3KE2A 3ZMTA 2HQRA 5D4SA 1K6OA 4M73A 3RPUA 2LDUA 4R1HA 1AOYA 3TDUC 5D8LB 4IRHA 4QLCU 3IRQA 3IL2A 4PCQA 4PZJA 1XGNA 2P5LC 1I1SA 1RI7A 1KU9A 1SMYF 4LJZF 5E1WA 4JQFA 2UZKA 3HYIA 4G6QA 3FHZA 4UVCA 3CO7C 2AXLA 1YFHA 4RB0A 2WTEA 2DFIA 4I02A 5BS6A 3R60A 3SZPA 1QO0D 3ZMZA 4UUVA 4BXUA 3V7RA 3RJPA 2ZMEB 4BHPA 2DQRA 2EWNA 4EM1A 1YTYA 4CGZA 1I5ZA 3NQOA
chains in the Genus database with same CATH superfamily
1IXSB 2DFEA 1LDDA 3LNQA 1XSXA 4G9YA 1ITYA 4BUPA 1V3FA 4DBRA 2ETHA 2BGCA 4RS8A 4RLQA 5DM6F 3G4SI 4P96A 3I3LA 3N4MA 3G1MA 3CP8A 2H27A 1J59A 1SVLA 4UUSA 2VQLA 1J0RA 3QU3A 4NC6A 1WH5A 2CMPA 2V1XA 4UY8I 2VQGA 3MZ8A 1HW2A 3AG3H 1QBJA 4H4KC 5FRMA 1G3SA 3ZMDA 3FXQA 3C1DA 4PSWA 3JRIA 1A31A 4XBFA 1X1BA 2OU2A 1VQMI 3W2VA 2H6CA 1UG0A 3DBRB 3KP5A 4I99C 2RVCA 2XIGA 3BLYA 5K7FA 1OPCA 2KIFA 2PJRB 5FLVA 4GCVA 1CQTA 2F6CA 3TQNA 4CCKA 1IC8A 2XGXA 1QNTA 3L9FA 4L0ZB 4BHBA 1ZARA 1VQOI 2DMQA 1Y39A 1YE9A 1FJLA 4IHTA 2E5ZA 3OYGA 5H6RA 5E3NA 1AKHB 2O8KA 2KHMA 4EJTA 3F8NA 1USSA 3ESWB 4PJJA 2JUCA 2PMUA 3ABUA 2RDPA 1K61A 4BY1J 5CJ9A 1YX3A 1TNTA 3OOUA 2QBYB 2HZTA 4NBQA 1P4WA 5IT9Z 2HVRA 2P6TA 3GLLA 2E1MC 3W6VA 2IBDA 2KZVA 3OV8A 2JT1A 3BCAA 4HYEA 5A2QZ 3LSIA 2FJRA 3D0SA 1FSHA 4A6DA 4RGRA 2QLZA 3DPUA 4BQNA 1Y0NA 2XF5A 2KIMA 3V8LA 2O5RA 4E4HA 3PNYA 4C3IJ 1XSVA 4G12A 4AC0A 1KA8A 2ELKA 1Q1HA 3NWSA 2VUMJ 1LVAA 4F7ZA 1I1GA 2A6TA 4EGZA 5JI6A 4HOBA 4BACA 1Z91A 2E34A 2LBFA 3S2WA 1OKRA 2FNPA 2W84A 1TT5B 5LRRA 3I59B 4XLNF 1UMUA 3BG6A 3GFMA 4DBQA 4HW0A 1F5TA 2PMZA 3WG9A 3ISPA 3ECOA 3DQVC 4D7NA 4KUMA 1KGSA 4ITVA 4B09A 2Z99A 2KIQA 3FKJA 3WODF 2K40A 4IXAA 3KYCB 4J00A 3K7AJ 1QHHD 3N97A 3GTQJ 2IT0A 1RKWA 3V8KA 2P7VB 1Z05A 4ZTFA 4ZYGA 3PSIA 2BZTA 1MH3A 1MBKA 4NUBA 4FHTA 4U87A 3EYYA 3M8FA 5C44J 4FX4A 3PSFA 5JLXA 4B4CA 4ZZDA 2CUZA 2W57A 2LKPA 3T1BA 3RZDJ 4AIDA 2R7SA 4BQOA 3DTIA 3KP3A 3OYJA 2COBA 2DTZA 5B3SH 4B8XA 4ZTJA 3HB9A 3G71I 2DXIA 3BOQA 2M9HA 3FM5A 5LRSA 3P9CA 4UB6C 2Q1ZB 3CQZJ 4D1QA 1ZRDA 3K70D 3DP7A 1D1BA 3S1MJ 2MLGA 1FWZA 3IKTA 5E8GA 1B72B 3LQQA 4Y4RA 1UG2A 2DDBA 3TW6A 2HKOA 4B3XA 1T0FC 3SHFA 1WJBA 4EJWA 4BDZA 1MBHA 3OR2C 2FOWA 3L2RA 4OIPF 1Z7UA 1GVJA 2B9SA 5B5EC 5KAFC 5FKMA 4DIQA 3BDDA 1EKEA 3REOA 3PIPF 2EBIA 5IYBJ 1TQIA 2X6WA 2EFOA 2JMWA 2DMNA 2D1HA 2HQNA 2VKVA 3KP2A 5FGMA 2DA5A 4FE4A 3WE2A 1FSEA 2XSJC 3COAC 1JJ6C 2F5EA 3JAMZ 2R3SA 2IS2A 2FEZA 1I4VA 2E2JJ 2YX7A 3L7WA 2IAIA 2W00A 4LMYA 4OWRB 4CUGA 2R7OA 2VQHA 3E97A 2GXAA 5GPCA 2EZKA 3P9KA 3CDLA 5L3GA 2GXBA 1Z0XA 4ZYHA 3J81Z 1D1CA 2AQEA 3CJTB 1IRGA 4QWQA 4OMZA 1KU7A 4MIMA 3SZTA 3ZR8X 1W5SA 2XF7A 5ICFA 2JA8J 5D6EA 3M9AA 4QSHA 1UHMA 4ENNA 1ETOA 2HEOA 2EZIA 1D0XA 3B73A 1R1TA 1TP4A 2ECBA 3K0LA 3LAPA 1WWXA 1XX5A 4C9YA 3WU1B 2CS3A 4EQQA 4QPQA 5DDGA 3JCUC 4DJAA 5LFAA 5LBQA 1ZELA 3Q0VA 2GIVA 3TO7A 1YIJI 3DPLC 3FMSA 5ILSA 3GFJA 4A3LJ 2XRLA 4FASD 2IVMA 5D5XB 4BH9A 1FOXA 4MTEA 2ZJQF 4BXFA 3ASNH 3KPHA 4BJ6C 4YIRX 1SANA 2HDWA 2KDZA 1MW7A 2ADUA 3HOTA 4U0YA 2X48A 2HOTA 3S16J 4AIKA 4I7HA 2GZWA 4YG2F 5LHHA 4A3CJ 2FSWA 3ABTA 4BE2A 2YSRA 5D6FA 4ON0A 3WU0A 2OZUA 5LHIA 2NAZA 3K9TA 3G2BA 4MHGA 3UNGC 3FF5A 1SD5A 3JTGA 4N4NB 5L3EA 1U78A 1T98A 1FZPB 1OR7A 1OCZH 3BR6A 2EZLA 1UJ8A 2DCEA 1FYLA 5JR3A 2COMA 4E7SA 1R6RA 4KIGA 3I53A 3ZN0A 2HFHA 3OS1A 1QVUA 3SEZA 3CMMA 3CUQC 2QEXI 5HNFA 5JHFA 5HLIA 3LSKA 4XL9A 3K4CA 1PVEA 2D1VA 2IW5A 2WY7Q 3GTKJ 5IYDJ 2L7FP 4M9XA 3SJMA 4A3BJ 4YFXF 2KISA 3A0HC 3S3OA 4ANJA 4FQGA 3K6GA 3HOVJ 3ZQGA 1E0EA 3QWLA 4LG0A 3OYNA 3GCMA 1DPRA 5E1XA 2ID6A 4MEXF 4MNUA 4F55A 5A2QK 5ICGA 4IHSA 1VQ6I 1ZK8A 5B1BH 4E7KA 4PDKA 2M30A 2VXDA 1POGA 2E2HJ 1VQNI 2M4GA 2KRHA 2AS5F 4L18B 2OAZA 3VWBA 1LB2A 1STZA 3FBNB 4CCOA 1E3PA 3GFLA 2FBKA 1UHSA 3BR3A 4F52A 3RPUD 3TW7A 3P5JA 1K4SA 3CJNA 5LHGA 1R58A 1XGMA 4A12A 3MCZA 2P8TA 1D5VA 4K2EA 2JUGA 5E1ZB 4X0GA 3CMEI 1KU2A 5L3CA 1MJBA 2ZXIA 1RIOH 2RQPA 1QU3A 4KICA 1S7EA 1XD7A 1JI8A 1MBFA 4GGGA 5EEAA 1D1AA 3E6DA 3OSFA 2IRFG 2DFHA 4BHCA 2ZNZA 4UV8A 4CZZA 4BYYA 5F1RA 2PMHA 2XROA 4KNYA 3LWFA 1K4TA 3LSPA 1W36D 1G59A 3W6KB 1ZTRA 5J8FA 3NEUA 5E20A 3WTZA 3IP4B 5IYCJ 1ZRCA 3ZQHA 1U0JA 1P7IA 3WTYC 4E7HA 1SFOJ 3A01B 1VI0A 1TTYA 1G4DA 4RAGA 2ZSHB 2DK8A 3ZQQA 5GTHC 1OJLA 1PUFB 2M7BA 2NS0A 2XB0X 3CC4I 2B7EA 5M3FJ 2CH0A 2KP6A 1V4RA 1UMQA 3BR0A 3FMRA 1B59A 1XDSA 3FDYA 2JK3A 3ZPLA 4RDUA 2JWTA 1X3UA 2RREA 5HOOA 3NRVA 3MMYB 2CUEA 4IF4A 3FBIB 3OIQA 4JBAA 3D5LA 3ZQIA 4A3JJ 1TWGJ 1WHUA 2M7AA 1JT0A 2L7MP 1WI9A 3T0YA 1OFCX 2I5UA 1TT0A 2EQRA 3LA2A 1MD0A 2JTVA 5CVRA 3GW2A 1I3QJ 2DA7A 4HRIA 2VBXA 5FKKA 2QKMB 4XOTA 2EK5A 2VJIA 4A0YA 2GAUA 1ON1A 4U0VA 1ETXA 5IT3A 1ZG1A 3IC7A 3VPRA 4OINF 3JRDA 1X19A 4KIFA 3V42A 3JAMK 2XC7A 2BW3A 3M1EA 2OC6A 3P9IA 2X6XA 2RKHA 3H9JA 4PGHA 1B8IB 2A61A 1U3EM 1OCRH 1KQ9A 1FLIA 1YW8A 5E17F 2YX4A 2E5NA 5FD5A 1LUJB 3BC8A 3OYKA 3S1NJ 4MFEA 1YLFA 1XS9A 2QF7A 1TL8A 1T6SA 3K4MA 2O7OA 2HNFA 2ZO4A 3HOXJ 3GTLJ 2VC1A 3HHGA 3E5QA 3J81K 2UXNA 1BIAA 4XLAA 1F43A 1JGSA 2WA0A 3LFKA 2HTJA 2EPFA 2CQXA 2WC2A 3K10A 2JA2A 3G73A 2IXSA 1FOWA 1Y8QB 1GXQA 3OIOA 5FO5A 2H8WA 4B47A 3JREA 2WAQA 4IJAA 4D5FA 2Z33A 2M34A 3S2HJ 1E3OC 4C3JJ 3E5UA 2M45A 1B6AA 3ZXSA 2XAUA 3NWTA 3V7SA 3R4KA 4MGRA 4ZYAA 2K85A 1SD7A 2GM4A 3RKQA 3ZMUA 2WAQN 4DOZA 5H2FC 2MD0A 1H8AC 4AIHA 3U1KA 4KT5C 3SXYA 2BXYA 1O4XA 2LLKA 2VBWA 1MMSA 1UB9A 2QGUA 4U0WA 1CGPA 5ILVA 2E1MB 3G1OA 1W5TA 2DAOA 2BY0A 2F2EA 2P81A 4ZZLA 2ZB9A 5FFXA 4EATA 3R0JA 2ZXWH 3M1CA 2MYSA 3G3ZA 2W4SA 1RR8C 4I09A 4M71A 3ERED 1K83J 2ZKZA 4PK4A 2R7TA 3O8HA 2O03A 3DLAA 2OA4A 3VYSB 1I39A 1BW6A 5JFRA 2P6SA 4JX5A 3IIQA 2E35A 4NC7A 1T95A 3Q9VA 1J75A 1LE8B 1MIJA 2V79A 2F5FA 4WXCA 2VODA 1OYIA 2P0WA 2PG4A 1JT6A 3CCQI 1M1EB 2WB1A 4V2GA 1MH4A 2LNBA 4XR6A 5EGOA 4KMUX 2GA2A 3RKXA 3JRGA 1EH7A 3AG1H 3MWMA 2K02A 1RETA 4CXFA 5HVQC 5D5VB 3TOBA 6PAXA 2UUZA 3ZQ7A 3CZ6A 1E17A 3BDNA 2CYYA 4X1EA 2NVTJ 1OLTA 2UXXA 2Z5UA 4Y15A 1DU0A 5ERIA 2B63J 3S93A 2ZFUA 3KYDB 4EV0A 3CCSI 3BCBA 4CYCB 3QPSA 3ABKH 3WTTC 5C3EJ 3ZQLA 2VPRA 4B48A 1GXPA 5TGTA 1R00A 5LGNA 2KRCA 4YRVA 2DYSH 2EIJH 4EVIA 2XDVA 1BC8C 2Q0OA 3CLOA 2FQ4A 1Z1DA 4EMSA 2EIKH 1VQ7I 4DGWB 1BIBA 1P6RA 3O6BB 1S8NA 3K2ZA 4IZZA 2Z9OA 3BQZA 4G6TB 1TWHJ 2FF4A 4H0EA 1J09A 3B6AA 3IRRA 4KFCA 1WJ5A 2HOSA 3QQAA 1S5LC 3JR9A 2FQ3A 3H5NA 5K7HA 4B44A 3BTJA 5DEQA 1ZREA 2DA1A 4UVAA 1LPQA 1D0YA 2QYOA 4PJLA 1MMAA 3ABMH 3U2RA 1D3YA 2GLOA 1ETWA 1YRNB 2D5VA 1X1DA 3TO9A 5IY5H 1SC7A 3ONQA 3MZHA 4V19K 3BG5A 3U1DA 2HI3A 4Q4ZF 2IS4A 3FK6A 3HPGA 3CF2A 4CH7A 1HDPA 1OYWA 2TDXA 3IAS2 2W24A 3RYPA 3C7JA 2HVQA 3CCJI 1SMTA 4HQMA 4HNTA 2FXAA 1HBXG 4YIFA 1S6LA 3RZOJ 4HQEA 3C2HA 1WVRA 3PNVA 1BM9A 2DMUA 3QPHA 5J4YA 3OYDA 4O6JA 1ZLKA 2EFPA 2Y69H 1IUYA 1N77A 3A03A 1USTA 2E2IJ 2JVHA 1D8JA 3BROA 4M6YA 2NVXJ 1T39A 1KCAA 4YFNF 4BGDA 2XVCA 3MKYB 2WWYA 4E7LA 3M7GA 4PJNA 3A01A 2E7XA 4I2OA 1BR2A 2R7WA 3EUHA 5FKLA 2OBPA 5LLQA 4ENJA 4JOMA 1S72I 5DCMB 4AM3A 3F6OA 2ZJPF 3EQLF 1DU6A 2W7NA 3VODA 3HSFA 2VOPA 5EJCA 2H8RA 2L0KA 2YS9A 5GAGJ 1LVKA 4ENMA 2BYVE 2DA2A 4W97A 1BR4A 5F64A 1MDMA 1R1UA 3GEZA 5AIPA 2LF8A 3RQ4A 1XN7A 4RGXA 1LDJA 3E6MA 3L2QA 1R9TJ 2VC0A 5J6XA 4A69C 4MQ9F 2R7ZJ 4BQAA 2XAFA 2W1OA 4XSXF 1LEBA 2G7HA 2Y9YA 1BC7C 3JRCA 3DV8A 2R5ZA 2MGQA 1AWCA 3HEFA 1DP3A 2FD5A 4WXHA 3FXJA 1JHFA 1G8XA 1FC3A 1IV8A 3RQIA 2VE9A 1DGWY 1U9NA 2VN2A 3QP5A 1U8RA 5HDGA 2HPMA 4XLPF 3FM3A 3J7AY 1JUSA 1IN7A 2HXOA 2HQAA 4HF1A 3PM1A 3PUBA 2LRDA 1T2KA 4IX7A 4P5OA 3CCLI 4G7HF 1AY9A 1CF7A 3HHHA 3F72A 4GYIA 1Y6IA 4LIUA 4O5VA 3VYRB 3IUOA 4ASNA 3BPVA 3I4NJ 5FLXZ 3VB2A 5IP6A 3GX4X 2X1CA 2F5DA 2K9NA 3HRUA 5FLMJ 3CUQB 2CW8A 1OCTC 2NOGA 2VL8A 3ULQB 1WCMJ 1HF0A 2BHZA 4II2A 2R7DA 3D5RC 4W1UA 3KYLA 2A68F 2FUG2 2X6YA 3H0DA 3BWGA 2ISYA 5TJJA 3OYLA 1B4AA 1P4AA 1LJ9A 3BR1A 2QSFX 4GYGA 1R7JA 4AU7A 4DNCA 2DA3A 2DO7A 3WG7H 1TQPA 1ZKGA 2DQLA 1NG7A 3M07A 3HGGA 4DYQA 2D2WA 3QODA 1AHDP 3HC7A 1JTYA 1R71A 2XB5A 3HGYA 1BL0A 3DBLB 4L9JA 3E3VA 1Z7LA 3Q5FA 3O2PE 3H9GA 1OCPA 1DQUA 1JUMA 4BQQA 1IGNA 2M4KA 3CTAA 3L2WA 2CU7A 2MFZA 4HF0A 5DM7F 3S15J 4NV4A 4IHVA 1HXDA 3GF2A 3I4MJ 3CMYA 1UELB 4BY7J 2R0QC 3WGHA 2NRAC 3AFHA 1KU3A 1I6XA 1V5GA 1MMDA 1MNEA 3KP4A 3JRAA 2XAQA 1NTCA 2CO5A 2A5WA 4II3A 4ZDPA 4XRSG 3S1RJ 3E0JB 3CDIA 2G7UA 2X4HA 4Y3OA 3SDGA 2MC4A 4A3DJ 4D7MA 1EA3A 1WI3A 5D5UB 4YELA 2R93J 2JQ7A 3F0CA 1ZG3A 1FPQA 1XCBA 4ESFA 4AVPA 1R49A 1QRYA 2WV0A 4IEJA 4HDUA 3EUAA 2VB6A 2EFQA 2DFFA 1IRZA 1W7PB 3CCEI 1FYKA 3HUGB 1U5TA 1UFMA 4XIDA 4L5JA 3KLNA 4UXNA 4J19A 3B02A 1IJWC 3BJOA 5GADJ 4X6AJ 2A07F 1BI0A 1TLHB 2O3FA 2V1UA 4CCJA 5BPIA 2MG4A 4OIQF 2CV2A 3H5AA 3F22A 1OCOH 1YS6A 3FIWA 3LSJA 4B1RA 4C30A 1R5ID 2QSHX 1TWCJ 3DEUA 2K9SA 2VJ5A 1BN5A 5EYRA 3OSGA 3MAJA 4RA2A 4A3FJ 1B9NA 2V7FA 1VQ4I 2JA7J 2MC3A 4XOPA 4B43A 1FNNA 3EYIA 3HZJA 2K27A 4XMYA 3A4CA 4E7JA 2JZYA 5BOXA 1S7AA 2QCOA 1OISA 2M0MA 1YI2I 2QKLB 4I0BA 3ZMVA 4BL0B 4Q48A 4NQWA 3T5XA 4HZFA 1JE8A 3I9V2 5KNLA 2DPDA 2VQCA 1R5HA 1JHHA 4JX4A 1YHQI 4ZDLA 4LG3A 2JN6A 1H9TA 4P55A 2LK2A 3I54A 1A6IA 5EG0B 3UKGA 2HVSA 4EJVA 3OYFA 2XPVA 2EFNA 3LMMA 5HLGA 4LLNA 3HOZJ 4PFOA 3ABLH 1XC5A 3C3WA 3HTSB 1Y1WJ 1FMVA 3OY9A 2NS7A 2VKEA 2ACJA 1SD6A 4UNOA 4S04A 1MKMA 4EJUA 4N4OB 2LKXA 1ZAOA 2D45A 1VF9A 2FBHA 1BJAA 4RM3A 1XPXA 1IG7A 4HLXA 3ZCOA 3R6SA 1YJWI 5AIQA 1KZHA 2K4JA 3DXJF 3VSLA 2V26A 1D0ZA 4CICA 2HNHA 4Z6YA 4CYDA 4XRMA 2QQ8A 3WHCA 3OS0A 3M4OJ 1JJ8C 2PN6A 2XRNA 4N9IA 1KQ8A 1ORKA 1P9QC 3HRSA 2ZMEA 3M8EA 4PGGA 5EEHA 4D5CA 1VQPI 4OAYA 1BOBA 5EF6A 3J7ZI 2DT5A 4BBRJ 3FXOA 2O6GE 1OR7C 4DYRA 2CQQA 1RUNA 5EEGA 2DMTA 4ESBA 2WADA 3GTPJ 2K3PA 1WKMA 1IN6A 2OJED 2L7ZA 1WQ2A 1FEXA 2LH9A 5J1RA 3RI4A 3MVPA 5GP9A 2M3AA 4LFUA 4BS9A 2Y9ZA 3VFZA 2RAEA 3AL0C 1UCRA 1RKTA 4P9UA 3F3XA 4AD9A 1MBJA 1YIOA 1IAWA 3CDHA 4MEYF 1N78A 3B6CA 2R7UA 4S0HB 4ENKA 4OIRF 2DJNA 2HDCA 1FTZA 2JSPA 4B3AA 2E1NA 4A0ZA 2EILH 2PJRA 4G7ZF 2E36A 1KN9A 1NK3P 5FLXK 1Y8RB 3H35A 2VT2A 2AHQA 4G7OF 1HKTA 3J80Z 2L02A 1ON2A 5K5OA 3BQYA 1AKHA 4G94A 3JRHA 3JSOA 2QBYA 2KKOA 4IHXA 5K1YA 3CMAI 1MNDA 2FNAA 3BY6A 2A05A 4GRIA 1W0TA 4CO8A 1ZR2A 2OCEA 1BJZA 5IP7J 1ETKA 1R5GA 3FK7A 1ZGWA 4G6DA 1FIAA 3CP2A 1FBSA 5JHUA 4XRFA 3F23A 3DWLE 4L9VA 1WJEA 3BJ6A 4A3KJ 3BG7A 1JKQC 4IHYA 4U7BA 1YW7A 2PBIA 2PI0A 1GV2A 1F1ZA 1D8KA 3G1LA 4A6EA 3OYEA 2XV4S 1BBYA 2F5VA 2KIUA 2M5WA 4RMNA 2GOMA 4I76A 1L0OC 3I59A 2XGEA 2K9QA 2XPWA 1WJDA 1RRJA 1S3JA 2JA6J 3DPTA 3PJRA 3LOCA 2MA3A 3N05A 4LB6B 1APLC 5M3MJ 4HF2A 3OYAA 2ZXJA 2XAHA 3A1YA 2TRTA 3K2AA 4I0AA 5GAEJ 3K70C 4IKFA 3MKWB 1T7DA 3DU5A 2DTRA 2PQ8A 3OL3A 2ID3A 1P2FA 3MZYA 3CF5F 1K79A 3OR1C 4I01A 1YOVB 1LEAA 3T8TA 2L5QA 3KZZA 5H20A 3HOSA 5M5WJ 1IDZA 5FROA 4NDLA 3OYHA 2DYRH 2EV0A 3HPHA 2F5CA 2DI3A 2L54A 3HM5A 3CJQB 