3JSOA

Classic protein with a new twist: crystal structure of a lexa repressor dna complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
188
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLGLPLVGRVAAGEPLIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords LexA repressor
publication title Structure of the LexA-DNA complex and implications for SOS box measurement.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 45
structure length 188
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2009-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3jsoA01
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3jsoA02
4JK1X 3IL2A 2VE9A 1B9NA 2QBYB 1W7PB 2P7CB 2DI3A 3LA2A 2XGXA 1ZG5A 4F7ZA 4LGWA 2G9WA 3K1MA 3ZMZA 4I0AA 5BMZA 4UVBA 1ZARA 4HX7A 4M6XA 2P5VA 1BIAA 4OMZA 1P6RA 2QQ9A 3OV8A 3VB2A 1HKQA 4I7HA 2Z5UA 3F23A 3KZYA 3RKYA 4MQ9F 3EUHA 4AWXB 3DEUA 2W57A 1FC3A 4M73A 5AONA 4R8HA 5DD4A 3QP6A 3CO6C 1F9NA 1FP1D 1HW2A 3ML6A 2Q8KA 1TW3A 2RKHA 3BPXA 3LAPA 1XCBA 4HBLA 5LBQA 2IA1A 1KU7A 2IT0A 1W5SA 4HZFA 4U0YA 2OD5A 2D45A 2BYVE 4S04A 5D6FA 4NHJA 4A5NA 2GQQA 4KMFA 1IN5A 2MH9A 1PP7U 1F4KA 4O6JA 4L18B 4HAMA 2L02A 4HA8A 1JHEA 4G8XA 4BHCA 1KN9A 1KU2A 1GXPA 2XHKA 2HS5A 4P55A 2MBFA 2JTVA 3SXYA 4NV4A 1I1SA 2Q0OA 4U7DA 1T2KA 1R5GA 3T5XA 3CTAA 3JAMK 3ERED 3WGIA 2PMUA 3HRSA 1UFMA 1P4AA 3V4GA 5HS7A 1BC7C 2PN6A 5E8IA 1D8JA 1XSDA 2VE8A 4AVPA 3FWEA 3BPVA 1IAWA 4Q47A 2L54A 1WSUA 1SD6A 2XVCA 3NQOA 3GFLA 3O2PE 3FXQA 3LSTA 1P4WA 4L0ZB 3TDUC 1TBXA 2A69F 1ZRCA 2DLLA 1FSHA 2MH2A 3BROA 3M9AA 1Z05A 2WWYA 4RS8A 4OMYA 2DAOA 2RVCA 4BH9A 2NYXA 3Q9SA 1TQPA 1ZGAA 4IHSA 1XMKA 2EFWA 4GYIA 4MGRA 3DKWA 1L3LA 1OR7A 5HLGA 2D1VA 4N31A 2CWEA 2V79A 2WV0A 5HS9A 3EETA 4PGHA 3CUQC 2ACJA 4BAYA 2JPBA 4GGGA 4KYWA 4MEXF 3SQNA 2J5PA 2X4HA 4ETSA 3KZZA 5ILSA 4EM2A 3W6JB 3CO7C 3S04A 2K27A 4UNOA 5LGUA 4R79A 3LQQA 