3H1CA 3QOEA 3WU2C 2HOEA 1I27A 2JA5J 3C2GA 1PUEE 1HKSA 1BOAA 3GBGA 3QYEA 3BZCA 2PFBA 3LQRA 1PYVA 5FKNA 4BAYA 2FE3A 1YX5A 5HS8A 2I8DA 3AKZA 2Q2EB 3CCRI 2Y0MA 4LB5A 3HUGA 5J1YA 4KN4X 3MEXA 4HDVA 1B72A 4GXOA 5BMZA 1ZGJA 4Q47A 2IA0A 2H1KA 3SZGA 2JSCA 3WHBA 2HKXA 4FETA 3JRFA 2R7VA 3V4GA 3SQNA 1GVDA 3BPXA 2Y0SA 2J5PA 2P5VA 5M5YJ 2GA1A 4EM2A 4UVBA 5ILUA 2RGVA 4UUSB 1OYYA 3DU6A 1X1CA 2Q8KA 1Y0UA 3QAHA 3IAM2 4HNUA 2LMDA 1F36A 3F21A 1FX7A 5IOYA 3HSEA 4NC8A 3FX3A 4RGUA 1IDYA 3I5UA 4CCNA 4FCYA 4HNVA 4ETSA 2Y0SN 1XSDA 1VQ8I 1HLVA 4MFDA 2DU9A 3BZ6A 3HXLA 1ZRFA 3F8CA 1MBEA 3GTGJ 3PQKA 2HYFA 3A2KA 5AONA 1V5FA 1ZG5A 2W82A 3CESA 4IOAF 5F27A 1HSJA 2WV1A 2QSGX 5LGUA 4LOCA 2QQBA 1Z6RA 2Y75A 5TRDA 4ZYEA 1HW5A 2DA4A 2ESHA 2RV8A 2ZJRF 1JKRC 3QYBA 1IZ1A 1FP2A 1W4MA 2M8EA 2ZC2A 3DKWA 4R8HA 3WE3A 1ENHA 1QZYA 4BE0A 1ZR4A 2Y48A 3MKZA 1YITI 1FYMA 2EJRA 3UR3C 2O9LA 1SFKA 1OMIA 3KETA 2K9LA 4TV7A 1VNDA 2CFXA 4HSRA 5CPRB 4Q5SF 1BI3A 2L3DA 4HEA2 4A3MJ 1IUFA 2NS8A 3M3YJ 5BQTA 4IRIA 2HS5A 3V8JA 2LTPA 4IL6C 3GZ6A 1BA5A 3GMEA 4BEHB 2VT3A 4C2MJ 3QOPA 2EIMH 4EM0B 4WWCA 3VYUB 1IV6A 3R61A 2V9PA 1WJAA 4E7ZA 2NVUB 1T08B 2DK5A 2HR3A 1GHCA 1H9GA 1V54H 2LBFB 2AQFA 2EB7A 3LSHA 3M8JA 3GFIA 3Q9SA 2B0LA 1XGOA 1SFXA 3WTWC 2BVLA 5ICEA 4BNCA 2ZBKA 2PEXA 2MW8A 1T8IA 4M72A 3VDXA 3NARA 1S9HA 1YO5C 3S3NA 3BZKA 3LA3A 3S3MA 2HWVA 3TOAA 4RAYA 4JK1X 3IWZA 3ZRGA 2CSOA 4IQ4A 2CWEA 4D0PA 3DFGA 5DD8A 2NVYJ 1I3AA 4FE7A 1MNMC 1X1AA 1J9IA 5GPAA 4M3BA 3J80K 1UAAA 2VKHA 1ZGAA 2P7CB 2IPQX 3PUFA 3LSRA 1R22A 1XB4A 1LDKB 1MSEC 5E18F 2HOAA 5E3LA 1G3TA 3D5SC 2LY1A 5D5WB 2R4GA 4HX8A 4AIJA 2CQKA 3F8FA 1GUUA 2ECCA 4XLCA 4Y17A 1LNWA 2DT7B 4OIOF 4ZDOA 3VYTB 1V5EA 2R5YB 3WTVC 3FWEA 2MD5A 4E6KG 5K5QA 3HL2A 2O8XA 3IHUA 2HXIA 3S2DJ 1MJAA 1PJRA 3EDPA 3D1NI 1I50J 3ASOH 2FOKA 3I4PA 3PL8A 1W36C 3I58A 4KIBA 3CC2I 2LG4A 1ZLJA 2V6EA 1E2XA 1U2WA 1ETVA 1WRJA 3JSPA 2Z16A 3W3CA 3H92A 3FKIJ 4QTRA 1O3TA 1X3WB 3OYCA 4R79A 2FMYA 3GO5A 1NHAA 3ROUA 3Q0UA 3L2UA 2ZXHA 1J5YA 3ELKA 4ESJA 2EV5A 2P5KA 4J01A 1KYWA 3IH3A 2V9VA 1PDNC 2R7QA 3RSNA 2CV0A 3F8MA 2FBIA 1LFUP 4ABZA 1VQKI 2LR8A 4XKVA 3OMYA 1FMWA 2ZJ2A 5HNHA 4GDFA 4XICA 3WTSC 4M9SA 5CVVA 3JTHA 1JHEA 3EUHC 2JPBA 2CUJA 1MMGA 2QUFA 5DV5A 4XLEA 2YU9J 2NOJB 3JW4A 5ICCA 2M1BA 3FISA 2YU3A 2FKDA 2QENA 5DCFA 5IP9J 4UB8C 3AG2H 2I10A 2K7LA 4KYWA 1SD4A 3K69A 4KDPA 3KP6A 4HLYA 1PUFA 2ZSIB 3BTLA 4A5MA 2HTSA 5J4VA 4A3GJ 3HIFA 2FU4A 3FXMA 3PIOF 2IA2A 2NXNB 1WH7A 2L9SA 4D9JA 1FOYA 1MMNA 5CQEA 3VSKA 1N75A 4OAZA 5K7ZA 4IRGA 5DUKA 1MGTA 4QIWN 2Q2EA 4IOCF 5E79C 2GIZA 2RQQA 3OYIA 2OZ6A 5L3DA 4M3DA 3IV5A 1UZCA 5J1UA 3V7CA 4KN7X 1FT9A 4KITB 3SEQA 5M5XJ 4C3HJ 5TISC 2KT0A 1WGXA 2KQRA 2DOEA 3H5RA 3OOPA 4IVNA 3RCOA 3KZYA 5KK1A 4K8WA 5FD6A 3DKYA 4PJ0C 3AG4H 4YFKF 2F4MB 4XRSA 4L5IA 3QU6A 3BJAA 3GTJJ 1ODDA 1RUOA 2ICWG 3RPQA 3F9KA 1KONA 4XLFA 4G8XA 1B8IA 3E6BA 5LD2C 1FY7A 5BNGA 4U7DA 1HSTA 5CLSA 4Y13A 2IJLA 2OTLI 9ANTA 4BBSJ 2R7RA 2EH3A 2WAEA 2EFWA 3AL0B 5E8IA 1U6GA 4RB2C 3CCVI 4HBLA 3F6VA 1QQIA 2KJBA 4BDYA 1SAXA 5DYMA 5BPDA 4HPQA 4DZJA 3LFUA 1RR7A 2IGKA 3GXOA 4U88A 4XSZF 4LG0B 5J40A 3FHNA 4A5NA 5F04A 3OS2A 1O3SA 1TBXA 1HDDC 2TCTA 1X1PA 2Z3YA 4ZJZA 1JHCA 3H36A 5D8KB 1RNLA 2ME6A 4AYBA 3I71A 3TDZC 2L4AA 3DEEA 1T56A 4LD5A 5L3FA 2BV6A 3OIPA 4WX9A 5E3MA 2CG4A 4RM2A 3TL4X 2NYXA 1H89C 1HCRA 3BT9A 3MKLA 5CVUA 4M74A 3EPZA 2YR2A 4XNFA 2AXTC 2K5CA 3TP0A 4AYBN 4BEHA 3SYTA 2W25A 3DBHB 1O3QA 2L01A 4KT6A 3ZQCA 4HX7A 2X9DA 4BU2A 3SFZA 2ME0A 2VJJA 4HV6A 1Q1VA 2XKPA 2VPLA 3GTMJ 5JVTA 4M6VA 3WTXC 4ME8A 3LAJA 3Q0WA 1W5CC 2LP0A 3W2WA 1T38A 3K1MA 5J3LA 4IO9F 1A5JA 4FTHA 2F4OB 1QGPA 2MSYA 4CA0A 2E71A 2M2EA 1LE8A 1SAUA 2V9KA 2DODA 1U5TC 3MN2A 2BVMA 3LSGA 2DJIA 3VOEA 5FRNA 3J7AO 2KFDA 2BXZA 3GUDA 5DD4A 2H6BA 1VQLI 4UV9A 1XMKA 1QPMA 4YIIA 4CDGA 1ZH5A 1Y1VJ 3FXLA 2Y30A 2PMZN 2QVOA 1XMAA 3H9QA 2E1OA 4XLHA 1F39A 3K4BA 2VOOA 2NNYA 2XASA 1HQCA 2QM3A 4CYCA 3DF8A 2VE8A 2A5YB 2RN7A 2V6CA 2X1DA 4Y33A 3ZGKA 1SFEA 4LLLA 4S05A 2EA2A 3S8PA 1LFBA 1A04A 1JKOC 2BEOA 4M9ZA 4RBOA 1X4OA 1S7OA 2IA1A 4F93B 5FJ8J 2O0YA 2X51A 1G6NA 1W7PD 4OOIA 1L3LA 4XK4A 5GTIC 1TWFJ 1DP7P 3QPLA 3L09A 3MQ0A 5CKTA 2KPMA 1QZEA 2JJ7A 2Y2ZA 2GQQA 4EEFG 5HODA 1B1BA 1IN4A 4LK0F 3HRTA 4N31A 2OTJI 2E60A 2R5YA 1A35A 2DT6A 3CD6I 1W0UA 2ZNYA 3H0GJ 5E3OA 2QWWA 1KYZA 4CSWA 3X2QH 3KLOA 1QHGA 3KEYA 2L2OA 5EZGA 1GT0C 2R92J 1IW7F 2ESNA 3RDIA 2A6HF 3P7NA 1WJFA 2KL4A 2H94A 2DPUA 3K4KA 2BW3B 4DW6A 2KLOA 1O3RA 1T0FA 1YRNA 1SEUA 3G6EI 3I55I 1QA6A 3BR5A 4RLFA 2FJ1A 4DQ2A 1WFXA 1NH3A 4PUSA 1TW2A 2K3FA 1XTAA 2MH2A 5EDNA 1U8BA 2E1CA 3E5XA 2KZGA 5FB2A 1DPUA 2LYCA 3HRMA 3CJRB 2G0EA 3IKVA 4NB5A 1R4NB 4ZH4F 2XSDC 2P4WA 2LY9A 1P7JA 2MABA 3A02A 1AA7A 2IGOA 3CO6C 2VBYA 1IN8A 2IEKA 3ZP5A 1ACIA 1B12A 3GWZA 4LIVA 2JVGA 2ZMEC 1Y56A 5H6QA 4MTDA 3WTUC 4IPAA 2XAGA 2O61A 1QPIA 4P9FA 2EV6A 4E7IA 3OYMA 1E3HA 5DCMA 1XGSA 5HS7A 2DMPA 2RNJA 4WK8F 3HOYJ 2IGNA 3ERMA 2BBYA 2R7FA 3KZIC 4UUTA 2MH9A 3U9GA 4A3EJ 3PO2J 4CCMA 3DTKA 1S29A 1UHWA 3BG3A 4HSTA 4LITA 3GTOJ 1K78B 3QRFF 2K9MA 3RYRA 4KA4A 2V1DA 2VXZA 4BE1A 4M3EA 3PO3J 2X85A 2DDAA 4F3QA 2W48A 4MO7A 2VI6A 1Z9CA 2QZ8A 4JYKA 4OU0A 2E19A 2N8GA 1FOKA 4LGWA 4A2UA 3SFIA 1TNSA 1IN5A 2YUSA 5C4XJ 2LREA 5KCMA 4L9TA 3H3UA 2WBMA 1TWAJ 3BP8A 3E7LA 2MBFA 5EGOB 2VONA 1MJ9A 3J7YJ 3RIRA 4RGSA 2IS1A 3GZ5A 2Y31A 4O3MA 2R7XA 1FBUA 2DLLA 2KJCA 4IQJA 2LVSA 5DUIA 1Z67A 2J5OA 3HKZA 2XHKA 2HO0A 4LLGF 4XKBA 2HYGD 2L7KA 3NAUA 4HX4A 3C2BA 3DLLF 3QP6A 1EV7A 1DDNA 3W2AA 4PSXA 3CUQA 5IT9K 3HKZN 2W85A 1EJ9A 3GYHX 1SVMA 3AAFA 3W6JB 4XKWA 3I64A 2UWMA 3LL7A 3ZQFA 2AO9A 2JRMA 5CVJA 2PJPA 1ZYRF 1N25A 3K1NA 1XDUA 2FX0A 3KP7A 2C6YA 4HV5A 1K7AA 3E6CC 2KRFA 3BTIA 2LSOA 3RKYA 2HGCA 2IGMA 3LA7A 5GAHJ 3K4NA 4A93J 1PP8F 5HLTA 3FMQA 2CJJA 1R1VA 1R36A 1WJCA 3O3KA 5CVIA 2VASA 3SDBA 1JTXA 2H1LA 3DCFA 1Z6TA 2EINH 2OPTA 2HQ5A 2L9RA 3O8GA 1O7LA 1X2NA 3C18A 3TP3A 5L3BA 1VQ9I 3IWFA 5HLHA 1B9MA 4BXXJ 1IRFA 1FBQA 2JRTA 2FRHA 3KIOA 5F1JA 1ETQA 3ZMSA 4BJ5C 2Z2SB 4RB1A 1G3YA 1HOMA 3ML6A 2PX9A 4NHJA 2LKSA 2K86A 4XM3A 4WXDA 4MQVA 1IXRC 1VTNC 2YPRA 1X2MA 3CCYA 1W1WE 3TKYA 4ZYDA 1BI1A 2KMUA 2DBBA 1SVOA 3L2CA 3FZVA 1W7PA 3S17J 3TGNA 3U21A 3CUOA 1REPC 1OCCH 4FISA 3GLXA 1H0MA 2A69F 2JPCA 2G9WA 2XUBA 3QPTA 4BKXA 4XQFA 5J8CA 2ELJA 1P92A 1O7FA 3S32A 3I0TA 2L9VA 3KFWX 2STWA 1IXCA 2DW4A 1GDTA 1MDMB 1WPKA 2WY8Q 4C2TA 1Z21A 2QQ9A 2DOAA 1IF1A 4RAFA 1VFCA 3FXUA 1HW1A 3L00A 1C0WA 1ERDA 2ZCWA 1EF4A 3H3VK 4XN3A 3E1SA 4DZPA 2XPUA 4AVZA 4M3GA 4JX6A 1ULYA 1JKPC 4M6XA 2X0LA 2R5ZB 1R4MB 4GFBA 1OQYA 1GV5A 1HA8A 1X58A 1JGGA 3HOWJ 3PFYA 2XAJA 2L4MA 3ECHA 2EA4A 2RC4A 2GOXB 2V1NA 2MLKA 1NG6A 1TC3C 1RESA 4E70A 3JRBA 2XF6A 3WGIA 1KQ0A 1BR1A 2CUFA 2ISZA 1IO2A 5CYVA 2CW0F 3RKWA 3LSMA 2GXGA 2H09A 3KEQA 3S04A 3WGGA 5KAIC 1H88C 2BHYA 5JLWA 4BJTA 1VQ5I 4I98B 1G3WA 2WAFA 4AUXA 1CF7B 5DTDA 1BI2A 1MZBA 5EG0A 2STTA 2LF7A 4QPOA 2NVQJ 5LEJA 5JVGF 4HAMA 2OF7A 1YYVA 3PFIA 2XKOA 1TQMA 1YW9A 4UHTA 2RNGA 5J47A 2BE5F 4N0BA 1FTTA 2LY2A 4ZC3A 5K5RA 4HA8A 4FT8A 4PJMA 5ED4A 3H3ZA 3TMOA 3TEDA 2DN0A 1TZLA 4EJOA 1JUPA 2X1EA 1ONVA 2BY3A 1EH6A 1XG1A 2OD5A 3MD2A 3L1PA 2LC2A 1P4XA 4PFPA 3CCUI 3FXRA 5HDKA 1J7KA 3MFKA 5KVRA 4WF2A 3OYBA 1QVTA 2X6OA 3OWTA 1YS7A 2GWRA 4GO1A 4L0YB 2OV7A 2VBZA 3GZNB 1A36A 3VEPA 1ZHFA 4AWXB 1O57A 2E7WA 3S1QJ 5KHDA 4Z2YA 3KCCA 4KMFA 3K4JA 1RPWA 3DEWA 3CC7I 4NNJA 1XMXA 2HYJA 4EGYA 1MSFC 2LFBA 3K4LA 1ZN2A 1Z77A 5DS9A 1WZ2A 2OCCH 1VZ0A 2FA5A 4A0XA 1K78A 1FP1D 2ELHA 3PNTA 1EH8A 4L5EA 4KISA 2QQAA 1F9NA 4V2FA 2CRGA 5B1AH 4CZCA 1RZ4A 3GVAA 1WSUA 5LEKA 4Y7NJ 1YQAA 2FMLA 1U9OA 4RAZA 4FX0A 5FFZA 4XONA 4WCGA 1G2HA 2ZFWA 2LOOA 1PP7U 1YG2A 3IH4A 3KEOA 3QYFA 4XKCA 4XORA 1J2XA 3HBLA 3HTUA 5F0FA 3HDDA 3EETA 2M0CA 2CGPA 1Z3XA 2K4BA 1YJNI 2A6EF 3RTRA 2OUMA 1T33A 4OMYA 5F0CA 5FKOA 5F0HA 1IRXA 2HZDA 4LK1F 5F08A 3LSTA 3T8RA 3HSRA 4N9HA 1LKXA 5LGTA 3F8BA 1R23A 3TO6A 5IOZA 1MBGA 3PQJA 2PLYA 4MLOA 1U5TB 4KJZA 5HDNA 1K6YA 1V55H 2WB1N 1DUXC 2XGDA 1I6HJ 1FIPA 2OQGA 4F91B 3K1PA 2LD5A 4CHUA 1F4KA 1QZZA 3DKXA 2NNNA 3EUKL 1SFUA 4IHWA 2IP2A 5EZHA 1A6QA 1JXSA 2A3SA 3BR2A 1LQ1A 3ZN1A 1TW3A 5F6FA 4M3FA 3R0AA 4P1WA 3HOUJ 5HS9A 2XGCA 1HKQA 2OQRA 4XN0A 4RB3C 1Z3YA 3A0BC 5D4RA 4L9NA 2M87A 1XCVA 3KE2A 3ZMTA 2HQRA 5D4SA 1K6OA 4M73A 3RPUA 2HPIA 2LDUA 4R1HA 1AOYA 1RC9A 2KDOA 2HDDA 3TDUC 5D8LB 2CQNA 2VLAA 4IRHA 2UV1A 3I56I 4QLCU 3IRQA 4Y52J 3IL2A 4PCQA 2CW7A 1X4PA 4PZJA 1GLNA 1XGNA 4I6ZA 1NK2P 2P5LC 4JP0A 3CLQA 1X3ZB 1I1SA 4NQWB 2BY2A 1D5YA 1ETYA 1KU9A 1RI7A 1SMYF 4LJZF 5E1WA 5CQGA 4JQFA 4A3IJ 3IH2A 5C4JJ 2F4IA 2UZKA 3HYIA 4F92B 4C2UA 3HG9A 4G6QA 1AU7A 2F48A 4UVCA 3FHZA 2QA4I 1DGRM 1HC8A 2VJ4A 2AXLA 3CO7C 1YFHA 4RB0A 4DYCA 2WTEA 2Z1DA 3S14J 3FXKA 2HU9A 3ZOBA 2L9NA 2DFIA 4I02A 5IPAA 5B66C 5BS6A 3R60A 2DOFA 2CV1A 2BY1A 4YEJA 3SZPA 1QO0D 3ZMZA 3BTCA 1LFPA 2GBYA 2CFOA 3Q3SA 4UUVA 3DTEA 2M8GX 4HG2A 4BXUA 3V7RA 3RJPA 1YJ9I 2BOLA 2EZHA 4CCLA 3CCMI 3OL4A 1BW5A 2ZMEB 3BG9A 4BHPA 2DQRA 2EWNA 2VKDA 4EM1A 1YTYA 2IS6A 4CGZA 2DA6A 3KX2A 2CQ7A 2VIXA 3HJEA 3L2VA 1ZQ3P 2V4JC 3TBIA 1I5ZA 3NQOA
chains in the Genus database with same CATH topology
1IXSB 1LDDA 1XSXA 4G9YA 1V3FA 2ETHA 2BGCA 4RS8A 4P96A 3N4MA 2H27A 1J59A 1J0RA 3QU3A 2V1XA 1HW2A 1QBJA 1G3SA 3ZMDA 3FXQA 3C1DA 4XBFA 2OU2A 2H6CA 3KP5A 2RVCA 2XIGA 1OPCA 2KIFA 4GCVA 3TQNA 2XGXA 1QNTA 3L9FA 4L0ZB 4BHBA 1ZARA 4IHTA 5H6RA 4EJTA 3F8NA 1USSA 2PMUA 3ABUA 2RDPA 5CJ9A 1TNTA 2QBYB 2HZTA 1P4WA 5IT9Z 2P6TA 3OV8A 2JT1A 4HYEA 5A2QZ 2FJRA 3D0SA 1FSHA 4A6DA 4RGRA 2QLZA 2KIMA 3V8LA 1XSVA 1KA8A 1Q1HA 1LVAA 4F7ZA 1I1GA 4EGZA 5JI6A 4HOBA 1Z91A 3S2WA 1OKRA 2FNPA 2W84A 5LRRA 3I59B 4XLNF 1UMUA 3GFMA 4HW0A 1F5TA 3WG9A 3ISPA 3ECOA 3DQVC 4KUMA 1KGSA 4B09A 2Z99A 3WODF 4IXAA 3N97A 2IT0A 3V8KA 2P7VB 1Z05A 4ZYGA 4FHTA 3EYYA 3M8FA 4FX4A 4ZZDA 2W57A 2LKPA 3T1BA 3KP3A 4B8XA 3BOQA 5LRSA 3FM5A 3P9CA 1ZRDA 3DP7A 2MLGA 1FWZA 3IKTA 5E8GA 3LQQA 2HKOA 3SHFA 4EJWA 4OIPF 1Z7UA 1GVJA 3BDDA 3REOA 1TQIA 2EFOA 2D1HA 2HQNA 3KP2A 5FGMA 3WE2A 1FSEA 3COAC 2F5EA 3JAMZ 2R3SA 2FEZA 1I4VA 2YX7A 3L7WA 4LMYA 3E97A 3P9KA 5L3GA 2GXBA 4ZYHA 3J81Z 1IRGA 4QWQA 4OMZA 1KU7A 3SZTA 1W5SA 5ICFA 5D6EA 3M9AA 1UHMA 4ENNA 2HEOA 3B73A 1R1TA 3K0LA 3LAPA 1WWXA 3WU1B 4EQQA 5DDGA 5LBQA 2GIVA 3TO7A 3DPLC 3FMSA 5ILSA 3GFJA 2IVMA 5D5XB 4BH9A 4MTEA 2ADUA 3HOTA 4U0YA 4AIKA 4I7HA 2GZWA 4YG2F 5LHHA 2FSWA 3ABTA 2YSRA 5D6FA 4ON0A 3WU0A 2OZUA 5LHIA 2NAZA 3K9TA 4MHGA 3FF5A 1SD5A 3JTGA 5L3EA 1U78A 1T98A 1FZPB 1OR7A 1FYLA 5JR3A 2COMA 4KIGA 3I53A 3ZN0A 2HFHA 3CUQC 5HLIA 2D1VA 2IW5A 4M9XA 4YFXF 4LG0A 1DPRA 5E1XA 4MEXF 4MNUA 5A2QK 5ICGA 4IHSA 4PDKA 2M30A 4L18B 2AS5F 2OAZA 1LB2A 1STZA 3GFLA 2FBKA 3CJNA 5LHGA 1R58A 1XGMA 4A12A 3MCZA 2P8TA 1D5VA 4K2EA 5E1ZB 1KU2A 5L3CA 1MJBA 1RIOH 2RQPA 4KICA 1XD7A 4GGGA 3E6DA 2IRFG 4BHCA 4CZZA 5F1RA 2ZNZA 4UV8A 4BYYA 2PMHA 2XROA 4KNYA 3LWFA 3W6KB 5J8FA 3NEUA 5E20A 3WTZA 1ZRCA 3WTYC 1TTYA 1G4DA 2DK8A 2NS0A 1V4RA 3FMRA 1B59A 1XDSA 3ZPLA 1X3UA 5HOOA 3NRVA 4IF4A 4JBAA 3D5LA 3T0YA 1WI9A 3LA2A 1MD0A 2JTVA 5CVRA 3GW2A 2VBXA 2EK5A 4A0YA 2GAUA 1ON1A 4U0VA 5IT3A 1ZG1A 3IC7A 4OINF 4KIFA 3JAMK 3M1EA 3P9IA 2RKHA 4PGHA 2A61A 1U3EM 1KQ9A 1FLIA 1YW8A 5E17F 2YX4A 5FD5A 1YLFA 1T6SA 2HNFA 2ZO4A 2VC1A 3HHGA 3E5QA 3J81K 2UXNA 1BIAA 1JGSA 3LFKA 2HTJA 2WC2A 3G73A 1GXQA 5FO5A 4IJAA 2Z33A 3E5UA 2M45A 1B6AA 3V7SA 3R4KA 4MGRA 1SD7A 3ZMUA 4AIHA 4KT5C 3SXYA 2VBWA 1UB9A 4U0WA 1CGPA 5ILVA 1W5TA 2DAOA 2F2EA 4ZZLA 5FFXA 3R0JA 3G3ZA 4I09A 4M71A 3ERED 2ZKZA 2O03A 2OA4A 5JFRA 2P6SA 3IIQA 3Q9VA 1J75A 2V79A 2F5FA 4WXCA 2VODA 1OYIA 2PG4A 2LNBA 4KMUX 2GA2A 3RKXA 1EH7A 3MWMA 2K02A 4CXFA 5HVQC 5D5VB 3TOBA 6PAXA 3ZQ7A 1E17A 3BDNA 2CYYA 2UXXA 2Z5UA 4Y15A 5ERIA 4EV0A 3WTTC 1GXPA 1R00A 5LGNA 4EVIA 1BC8C 2Q0OA 3CLOA 1Z1DA 4EMSA 1BIBA 1P6RA 3O6BB 1S8NA 3K2ZA 2Z9OA 2FF4A 4H0EA 3IRRA 4KFCA 2FQ3A 5DEQA 1ZREA 4UVAA 2QYOA 3U2RA 1D3YA 3TO9A 3MZHA 3U1DA 4Q4ZF 1OYWA 2TDXA 2W24A 3RYPA 3C7JA 1SMTA 4HQMA 2FXAA 1HBXG 4YIFA 1S6LA 4HQEA 1BM9A 3QPHA 4O6JA 1ZLKA 2EFPA 1IUYA 1USTA 1D8JA 3BROA 4M6YA 1T39A 1KCAA 4YFNF 2XVCA 2WWYA 3M7GA 4I2OA 2E7XA 3EUHA 2OBPA 5LLQA 4ENJA 5DCMB 3F6OA 3EQLF 3VODA 3HSFA 2VOPA 4ENMA 2BYVE 5F64A 1MDMA 1R1UA 3GEZA 5AIPA 2LF8A 1XN7A 4RGXA 1LDJA 3E6MA 2VC0A 5J6XA 4MQ9F 4BQAA 2XAFA 4XSXF 1LEBA 2G7HA 1BC7C 3DV8A 1AWCA 4WXHA 1JHFA 1FC3A 2VE9A 2VN2A 3QP5A 1U8RA 5HDGA 4XLPF 3FM3A 1IN7A 4HF1A 1T2KA 4P5OA 4G7HF 1AY9A 1CF7A 3HHHA 3F72A 4GYIA 4O5VA 4ASNA 3BPVA 5FLXZ 3VB2A 3GX4X 2F5DA 3HRUA 3CUQB 3ULQB 2R7DA 2A68F 3BWGA 2ISYA 5TJJA 1B4AA 1P4AA 1LJ9A 4GYGA 1R7JA 4DNCA 2DO7A 1TQPA 2DQLA 2D2WA 4L9JA 3E3VA 3Q5FA 3O2PE 3CTAA 4HF0A 4NV4A 1HXDA 3GF2A 3WGHA 2NRAC 1KU3A 1I6XA 3KP4A 2XAQA 2CO5A 2G7UA 2X4HA 5D5UB 1ZG3A 1FPQA 1XCBA 4ESFA 4AVPA 2WV0A 4HDUA 2EFQA 1W7PB 1FYKA 1U5TA 1UFMA 4L5JA 3KLNA 4UXNA 3B02A 3BJOA 2A07F 1BI0A 1TLHB 2O3FA 2V1UA 5BPIA 4OIQF 3F22A 1YS6A 3DEUA 1BN5A 3MAJA 1B9NA 2MC3A 1FNNA 3EYIA 2K27A 2JZYA 5BOXA 1S7AA 4I0BA 3ZMVA 4Q48A 4NQWA 3T5XA 4HZFA 1JE8A 2DPDA 1R5HA 1JHHA 1H9TA 4P55A 3I54A 4EJVA 2EFNA 5HLGA 4LLNA 3C3WA 3HTSB 2ACJA 1SD6A 4UNOA 4S04A 1MKMA 4EJUA 2D45A 1ZAOA 2FBHA 1BJAA 4HLXA 3R6SA 5AIQA 2K4JA 3DXJF 4CICA 4CYDA 2PN6A 2XRNA 4N9IA 1KQ8A 4PGGA 3HRSA 2ZMEA 3M8EA 5EEHA 2DT5A 2O6GE 1RUNA 5EEGA 4ESBA 1WKMA 1IN6A 1WQ2A 3RI4A 4LFUA 3VFZA 1UCRA 4P9UA 3F3XA 4AD9A 1YIOA 1IAWA 3CDHA 4MEYF 4ENKA 4OIRF 2HDCA 2E1NA 4A0ZA 4G7ZF 5FLXK 2VT2A 1HKTA 4G7OF 3J80Z 2L02A 1ON2A 5K5OA 4G94A 3JSOA 2QBYA 2KKOA 5K1YA 2FNAA 3BY6A 4CO8A 1R5GA 4G6DA 5JHUA 1FBSA 4XRFA 3F23A 4L9VA 3BJ6A 4U7BA 1YW7A 2PBIA 2PI0A 1F1ZA 1D8KA 4A6EA 2XV4S 1BBYA 2KIUA 2M5WA 1L0OC 3I59A 1S3JA 3DPTA 2MA3A 4LB6B 4HF2A 2XAHA 2ZXJA 4I0AA 1T7DA 2DTRA 2PQ8A 1K79A 1P2FA 3MZYA 4I01A 1LEAA 3T8TA 3KZZA 5H20A 3HOSA 2EV0A 2F5CA 2DI3A 2L54A 2HOEA 1I27A 1PUEE 1HKSA 1BOAA 2PFBA 3LQRA 4BAYA 2FE3A 5HS8A 2Y0MA 4LB5A 3HUGA 4KN4X 3MEXA 4HDVA 4GXOA 5BMZA 1ZGJA 4Q47A 2IA0A 2JSCA 2HKXA 3V4GA 3SQNA 3BPXA 2J5PA 2P5VA 2GA1A 4EM2A 4UVBA 5ILUA 2RGVA 1OYYA 2Q8KA 1Y0UA 3QAHA 3F21A 1FX7A 3HSEA 3FX3A 4RGUA 3I5UA 4ETSA 1XSDA 2DU9A 3BZ6A 1ZRFA 3F8CA 3PQKA 2HYFA 5AONA 1ZG5A 1HSJA 5LGUA 2QQBA 1Z6RA 2Y75A 5TRDA 4ZYEA 1HW5A 2ESHA 2RV8A 1IZ1A 1FP2A 1W4MA 2M8EA 3DKWA 4R8HA 3WE3A 1QZYA 1FYMA 2Y48A 2EJRA 1OMIA 3KETA 4TV7A 2CFXA 4Q5SF 1BI3A 2L3DA 5BQTA 4IRIA 2HS5A 3V8JA 3GZ6A 2VT3A 3QOPA 4EM0B 4WWCA 3R61A 2DK5A 2HR3A 1GHCA 1H9GA 2EB7A 3GFIA 3Q9SA 2B0LA 1XGOA 1SFXA 3WTWC 5ICEA 4BNCA 2ZBKA 2PEXA 4M72A 1YO5C 3LA3A 2HWVA 3TOAA 4RAYA 4JK1X 3IWZA 2CSOA 2CWEA 4D0PA 3DFGA 5DD8A 1J9IA 3J80K 1ZGAA 2P7CB 2IPQX 1R22A 1XB4A 1LDKB 5E18F 1G3TA 5D5WB 4HX8A 4AIJA 2CQKA 3F8FA 4Y17A 1LNWA 4OIOF 3WTVC 5K5QA 2MD5A 3FWEA 2O8XA 3IHUA 1MJAA 3EDPA 2FOKA 3I4PA 3I58A 4KIBA 1ZLJA 1E2XA 1U2WA 1WRJA 3JSPA 3H92A 1O3TA 4R79A 2FMYA 3GO5A 1NHAA 3ROUA 1J5YA 3ELKA 4ESJA 2EV5A 2P5KA 1KYWA 2V9VA 1PDNC 3F8MA 2FBIA 2ZJ2A 3WTSC 4M9SA 5CVVA 3JTHA 1JHEA 2JPBA 2QUFA 5DV5A 3JW4A 5ICCA 2M1BA 2YU3A 2FKDA 2QENA 5DCFA 2K7LA 4KYWA 1SD4A 3K69A 4KDPA 3KP6A 4HLYA 4A5MA 2HTSA 3HIFA 2FU4A 2IA2A 4IRGA 5DUKA 1MGTA 2Q2EA 2OZ6A 5L3DA 3V7CA 4KN7X 1FT9A 3OOPA 4IVNA 3KZYA 5KK1A 4K8WA 5FD6A 4YFKF 4L5IA 3QU6A 3BJAA 1ODDA 1RUOA 3RPQA 4G8XA 3E6BA 1FY7A 4U7DA 1HSTA 5CLSA 4Y13A 2IJLA 2EFWA 5E8IA 1U6GA 4RB2C 4HBLA 3F6VA 1QQIA 2KJBA 1SAXA 5DYMA 5BPDA 3GXOA 4U88A 4XSZF 4LG0B 4A5NA 1O3SA 1TBXA 1JHCA 2Z3YA 5D8KB 1RNLA 3I71A 3TDZC 2L4AA 4LD5A 5L3FA 2BV6A 4WX9A 2CG4A 2NYXA 5CVUA 4M74A 2YR2A 2W25A 1O3QA 2L01A 4HX7A 3SFZA 4HV6A 2XKPA 5JVTA 3WTXC 4ME8A 3LAJA 1T38A 3K1MA 1QGPA 1U5TC 3VOEA 3J7AO 3GUDA 5DD4A 2H6BA 4UV9A 1XMKA 1QPMA 4YIIA 4CDGA 1ZH5A 2QVOA 1XMAA 1F39A 2VOOA 2NNYA 2XASA 1HQCA 2QM3A 3DF8A 2VE8A 2A5YB 2RN7A 2V6CA 1SFEA 4LLLA 4S05A 2EA2A 1A04A 2BEOA 4M9ZA 1S7OA 2IA1A 2O0YA 1G6NA 1W7PD 4OOIA 1L3LA 1DP7P 3L09A 3MQ0A 2GQQA 1B1BA 1IN4A 4LK0F 3HRTA 4N31A 2ZNYA 2QWWA 1KYZA 3KLOA 1IW7F 2ESNA 3RDIA 2A6HF 3P7NA 2H94A 2DPUA 1O3RA 1T0FA 4DQ2A 1TW2A 2MH2A 2E1CA 3E5XA 5FB2A 1DPUA 3HRMA 3IKVA 4NB5A 4ZH4F 2P4WA 3CO6C 2VBYA 1IN8A 3ZP5A 1B12A 3GWZA 5H6QA 4MTDA 3WTUC 4IPAA 2XAGA 2O61A 4P9FA 2EV6A 5DCMA 1XGSA 5HS7A 2RNJA 4WK8F 2BBYA 2R7FA 3U9GA 2MH9A 1S29A 1UHWA 1K78B 3QRFF 3RYRA 4KA4A 2V1DA 2VXZA 1Z9CA 2QZ8A 4OU0A 1FOKA 4LGWA 4A2UA 1TNSA 1IN5A 4L9TA 3H3UA 3BP8A 2MBFA 2VONA 1MJ9A 3RIRA 4RGSA 3GZ5A 4O3MA 2DLLA 1FBUA 2KJCA 5DUIA 2J5OA 2XHKA 2HO0A 4LLGF 2HYGD 4HX4A 3QP6A 1EV7A 1DDNA 3CUQA 5IT9K 2W85A 3GYHX 3AAFA 3W6JB 3I64A 2UWMA 5CVJA 2PJPA 1ZYRF 3K1NA 1XDUA 3KP7A 2C6YA 4HV5A 1K7AA 3E6CC 2KRFA 2LSOA 3RKYA 2HGCA 3LA7A 1PP8F 3FMQA 1R1VA 1R36A 5CVIA 3O3KA 1Z6TA 1O7LA 3C18A 5L3BA 3IWFA 5HLHA 1B9MA 1IRFA 1FBQA 2JRTA 2FRHA 3ZMSA 4RB1A 1G3YA 3ML6A 4NHJA 2K86A 4WXDA 4MQVA 1IXRC 1VTNC 2YPRA 3TKYA 4ZYDA 1BI1A 2DBBA 3L2CA 3FZVA 1W7PA 3TGNA 3CUOA 1REPC 3GLXA 1H0MA 2A69F 2JPCA 2G9WA 2XUBA 3QPTA 5J8CA 1P92A 1O7FA 3I0TA 3KFWX 2STWA 1IXCA 2DW4A 1MDMB 2QQ9A 1IF1A 3FXUA 1HW1A 3L00A 1C0WA 2ZCWA 1ULYA 4M6XA 2X0LA 2XAJA 2L4MA 3ECHA 2EA4A 2RC4A 2MLKA 4E70A 3WGIA 1KQ0A 2ISZA 5CYVA 2CW0F 3RKWA 3S04A 2GXGA 2H09A 3KEQA 3WGGA 4I98B 1G3WA 1CF7B 1BI2A 1MZBA 2STTA 2LF7A 5LEJA 4HAMA 1YYVA 3PFIA 2XKOA 1TQMA 1YW9A 4UHTA 1KN9A 2BE5F 4N0BA 5K5RA 4HA8A 4FT8A 5ED4A 3H3ZA 4EJOA 1ONVA 1EH6A 2OD5A 1P4XA 3FXRA 5HDKA 1J7KA 3MFKA 5KVRA 4WF2A 1YS7A 2GWRA 4GO1A 4L0YB 2VBZA 3VEPA 1ZHFA 4AWXB 1O57A 2E7WA 4Z2YA 3KCCA 4KMFA 4EGYA 1ZN2A 2FA5A 4A0XA 1K78A 1FP1D 2ELHA 1EH8A 2QQAA 1F9NA 1RZ4A 3GVAA 1WSUA 5LEKA 1YQAA 2FMLA 4RAZA 4FX0A 5FFZA 4WCGA 2ZFWA 1PP7U 1YG2A 3KEOA 1J2XA 3HTUA 3EETA 2CGPA 2K4BA 2A6EF 3RTRA 4OMYA 4LK1F 3LSTA 3T8RA 3HSRA 4N9HA 5LGTA 3F8BA 1R23A 3TO6A 2PLYA 3PQJA 1U5TB 5HDNA 1DUXC 2OQGA 4CHUA 3K1PA 1F4KA 1QZZA 2NNNA 1SFUA 2IP2A 1JXSA 2A3SA 1LQ1A 3ZN1A 1TW3A 5F6FA 3R0AA 5HS9A 1HKQA 2OQRA 4RB3C 5D4RA 4L9NA 2M87A 1XCVA 3KE2A 3ZMTA 2HQRA 5D4SA 1K6OA 4M73A 3RPUA 2LDUA 4R1HA 1AOYA 3TDUC 5D8LB 4IRHA 4QLCU 3IRQA 3IL2A 4PCQA 4PZJA 1XGNA 2P5LC 1I1SA 1RI7A 1KU9A 1SMYF 4LJZF 5E1WA 4JQFA 2UZKA 3HYIA 4G6QA 3FHZA 4UVCA 3CO7C 2AXLA 1YFHA 4RB0A 2WTEA 2DFIA 4I02A 5BS6A 3R60A 3SZPA 1QO0D 3ZMZA 4UUVA 4BXUA 3V7RA 3RJPA 2ZMEB 4BHPA 2DQRA 2EWNA 4EM1A 1YTYA 4CGZA 1I5ZA 3NQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXS B;  1LDD A;  1XSX A;  4G9Y A;  1V3F A;  2ETH A;  2BGC A;  4RS8 A;  4P96 A;  3N4M A;  2H27 A;  1J59 A;  1J0R A;  3QU3 A;  2V1X A;  1HW2 A;  1QBJ A;  1G3S A;  3ZMD A;  3FXQ A;  3C1D A;  4XBF A;  2OU2 A;  2H6C A;  3KP5 A;  2RVC A;  2XIG A;  1OPC A;  2KIF A;  4GCV A;  3TQN A;  2XGX A;  1QNT A;  3L9F A;  4L0Z B;  4BHB A;  1ZAR A;  4IHT A;  5H6R A;  4EJT A;  3F8N A;  1USS A;  2PMU A;  3ABU A;  2RDP A;  5CJ9 A;  1TNT A;  2QBY B;  2HZT A;  1P4W A;  5IT9 Z;  2P6T A;  3OV8 A;  2JT1 A;  4HYE A;  5A2Q Z;  2FJR A;  3D0S A;  1FSH A;  4A6D A;  4RGR A;  2QLZ A;  2KIM A;  3V8L A;  1XSV A;  1KA8 A;  1Q1H A;  1LVA A;  4F7Z A;  1I1G A;  4EGZ A;  5JI6 A;  4HOB A;  1Z91 A;  3S2W A;  1OKR A;  2FNP A;  2W84 A;  5LRR A;  3I59 B;  4XLN F;  1UMU A;  3GFM A;  4HW0 A;  1F5T A;  3WG9 A;  3ISP A;  3ECO A;  3DQV C;  4KUM A;  1KGS A;  4B09 A;  2Z99 A;  3WOD F;  4IXA A;  3N97 A;  2IT0 A;  3V8K A;  2P7V B;  1Z05 A;  4ZYG A;  4FHT A;  3EYY A;  3M8F A;  4FX4 A;  4ZZD A;  2W57 A;  2LKP A;  3T1B A;  3KP3 A;  4B8X A;  3BOQ A;  5LRS A;  3FM5 A;  3P9C A;  1ZRD A;  3DP7 A;  2MLG A;  1FWZ A;  3IKT A;  5E8G A;  3LQQ A;  2HKO A;  3SHF A;  4EJW A;  4OIP F;  1Z7U A;  1GVJ A;  3BDD A;  3REO A;  1TQI A;  2EFO A;  2D1H A;  2HQN A;  3KP2 A;  5FGM A;  3WE2 A;  1FSE A;  3COA C;  2F5E A;  3JAM Z;  2R3S A;  2FEZ A;  1I4V A;  2YX7 A;  3L7W A;  4LMY A;  3E97 A;  3P9K A;  5L3G A;  2GXB A;  4ZYH A;  3J81 Z;  1IRG A;  4QWQ A;  4OMZ A;  1KU7 A;  3SZT A;  1W5S A;  5ICF A;  5D6E A;  3M9A A;  1UHM A;  4ENN A;  2HEO A;  3B73 A;  1R1T A;  3K0L A;  3LAP A;  1WWX A;  3WU1 B;  4EQQ A;  5DDG A;  5LBQ A;  2GIV A;  3TO7 A;  3DPL C;  3FMS A;  5ILS A;  3GFJ A;  2IVM A;  5D5X B;  4BH9 A;  4MTE A;  2ADU A;  3HOT A;  4U0Y A;  4AIK A;  4I7H A;  2GZW A;  4YG2 F;  5LHH A;  2FSW A;  3ABT A;  2YSR A;  5D6F A;  4ON0 A;  3WU0 A;  2OZU A;  5LHI A;  2NAZ A;  3K9T A;  4MHG A;  3FF5 A;  1SD5 A;  3JTG A;  5L3E A;  1U78 A;  1T98 A;  1FZP B;  1OR7 A;  1FYL A;  5JR3 A;  2COM A;  4KIG A;  3I53 A;  3ZN0 A;  2HFH A;  3CUQ C;  5HLI A;  2D1V A;  2IW5 A;  4M9X A;  4YFX F;  4LG0 A;  1DPR A;  5E1X A;  4MEX F;  4MNU A;  5A2Q K;  5ICG A;  4IHS A;  4PDK A;  2M30 A;  4L18 B;  2AS5 F;  2OAZ A;  1LB2 A;  1STZ A;  3GFL A;  2FBK A;  3CJN A;  5LHG A;  1R58 A;  1XGM A;  4A12 A;  3MCZ A;  2P8T A;  1D5V A;  4K2E A;  5E1Z B;  1KU2 A;  5L3C A;  1MJB A;  1RIO H;  2RQP A;  4KIC A;  1XD7 A;  4GGG A;  3E6D A;  2IRF G;  4BHC A;  4CZZ A;  5F1R A;  2ZNZ A;  4UV8 A;  4BYY A;  2PMH A;  2XRO A;  4KNY A;  3LWF A;  3W6K B;  5J8F A;  3NEU A;  5E20 A;  3WTZ A;  1ZRC A;  3WTY C;  1TTY A;  1G4D A;  2DK8 A;  2NS0 A;  1V4R A;  3FMR A;  1B59 A;  1XDS A;  3ZPL A;  1X3U A;  5HOO A;  3NRV A;  4IF4 A;  4JBA A;  3D5L A;  3T0Y A;  1WI9 A;  3LA2 A;  1MD0 A;  2JTV A;  5CVR A;  3GW2 A;  2VBX A;  2EK5 A;  4A0Y A;  2GAU A;  1ON1 A;  4U0V A;  5IT3 A;  1ZG1 A;  3IC7 A;  4OIN F;  4KIF A;  3JAM K;  3M1E A;  3P9I A;  2RKH A;  4PGH A;  2A61 A;  1U3E M;  1KQ9 A;  