1ZHFA 1EH7A 1J0RA 4L9VA 1F39A 3KP3A 1FBUA 4UXNA 2OAZA 5DV5A 4YFKF 5LHGA 5LEJA 1JE8A 2RNJA 5K5QA 4G94A 1J59A 2ZXJA 4E70A 2E7XA 5CVVA 1RI7A 5E1ZB 4ZZDA 1HKTA 2V1DA 3DP7A 4ENNA 3I58A 3HSEA 1YQAA 2VT3A 1EH6A 2NNYA 1DDNA 2P4WA 2TDXA 3HOSA 4LLNA 5TRDA 3F8NA 1R23A 4A5MA 3BOQA 4P5OA 1YG2A 1ZLKA 2BGCA 2VC0A 3IWZA 4EQQA 2H94A 3ABUA 3G73A 4KA4A 2QVOA 3FM3A 3TGNA 3T8TA 5E17F 1BI0A 2EWNA 2IJLA 1ZN2A 1Z1DA 4I98B 1HSJA 1XDSA 4HLXA 3OOPA 1XN7A 4RB0A 1YW9A 4HDUA 3VFZA 3HTUA 5HVQC 2DPUA 4ENMA 4WCGA 2H6BA 2Y0MA 2EK5A 3EYIA 2PQ8A 2HGCA 1SD7A 4OOIA 3QPHA 5BS6A 2OZ6A 3E3VA 2FKDA 2DQRA 3RPUA 2KIUA 5CLSA 3TOBA 3ROUA 2LF8A 3V8JA 3WTUC 4ASNA 3SZPA 2EV5A 2PEXA 1LDJA 2F5DA 4Q48A 4IRGA 1DUXC 2PJPA 3FXUA 1O57A 3M1EA 5CVIA 4BNCA 1LVAA 1QGPA 4RAZA 2M30A 3R0AA 2VBYA 5KVRA 4WXHA 1LB2A 4KN7X 3HRMA 3L09A 2QLZA 5ICCA 4LLGF 3N4MA 2E1NA 1SFEA 2NNNA 2EA4A 1QNTA 4JBAA 2GZWA 1ON2A 4M74A 1A04A 1XCVA 1L0OC 4HW0A 5BQTA 1CGPA 3F3XA 3QPTA 1OPCA 2ISZA 1E17A 1V3FA 1J9IA 2STTA 2XRNA 5D8KB 2Q2EA 2DFIA 1IXSB 4ME8A 3L2CA 4XLPF 1XMAA 5E1WA 3F72A 2VODA 4HOBA 4QLCU 3C7JA 3HRUA 2O3FA 5ED4A 1TNSA 2L3DA 1T7DA 1BI2A 3ULQB 2VXZA 1REPC 1TQIA 5ICFA 1TQMA 4HX4A 1SFXA 4OIQF 2HFHA 1IUYA 3LWFA 3IKTA 1OYYA 4HV5A 1B12A 4G7ZF 2G7HA 5FB2A 4M9SA 2A6EF 1BBYA 1IZ1A 1ZG3A 4LMYA 2W25A 3FMSA 1ZYRF 3U1DA 3B73A 1TTYA 3ZMUA 3LA7A 1H0MA 1ZH5A 1IRFA 1UCRA 3HUGA 4KIGA 4A6DA 1G3TA 5L3DA 1LDKB 5E20A 4MTDA 4YG2F 4HF0A 3KEQA 2XV4S 3BJ6A 2IA0A 2YSRA 2QM3A 4A2UA 5H6QA 3TKYA 1T98A 5IT9Z 5HDGA 5LLQA 1ZLJA 4IRIA 5IT9K 1BIBA 3GF2A 5HS8A 4L5IA 3EDPA 5JFRA 2XKPA 4FHTA 6PAXA 2LDUA 3GO5A 3LQRA 4KNYA 2DW4A 4KUMA 3D5LA 4LLLA 1J5YA 4Y15A 3DF8A 4WXDA 4I2OA 3SHFA 2DQLA 1J7KA 4M9ZA 2OQGA 3HTSB 3WU1B 2PI0A 1MD0A 4ENJA 1KA8A 4N9IA 1OYWA 4IJAA 2GIVA 1U8RA 2LNBA 3SZTA 2O8XA 1MKMA 3F22A 2DK5A 5HDKA 4MQVA 2GWRA 3QU6A 4HF2A 5DCFA 4KN4X 3F8MA 2HKOA 4CDGA 1B1BA 2JRTA 2UZKA 1V4RA 1Z6RA 5D5XB 1SD4A 2MLKA 4XLNF 3J80Z 5L3FA 3IRRA 1U3EM 2DT5A 2JZYA 2PFBA 4K2EA 1FBSA 1W5TA 3J80K 2M5WA 1P2FA 4EJOA 5DUIA 2Z33A 4HV6A 4IHTA 5JI6A 1T6SA 3DPTA 1TNTA 3PQKA 2MC3A 1AOYA 4PCQA 1K7AA 1FOKA 1W4MA 2HDCA 3HHHA 2HNFA 4LG0B 1SD5A 1YYVA 5ILVA 1R1VA 1XGMA 3HIFA 2IA2A 3RDIA 1K6OA 4HQEA 5DCMA 3I59A 2YR2A 5E1XA 1QPMA 2F5CA 3BJOA 2EFOA 3E5QA 2CG4A 4A12A 1MJ9A 3HSFA 4HLYA 5LGTA 1HXDA 2Y75A 4CXFA 3RI4A 1CF7A 3Q9VA 2P8TA 5IT3A 4UVCA 4G7HF 1EV7A 1TW2A 3T8RA 2LSOA 1RUOA 4G7OF 4PGGA 4IPAA 1K78A 3JAMZ 1FYLA 3ZP5A 4UV9A 3I71A 2AXLA 1J2XA 2FNAA 4RB3C 3ZMSA 3R60A 4R1HA 5LRSA 3C1DA 2Z9OA 1R58A 2RDPA 2ZO4A 1FX7A 1RZ4A 3BDDA 3RKWA 2K4BA 3GYHX 1R5HA 4M9XA 4KMUX 2HQRA 3IKVA 1FLIA 5JR3A 3EQLF 1MZBA 1ONVA 4CZZA 1XD7A 2JPCA 2FE3A 1IN4A 3I0TA 3WTTC 3MQ0A 2FSWA 1B9MA 3BJAA 4OINF 4EVIA 1KU9A 1F5TA 3C3WA 2XUBA 4U7BA 2A5YB 3GX4X 2WTEA 3M7GA 1O3TA 3TO9A 2O03A 1UB9A 3WE3A 2M8EA 4BYYA 2C6YA 2ADUA 2IP2A 4AIKA 2XKOA 4XSXF 3TOAA 3GFJA 5L3BA 2V1XA 1XGSA 1HQCA 4RGSA 4M71A 4EV0A 3WG9A 3GWZA 3K1NA 1JHFA 2ISYA 3TQNA 1LJ9A 1XGNA 1HW1A 5BPDA 3I4PA 3WTWC 1XGOA 4U0VA 4DQ2A 3E97A 3P9KA 2BBYA 1B4AA 1S29A 3P9CA 2FU4A 4IF4A 3FZVA 3F21A 3FMRA 3IWFA 4KT5C 2E7WA 5ICEA 3NEUA 2LF7A 3CUOA 3DV8A 3P7NA 4KFCA 5E8GA 3K69A 4AIHA 4ON0A 3JSOA 5LGNA 2UXXA 3JSPA 1FNNA 2GA2A 1WRJA 2A61A 3I59B 3QAHA 4RAYA 3ZN0A 2BV6A 2IPQX 2OU2A 1MDMA 3MAJA 4YFXF 1CF7B 5CVRA 1T0FA 1LEBA 2R7DA 2OQRA 3DXJF 1C0WA 1RIOH 3DPLC 1BI1A 1IN6A 3C18A 4I0BA 3I64A 2GAUA 2FA5A 1JHCA 4XSZF 3RPQA 1Y0UA 1K78B 3KP7A 3KCCA 3DFGA 4HX8A 4A0ZA 3R61A 5K1YA 1YTYA 4ZYHA 4YIFA 2VOOA 4ZYGA 1U5TA 3ZN1A 2V9VA 4O5VA 1HBXG 5CYVA 1G3YA 1IW7F 1B59A 5ICGA 2VT2A 2XAHA 1B6AA 3F8BA 1AWCA 4P9FA 3R4KA 4RGRA 1LQ1A 2UXNA 1FSEA 3CDHA 4UHTA 2FBHA 2AS5F 1S3JA 1XDUA 2M45A 1KCAA 1KU3A 2EFPA 3CLOA 2JT1A 5H6RA 1YLFA 1PP8F 3WTYC 1IXCA 4L9NA 2R7FA 3L9FA 3COAC 2CW0F 3FM5A 2QQAA 5F6FA 3G3ZA 3PQJA 