1FLI A;  1YW8 A;  5E17 F;  2YX4 A;  5FD5 A;  1YLF A;  1T6S A;  2HNF A;  2ZO4 A;  2VC1 A;  3HHG A;  3E5Q A;  3J81 K;  2UXN A;  1BIA A;  1JGS A;  3LFK A;  2HTJ A;  2WC2 A;  3G73 A;  1GXQ A;  5FO5 A;  4IJA A;  2Z33 A;  3E5U A;  2M45 A;  1B6A A;  3V7S A;  3R4K A;  4MGR A;  1SD7 A;  3ZMU A;  4AIH A;  4KT5 C;  3SXY A;  2VBW A;  1UB9 A;  4U0W A;  1CGP A;  5ILV A;  1W5T A;  2DAO A;  2F2E A;  4ZZL A;  5FFX A;  3R0J A;  3G3Z A;  4I09 A;  4M71 A;  3ERE D;  2ZKZ A;  2O03 A;  2OA4 A;  5JFR A;  2P6S A;  3IIQ A;  3Q9V A;  1J75 A;  2V79 A;  2F5F A;  4WXC A;  2VOD A;  1OYI A;  2PG4 A;  2LNB A;  4KMU X;  2GA2 A;  3RKX A;  1EH7 A;  3MWM A;  2K02 A;  4CXF A;  5HVQ C;  5D5V B;  3TOB A;  6PAX A;  3ZQ7 A;  1E17 A;  3BDN A;  2CYY A;  2UXX A;  2Z5U A;  4Y15 A;  5ERI A;  4EV0 A;  3WTT C;  1GXP A;  1R00 A;  5LGN A;  4EVI A;  1BC8 C;  2Q0O A;  3CLO A;  1Z1D A;  4EMS A;  1BIB A;  1P6R A;  3O6B B;  1S8N A;  3K2Z A;  2Z9O A;  2FF4 A;  4H0E A;  3IRR A;  4KFC A;  2FQ3 A;  5DEQ A;  1ZRE A;  4UVA A;  2QYO A;  3U2R A;  1D3Y A;  3TO9 A;  3MZH A;  3U1D A;  4Q4Z F;  1OYW A;  2TDX A;  2W24 A;  3RYP A;  3C7J A;  1SMT A;  4HQM A;  2FXA A;  1HBX G;  4YIF A;  1S6L A;  4HQE A;  1BM9 A;  3QPH A;  4O6J A;  1ZLK A;  2EFP A;  1IUY A;  1UST A;  1D8J A;  3BRO A;  4M6Y A;  1T39 A;  1KCA A;  4YFN F;  2XVC A;  2WWY A;  3M7G A;  4I2O A;  2E7X A;  3EUH A;  2OBP A;  5LLQ A;  4ENJ A;  5DCM B;  3F6O A;  3EQL F;  3VOD A;  3HSF A;  2VOP A;  4ENM A;  2BYV E;  5F64 A;  1MDM A;  1R1U A;  3GEZ A;  5AIP A;  2LF8 A;  1XN7 A;  4RGX A;  1LDJ A;  3E6M A;  2VC0 A;  5J6X A;  4MQ9 F;  4BQA A;  2XAF A;  4XSX F;  1LEB A;  2G7H A;  1BC7 C;  3DV8 A;  1AWC A;  4WXH A;  1JHF A;  1FC3 A;  2VE9 A;  2VN2 A;  3QP5 A;  1U8R A;  5HDG A;  4XLP F;  3FM3 A;  1IN7 A;  4HF1 A;  1T2K A;  4P5O A;  4G7H F;  1AY9 A;  1CF7 A;  3HHH A;  3F72 A;  4GYI A;  4O5V A;  4ASN A;  3BPV A;  5FLX Z;  3VB2 A;  3GX4 X;  2F5D A;  3HRU A;  3CUQ B;  3ULQ B;  2R7D A;  2A68 F;  3BWG A;  2ISY A;  5TJJ A;  1B4A A;  1P4A A;  1LJ9 A;  4GYG A;  1R7J A;  4DNC A;  2DO7 A;  1TQP A;  2DQL A;  2D2W A;  4L9J A;  3E3V A;  3Q5F A;  3O2P E;  3CTA A;  4HF0 A;  4NV4 A;  1HXD A;  3GF2 A;  3WGH A;  2NRA C;  1KU3 A;  1I6X A;  3KP4 A;  2XAQ A;  2CO5 A;  2G7U A;  2X4H A;  5D5U B;  1ZG3 A;  1FPQ A;  1XCB A;  4ESF A;  4AVP A;  2WV0 A;  4HDU A;  2EFQ A;  1W7P B;  1FYK A;  1U5T A;  1UFM A;  4L5J A;  3KLN A;  4UXN A;  3B02 A;  3BJO A;  2A07 F;  1BI0 A;  1TLH B;  2O3F A;  2V1U A;  5BPI A;  4OIQ F;  3F22 A;  1YS6 A;  3DEU A;  1BN5 A;  3MAJ A;  1B9N A;  2MC3 A;  1FNN A;  3EYI A;  2K27 A;  2JZY A;  5BOX A;  1S7A A;  4I0B A;  3ZMV A;  4Q48 A;  4NQW A;  3T5X A;  4HZF A;  1JE8 A;  2DPD A;  1R5H A;  1JHH A;  1H9T A;  4P55 A;  3I54 A;  4EJV A;  2EFN A;  5HLG A;  4LLN A;  3C3W A;  3HTS B;  2ACJ A;  1SD6 A;  4UNO A;  4S04 A;  1MKM A;  4EJU A;  2D45 A;  1ZAO A;  2FBH A;  1BJA A;  4HLX A;  3R6S A;  5AIQ A;  2K4J A;  3DXJ F;  4CIC A;  4CYD A;  2PN6 A;  2XRN A;  4N9I A;  1KQ8 A;  4PGG A;  3HRS A;  2ZME A;  3M8E A;  5EEH A;  2DT5 A;  2O6G E;  1RUN A;  5EEG A;  4ESB A;  1WKM A;  1IN6 A;  1WQ2 A;  3RI4 A;  4LFU A;  3VFZ A;  1UCR A;  4P9U A;  3F3X A;  4AD9 A;  1YIO A;  1IAW A;  3CDH A;  4MEY F;  4ENK A;  4OIR F;  2HDC A;  2E1N A;  4A0Z A;  4G7Z F;  5FLX K;  2VT2 A;  1HKT A;  4G7O F;  3J80 Z;  2L02 A;  1ON2 A;  5K5O A;  4G94 A;  3JSO A;  2QBY A;  2KKO A;  5K1Y A;  2FNA A;  3BY6 A;  4CO8 A;  1R5G A;  4G6D A;  5JHU A;  1FBS A;  4XRF A;  3F23 A;  4L9V A;  3BJ6 A;  4U7B A;  1YW7 A;  2PBI A;  2PI0 A;  1F1Z A;  1D8K A;  4A6E A;  2XV4 S;  1BBY A;  2KIU A;  2M5W A;  1L0O C;  3I59 A;  1S3J A;  3DPT A;  2MA3 A;  4LB6 B;  4HF2 A;  2XAH A;  2ZXJ A;  4I0A A;  1T7D A;  2DTR A;  2PQ8 A;  1K79 A;  1P2F A;  3MZY A;  4I01 A;  1LEA A;  3T8T A;  3KZZ A;  5H20 A;  3HOS A;  2EV0 A;  2F5C A;  2DI3 A;  2L54 A;  2HOE A;  1I27 A;  1PUE E;  1HKS A;  1BOA A;  2PFB A;  3LQR A;  4BAY A;  2FE3 A;  5HS8 A;  2Y0M A;  4LB5 A;  3HUG A;  4KN4 X;  3MEX A;  4HDV A;  4GXO A;  5BMZ A;  1ZGJ A;  4Q47 A;  2IA0 A;  2JSC A;  2HKX A;  3V4G A;  3SQN A;  3BPX A;  2J5P A;  2P5V A;  2GA1 A;  4EM2 A;  4UVB A;  5ILU A;  2RGV A;  1OYY A;  2Q8K A;  1Y0U A;  3QAH A;  3F21 A;  1FX7 A;  3HSE A;  3FX3 A;  4RGU A;  3I5U A;  4ETS A;  1XSD A;  2DU9 A;  3BZ6 A;  1ZRF A;  3F8C A;  3PQK A;  2HYF A;  5AON A;  1ZG5 A;  1HSJ A;  5LGU A;  2QQB A;  1Z6R A;  2Y75 A;  5TRD A;  4ZYE A;  1HW5 A;  2ESH A;  2RV8 A;  1IZ1 A;  1FP2 A;  1W4M A;  2M8E A;  3DKW A;  4R8H A;  3WE3 A;  1QZY A;  1FYM A;  2Y48 A;  2EJR A;  1OMI A;  3KET A;  4TV7 A;  2CFX A;  4Q5S F;  1BI3 A;  2L3D A;  5BQT A;  4IRI A;  2HS5 A;  3V8J A;  3GZ6 A;  2VT3 A;  3QOP A;  4EM0 B;  4WWC A;  3R61 A;  2DK5 A;  2HR3 A;  1GHC A;  1H9G A;  2EB7 A;  3GFI A;  3Q9S A;  2B0L A;  1XGO A;  1SFX A;  3WTW C;  5ICE A;  4BNC A;  2ZBK A;  2PEX A;  4M72 A;  1YO5 C;  3LA3 A;  2HWV A;  3TOA A;  4RAY A;  4JK1 X;  3IWZ A;  2CSO A;  2CWE A;  4D0P A;  3DFG A;  5DD8 A;  1J9I A;  3J80 K;  1ZGA A;  2P7C B;  2IPQ X;  1R22 A;  1XB4 A;  1LDK B;  5E18 F;  1G3T A;  5D5W B;  4HX8 A;  4AIJ A;  2CQK A;  3F8F A;  4Y17 A;  1LNW A;  4OIO F;  3WTV C;  5K5Q A;  2MD5 A;  3FWE A;  2O8X A;  3IHU A;  1MJA A;  3EDP A;  2FOK A;  3I4P A;  3I58 A;  4KIB A;  1ZLJ A;  1E2X A;  1U2W A;  1WRJ A;  3JSP A;  3H92 A;  1O3T A;  4R79 A;  2FMY A;  3GO5 A;  1NHA A;  3ROU A;  1J5Y A;  3ELK A;  4ESJ A;  2EV5 A;  2P5K A;  1KYW A;  2V9V A;  1PDN C;  3F8M A;  2FBI A;  2ZJ2 A;  3WTS C;  4M9S A;  5CVV A;  3JTH A;  1JHE A;  2JPB A;  2QUF A;  5DV5 A;  3JW4 A;  5ICC A;  2M1B A;  2YU3 A;  2FKD A;  2QEN A;  5DCF A;  2K7L A;  4KYW A;  1SD4 A;  3K69 A;  4KDP A;  3KP6 A;  4HLY A;  4A5M A;  2HTS A;  3HIF A;  2FU4 A;  2IA2 A;  4IRG A;  5DUK A;  1MGT A;  2Q2E A;  2OZ6 A;  5L3D A;  3V7C A;  4KN7 X;  1FT9 A;  3OOP A;  4IVN A;  3KZY A;  5KK1 A;  4K8W A;  5FD6 A;  4YFK F;  4L5I A;  3QU6 A;  3BJA A;  1ODD A;  1RUO A;  3RPQ A;  4G8X A;  3E6B A;  1FY7 A;  4U7D A;  1HST A;  5CLS A;  4Y13 A;  2IJL A;  2EFW A;  5E8I A;  1U6G A;  4RB2 C;  4HBL A;  3F6V A;  1QQI A;  2KJB A;  1SAX A;  5DYM A;  5BPD A;  3GXO A;  4U88 A;  4XSZ F;  4LG0 B;  4A5N A;  1O3S A;  1TBX A;  1JHC A;  2Z3Y A;  5D8K B;  1RNL A;  3I71 A;  3TDZ C;  2L4A A;  4LD5 A;  5L3F A;  2BV6 A;  4WX9 A;  2CG4 A;  2NYX A;  5CVU A;  4M74 A;  2YR2 A;  2W25 A;  1O3Q A;  2L01 A;  4HX7 A;  3SFZ A;  4HV6 A;  2XKP A;  5JVT A;  3WTX C;  4ME8 A;  3LAJ A;  1T38 A;  3K1M A;  1QGP A;  1U5T C;  3VOE A;  3J7A O;  3GUD A;  5DD4 A;  2H6B A;  4UV9 A;  1XMK A;  1QPM A;  4YII A;  4CDG A;  1ZH5 A;  2QVO A;  1XMA A;  1F39 A;  2VOO A;  2NNY A;  2XAS A;  1HQC A;  2QM3 A;  3DF8 A;  2VE8 A;  2A5Y B;  2RN7 A;  2V6C A;  1SFE A;  4LLL A;  4S05 A;  2EA2 A;  1A04 A;  2BEO A;  4M9Z A;  1S7O A;  2IA1 A;  2O0Y A;  1G6N A;  1W7P D;  4OOI A;  1L3L A;  1DP7 P;  3L09 A;  3MQ0 A;  2GQQ A;  1B1B A;  1IN4 A;  4LK0 F;  3HRT A;  4N31 A;  2ZNY A;  2QWW A;  1KYZ A;  3KLO A;  1IW7 F;  2ESN A;  3RDI A;  2A6H F;  3P7N A;  2H94 A;  2DPU A;  1O3R A;  1T0F A;  4DQ2 A;  1TW2 A;  2MH2 A;  2E1C A;  3E5X A;  5FB2 A;  1DPU A;  3HRM A;  3IKV A;  4NB5 A;  4ZH4 F;  2P4W A;  3CO6 C;  2VBY A;  1IN8 A;  3ZP5 A;  1B12 A;  3GWZ A;  5H6Q A;  4MTD A;  3WTU C;  4IPA A;  2XAG A;  2O61 A;  4P9F A;  2EV6 A;  5DCM A;  1XGS A;  5HS7 A;  2RNJ A;  4WK8 F;  2BBY A;  2R7F A;  3U9G A;  2MH9 A;  1S29 A;  1UHW A;  1K78 B;  3QRF F;  3RYR A;  4KA4 A;  2V1D A;  2VXZ A;  1Z9C A;  2QZ8 A;  4OU0 A;  1FOK A;  4LGW A;  4A2U A;  1TNS A;  1IN5 A;  4L9T A;  3H3U A;  3BP8 A;  2MBF A;  2VON A;  1MJ9 A;  3RIR A;  4RGS A;  3GZ5 A;  4O3M A;  2DLL A;  1FBU A;  2KJC A;  5DUI A;  2J5O A;  2XHK A;  2HO0 A;  4LLG F;  2HYG D;  4HX4 A;  3QP6 A;  1EV7 A;  1DDN A;  3CUQ A;  5IT9 K;  2W85 A;  3GYH X;  3AAF A;  3W6J B;  3I64 A;  2UWM A;  5CVJ A;  2PJP A;  1ZYR F;  3K1N A;  1XDU A;  3KP7 A;  2C6Y A;  4HV5 A;  1K7A A;  3E6C C;  2KRF A;  2LSO A;  3RKY A;  2HGC A;  3LA7 A;  1PP8 F;  3FMQ A;  1R1V A;  1R36 A;  5CVI A;  3O3K A;  1Z6T A;  1O7L A;  3C18 A;  5L3B A;  3IWF A;  5HLH A;  1B9M A;  1IRF A;  1FBQ A;  2JRT A;  2FRH A;  3ZMS A;  4RB1 A;  1G3Y A;  3ML6 A;  4NHJ A;  2K86 A;  4WXD A;  4MQV A;  1IXR C;  1VTN C;  2YPR A;  3TKY A;  4ZYD A;  1BI1 A;  2DBB A;  3L2C A;  3FZV A;  1W7P A;  3TGN A;  3CUO A;  1REP C;  3GLX A;  1H0M A;  2A69 F;  2JPC A;  2G9W A;  2XUB A;  3QPT A;  5J8C A;  1P92 A;  1O7F A;  3I0T A;  3KFW X;  2STW A;  1IXC A;  2DW4 A;  1MDM B;  2QQ9 A;  1IF1 A;  3FXU A;  1HW1 A;  3L00 A;  1C0W A;  2ZCW A;  1ULY A;  4M6X A;  2X0L A;  2XAJ A;  2L4M A;  3ECH A;  2EA4 A;  2RC4 A;  2MLK A;  4E70 A;  3WGI A;  1KQ0 A;  2ISZ A;  5CYV A;  2CW0 F;  3RKW A;  3S04 A;  2GXG A;  2H09 A;  3KEQ A;  3WGG A;  4I98 B;  1G3W A;  1CF7 B;  1BI2 A;  1MZB A;  2STT A;  2LF7 A;  5LEJ A;  4HAM A;  1YYV A;  3PFI A;  2XKO A;  1TQM A;  1YW9 A;  4UHT A;  1KN9 A;  2BE5 F;  4N0B A;  5K5R A;  4HA8 A;  4FT8 A;  5ED4 A;  3H3Z A;  4EJO A;  1ONV A;  1EH6 A;  2OD5 A;  1P4X A;  3FXR A;  5HDK A;  1J7K A;  3MFK A;  5KVR A;  4WF2 A;  1YS7 A;  2GWR A;  4GO1 A;  4L0Y B;  2VBZ A;  3VEP A;  1ZHF A;  4AWX B;  1O57 A;  2E7W A;  4Z2Y A;  3KCC A;  4KMF A;  4EGY A;  1ZN2 A;  2FA5 A;  4A0X A;  1K78 A;  1FP1 D;  2ELH A;  1EH8 A;  2QQA A;  1F9N A;  1RZ4 A;  3GVA A;  1WSU A;  5LEK A;  1YQA A;  2FML A;  4RAZ A;  4FX0 A;  5FFZ A;  4WCG A;  2ZFW A;  1PP7 U;  1YG2 A;  3KEO A;  1J2X A;  3HTU A;  3EET A;  2CGP A;  2K4B A;  2A6E F;  3RTR A;  4OMY A;  4LK1 F;  3LST A;  3T8R A;  3HSR A;  4N9H A;  5LGT A;  3F8B A;  1R23 A;  3TO6 A;  2PLY A;  3PQJ A;  1U5T B;  5HDN A;  1DUX C;  2OQG A;  4CHU A;  3K1P A;  1F4K A;  1QZZ A;  2NNN A;  1SFU A;  2IP2 A;  1JXS A;  2A3S A;  1LQ1 A;  3ZN1 A;  1TW3 A;  5F6F A;  3R0A A;  5HS9 A;  1HKQ A;  2OQR A;  4RB3 C;  5D4R A;  4L9N A;  2M87 A;  1XCV A;  3KE2 A;  3ZMT A;  2HQR A;  5D4S A;  1K6O A;  4M73 A;  3RPU A;  2LDU A;  4R1H A;  1AOY A;  3TDU C;  5D8L B;  4IRH A;  4QLC U;  3IRQ A;  3IL2 A;  4PCQ A;  4PZJ A;  1XGN A;  2P5L C;  1I1S A;  1RI7 A;  1KU9 A;  1SMY F;  4LJZ F;  5E1W A;  4JQF A;  2UZK A;  3HYI A;  4G6Q A;  3FHZ A;  4UVC A;  3CO7 C;  2AXL A;  1YFH A;  4RB0 A;  2WTE A;  2DFI A;  4I02 A;  5BS6 A;  3R60 A;  3SZP A;  1QO0 D;  3ZMZ A;  4UUV A;  4BXU A;  3V7R A;  3RJP A;  2ZME B;  4BHP A;  2DQR A;  2EWN A;  4EM1 A;  1YTY A;  4CGZ A;  1I5Z A;  3NQO A; 
#chains in the Genus database with same CATH topology