1U78A 2HO0A 2KIFA 4Q5SF 3R6SA 4KIFA 4RGUA 1JHHA 3CJNA 3KEOA 3RTRA 1I1GA 2VBZA 2K02A 1ZREA 1ZRDA 1O7FA 3KP6A 3FX3A 1JXSA 2DK8A 1G6NA 2GXGA 2NAZA 3TO7A 1LDDA 1FT9A 5FFXA 3T1BA 1ZG1A 2RQPA 1G3WA 2QENA 5K5OA 2QBYA 4L0YB 2FRHA 3VODA 1WKMA 3QP5A 2IRFG 4ENKA 1FPQA 1E2XA 1GVJA 1Q1HA 5J8FA 4Y13A 4N0BA 5FGMA 3V8KA 1FZPB 2HR3A 2YX4A 4EM1A 4RB2C 2G7UA 4ESJA 4EJTA 2CSOA 2XAQA 4A0YA 4CICA 1AY9A 2EFNA 4BHBA 3GFMA 2QZ8A 1P92A 2RGVA 4MHGA 1MJAA 4EJVA 3HSRA 3KLOA 2MA3A 1H9TA 4WX9A 2A6HF 2XASA 2E1CA 1XSXA 1D3YA 4OIOF 5D8LB 1KYWA 1O3SA 3M8FA 3I5UA 1OKRA 4UVAA 3HHGA 3O3KA 2YX7A 5HLIA 3BWGA 2P7VB 2VC1A 4NB5A 5L3GA 2OA4A 2QWWA 1G3SA 4P9UA 2QUFA 3D0SA 4Z2YA 3JTHA 3T0YA 3ELKA 2PBIA 3WTSC 3O6BB 3QU3A 2XAFA 1IN7A 3P9IA 5D5VB 1I6XA 3L7WA 1I4VA 1SFUA 5D4SA 2RC4A 2ZJ2A 2FOKA 1S7OA 4LFUA 2HKXA 3KLNA 5HDNA 2GA1A 2W85A 1QBJA 3KETA 3WGGA 2IW5A 3GZ5A 2VBWA 3BY6A 2HYGD 5A2QZ 4OIPF 3WGHA 5HOOA 2X0LA 2Z99A 5A2QK 3Q5FA 2VN2A 1ZRFA 1IRGA 1PDNC 3KE2A 1QZZA 1SMYF 4A0XA 5DD8A 2M87A 1USTA 1F1ZA 2BEOA 2CQKA 4UUVA 4OIRF 1UHWA 2D2WA 3AAFA 3H3ZA 5DUKA 2A07F 4ZH4F 2V1UA 5BOXA 2FF4A 5D5UB 1O3QA 1S8NA 4G9YA 1WI9A 2ZBKA 2YU3A 3MCZA 2KIMA 2STWA 4HYEA 2F2EA 1Z9CA 2BE5F 3QRFF 3RKXA 3ZPLA 5F64A 4GXOA 3MWMA 3V7SA 1DPUA 2D1HA 1QQIA 5CVUA 2VOPA 2O6GE 3KFWX 4AD9A 1X3UA 1ON1A 4WK8F 3MZYA 5J8CA 3S2WA 5D4RA 3U9GA 3BDNA 5K5RA 3M8EA 3RIRA 4M6YA 2P5KA 2HZTA 4EJWA 3REOA 2VONA 3H92A 4FX0A 2OZUA 2K4JA 4RB1A 4EGYA 4K8WA 4I01A 2FQ3A 1OYIA 2FXAA 1BI3A 5BPIA 2DO7A 2EFQA 2ZMEA 3MEXA 5LHHA 1KYZA 2DBBA 2HQNA 5LRRA 1FWZA 3R0JA 3WTXC 2FMYA 3PFIA 2Z3YA 4LB6B 3E6MA 5D6EA 1MJBA 2ESHA 1IF1A 3F8FA 4ZYDA 4YIIA 2DTRA 2HWVA 2COMA 3IRQA 5HLHA 4XRFA 4KICA 5LHIA 3K1PA 1U5TC 4EMSA 2KJCA 4EJUA 2XAJA 4LJZF 1HKSA 5H20A 2FNPA 1K79A 1R36A 4U0WA 1ULYA 2H6CA 2CGPA 1FP2A 3ZMVA 1H9GA 4YFNF 4Q4ZF 1FBQA 4PZJA 4A6EA 1R00A 4IVNA 1I5ZA 1BOAA 4CGZA 4P96A 4JQFA 2NS0A 2PLYA 1HW5A 1RNLA 1FYKA 4MTEA 4B09A 4WF2A 3WODF 1FY7A 4WWCA 1BN5A 4G6QA 1P4XA 3RYPA 2IVMA 3F6VA 2CFXA 3E5UA 2QYOA 4EM0B 1S6LA 4M72A 3IHUA 1D8KA 2KJBA 1YIOA 5EEGA 5TJJA 1DPRA 5FFZA 3J7AO 1I27A 1LNWA 4I09A 4WXCA 3IIQA 2PMHA 2ZNZA 4MEYF 2V6CA 4ZYEA 2ZNYA 4N9HA 5JHUA 1MGTA 2O61A 2ETHA 2P6SA 1J75A 1U2WA 1SAXA 2Y48A 4BQAA 1D5VA 5LEKA 3HOTA 3V8LA 2ZCWA 3ABTA 4FX4A 3KP4A 4GYGA 3BP8A 1Z7UA 3LFKA 5DCMB 3QOPA 3GW2A 2RN7A 3RJPA 4ESBA 1ZAOA 3WU0A 5E18F 4O3MA 1KGSA 2ZMEB 5FD6A 4ESFA 1ZGJA 1WQ2A 2GXBA 3E6BA 4U88A 4ZZLA 1HSTA 3K0LA 3DQVC 2HYFA 2KKOA 3N97A 3EYYA 5DEQA 1TLHB 2W24A 1OMIA 5AIPA 3NRVA 2FBIA 2F5FA 4RGXA 1KQ0A 2MD5A 2XAGA 3J81Z 5J6XA 2R3SA 4PDKA 3V7CA 1XB4A 3J81K 2CO5A 2CYYA 5L3CA 3B02A 2DPDA 2H09A 2EJRA 2RV8A 3WE2A 4UV8A 1G4DA 2UWMA 3MFKA 3MZHA 3TDZC 1VTNC 2JSCA 3TO6A 1R22A 4XBFA 3I54A 4CYDA 1LEAA 1KQ8A 2L01A 2O0YA 1U6GA 1QZYA 2EB7A 2DU9A 1W7PD 2ZFWA 3K9TA 1WWXA 2ZKZA 1O7LA 1O3RA 2NRAC 5ILUA 3LA3A 3F6OA 4GCVA 2J5OA 3GXOA 3RYRA 5D5WB 2ESNA 4CO8A 1YS7A 3LAJA 3FXRA 4D0PA 1USSA 1EH8A 2HTSA 4FT8A 2YPRA 3CUQA 5ERIA 1RUNA 3ECHA 3GFIA 1IN8A 1BJAA 1W7PA 3KP5A 4KIBA 4B8XA 3ISPA 4HQMA 3GUDA 2M1BA 3KP2A 5FLXZ 4LD5A 4NQWA 1ODDA 4MNUA 1UHMA 2EV6A 2XIGA 5FLXK 5FD5A 4I02A 4H0EA 1YW7A 2WC2A 1XSVA 2VBXA 5EEHA 4S05A 1UMUA 5DYMA 1JGSA 3WTZA 2P6TA 4OU0A 1GHCA 2K86A 4L5JA 5F1RA 1MDMB 1BM9A 5CVJA 3HRTA 2L4AA 4LK1F 1R1UA 2W84A 2HOEA 3I53A 4TV7A 1T38A 1T39A 2XROA 5AIQA 1YFHA 2A68F 3L00A 4GO1A 2FBKA 2L4MA 3F8CA 4L9TA 1IXRC 1R7JA 4HF1A 3E6DA 1YO5C 4LG0A 4LB5A 4KDPA 2EV0A 2FMLA 3GEZA 3V7RA 1U5TB 3GVAA 4BHPA 4IRHA 3K2ZA 4L9JA 5DDGA 1GXQA 3HYIA 3H3UA 5FO5A 3ZMTA 1YW8A 3WTVC 1R1TA 4Y17A 2EA2A 2QQBA 2B0LA 3FMQA 4EGZA 1STZA 2H27A 2F5EA 3JW4A 3GZ6A 3JTGA 1Z91A 3E5XA 4AIJA 3ZMDA 1FYMA 3SFZA 2P5LC 1QO0D 1S7AA 3W6KB 1DP7P 2K7LA 4IXAA 2FJRA 2PG4A 2HEOA 5KK1A 1SMTA 2KRFA 1KQ9A 3U2RA 1BC8C 3GLXA 4QWQA 3FHZA 3E6CC 2MLGA 2HTJA 5JVTA 2OBPA 4LK0F 2A3SA 3VOEA 4DNCA 3IC7A 4HDVA 2ELHA 1YS6A 4BXUA 3BZ6A 3ECOA 4CHUA 1Z6TA 5L3EA 1PUEE 4G6DA 3CUQB 3FF5A 5CJ9A 2LKPA 2FEZA 3VEPA 1NHAA 3ZQ7A