 1IXS B;  2DFE A;  1LDD A;  3LNQ A;  1XSX A;  4G9Y A;  1ITY A;  4BUP A;  1V3F A;  4DBR A;  2ETH A;  2BGC A;  4RS8 A;  4RLQ A;  5DM6 F;  3G4S I;  4P96 A;  3I3L A;  3N4M A;  3G1M A;  3CP8 A;  2H27 A;  1J59 A;  1SVL A;  4UUS A;  2VQL A;  1J0R A;  3QU3 A;  4NC6 A;  1WH5 A;  2CMP A;  2V1X A;  4UY8 I;  2VQG A;  3MZ8 A;  1HW2 A;  3AG3 H;  1QBJ A;  4H4K C;  5FRM A;  1G3S A;  3ZMD A;  3FXQ A;  3C1D A;  4PSW A;  3JRI A;  1A31 A;  4XBF A;  1X1B A;  2OU2 A;  1VQM I;  3W2V A;  2H6C A;  1UG0 A;  3DBR B;  3KP5 A;  4I99 C;  2RVC A;  2XIG A;  3BLY A;  5K7F A;  1OPC A;  2KIF A;  2PJR B;  5FLV A;  4GCV A;  1CQT A;  2F6C A;  3TQN A;  4CCK A;  1IC8 A;  2XGX A;  1QNT A;  3L9F A;  4L0Z B;  4BHB A;  1ZAR A;  1VQO I;  2DMQ A;  1Y39 A;  1YE9 A;  1FJL A;  4IHT A;  2E5Z A;  3OYG A;  5H6R A;  5E3N A;  1AKH B;  2O8K A;  2KHM A;  4EJT A;  3F8N A;  1USS A;  3ESW B;  4PJJ A;  2JUC A;  2PMU A;  3ABU A;  2RDP A;  1K61 A;  4BY1 J;  5CJ9 A;  1YX3 A;  1TNT A;  3OOU A;  2QBY B;  2HZT A;  4NBQ A;  1P4W A;  5IT9 Z;  2HVR A;  2P6T A;  3GLL A;  2E1M C;  3W6V A;  2IBD A;  2KZV A;  3OV8 A;  2JT1 A;  3BCA A;  4HYE A;  5A2Q Z;  3LSI A;  2FJR A;  3D0S A;  1FSH A;  4A6D A;  4RGR A;  2QLZ A;  3DPU A;  4BQN A;  1Y0N A;  2XF5 A;  2KIM A;  3V8L A;  2O5R A;  4E4H A;  3PNY A;  4C3I J;  1XSV A;  4G12 A;  4AC0 A;  1KA8 A;  2ELK A;  1Q1H A;  3NWS A;  2VUM J;  1LVA A;  4F7Z A;  1I1G A;  2A6T A;  4EGZ A;  5JI6 A;  4HOB A;  4BAC A;  1Z91 A;  2E34 A;  2LBF A;  3S2W A;  1OKR A;  2FNP A;  2W84 A;  1TT5 B;  5LRR A;  3I59 B;  4XLN F;  1UMU A;  3BG6 A;  3GFM A;  4DBQ A;  4HW0 A;  1F5T A;  2PMZ A;  3WG9 A;  3ISP A;  3ECO A;  3DQV C;  4D7N A;  4KUM A;  1KGS A;  4ITV A;  4B09 A;  2Z99 A;  2KIQ A;  3FKJ A;  3WOD F;  2K40 A;  4IXA A;  3KYC B;  4J00 A;  3K7A J;  1QHH D;  3N97 A;  3GTQ J;  2IT0 A;  1RKW A;  3V8K A;  2P7V B;  1Z05 A;  4ZTF A;  4ZYG A;  3PSI A;  2BZT A;  1MH3 A;  1MBK A;  4NUB A;  4FHT A;  4U87 A;  3EYY A;  3M8F A;  5C44 J;  4FX4 A;  3PSF A;  5JLX A;  4B4C A;  4ZZD A;  2CUZ A;  2W57 A;  2LKP A;  3T1B A;  3RZD J;  4AID A;  2R7S A;  4BQO A;  3DTI A;  3KP3 A;  3OYJ A;  2COB A;  2DTZ A;  5B3S H;  4B8X A;  4ZTJ A;  3HB9 A;  3G71 I;  2DXI A;  3BOQ A;  2M9H A;  3FM5 A;  5LRS A;  3P9C A;  4UB6 C;  2Q1Z B;  3CQZ J;  4D1Q A;  1ZRD A;  3K70 D;  3DP7 A;  1D1B A;  3S1M J;  2MLG A;  1FWZ A;  3IKT A;  5E8G A;  1B72 B;  3LQQ A;  4Y4R A;  1UG2 A;  2DDB A;  3TW6 A;  2HKO A;  4B3X A;  1T0F C;  3SHF A;  1WJB A;  4EJW A;  4BDZ A;  1MBH A;  3OR2 C;  2FOW A;  3L2R A;  4OIP F;  1Z7U A;  1GVJ A;  2B9S A;  5B5E C;  5KAF C;  5FKM A;  4DIQ A;  3BDD A;  1EKE A;  3REO A;  3PIP F;  2EBI A;  5IYB J;  1TQI A;  2X6W A;  2EFO A;  2JMW A;  2DMN A;  2D1H A;  2HQN A;  2VKV A;  3KP2 A;  5FGM A;  2DA5 A;  4FE4 A;  3WE2 A;  1FSE A;  2XSJ C;  3COA C;  1JJ6 C;  2F5E A;  3JAM Z;  2R3S A;  2IS2 A;  2FEZ A;  1I4V A;  2E2J J;  2YX7 A;  3L7W A;  2IAI A;  2W00 A;  4LMY A;  4OWR B;  4CUG A;  2R7O A;  2VQH A;  3E97 A;  2GXA A;  5GPC A;  2EZK A;  3P9K A;  3CDL A;  5L3G A;  2GXB A;  1Z0X A;  4ZYH A;  3J81 Z;  1D1C A;  2AQE A;  3CJT B;  1IRG A;  4QWQ A;  4OMZ A;  1KU7 A;  4MIM A;  3SZT A;  3ZR8 X;  1W5S A;  2XF7 A;  5ICF A;  2JA8 J;  5D6E A;  3M9A A;  4QSH A;  1UHM A;  4ENN A;  1ETO A;  2HEO A;  2EZI A;  1D0X A;  3B73 A;  1R1T A;  1TP4 A;  2ECB A;  3K0L A;  3LAP A;  1WWX A;  1XX5 A;  4C9Y A;  3WU1 B;  2CS3 A;  4EQQ A;  4QPQ A;  5DDG A;  3JCU C;  4DJA A;  5LFA A;  5LBQ A;  1ZEL A;  3Q0V A;  2GIV A;  3TO7 A;  1YIJ I;  3DPL C;  3FMS A;  5ILS A;  3GFJ A;  4A3L J;  2XRL A;  4FAS D;  2IVM A;  5D5X B;  4BH9 A;  1FOX A;  4MTE A;  2ZJQ F;  4BXF A;  3ASN H;  3KPH A;  4BJ6 C;  4YIR X;  1SAN A;  2HDW A;  2KDZ A;  1MW7 A;  2ADU A;  3HOT A;  4U0Y A;  2X48 A;  2HOT A;  3S16 J;  4AIK A;  4I7H A;  2GZW A;  4YG2 F;  5LHH A;  4A3C J;  2FSW A;  3ABT A;  4BE2 A;  2YSR A;  5D6F A;  4ON0 A;  3WU0 A;  2OZU A;  5LHI A;  2NAZ A;  3K9T A;  3G2B A;  4MHG A;  3UNG C;  3FF5 A;  1SD5 A;  3JTG A;  4N4N B;  5L3E A;  1U78 A;  1T98 A;  1FZP B;  1OR7 A;  1OCZ H;  3BR6 A;  2EZL A;  1UJ8 A;  2DCE A;  1FYL A;  5JR3 A;  2COM A;  4E7S A;  1R6R A;  4KIG A;  3I53 A;  3ZN0 A;  2HFH A;  3OS1 A;  1QVU A;  3SEZ A;  3CMM A;  3CUQ C;  2QEX I;  5HNF A;  5JHF A;  5HLI A;  3LSK A;  4XL9 A;  3K4C A;  1PVE A;  2D1V A;  2IW5 A;  2WY7 Q;  3GTK J;  5IYD J;  2L7F P;  4M9X A;  3SJM A;  4A3B J;  4YFX F;  2KIS A;  3A0H C;  3S3O A;  4ANJ A;  4FQG A;  3K6G A;  3HOV J;  3ZQG A;  1E0E A;  3QWL A;  4LG0 A;  3OYN A;  3GCM A;  1DPR A;  5E1X A;  2ID6 A;  4MEX F;  4MNU A;  4F55 A;  5A2Q K;  5ICG A;  4IHS A;  1VQ6 I;  1ZK8 A;  5B1B H;  4E7K A;  4PDK A;  2M30 A;  2VXD A;  1POG A;  2E2H J;  1VQN I;  2M4G A;  2KRH A;  2AS5 F;  4L18 B;  2OAZ A;  3VWB A;  1LB2 A;  1STZ A;  3FBN B;  4CCO A;  1E3P A;  3GFL A;  2FBK A;  1UHS A;  3BR3 A;  4F52 A;  3RPU D;  3TW7 A;  3P5J A;  1K4S A;  3CJN A;  5LHG A;  1R58 A;  1XGM A;  4A12 A;  3MCZ A;  2P8T A;  1D5V A;  4K2E A;  2JUG A;  5E1Z B;  4X0G A;  3CME I;  1KU2 A;  5L3C A;  1MJB A;  2ZXI A;  1RIO H;  2RQP A;  1QU3 A;  4KIC A;  1S7E A;  1XD7 A;  1JI8 A;  1MBF A;  4GGG A;  5EEA A;  1D1A A;  3E6D A;  3OSF A;  2IRF G;  2DFH A;  4BHC A;  2ZNZ A;  4UV8 A;  4CZZ A;  4BYY A;  5F1R A;  2PMH A;  2XRO A;  4KNY A;  3LWF A;  1K4T A;  3LSP A;  1W36 D;  1G59 A;  3W6K B;  1ZTR A;  5J8F A;  3NEU A;  5E20 A;  3WTZ A;  3IP4 B;  5IYC J;  1ZRC A;  3ZQH A;  1U0J A;  1P7I A;  3WTY C;  4E7H A;  1SFO J;  3A01 B;  1VI0 A;  1TTY A;  1G4D A;  4RAG A;  2ZSH B;  2DK8 A;  3ZQQ A;  5GTH C;  1OJL A;  1PUF B;  2M7B A;  2NS0 A;  2XB0 X;  3CC4 I;  2B7E A;  5M3F J;  2CH0 A;  2KP6 A;  1V4R A;  1UMQ A;  3BR0 A;  3FMR A;  1B59 A;  1XDS A;  3FDY A;  2JK3 A;  3ZPL A;  4RDU A;  2JWT A;  1X3U A;  2RRE A;  5HOO A;  3NRV A;  3MMY B;  2CUE A;  4IF4 A;  3FBI B;  3OIQ A;  4JBA A;  3D5L A;  3ZQI A;  4A3J J;  1TWG J;  1WHU A;  2M7A A;  1JT0 A;  2L7M P;  1WI9 A;  3T0Y A;  1OFC X;  2I5U A;  1TT0 A;  2EQR A;  3LA2 A;  1MD0 A;  2JTV A;  5CVR A;  3GW2 A;  1I3Q J;  2DA7 A;  4HRI A;  2VBX A;  5FKK A;  2QKM B;  4XOT A;  2EK5 A;  2VJI A;  4A0Y A;  2GAU A;  1ON1 A;  4U0V A;  1ETX A;  5IT3 A;  1ZG1 A;  3IC7 A;  3VPR A;  4OIN F;  3JRD A;  1X19 A;  4KIF A;  3V42 A;  3JAM K;  2XC7 A;  2BW3 A;  3M1E A;  2OC6 A;  3P9I A;  2X6X A;  2RKH A;  3H9J A;  4PGH A;  1B8I B;  2A61 A;  1U3E M;  1OCR H;  1KQ9 A;  1FLI A;  1YW8 A;  5E17 F;  2YX4 A;  2E5N A;  5FD5 A;  1LUJ B;  3BC8 A;  3OYK A;  3S1N J;  4MFE A;  1YLF A;  1XS9 A;  2QF7 A;  1TL8 A;  1T6S A;  3K4M A;  2O7O A;  2HNF A;  2ZO4 A;  3HOX J;  3GTL J;  2VC1 A;  3HHG A;  3E5Q A;  3J81 K;  2UXN A;  1BIA A;  4XLA A;  1F43 A;  1JGS A;  2WA0 A;  3LFK A;  2HTJ A;  2EPF A;  2CQX A;  2WC2 A;  3K10 A;  2JA2 A;  3G73 A;  2IXS A;  1FOW A;  1Y8Q B;  1GXQ A;  3OIO A;  5FO5 A;  2H8W A;  4B47 A;  3JRE A;  2WAQ A;  4IJA A;  4D5F A;  2Z33 A;  2M34 A;  3S2H J;  1E3O C;  4C3J J;  3E5U A;  2M45 A;  1B6A A;  3ZXS A;  2XAU A;  3NWT A;  3V7S A;  3R4K A;  4MGR A;  4ZYA A;  2K85 A;  1SD7 A;  2GM4 A;  3RKQ A;  3ZMU A;  2WAQ N;  4DOZ A;  5H2F C;  2MD0 A;  1H8A C;  4AIH A;  3U1K A;  4KT5 C;  3SXY A;  2BXY A;  1O4X A;  2LLK A;  2VBW A;  1MMS A;  1UB9 A;  2QGU A;  4U0W A;  1CGP A;  5ILV A;  2E1M B;  3G1O A;  1W5T A;  2DAO A;  2BY0 A;  2F2E A;  2P81 A;  4ZZL A;  2ZB9 A;  5FFX A;  4EAT A;  3R0J A;  2ZXW H;  3M1C A;  2MYS A;  3G3Z A;  2W4S A;  1RR8 C;  4I09 A;  4M71 A;  3ERE D;  1K83 J;  2ZKZ A;  4PK4 A;  2R7T A;  3O8H A;  2O03 A;  3DLA A;  2OA4 A;  3VYS B;  1I39 A;  1BW6 A;  5JFR A;  2P6S A;  4JX5 A;  3IIQ A;  2E35 A;  4NC7 A;  1T95 A;  3Q9V A;  1J75 A;  1LE8 B;  1MIJ A;  2V79 A;  2F5F A;  4WXC A;  2VOD A;  1OYI A;  2P0W A;  2PG4 A;  1JT6 A;  3CCQ I;  1M1E B;  2WB1 A;  4V2G A;  1MH4 A;  2LNB A;  4XR6 A;  5EGO A;  4KMU X;  2GA2 A;  3RKX A;  3JRG A;  1EH7 A;  3AG1 H;  3MWM A;  2K02 A;  1RET A;  4CXF A;  5HVQ C;  5D5V B;  3TOB A;  6PAX A;  2UUZ A;  3ZQ7 A;  3CZ6 A;  1E17 A;  3BDN A;  2CYY A;  4X1E A;  2NVT J;  1OLT A;  2UXX A;  2Z5U A;  4Y15 A;  1DU0 A;  5ERI A;  2B63 J;  3S93 A;  2ZFU A;  3KYD B;  4EV0 A;  3CCS I;  3BCB A;  4CYC B;  3QPS A;  3ABK H;  3WTT C;  5C3E J;  3ZQL A;  2VPR A;  4B48 A;  1GXP A;  5TGT A;  1R00 A;  5LGN A;  2KRC A;  4YRV A;  2DYS H;  2EIJ H;  4EVI A;  2XDV A;  1BC8 C;  2Q0O A;  3CLO A;  2FQ4 A;  1Z1D A;  4EMS A;  2EIK H;  1VQ7 I;  4DGW B;  1BIB A;  1P6R A;  3O6B B;  1S8N A;  3K2Z A;  4IZZ A;  2Z9O A;  3BQZ A;  4G6T B;  1TWH J;  2FF4 A;  4H0E A;  1J09 A;  3B6A A;  3IRR A;  4KFC A;  1WJ5 A;  2HOS A;  3QQA A;  1S5L C;  3JR9 A;  2FQ3 A;  3H5N A;  5K7H A;  4B44 A;  3BTJ A;  5DEQ A;  1ZRE A;  2DA1 A;  4UVA A;  1LPQ A;  1D0Y A;  2QYO A;  4PJL A;  1MMA A;  3ABM H;  3U2R A;  1D3Y A;  2GLO A;  1ETW A;  1YRN B;  2D5V A;  1X1D A;  3TO9 A;  5IY5 H;  1SC7 A;  3ONQ A;  3MZH A;  4V19 K;  3BG5 A;  3U1D A;  2HI3 A;  4Q4Z F;  2IS4 A;  3FK6 A;  3HPG A;  3CF2 A;  4CH7 A;  1HDP A;  1OYW A;  2TDX A;  3IAS 2;  2W24 A;  3RYP A;  3C7J A;  2HVQ A;  3CCJ I;  1SMT A;  4HQM A;  4HNT A;  2FXA A;  1HBX G;  4YIF A;  1S6L A;  3RZO J;  4HQE A;  3C2H A;  1WVR A;  3PNV A;  1BM9 A;  2DMU A;  3QPH A;  5J4Y A;  3OYD A;  4O6J A;  1ZLK A;  2EFP A;  2Y69 H;  1IUY A;  1N77 A;  3A03 A;  1UST A;  2E2I J;  2JVH A;  1D8J A;  3BRO A;  4M6Y A;  2NVX J;  1T39 A;  1KCA A;  4YFN F;  4BGD A;  2XVC A;  3MKY B;  2WWY A;  4E7L A;  3M7G A;  4PJN A;  3A01 A;  2E7X A;  4I2O A;  1BR2 A;  2R7W A;  3EUH A;  5FKL A;  2OBP A;  5LLQ A;  4ENJ A;  4JOM A;  1S72 I;  5DCM B;  4AM3 A;  3F6O A;  2ZJP F;  3EQL F;  1DU6 A;  2W7N A;  3VOD A;  3HSF A;  2VOP A;  5EJC A;  2H8R A;  2L0K A;  2YS9 A;  5GAG J;  1LVK A;  4ENM A;  2BYV E;  2DA2 A;  4W97 A;  1BR4 A;  5F64 A;  1MDM A;  1R1U A;  3GEZ A;  5AIP A;  2LF8 A;  3RQ4 A;  1XN7 A;  4RGX A;  1LDJ A;  3E6M A;  3L2Q A;  1R9T J;  2VC0 A;  5J6X A;  4A69 C;  4MQ9 F;  2R7Z J;  4BQA A;  2XAF A;  2W1O A;  4XSX F;  1LEB A;  2G7H A;  2Y9Y A;  1BC7 C;  3JRC A;  3DV8 A;  2R5Z A;  2MGQ A;  1AWC A;  3HEF A;  1DP3 A;  2FD5 A;  4WXH A;  3FXJ A;  1JHF A;  1G8X A;  1FC3 A;  1IV8 A;  3RQI A;  2VE9 A;  1DGW Y;  1U9N A;  2VN2 A;  3QP5 A;  1U8R A;  5HDG A;  2HPM A;  4XLP F;  3FM3 A;  3J7A Y;  1JUS A;  1IN7 A;  2HXO A;  2HQA A;  4HF1 A;  3PM1 A;  3PUB A;  2LRD A;  1T2K A;  4IX7 A;  4P5O A;  3CCL I;  4G7H F;  1AY9 A;  1CF7 A;  3HHH A;  3F72 A;  4GYI A;  1Y6I A;  4LIU A;  4O5V A;  3VYR B;  3IUO A;  4ASN A;  3BPV A;  3I4N J;  5FLX Z;  3VB2 A;  5IP6 A;  3GX4 X;  2X1C A;  2F5D A;  2K9N A;  3HRU A;  5FLM J;  3CUQ B;  2CW8 A;  1OCT