chains in the Genus database with same CATH superfamily
4JK1X 3L2WA 3IL2A 2VE9A 1B9NA 2QBYB 3MKYB 1SVLA 3RCOA 3W2VA 3WHCA 2WAQA 1W7PB 2IGNA 3LOCA 3OYBA 3TBIA 2P7CB 2DJNA 3A1YA 2DI3A 3LA2A 2XGXA 3HJEA 4IOCF 1ZG5A 4HG2A 4F7ZA 4LGWA 2G9WA 3K1MA 3ZMZA 4I0AA 3DBRB 1GUUA 4QTRA 5BMZA 4UVBA 4HNTA 4IZZA 2R7RA 1ZARA 2OCEA 2VKEA 1A6QA 3A01A 2ICWG 4HX7A 5FKNA 4KISA 4M6XA 2P5VA 1BIAA 4QSHA 3RKQA 4OMZA 4MO7A 1P6RA 2KDZA 3GLLA 2QQ9A 3OV8A 5IP7J 2KFDA 3VB2A 1HKQA 3CDIA 4I7HA 2HOSA 1W36D 2Z5UA 3F23A 3NWTA 4H4KC 2DDAA 3KZYA 3RKYA 1F36A 4MQ9F 3ERMA 3X2QH 3EUHA 4AWXB 3DEUA 1E0EA 2W57A 1FC3A 4M73A 5AONA 4R8HA 5DD4A 3BG3A 3N05A 2LTPA 3GTOJ 3QP6A 3CO6C 1F9NA 5B1AH 1Y8QB 3VYUB 1FP1D 1HW2A 2WAFA 3ML6A 2Q8KA 4XLHA 2BY2A 1TW3A 2PMZA 2RKHA 3BPXA 3LAPA 3JRIA 1XCBA 4HBLA 5LBQA 2IA1A 1KU7A 4Y3OA 2QF7A 2IT0A 1W5SA 2XAUA 3GCMA 1N77A 1ORKA 4HZFA 4RA2A 2IAIA 4U0YA 3BZCA 2OD5A 2D45A 2BYVE 4S04A 4IHWA 5D6FA 4NHJA 4A5NA 2GQQA 2YU9J 4KMFA 1V5GA 2V26A 1IN5A 2MH9A 1N75A 3UNGC 1D1CA 1YRNA 1PP7U 5IOYA 5HODA 3HOWJ 1F4KA 1Q1VA 2K3PA 4O6JA 4L18B 2LK2A 4HAMA 2CV2A 2BXYA 4BJTA 2L02A 2P81A 4HA8A 4FASD 2X6WA 3TMOA 1JHEA 4G8XA 1NTCA 2XF7A 3CC4I 1MSFC 2QCOA 3ASNH 4BHCA 4J00A 1KN9A 1LFUP 3A2KA 2LY1A 2ME0A 1KU2A 1MH3A 1JKQC 1GXPA 2XHKA 3MZ8A 2HS5A 4P55A 4BQQA 2MBFA 1HCRA 2CRGA 4NC7A 4IHXA 2GXAA 1JKPC 2JTVA 3SXYA 4NV4A 3A0BC 1VQMI 1BW5A 1I1SA 2Q0OA 2XGDA 4PSWA 4U7DA 3IAM2 1T2KA 1R5GA 3T5XA 2IGMA 2DMTA 3IH4A 3CTAA 1AU7A 3JAMK 3ERED 1PUFB 3HKZN 3WGIA 2KMUA 2PMUA 2R7UA 3HRSA 1UFMA 1P4AA 2X6XA 5F08A 4IQ4A 3LNQA 3V4GA 5C44J 2XPWA 5HS7A 1SANA 1BC7C 2PN6A 5E8IA 4XLAA 1T56A 2PMZN 3TEDA 3AL0C 4M3BA 4UUSA 4CZCA 1X3ZB 3S3NA 1D8JA 4NC8A 1XSDA 3PIPF 2VE8A 2WV1A 4AVPA 3FWEA 2HDDA 