C;  2NOG A;  2VL8 A;  3ULQ B;  1WCM J;  1HF0 A;  2BHZ A;  4II2 A;  2R7D A;  3D5R C;  4W1U A;  3KYL A;  2A68 F;  2FUG 2;  2X6Y A;  3H0D A;  3BWG A;  2ISY A;  5TJJ A;  3OYL A;  1B4A A;  1P4A A;  1LJ9 A;  3BR1 A;  2QSF X;  4GYG A;  1R7J A;  4AU7 A;  4DNC A;  2DA3 A;  2DO7 A;  3WG7 H;  1TQP A;  1ZKG A;  2DQL A;  1NG7 A;  3M07 A;  3HGG A;  4DYQ A;  2D2W A;  3QOD A;  1AHD P;  3HC7 A;  1JTY A;  1R71 A;  2XB5 A;  3HGY A;  1BL0 A;  3DBL B;  4L9J A;  3E3V A;  1Z7L A;  3Q5F A;  3O2P E;  3H9G A;  1OCP A;  1DQU A;  1JUM A;  4BQQ A;  1IGN A;  2M4K A;  3CTA A;  3L2W A;  2CU7 A;  2MFZ A;  4HF0 A;  5DM7 F;  3S15 J;  4NV4 A;  4IHV A;  1HXD A;  3GF2 A;  3I4M J;  3CMY A;  1UEL B;  4BY7 J;  2R0Q C;  3WGH A;  2NRA C;  3AFH A;  1KU3 A;  1I6X A;  1V5G A;  1MMD A;  1MNE A;  3KP4 A;  3JRA A;  2XAQ A;  1NTC A;  2CO5 A;  2A5W A;  4II3 A;  4ZDP A;  4XRS G;  3S1R J;  3E0J B;  3CDI A;  2G7U A;  2X4H A;  4Y3O A;  3SDG A;  2MC4 A;  4A3D J;  4D7M A;  1EA3 A;  1WI3 A;  5D5U B;  4YEL A;  2R93 J;  2JQ7 A;  3F0C A;  1ZG3 A;  1FPQ A;  1XCB A;  4ESF A;  4AVP A;  1R49 A;  1QRY A;  2WV0 A;  4IEJ A;  4HDU A;  3EUA A;  2VB6 A;  2EFQ A;  2DFF A;  1IRZ A;  1W7P B;  3CCE I;  1FYK A;  3HUG B;  1U5T A;  1UFM A;  4XID A;  4L5J A;  3KLN A;  4UXN A;  4J19 A;  3B02 A;  1IJW C;  3BJO A;  5GAD J;  4X6A J;  2A07 F;  1BI0 A;  1TLH B;  2O3F A;  2V1U A;  4CCJ A;  5BPI A;  2MG4 A;  4OIQ F;  2CV2 A;  3H5A A;  3F22 A;  1OCO H;  1YS6 A;  3FIW A;  3LSJ A;  4B1R A;  4C30 A;  1R5I D;  2QSH X;  1TWC J;  3DEU A;  2K9S A;  2VJ5 A;  1BN5 A;  5EYR A;  3OSG A;  3MAJ A;  4RA2 A;  4A3F J;  1B9N A;  2V7F A;  1VQ4 I;  2JA7 J;  2MC3 A;  4XOP A;  4B43 A;  1FNN A;  3EYI A;  3HZJ A;  2K27 A;  4XMY A;  3A4C A;  4E7J A;  2JZY A;  5BOX A;  1S7A A;  2QCO A;  1OIS A;  2M0M A;  1YI2 I;  2QKL B;  4I0B A;  3ZMV A;  4BL0 B;  4Q48 A;  4NQW A;  3T5X A;  4HZF A;  1JE8 A;  3I9V 2;  5KNL A;  2DPD A;  2VQC A;  1R5H A;  1JHH A;  4JX4 A;  1YHQ I;  4ZDL A;  4LG3 A;  2JN6 A;  1H9T A;  4P55 A;  2LK2 A;  3I54 A;  1A6I A;  5EG0 B;  3UKG A;  2HVS A;  4EJV A;  3OYF A;  2XPV A;  2EFN A;  3LMM A;  5HLG A;  4LLN A;  3HOZ J;  4PFO A;  3ABL H;  1XC5 A;  3C3W A;  3HTS B;  1Y1W J;  1FMV A;  3OY9 A;  2NS7 A;  2VKE A;  2ACJ A;  1SD6 A;  4UNO A;  4S04 A;  1MKM A;  4EJU A;  4N4O B;  2LKX A;  1ZAO A;  2D45 A;  1VF9 A;  2FBH A;  1BJA A;  4RM3 A;  1XPX A;  1IG7 A;  4HLX A;  3ZCO A;  3R6S A;  1YJW I;  5AIQ A;  1KZH A;  2K4J A;  3DXJ F;  3VSL A;  2V26 A;  1D0Z A;  4CIC A;  2HNH A;  4Z6Y A;  4CYD A;  4XRM A;  2QQ8 A;  3WHC A;  3OS0 A;  3M4O J;  1JJ8 C;  2PN6 A;  2XRN A;  4N9I A;  1KQ8 A;  1ORK A;  1P9Q C;  3HRS A;  2ZME A;  3M8E A;  4PGG A;  5EEH A;  4D5C A;  1VQP I;  4OAY A;  1BOB A;  5EF6 A;  3J7Z I;  2DT5 A;  4BBR J;  3FXO A;  2O6G E;  1OR7 C;  4DYR A;  2CQQ A;  1RUN A;  5EEG A;  2DMT A;  4ESB A;  2WAD A;  3GTP J;  2K3P A;  1WKM A;  1IN6 A;  2OJE D;  2L7Z A;  1WQ2 A;  1FEX A;  2LH9 A;  5J1R A;  3RI4 A;  3MVP A;  5GP9 A;  2M3A A;  4LFU A;  4BS9 A;  2Y9Z A;  3VFZ A;  2RAE A;  3AL0 C;  1UCR A;  1RKT A;  4P9U A;  3F3X A;  4AD9 A;  1MBJ A;  1YIO A;  1IAW A;  3CDH A;  4MEY F;  1N78 A;  3B6C A;  2R7U A;  4S0H B;  4ENK A;  4OIR F;  2DJN A;  2HDC A;  1FTZ A;  2JSP A;  4B3A A;  2E1N A;  4A0Z A;  2EIL H;  2PJR A;  4G7Z F;  2E36 A;  1KN9 A;  1NK3 P;  5FLX K;  1Y8R B;  3H35 A;  2VT2 A;  2AHQ A;  4G7O F;  1HKT A;  3J80 Z;  2L02 A;  1ON2 A;  5K5O A;  3BQY A;  1AKH A;  4G94 A;  3JRH A;  3JSO A;  2QBY A;  2KKO A;  4IHX A;  5K1Y A;  3CMA I;  1MND A;  2FNA A;  3BY6 A;  2A05 A;  4GRI A;  1W0T A;  4CO8 A;  1ZR2 A;  2OCE A;  1BJZ A;  5IP7 J;  1ETK A;  1R5G A;  3FK7 A;  1ZGW A;  4G6D A;  1FIA A;  3CP2 A;  1FBS A;  5JHU A;  4XRF A;  3F23 A;  3DWL E;  4L9V A;  1WJE A;  3BJ6 A;  4A3K J;  3BG7 A;  1JKQ C;  4IHY A;  4U7B A;  1YW7 A;  2PBI A;  2PI0 A;  1GV2 A;  1F1Z A;  1D8K A;  3G1L A;  4A6E A;  3OYE A;  2XV4 S;  1BBY A;  2F5V A;  2KIU A;  2M5W A;  4RMN A;  2GOM A;  4I76 A;  1L0O C;  3I59 A;  2XGE A;  2K9Q A;  2XPW A;  1WJD A;  1RRJ A;  1S3J A;  2JA6 J;  3DPT A;  3PJR A;  3LOC A;  2MA3 A;  3N05 A;  4LB6 B;  1APL C;  5M3M J;  4HF2 A;  3OYA A;  2ZXJ A;  2XAH A;  3A1Y A;  2TRT A;  3K2A A;  4I0A A;  5GAE J;  3K70 C;  4IKF A;  3MKW B;  1T7D A;  3DU5 A;  2DTR A;  2PQ8 A;  3OL3 A;  2ID3 A;  1P2F A;  3MZY A;  3CF5 F;  1K79 A;  3OR1 C;  4I01 A;  1YOV B;  1LEA A;  3T8T A;  2L5Q A;  3KZZ A;  5H20 A;  3HOS A;  5M5W J;  1IDZ A;  5FRO A;  4NDL A;  3OYH A;  2DYR H;  2EV0 A;  3HPH A;  2F5C A;  2DI3 A;  2L54 A;  3HM5 A;  3CJQ B;  3H1C A;  3QOE A;  3WU2 C;  2HOE A;  1I27 A;  2JA5 J;  3C2G A;  1PUE E;  1HKS A;  1BOA A;  3GBG A;  3QYE A;  3BZC A;  2PFB A;  3LQR A;  1PYV A;  5FKN A;  4BAY A;  2FE3 A;  1YX5 A;  5HS8 A;  2I8D A;  3AKZ A;  2Q2E B;  3CCR I;  2Y0M A;  4LB5 A;  3HUG A;  5J1Y A;  4KN4 X;  3MEX A;  4HDV A;  1B72 A;  4GXO A;  5BMZ A;  1ZGJ A;  4Q47 A;  2IA0 A;  2H1K A;  3SZG A;  2JSC A;  3WHB A;  2HKX A;  4FET A;  3JRF A;  2R7V A;  3V4G A;  3SQN A;  1GVD A;  3BPX A;  2Y0S A;  2J5P A;  2P5V A;  5M5Y J;  2GA1 A;  4EM2 A;  4UVB A;  5ILU A;  2RGV A;  4UUS B;  1OYY A;  3DU6 A;  1X1C A;  2Q8K A;  1Y0U A;  3QAH A;  3IAM 2;  4HNU A;  2LMD A;  1F36 A;  3F21 A;  1FX7 A;  5IOY A;  3HSE A;  4NC8 A;  3FX3 A;  4RGU A;  1IDY A;  3I5U A;  4CCN A;  4FCY A;  4HNV A;  4ETS A;  2Y0S N;  1XSD A;  1VQ8 I;  1HLV A;  4MFD A;  2DU9 A;  3BZ6 A;  3HXL A;  1ZRF A;  3F8C A;  1MBE A;  3GTG J;  3PQK A;  2HYF A;  3A2K A;  5AON A;  1V5F A;  1ZG5 A;  2W82 A;  3CES A;  4IOA F;  5F27 A;  1HSJ A;  2WV1 A;  2QSG X;  5LGU A;  4LOC A;  2QQB A;  1Z6R A;  2Y75 A;  5TRD A;  4ZYE A;  1HW5 A;  2DA4 A;  2ESH A;  2RV8 A;  2ZJR F;  1JKR C;  3QYB A;  1IZ1 A;  1FP2 A;  1W4M A;  2M8E A;  2ZC2 A;  3DKW A;  4R8H A;  3WE3 A;  1ENH A;  1QZY A;  4BE0 A;  1ZR4 A;  2Y48 A;  3MKZ A;  1YIT I;  1FYM A;  2EJR A;  3UR3 C;  2O9L A;  1SFK A;  1OMI A;  3KET A;  2K9L A;  4TV7 A;  1VND A;  2CFX A;  4HSR A;  5CPR B;  4Q5S F;  1BI3 A;  2L3D A;  4HEA 2;  4A3M J;  1IUF A;  2NS8 A;  3M3Y J;  5BQT A;  4IRI A;  2HS5 A;  3V8J A;  2LTP A;  4IL6 C;  3GZ6 A;  1BA5 A;  3GME A;  4BEH B;  2VT3 A;  4C2M J;  3QOP A;  2EIM H;  4EM0 B;  4WWC A;  3VYU B;  1IV6 A;  3R61 A;  2V9P A;  1WJA A;  4E7Z A;  2NVU B;  1T08 B;  2DK5 A;  2HR3 A;  1GHC A;  1H9G A;  1V54 H;  2LBF B;  2AQF A;  2EB7 A;  3LSH A;  3M8J A;  3GFI A;  3Q9S A;  2B0L A;  1XGO A;  1SFX A;  3WTW C;  2BVL A;  5ICE A;  4BNC A;  2ZBK A;  2PEX A;  2MW8 A;  1T8I A;  4M72 A;  3VDX A;  3NAR A;  1S9H A;  1YO5 C;  3S3N A;  3BZK A;  3LA3 A;  3S3M A;  2HWV A;  3TOA A;  4RAY A;  4JK1 X;  3IWZ A;  3ZRG A;  2CSO A;  4IQ4 A;  2CWE A;  4D0P A;  3DFG A;  5DD8 A;  2NVY J;  1I3A A;  4FE7 A;  1MNM C;  1X1A A;  1J9I A;  5GPA A;  4M3B A;  3J80 K;  1UAA A;  2VKH A;  1ZGA A;  2P7C B;  2IPQ X;  3PUF A;  3LSR A;  1R22 A;  1XB4 A;  1LDK B;  1MSE C;  5E18 F;  2HOA A;  5E3L A;  1G3T A;  3D5S C;  2LY1 A;  5D5W B;  2R4G A;  4HX8 A;  4AIJ A;  2CQK A;  3F8F A;  1GUU A;  2ECC A;  4XLC A;  4Y17 A;  1LNW A;  2DT7 B;  4OIO F;  4ZDO A;  3VYT B;  1V5E A;  2R5Y B;  3WTV C;  3FWE A;  2MD5 A;  4E6K G;  5K5Q A;  3HL2 A;  2O8X A;  3IHU A;  2HXI A;  3S2D J;  1MJA A;  1PJR A;  3EDP A;  3D1N I;  1I50 J;  3ASO H;  2FOK A;  3I4P A;  3PL8 A;  1W36 C;  3I58 A;  4KIB A;  3CC2 I;  2LG4 A;  1ZLJ A;  2V6E A;  1E2X A;  1U2W A;  1ETV A;  1WRJ A;  3JSP A;  2Z16 A;  3W3C A;  3H92 A;  3FKI J;  4QTR A;  1O3T A;  1X3W B;  3OYC A;  4R79 A;  2FMY A;  3GO5 A;  1NHA A;  3ROU A;  3Q0U A;  3L2U A;  2ZXH A;  1J5Y A;  3ELK A;  4ESJ A;  2EV5 A;  2P5K A;  4J01 A;  1KYW A;  3IH3 A;  2V9V A;  1PDN C;  2R7Q A;  3RSN A;  2CV0 A;  3F8M A;  2FBI A;  1LFU P;  4ABZ A;  1VQK I;  2LR8 A;  4XKV A;  3OMY A;  1FMW A;  2ZJ2 A;  5HNH A;  4GDF A;  4XIC A;  3WTS C;  4M9S A;  5CVV A;  3JTH A;  1JHE A;  3EUH C;  2JPB A;  2CUJ A;  1MMG A;  2QUF A;  5DV5 A;  4XLE A;  2YU9 J;  2NOJ B;  3JW4 A;  5ICC A;  2M1B A;  3FIS A;  2YU3 A;  2FKD A;  2QEN A;  5DCF A;  5IP9 J;  4UB8 C;  3AG2 H;  2I10 A;  2K7L A;  4KYW A;  1SD4 A;  3K69 A;  4KDP A;  3KP6 A;  4HLY A;  1PUF A;  2ZSI B;  3BTL A;  4A5M A;  2HTS A;  5J4V A;  4A3G J;  3HIF A;  2FU4 A;  3FXM A;  3PIO F;  2IA2 A;  2NXN B;  1WH7 A;  2L9S A;  4D9J A;  1FOY A;  1MMN A;  5CQE A;  3VSK A;  1N75 A;  4OAZ A;  5K7Z A;  4IRG A;  5DUK A;  1MGT A;  4QIW N;  2Q2E A;  4IOC F;  5E79 C;  2GIZ A;  2RQQ A;  3OYI A;  2OZ6 A;  5L3D A;  4M3D A;  3IV5 A;  1UZC A;  5J1U A;  3V7C A;  4KN7 X;  1FT9 A;  4KIT B;  3SEQ A;  5M5X J;  4C3H J;  5TIS C;  2KT0 A;  1WGX A;  2KQR A;  2DOE A;  3H5R A;  3OOP A;  4IVN A;  3RCO A;  3KZY A;  5KK1 A;  4K8W A;  5FD6 A;  3DKY A;  4PJ0 C;  3AG4 H;  4YFK F;  2F4M B;  4XRS A;  4L5I A;  3QU6 A;  3BJA A;  3GTJ J;  1ODD A;  1RUO A;  2ICW G;  3RPQ A;  3F9K A;  1KON A;  4XLF A;  4G8X A;  1B8I A;  3E6B A;  5LD2 C;  1FY7 A;  5BNG A;  4U7D A;  1HST A;  5CLS A;  4Y13 A;  2IJL A;  2OTL I;  9ANT A;  4BBS J;  2R7R A;  2EH3 A;  2WAE A;  2EFW A;  3AL0 B;  5E8I A;  1U6G A;  4RB2 C;  3CCV I;  4HBL A;  3F6V A;  1QQI A;  2KJB A;  4BDY A;  1SAX A;  5DYM A;  5BPD A;  4HPQ A;  4DZJ A;  3LFU A;  1RR7 A;  2IGK A;  3GXO A;  4U88 A;  4XSZ F;  4LG0 B;  5J40 A;  3FHN A;  4A5N A;  5F04 A;  3OS2 A;  1O3S A;  1TBX A;  1HDD C;  2TCT A;  1X1P A;  2Z3Y A;  4ZJZ A;  1JHC A;  3H36 A;  5D8K B;  1RNL A;  2ME6 A;  4AYB A;  3I71 A;  3TDZ C;  2L4A A;  3DEE A;  1T56 A;  4LD5 A;  5L3F A;  2BV6 A;  3OIP A;  4WX9 A;  5E3M A;  2CG4 A;  4RM2 A;  3TL4 X;  2NYX A;  1H89 C;  1HCR A;  3BT9 A;  3MKL A;  5CVU A;  4M74 A;  3EPZ A;  2YR2 A;  4XNF A;  2AXT C;  2K5C A;  3TP0 A;  4AYB N;  4BEH A;  3SYT A;  2W25 A;  3DBH B;  1O3Q A;  2L01 A;  4KT6 A;  3ZQC A;  4HX7 A;  2X9D A;  4BU2 A;  3SFZ A;  2ME0 A;  2VJJ A;  4HV6 A;  1Q1V A;  2XKP A;  2VPL A;  3GTM J;  5JVT A;  4M6V A;  3WTX C;  4ME8 A;  3LAJ A;  3Q0W A;  1W5C C;  2LP0 A;  3W2W A;  1T38 A;  3K1M A;  5J3L A;  4IO9 F;  1A5J A;  4FTH A;  2F4O B;  1QGP A;  2MSY A;  4CA0 A;  2E71 A;  2M2E A;  1LE8 A;  1SAU A;  2V9K A;  2DOD A;  1U5T C;  3MN2 A;  2BVM A;  3LSG A;  2DJI A;  3VOE A;  5FRN A;  3J7A O;  2KFD A;  2BXZ A;  3GUD A;  5DD4 A;  2H6B A;  1VQL I;  4UV9 A;  1XMK A;  1QPM A;  4YII A;  4CDG A;  1ZH5 A;  1Y1V J;  3FXL A;  2Y30 A;  2PMZ N;  2QVO A;  1XMA A;  3H9Q A;  2E1O A;  4XLH A;  1F39 A;  3K4B A;  2VOO A;  2NNY A;  2XAS A;  1HQC A;  2QM3 A;  4CYC A;  3DF8 A;  2VE8 A;  2A5Y B;  2RN7 A;  2V6C A;  2X1D A;  4Y33 A;  3ZGK A;  1SFE A;  4LLL A;  4S05 A;  2EA2 A;  3S8P A;  1LFB A;  1A04 A;  1JKO C;  2BEO A;  4M9Z A;  4RBO A;  1X4O A;  1S7O A;  2IA1 A;  4F93 B;  5FJ8 J;  2O0Y A;  2X51 A;  1G6N A;  1W7P D;  4OOI A;  1L3L A;  4XK4 A;  5GTI C;  1TWF J;  1DP7 P;  3QPL A;  3L09 A;  3MQ0 A;  5CKT A;  2KPM A;  1QZE A;  2JJ7 A;  2Y2Z A;  2GQQ A;  4EEF G;  5HOD A;  1B1B A;  1IN4 A;  4LK0 F;  3HRT A;  4N31 A;  2OTJ I;  2E60 A;  2R5Y A;  1A35 A;  2DT6 A;  3CD6 I;  1W0U A;  2ZNY A;  3H0G J;  5E3O A;  2QWW A;  1KYZ A;  4CSW A;  3X2Q H;  3KLO A;  1QHG A;  3KEY A;  2L2O A;  5EZG A;  1GT0 C;  2R92 J;  1IW7 F;  2ESN A;  3RDI A;  2A6H F;  3P7N A;  1WJF A;  2KL4 A;  2H94 A;  2DPU A;  3K4K A;  2BW3 B;  4DW6 A;  2KLO A;  1O3R A;  1T0F A;  1YRN A;  1SEU A;  3G6E I;  3I55 I;  1QA6 A;  3BR5 A;  4RLF A;  2FJ1 A;  4DQ2 A;  1WFX A;  1NH3 A;  4PUS A;  1TW2 A;  2K3F A;  1XTA A;  2MH2 A;  5EDN A;  1U8B A;  2E1C A;  3E5X A;  2KZG A;  5FB2 A;  1DPU A;  2LYC A;  3HRM A;  3CJR B;  2G0E A;  3IKV A;  4NB5 A;  1R4N B;  4ZH4 F;  2XSD C;  2P4W A;  2LY9 A;  1P7J A;  2MAB A;  3A02 A;  1AA7 A;  2IGO A;  3CO6 C;  2VBY A;  1IN8 A;  2IEK A;  3ZP5 A;  1ACI A;  1B12 A;  3GWZ A;  4LIV A;  2JVG A;  2ZME C;  1Y56 A;  5H6Q A;  4MTD A;  3WTU C;  4IPA A;  2XAG A;  2O61 A;  1QPI A;  4P9F A;  2EV6 A;  4E7I A;  3OYM A;  1E3H A;  5DCM A;  1XGS A;  5HS7 A;  2DMP A;  2RNJ A;  4WK8 F;  3HOY J;  2IGN A;  3ERM A;  2BBY A;  2R7F A;  3KZI C;  4UUT A;  2MH9 A;  3U9G A;  4A3E J;  3PO2 J;  4CCM A;  3DTK A;  1S29 A;  1UHW A;  3BG3 A;  4HST A;  4LIT A;  3GTO J;  1K78 B;  3QRF F;  2K9M A;  3RYR A;  4KA4 A;  2V1D A;  2VXZ A;  4BE1 A;  4M3E A;  3PO3 J;  2X85 A;  2DDA A;  4F3Q A;  2W48 A;  4MO7 A;  2VI6 A;  1Z9C A;  2QZ8 A;  4JYK A;  4OU0 A;  2E19 A;  2N8G A;  1FOK A;  4LGW A;  4A2U A;  3SFI A;  1TNS A;  1IN5 A;  2YUS A;  5C4X J;  2LRE A;  5KCM A;  4L9T A;  3H3U A;  2WBM A;  1TWA J;  3BP8 A;  3E7L A;  2MBF A;  5EGO B;  2VON A;  1MJ9 A;  3J7Y J;  3RIR A;  4RGS A;  2IS1 A;  3GZ5 A;  2Y31 A;  4O3M A;  2R7X A;  1FBU A;  2DLL A;  2KJC A;  4IQJ A;  2LVS A;  5DUI A;  1Z67 A;  2J5O A;  3HKZ A;  2XHK A;  2HO0 A;  4LLG F;  4XKB A;  2HYG D;  2L7K A;  3NAU A;  4HX4 A;  3C2B A;  3DLL F;  3QP6 A;  1EV7 A;  1DDN A;  3W2A A;  4PSX A;  3CUQ A;  5IT9 K;  3HKZ N;  2W85 A;  1EJ9 A;  3GYH X;  1SVM A;  3AAF A;  3W6J B;  4XKW A;  3I64 A;  2UWM A;  3LL7 A;  3ZQF A;  2AO9 A;  2JRM A;  5CVJ A;  2PJP A;  1ZYR F;  1N25 A;  3K1N A;  1XDU A;  2FX0 A;  3KP7 A;  2C6Y A;  4HV5 A;  1K7A A;  3E6C C;  2KRF A;  3BTI A;  2LSO A;  3RKY A;  2HGC A;  2IGM A;  3LA7 A;  5GAH J;  3K4N A;  4A93 J;  1PP8 F;  5HLT A;  3FMQ A;  2CJJ A;  1R1V A;  1R36 A;  1WJC A;  3O3K A;  5CVI A;  2VAS A;  3SDB A;  1JTX A;  2H1L A;  3DCF A;  1Z6T A;  2EIN H;  2OPT A;  2HQ5 A;  2L9R A;  3O8G A;  1O7L A;  1X2N A;  3C18 A;  3TP3 A;  5L3B A;  1VQ9 I;  3IWF A;  5HLH A;  1B9M A;  4BXX J;  1IRF A;  1FBQ A;  2JRT A;  2FRH A;  3KIO A;  5F1J A;  1ETQ A;  3ZMS A;  4BJ5 C;  2Z2S B;  4RB1 A;  1G3Y A;  1HOM A;  3ML6 A;  2PX9 A;  4NHJ A;  2LKS A;  2K86 A;  4XM3 A;  4WXD A;  4MQV A;  1IXR C;  1VTN C;  2YPR A;  1X2M A;  3CCY A;  1W1W E;  3TKY A;  4ZYD A;  1BI1 A;  2KMU A;  2DBB A;  1SVO A;  3L2C A;  3FZV A;  1W7P A;  3S17 J;  3TGN A;  3U21 A;  3CUO A;  1REP C;  1OCC H;  4FIS A;  3GLX A;  1H0M A;  2A69 F;  2JPC A;  2G9W A;  2XUB A;  3QPT A;  4BKX A;  4XQF A;  5J8C A;  2ELJ A;  1P92 A;  1O7F A;  3S32 A;  3I0T A;  2L9V A;  3KFW X;  2STW A;  1IXC A;  2DW4 A;  1GDT A;  1MDM B;  1WPK A;  2WY8 Q;  4C2T A;  1Z21 A;  2QQ9 A;  2DOA A;  1IF1 A;  4RAF A;  1VFC A;  3FXU A;  1HW1 A;  3L00 A;  1C0W A;  1ERD A;  2ZCW A;  1EF4 A;  3H3V K;  4XN3 A;  3E1S A;  4DZP A;  2XPU A;  4AVZ A;  4M3G A;  4JX6 A;  1ULY A;  1JKP C;  4M6X A;  2X0L A;  2R5Z B;  1R4M B;  4GFB A;  1OQY A;  1GV5 A;  1HA8 A;  1X58 A;  1JGG A;  3HOW J;  3PFY A;  2XAJ A;  2L4M A;  3ECH A;  2EA4 A;  2RC4 A;  2GOX B;  2V1N A;  2MLK A;  1NG6 A;  1TC3 C;  1RES A;  4E70 A;  3JRB A;  2XF6 A;  3WGI A;  1KQ0 A;  1BR1 A;  2CUF A;  2ISZ A;  1IO2 A;  5CYV A;  2CW0 F;  3RKW A;  3LSM A;  2GXG A;  2H09 A;  3KEQ A;  3S04 A;  3WGG A;  5KAI C;  1H88 C;  2BHY A;  5JLW A;  4BJT A;  1VQ5 I;  4I98 B;  1G3W A;  2WAF A;  4AUX A;  1CF7 B;  5DTD A;  1BI2 A;  1MZB A;  5EG0 A;  2STT A;  2LF7 A;  4QPO A;  2NVQ J;  5LEJ A;  5JVG F;  4HAM A;  2OF7 A;  1YYV A;  3PFI A;  2XKO A;  1TQM A;  1YW9 A;  4UHT A;  2RNG A;  5J47 A;  2BE5 F;  4N0B A;  1FTT A;  2LY2 A;  4ZC3 A;  5K5R A;  4HA8 A;  4FT8 A;  4PJM A;  5ED4 A;  3H3Z A;  3TMO A;  3TED A;  2DN0 A;  1TZL A;  4EJO A;  1JUP A;  2X1E A;  1ONV A;  2BY3 A;  1EH6 A;  1XG1 A;  2OD5 A;  3MD2 A;  3L1P A;  2LC2 A;  1P4X A;  4PFP A;  3CCU I;  3FXR A;  5HDK A;  1J7K A;  3MFK A;  5KVR A;  4WF2 A;  3OYB A;  1QVT A;  2X6O A;  3OWT A;  1YS7 A;  2GWR A;  4GO1 A;  4L0Y B;  2OV7 A;  2VBZ A;  3GZN B;  1A36 A;  3VEP A;  1ZHF A;  4AWX B;  1O57 A;  2E7W A;  3S1Q J;  5KHD A;  4Z2Y A;  3KCC A;  4KMF A;  3K4J A;  1RPW A;  3DEW A;  3CC7 I;  4NNJ A;  1XMX A;  2HYJ A;  4EGY A;  1MSF C;  2LFB A;  3K4L A;  1ZN2 A;  1Z77 A;  5DS9 A;  1WZ2 A;  2OCC H;  1VZ0 A;  2FA5 A;  4A0X A;  1K78 A;  1FP1 D;  2ELH A;  3PNT A;  1EH8 A;  4L5E A;  4KIS A;  2QQA A;  1F9N A;  4V2F A;  2CRG A;  5B1A H;  4CZC A;  1RZ4 A;  3GVA A;  1WSU A;  5LEK A;  4Y7N J;  1YQA A;  2FML A;  1U9O A;  4RAZ A;  4FX0 A;  5FFZ A;  4XON A;  4WCG A;  1G2H A;  2ZFW A;  2LOO A;  1PP7 U;  1YG2 A;  3IH4 A;  3KEO A;  3QYF A;  4XKC A;  4XOR A;  1J2X A;  3HBL A;  3HTU A;  5F0F A;  3HDD A;  3EET A;  2M0C A;  2CGP A;  1Z3X A;  2K4B A;  1YJN I;  2A6E F;  3RTR A;  2OUM A;  1T33 A;  4OMY A;  5F0C A;  5FKO A;  5F0H A;  1IRX A;  2HZD A;  4LK1 F;  5F08 A;  3LST A;  3T8R A;  3HSR A;  4N9H A;  1LKX A;  5LGT A;  3F8B A;  1R23 A;  3TO6 A;  5IOZ A;  1MBG A;  3PQJ A;  2PLY A;  4MLO A;  1U5T B;  4KJZ A;  5HDN A;  1K6Y A;  1V55 H;  2WB1 N;  1DUX C;  2XGD A;  1I6H J;  1FIP A;  2OQG A;  4F91 B;  3K1P A;  2LD5 A;  4CHU A;  1F4K A;  1QZZ A;  3DKX A;  2NNN A;  3EUK L;  1SFU A;  4IHW A;  2IP2 A;  5EZH A;  1A6Q A;  1JXS A;  2A3S A;  3BR2 A;  1LQ1 A;  3ZN1 A;  1TW3 A;  5F6F A;  4M3F A;  3R0A A;  4P1W A;  3HOU J;  5HS9 A;  2XGC A;  1HKQ A;  2OQR A;  4XN0 A;  4RB3 C;  1Z3Y A;  3A0B C;  5D4R A;  4L9N A;  2M87 A;  1XCV A;  3KE2 A;  3ZMT A;  2HQR A;  5D4S A;  1K6O A;  4M73 A;  3RPU A;  2HPI A;  2LDU A;  4R1H A;  1AOY A;  1RC9 A;  2KDO A;  2HDD A;  3TDU C;  5D8L B;  2CQN A;  2VLA A;  4IRH A;  2UV1 A;  3I56 I;  4QLC U;  3IRQ A;  4Y52 J;  3IL2 A;  4PCQ A;  2CW7 A;  1X4P A;  4PZJ A;  1GLN A;  1XGN A;  4I6Z A;  1NK2 P;  2P5L C;  4JP0 A;  3CLQ A;  1X3Z B;  1I1S A;  4NQW B;  2BY2 A;  1D5Y A;  1ETY A;  1KU9 A;  1RI7 A;  1SMY F;  4LJZ F;  5E1W A;  5CQG A;  4JQF A;  4A3I J;  3IH2 A;  5C4J J;  2F4I A;  2UZK A;  3HYI A;  4F92 B;  4C2U A;  3HG9 A;  4G6Q A;  1AU7 A;  2F48 A;  4UVC A;  3FHZ A;  2QA4 I;  1DGR M;  1HC8 A;  2VJ4 A;  2AXL A;  3CO7 C;  1YFH A;  4RB0 A;  4DYC A;  2WTE A;  2Z1D A;  3S14 J;  3FXK A;  2HU9 A;  3ZOB A;  2L9N A;  2DFI A;  4I02 A;  5IPA A;  5B66 C;  5BS6 A;  3R60 A;  2DOF A;  2CV1 A;  2BY1 A;  4YEJ A;  3SZP A;  1QO0 D;  3ZMZ A;  3BTC A;  1LFP A;  2GBY A;  2CFO A;  3Q3S A;  4UUV A;  3DTE A;  2M8G X;  4HG2 A;  4BXU A;  3V7R A;  3RJP A;  1YJ9 I;  2BOL A;  2EZH A;  4CCL A;  3CCM I;  3OL4 A;  1BW5 A;  2ZME B;  3BG9 A;  4BHP A;  2DQR A;  2EWN A;  2VKD A;  4EM1 A;  1YTY A;  2IS6 A;  4CGZ A;  2DA6 A;  3KX2 A;  2CQ7 A;  2VIX A;  3HJE A;  3L2V A;  1ZQ3 P;  2V4J C;  3TBI A;  1I5Z A;  3NQO A; 
#chains in the Genus database with same CATH homology
 1IXS B;  1LDD A;  1XSX A;  4G9Y A;  1V3F A;  2ETH A;  2BGC A;  4RS8 A;  4P96 A;  3N4M A;  2H27 A;  1J59 A;  1J0R A;  3QU3 A;  2V1X A;  1HW2 A;  1QBJ A;  1G3S A;  3ZMD A;  3FXQ A;  3C1D A;  4XBF A;  2OU2 A;  2H6C A;  3KP5 A;  2RVC A;  2XIG A;  1OPC A;  2KIF A;  4GCV A;  3TQN A;  2XGX A;  1QNT A;  3L9F A;  4L0Z B;  4BHB A;  1ZAR A;  4IHT A;  5H6R A;  4EJT A;  3F8N A;  1USS A;  2PMU A;  3ABU A;  2RDP A;  5CJ9 A;  1TNT A;  2QBY B;  2HZT A;  1P4W A;  5IT9 Z;  2P6T A;  3OV8 A;  2JT1 A;  4HYE A;  5A2Q Z;  2FJR A;  3D0S A;  1FSH A;  4A6D A;  4RGR A;  2QLZ A;  2KIM A;  3V8L A;  1XSV A;  1KA8 A;  1Q1H A;  1LVA A;  4F7Z A;  1I1G A;  4EGZ A;  5JI6 A;  4HOB A;  1Z91 A;  3S2W A;  1OKR A;  2FNP A;  2W84 A;  5LRR A;  3I59 B;  4XLN F;  1UMU A;  3GFM A;  4HW0 A;  1F5T A;  3WG9 A;  3ISP A;  3ECO A;  3DQV C;  4KUM A;  1KGS A;  4B09 A;  2Z99 A;  3WOD F;  4IXA A;  3N97 A;  2IT0 A;  3V8K A;  2P7V B;  1Z05 A;  4ZYG A;  4FHT A;  3EYY A;  3M8F A;  4FX4 A;  4ZZD A;  2W57 A;  2LKP A;  3T1B A;  3KP3 A;  4B8X A;  3BOQ A;  5LRS A;  3FM5 A;  3P9C A;  1ZRD A;  3DP7 A;  2MLG A;  1FWZ A;  3IKT A;  5E8G A;  3LQQ A;  2HKO A;  3SHF A;  4EJW A;  4OIP F;  1Z7U A;  1GVJ A;  3BDD A;  3REO A;  1TQI A;  2EFO A;  2D1H A;  2HQN A;  3KP2 A;  5FGM A;  3WE2 A;  1FSE A;  3COA C;  2F5E A;  3JAM Z;  2R3S A;  2FEZ A;  1I4V A;  2YX7 A;  3L7W A;  4LMY A;  3E97 A;  3P9K A;  5L3G A;  2GXB A;  4ZYH A;  3J81 Z;  1IRG A;  4QWQ A;  4OMZ A;  1KU7 A;  3SZT A;  1W5S A;  5ICF A;  5D6E A;  3M9A A;  1UHM A;  4ENN A;  2HEO A;  3B73 A;  1R1T A;  3K0L A;  3LAP A;  1WWX A;  3WU1 B;  4EQQ A;  5DDG A;  5LBQ A;  2GIV A;  3TO7 A;  3DPL C;  3FMS A;  5ILS A;  3GFJ A;  2IVM A;  5D5X B;  4BH9 A;  4MTE A;  2ADU A;  3HOT A;  4U0Y A;  4AIK A;  4I7H A;  2GZW A;  4YG2 F;  5LHH A;  2FSW A;  3ABT A;  2YSR A;  5D6F A;  4ON0 A;  3WU0 A;  2OZU A;  5LHI A;  2NAZ A;  3K9T A;  4MHG A;  3FF5 A;  1SD5 A;  3JTG A;  5L3E A;  1U78 A;  1T98 A;  1FZP B;  1OR7 A;  1FYL A;  5JR3 A;  2COM A;  4KIG A;  3I53 A;  3ZN0 A;  2HFH A;  3CUQ C;  5HLI A;  2D1V A;  2IW5 A;  4M9X A;  4YFX F;  4LG0 A;  1DPR A;  5E1X A;  4MEX F;  4MNU A;  5A2Q K;  5ICG A;  4IHS A;  4PDK A;  2M30 A;  4L18 B;  2AS5 F;  2OAZ A;  1LB2 A;  1STZ A;  3GFL A;  2FBK A;  3CJN A;  5LHG A;  1R58 A;  1XGM A;  4A12 A;  3MCZ A;  2P8T A;  1D5V A;  4K2E A;  5E1Z B;  1KU2 A;  5L3C A;  1MJB A;  1RIO H;  2RQP A;  4KIC A;  1XD7 A;  4GGG A;  3E6D A;  2IRF G;  4BHC A;  4CZZ A;  5F1R A;  2ZNZ A;  4UV8 A;  4BYY A;  2PMH A;  2XRO A;  4KNY A;  3LWF A;  3W6K B;  5J8F A;  3NEU A;  5E20 A;  3WTZ A;  1ZRC A;  3WTY C;  1TTY A;  1G4D A;  2DK8 A;  2NS0 A;  1V4R A;  3FMR A;  1B59 A;  1XDS A;  3ZPL A;  1X3U A;  5HOO A;  3NRV A;  4IF4 A;  4JBA A;  3D5L A;  3T0Y A;  1WI9 A;  3LA2 A;  1MD0 A;  2JTV A;  5CVR A;  3GW2 A;  2VBX A;  2EK5 A;  4A0Y A;  2GAU A;  1ON1 A;  4U0V A;  5IT3 A;  1ZG1 A;  3IC7 A;  4OIN F;  4KIF A;  3JAM K;  3M1E A;  3P9I A;  2RKH A;  4PGH A;  2A61 A;  1U3E M;  1KQ9 A;  1FLI A;  1YW8 A;  5E17 F;  2YX4 A;  5FD5 A;  1YLF A;  1T6S A;  2HNF A;  2ZO4 A;  2VC1 A;  3HHG A;  3E5Q A;  3J81 K;  2UXN A;  1BIA A;  1JGS A;  3LFK A;  2HTJ A;  2WC2 A;  3G73 A;  1GXQ A;  5FO5 A;  4IJA A;  2Z33 A;  3E5U A;  2M45 A;  1B6A A;  3V7S A;  3R4K A;  4MGR A;  1SD7 A;  3ZMU A;  4AIH A;  4KT5 C;  3SXY A;  2VBW A;  1UB9 A;  4U0W A;  1CGP A;  5ILV A;  1W5T A;  2DAO A;  2F2E A;  4ZZL A;  5FFX A;  3R0J A;  3G3Z A;  4I09 A;  4M71 A;  3ERE D;  2ZKZ A;  2O03 A;  2OA4 A;  5JFR A;  2P6S A;  3IIQ A;  3Q9V A;  1J75 A;  2V79 A;  2F5F A;  4WXC A;  2VOD A;  1OYI A;  2PG4 A;  2LNB A;  4KMU X;  2GA2 A;  3RKX A;  1EH7 A;  3MWM A;  2K02 A;  4CXF A;  5HVQ C;  5D5V B;  3TOB A;  6PAX A;  3ZQ7 A;  1E17 A;  3BDN A;  2CYY A;  2UXX A;  2Z5U A;  4Y15 A;  5ERI A;  4EV0 A;  3WTT C;  1GXP A;  1R00 A;  5LGN A;  4EVI A;  1BC8 C;  2Q0O A;  3CLO A;  1Z1D A;  4EMS A;  1BIB A;  1P6R A;  3O6B B;  1S8N A;  3K2Z A;  2Z9O A;  2FF4 A;  4H0E A;  3IRR A;  4KFC A;  2FQ3 A;  5DEQ A;  1ZRE A;  4UVA A;  2QYO A;  3U2R A;  1D3Y A;  3TO9 A;  3MZH A;  3U1D A;  4Q4Z F;  1OYW A;  2TDX A;  2W24 A;  3RYP A;  3C7J A;  1SMT A;  4HQM A;  2FXA A;  1HBX G;  4YIF A;  1S6L A;  4HQE A;  1BM9 A;  3QPH A;  4O6J A;  1ZLK A;  2EFP A;  1IUY A;  1UST A;  1D8J A;  3BRO A;  4M6Y A;  1T39 A;  1KCA A;  4YFN F;  2XVC A;  2WWY A;  3M7G A;  4I2O A;  2E7X A;  3EUH A;  2OBP A;  5LLQ A;  4ENJ A;  5DCM B;  3F6O A;  3EQL F;  3VOD A;  3HSF A;  2VOP A;  4ENM A;  2BYV E;  5F64 A;  1MDM A;  1R1U A;  3GEZ A;  5AIP A;  2LF8 A;  1XN7 A;  4RGX A;  1LDJ A;  3E6M A;  2VC0 A;  5J6X A;  4MQ9 F;  4BQA A;  2XAF A;  4XSX F;  1LEB A;  2G7H A;  1BC7 C;  3DV8 A;  1AWC A;  4WXH A;  1JHF A;  1FC3 A;  2VE9 A;  2VN2 A;  3QP5 A;  1U8R A;  5HDG A;  4XLP F;  3FM3 A;  1IN7 A;  4HF1 A;  1T2K A;  4P5O A;  4G7H F;  1AY9 A;  1CF7 A;  3HHH A;  3F72 A;  4GYI A;  4O5V A;  4ASN A;  3BPV A;  5FLX Z;  3VB2 A;  3GX4 X;  2F5D A;  3HRU A;  3CUQ B;  3ULQ B;  2R7D A;  2A68 F;  3BWG A;  2ISY A;  5TJJ A;  1B4A A;  1P4A A;  1LJ9 A;  4GYG A;  1R7J A;  4DNC A;  2DO7 A;  1TQP A;  2DQL A;  2D2W A;  4L9J A;  3E3V A;  3Q5F A;  3O2P E;  3CTA A;  4HF0 A;  4NV4 A;  1HXD A;  3GF2 A;  3WGH A;  2NRA C;  1KU3 A;  1I6X A;  3KP4 A;  2XAQ A;  2CO5 A;  2G7U A;  2X4H A;  5D5U B;  1ZG3 A;  1FPQ A;  1XCB A;  4ESF A;  4AVP A;  2WV0 A;  4HDU A;  2EFQ A;  1W7P B;  1FYK A;  1U5T A;  1UFM A;  4L5J A;  3KLN A;  4UXN A;  3B02 A;  3BJO A;  2A07 F;  1BI0 A;  1TLH B;  2O3F A;  2V1U A;  5BPI A;  4OIQ F;  3F22 A;  1YS6 A;  3DEU A;  1BN5 A;  3MAJ A;  1B9N A;  2MC3 A;  1FNN A;  3EYI A;  2K27 A;  2JZY A;  5BOX A;  1S7A A;  4I0B A;  3ZMV A;  4Q48 A;  4NQW A;  3T5X A;  4HZF A;  1JE8 A;  2DPD A;  1R5H A;  1JHH A;  1H9T A;  4P55 A;  3I54 A;  4EJV A;  2EFN A;  5HLG A;  4LLN A;  3C3W A;  3HTS B;  2ACJ A;  1SD6 A;  4UNO A;  4S04 A;  1MKM A;  4EJU A;  2D45 A;  1ZAO A;  2FBH A;  1BJA A;  4HLX A;  3R6S A;  5AIQ A;  2K4J A;  3DXJ F;  4CIC A;  4CYD A;  2PN6 A;  2XRN A;  4N9I A;  1KQ8 A;  4PGG A;  3HRS A;  2ZME A;  3M8E A;  5EEH A;  2DT5 A;  2O6G E;  1RUN A;  5EEG A;  4ESB A;  1WKM A;  1IN6 A;  1WQ2 A;  3RI4 A;  4LFU A;  3VFZ A;  1UCR A;  4P9U A;  3F3X A;  4AD9 A;  1YIO A;  1IAW A;  3CDH A;  4MEY F;  4ENK A;  4OIR F;  2HDC A;  2E1N A;  4A0Z A;  4G7Z F;  5FLX K;  2VT2 A;  1HKT A;  4G7O F;  3J80 Z;  2L02 A;  1ON2 A;  5K5O A;  4G94 A;  3JSO A;  2QBY A;  2KKO A;  5K1Y A;  2FNA A;  3BY6 A;  4CO8 A;  1R5G A;  4G6D A;  5JHU A;  1FBS A;  4XRF A;  3F23 A;  4L9V A;  3BJ6 A;  4U7B A;  1YW7 A;  2PBI A;  2PI0 A;  1F1Z A;  1D8K A;  4A6E A;  2XV4 S;  1BBY A;  2KIU A;  2M5W A;  1L0O C;  3I59 A;  1S3J A;  3DPT A;  2MA3 A;  4LB6 B;  4HF2 A;  2XAH A;  2ZXJ A;  4I0A A;  1T7D A;  2DTR A;  2PQ8 A;  1K79 A;  1P2F A;  3MZY A;  4I01 A;  1LEA A;  3T8T A;  3KZZ A;  5H20 A;  3HOS A;  2EV0 A;  2F5C A;  2DI3 A;  2L54 A;  2HOE A;  1I27 A;  1PUE E;  1HKS A;  1BOA A;  2PFB A;  3LQR A;  4BAY A;  2FE3 A;  5HS8 A;  2Y0M A;  4LB5 A;  3HUG A;  4KN4 X;  3MEX A;  4HDV A;  4GXO A;  5BMZ A;  1ZGJ A;  4Q47 A;  2IA0 A;  2JSC A;  2HKX A;  3V4G A;  3SQN A;  3BPX A;  2J5P A;  2P5V A;  2GA1 A;  4EM2 A;  4UVB A;  5ILU A;  2RGV A;  1OYY A;  2Q8K A;  1Y0U A;  3QAH A;  3F21 A;  1FX7 A;  3HSE A;  3FX3 A;  4RGU A;  3I5U A;  4ETS A;  1XSD A;  2DU9 A;  3BZ6 A;  1ZRF A;  3F8C A;  3PQK A;  2HYF A;  5AON A;  1ZG5 A;  1HSJ A;  5LGU A;  2QQB A;  1Z6R A;  2Y75 A;  5TRD A;  4ZYE A;  1HW5 A;  2ESH A;  2RV8 A;  1IZ1 A;  1FP2 A;  1W4M A;  2M8E A;  3DKW A;  4R8H A;  3WE3 A;  1QZY A;  1FYM A;  2Y48 A;  2EJR A;  1OMI A;  3KET A;  4TV7 A;  2CFX A;  4Q5S F;  1BI3 A;  2L3D A;  5BQT A;  4IRI A;  2HS5 A;  3V8J A;  3GZ6 A;  2VT3 A;  3QOP A;  4EM0 B;  4WWC A;  3R61 A;  2DK5 A;  2HR3 A;  1GHC A;  1H9G A;  2EB7 A;  3GFI A;  3Q9S A;  2B0L A;  1XGO A;  1SFX A;  3WTW C;  5ICE A;  4BNC A;  2ZBK A;  2PEX A;  4M72 A;  1YO5 C;  3LA3 A;  2HWV A;  3TOA A;  4RAY A;  4JK1 X;  3IWZ A;  2CSO A;  2CWE A;  4D0P A;  3DFG A;  5DD8 A;  1J9I A;  3J80 K;  1ZGA A;  2P7C B;  2IPQ X;  1R22 A;  1XB4 A;  1LDK B;  5E18 F;  1G3T A;  5D5W B;  4HX8 A;  4AIJ A;  2CQK A;  3F8F A;  4Y17 A;  1LNW A;  4OIO F;  3WTV C;  5K5Q A;  2MD5 A;  3FWE A;  2O8X A;  3IHU A;  1MJA A;  3EDP A;  2FOK A;  3I4P A;  3I58 A;  4KIB A;  1ZLJ A;  1E2X A;  1U2W A;  1WRJ A;  3JSP A;  3H92 A;  1O3T A;  4R79 A;  2FMY A;  3GO5 A;  1NHA A;  3ROU A;  1J5Y A;  3ELK A;  4ESJ A;  2EV5 A;  2P5K A;  1KYW A;  2V9V A;  1PDN C;  3F8M A;  2FBI A;  2ZJ2 A;  3WTS C;  4M9S A;  5CVV A;  3JTH A;  1JHE A;  2JPB A;  2QUF A;  5DV5 A;  3JW4 A;  5ICC A;  2M1B A;  2YU3 A;  2FKD A;  2QEN A;  5DCF A;  2K7L A;  4KYW A;  1SD4 A;  3K69 A;  4KDP A;  3KP6 A;  4HLY A;  4A5M A;  2HTS A;  3HIF A;  2FU4 A;  2IA2 A;  4IRG A;  5DUK A;  1MGT A;  2Q2E A;  2OZ6 A;  5L3D A;  3V7C A;  4KN7 X;  1FT9 A;  3OOP A;  4IVN A;  3KZY A;  5KK1 A;  4K8W A;  5FD6 A;  4YFK F;  4L5I A;  3QU6 A;  3BJA A;  1ODD A;  1RUO A;  3RPQ A;  4G8X A;  3E6B A;  1FY7 A;  4U7D A;  1HST A;  5CLS A;  4Y13 A;  2IJL A;  2EFW A;  5E8I A;  1U6G A;  4RB2 C;  4HBL A;  3F6V A;  1QQI A;  2KJB A;  1SAX A;  5DYM A;  5BPD A;  3GXO A;  4U88 A;  4XSZ F;  4LG0 B;  4A5N A;  1O3S A;  1TBX A;  1JHC A;  2Z3Y A;  5D8K B;  1RNL A;  3I71 A;  3TDZ C;  2L4A A;  4LD5 A;  5L3F A;  2BV6 A;  4WX9 A;  2CG4 A;  2NYX A;  5CVU A;  4M74 A;  2YR2 A;  2W25 A;  1O3Q A;  2L01 A;  4HX7 A;  3SFZ A;  4HV6 A;  2XKP A;  5JVT A;  3WTX C;  4ME8 A;  3LAJ A;  1T38 A;  3K1M A;  1QGP A;  1U5T C;  3VOE A;  3J7A O;  3GUD A;  5DD4 A;  2H6B A;  4UV9 A;  1XMK A;  1QPM A;  4YII A;  4CDG A;  1ZH5 A;  2QVO A;  1XMA A;  1F39 A;  2VOO A;  2NNY A;  2XAS A;  1HQC A;  2QM3 A;  3DF8 A;  2VE8 A;  2A5Y B;  2RN7 A;  2V6C A;  1SFE A;  4LLL A;  4S05 A;  2EA2 A;  1A04 A;  2BEO A;  4M9Z A;  1S7O A;  2IA1 A;  2O0Y A;  1G6N A;  1W7P D;  4OOI A;  1L3L A;  1DP7 P;  3L09 A;  3MQ0 A;  2GQQ A;  1B1B A;  1IN4 A;  4LK0 F;  3HRT A;  4N31 A;  2ZNY A;  2QWW A;  1KYZ A;  3KLO A;  1IW7 F;  2ESN A;  3RDI A;  2A6H F;  3P7N A;  2H94 A;  2DPU A;  1O3R A;  1T0F A;  4DQ2 A;  1TW2 A;  2MH2 A;  2E1C A;  3E5X A;  5FB2 A;  1DPU A;  3HRM A;  3IKV A;  4NB5 A;  4ZH4 F;  2P4W A;  3CO6 C;  2VBY A;  1IN8 A;  3ZP5 A;  1B12 A;  3GWZ A;  5H6Q A;  4MTD A;  3WTU C;  4IPA A;  2XAG A;  2O61 A;  4P9F A;  2EV6 A;  5DCM A;  1XGS A;  5HS7 A;  2RNJ A;  4WK8 F;  2BBY A;  2R7F A;  3U9G A;  2MH9 A;  1S29 A;  1UHW A;  1K78 B;  3QRF F;  3RYR A;  4KA4 A;  2V1D A;  2VXZ A;  1Z9C A;  2QZ8 A;  4OU0 A;  1FOK A;  4LGW A;  4A2U A;  1TNS A;  1IN5 A;  4L9T A;  3H3U A;  3BP8 A;  2MBF A;  2VON A;  1MJ9 A;  3RIR A;  4RGS A;  3GZ5 A;  4O3M A;  2DLL A;  1FBU A;  2KJC A;  5DUI A;  2J5O A;  2XHK A;  2HO0 A;  4LLG F;  2HYG D;  4HX4 A;  3QP6 A;  1EV7 A;  1DDN A;  3CUQ A;  5IT9 K;  2W85 A;  3GYH X;  3AAF A;  3W6J B;  3I64 A;  2UWM A;  5CVJ A;  2PJP A;  1ZYR F;  3K1N A;  1XDU A;  3KP7 A;  2C6Y A;  4HV5 A;  1K7A A;  3E6C C;  2KRF A;  2LSO A;  3RKY A;  2HGC A;  3LA7 A;  1PP8 F;  3FMQ A;  1R1V A;  1R36 A;  5CVI A;  3O3K A;  1Z6T A;  1O7L A;  3C18 A;  5L3B A;  3IWF A;  5HLH A;  1B9M A;  1IRF A;  1FBQ A;  2JRT A;  2FRH A;  3ZMS A;  4RB1 A;  1G3Y A;  3ML6 A;  4NHJ A;  2K86 A;  4WXD A;  4MQV A;  1IXR C;  1VTN C;  2YPR A;  3TKY A;  4ZYD A;  1BI1 A;  2DBB A;  3L2C A;  3FZV A;  1W7P A;  3TGN A;  3CUO A;  1REP C;  3GLX A;  1H0M A;  2A69 F;  2JPC A;  2G9W A;  2XUB A;  3QPT A;  5J8C A;  1P92 A;  1O7F A;  3I0T A;  3KFW X;  2STW A;  1IXC A;  2DW4 A;  1MDM B;  2QQ9 A;  1IF1 A;  3FXU A;  1HW1 A;  3L00 A;  1C0W A;  2ZCW A;  1ULY A;  4M6X A;  2X0L A;  2XAJ A;  2L4M A;  3ECH A;  2EA4 A;  2RC4 A;  2MLK A;  4E70 A;  3WGI A;  1KQ0 A;  2ISZ A;  5CYV A;  2CW0 F;  3RKW A;  3S04 A;  2GXG A;  2H09 A;  3KEQ A;  3WGG A;  4I98 B;  1G3W A;  1CF7 B;  1BI2 A;  1MZB A;  2STT A;  2LF7 A;  5LEJ A;  4HAM A;  1YYV A;  3PFI A;  2XKO A;  1TQM A;  1YW9 A;  4UHT A;  1KN9 A;  2BE5 F;  4N0B A;  5K5R A;  4HA8 A;  4FT8 A;  5ED4 A;  3H3Z A;  4EJO A;  1ONV A;  1EH6 A;  2OD5 A;  1P4X A;  3FXR A;  5HDK A;  1J7K A;  3MFK A;  5KVR A;  4WF2 A;  1YS7 A;  2GWR A;  4GO1 A;  4L0Y B;  2VBZ A;  3VEP A;  1ZHF A;  4AWX B;  1O57 A;  2E7W A;  4Z2Y A;  3KCC A;  4KMF A;  4EGY A;  1ZN2 A;  2FA5 A;  4A0X A;  1K78 A;  1FP1 D;  2ELH A;  1EH8 A;  2QQA A;  1F9N A;  1RZ4 A;  3GVA A;  1WSU A;  5LEK A;  1YQA A;  2FML A;  4RAZ A;  4FX0 A;  5FFZ A;  4WCG A;  2ZFW A;  1PP7 U;  1YG2 A;  3KEO A;  1J2X A;  3HTU A;  3EET A;  2CGP A;  2K4B A;  2A6E F;  3RTR A;  4OMY A;  4LK1 F;  3LST A;  3T8R A;  3HSR A;  4N9H A;  5LGT A;  3F8B A;  1R23 A;  3TO6 A;  2PLY A;  3PQJ A;  1U5T B;  5HDN A;  1DUX C;  2OQG A;  4CHU A;  3K1P A;  1F4K A;  1QZZ A;  2NNN A;  1SFU A;  2IP2 A;  1JXS A;  2A3S A;  1LQ1 A;  3ZN1 A;  1TW3 A;  5F6F A;  3R0A A;  5HS9 A;  1HKQ A;  2OQR A;  4RB3 C;  5D4R A;  4L9N A;  2M87 A;  1XCV A;  3KE2 A;  3ZMT A;  2HQR A;  5D4S A;  1K6O A;  4M73 A;  3RPU A;  2LDU A;  4R1H A;  1AOY A;  3TDU C;  5D8L B;  4IRH A;  4QLC U;  3IRQ A;  3IL2 A;  4PCQ A;  4PZJ A;  1XGN A;  2P5L C;  1I1S A;  1RI7 A;  1KU9 A;  1SMY F;  4LJZ F;  5E1W A;  4JQF A;  2UZK A;  3HYI A;  4G6Q A;  3FHZ A;  4UVC A;  3CO7 C;  2AXL A;  1YFH A;  4RB0 A;  2WTE A;  2DFI A;  4I02 A;  5BS6 A;  3R60 A;  3SZP A;  1QO0 D;  3ZMZ A;  4UUV A;  4BXU A;  3V7R A;  3RJP A;  2ZME B;  4BHP A;  2DQR A;  2EWN A;  4EM1 A;  1YTY A;  4CGZ A;  1I5Z A;  3NQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...