3CCJI 3BPVA 1ETOA 2QA4I 1IAWA 4Q47A 2HDWA 3DTIA 3S8PA 2L54A 3RQ4A 1WJCA 2CUEA 2L0KA 1WSUA 1SD6A 2R5ZB 2CJJA 4BQNA 2XVCA 3CJTB 2E34A 2IBDA 3NQOA 2K9SA 1UAAA 3GFLA 2M7AA 2OUMA 3S15J 3O2PE 2GIZA 3FXQA 2XC7A 3LSTA 1P4WA 1K61A 4L0ZB 3TDUC 1TBXA 2A69F 4XRSG 1Z77A 2AHQA 1ZRCA 2VL8A 2DLLA 1RKWA 2WBMA 1FSHA 2MH2A 2TCTA 3BROA 5KCMA 3AG2H 3L2QA 3M9AA 1Z05A 2WWYA 4RS8A 4OMYA 3JR9A 4FISA 2DAOA 1WZ2A 2RVCA 3ZQHA 4BH9A 2NYXA 3Q9SA 1TWFJ 1TQPA 1ZGAA 3BG5A 4IHSA 1I6HJ 3I3LA 1XMKA 2EFWA 4GYIA 4MGRA 3FXKA 3M3YJ 1UG0A 2R7TA 4OAZA 3DKWA 4ZC3A 4E7ZA 1L3LA 3FISA 1OR7A 3JCUC 3G4SI 5HLGA 2X51A 2DT7B 2I5UA 2D1VA 4N31A 2A5WA 2CWEA 2V79A 4XMYA 2WV0A 1VQ5I 5HS9A 3EETA 2K9QA 4PGHA 3CUQC 2IS6A 3G2BA 1W5CC 2ACJA 4BAYA 2E60A 2JPBA 3CP2A 4GGGA 1HLVA 4KYWA 5C4XJ 4MEXF 5FROA 2E5ZA 3PJRA 3SQNA 2J5PA 4XN3A 2X4HA 4ETSA 5H2FC 4XKWA 3KZZA 3E7LA 5ILSA 4B3AA 4QPOA 2R93J 4EM2A 1ZELA 3W6JB 3CO7C 2FX0A 1XPXA 1BL0A 3S04A 2K27A 4NNJA 4UNOA 5LGUA 4R79A 4A3FJ 1VQLI 1N78A 5KAIC 3LQQA 2CV1A 1ZHFA 5J1UA 2JSPA 1EH7A 1TWHJ 4M3FA 3QPSA 1J0RA 2BXZA 4L9VA 1F39A 1V5FA 3KP3A 1FBUA 3H36A 4A93J 2WA0A 2JQ7A 4UXNA 2JRMA 3DKYA 2OAZA 1LKXA 5DV5A 4YFKF 5LHGA 4A3GJ 5LEJA 5GPCA 1JE8A 1VQ4I 2RNJA 5K5QA 2KZVA 4G94A 1ERDA 1J59A 2ZXJA 1VQPI 2GBYA 3OYFA 3OYAA 2ZSHB 4E70A 5FRMA 2E7XA 1VI0A 1R5ID 5CVVA 4HEA2 1RI7A 5E1ZB 1NG7A 4ZZDA 3VSKA 5GPAA 1HKTA 1S72I 5EZGA 4Y7NJ 1YRNB 2V1DA 3DP7A 2ZFUA 3I58A 4ENNA 2E2IJ 4FE7A 3HSEA 1YQAA 2BHZA 2VT3A 1EH6A 1HA8A 4UUTA 1WI3A 2NNYA 1DDNA 3ABKH 1U0JA 3ZCOA 2DA7A 2P4WA 5JVGF 2V6EA 1UG2A 2TDXA 3HOSA 4LLNA 2LMDA 4BEHA 3KEYA 4J01A 1H8AC 5TRDA 3F8NA 1R23A 5IOZA 2X48A 2OF7A 4A5MA 4M6VA 3BOQA 4P5OA 2FUG2 3H5AA 1A35A 1YG2A 2DFHA 3K6GA 1ZLKA 3OYIA 2BGCA 2VC0A 2WADA 3K7AJ 3VYTB 3OYJA 3IWZA 4EQQA 4OAYA 2H94A 5J3LA 3RPUD 3ABUA 3G73A 1RESA 3CCYA 4KA4A 2QVOA 3FM3A 2VJJA 3TGNA 3T8TA 3M8JA 4E6KG 1YJ9I 4QIWN 5E17F 1BI0A 2Z2SB 2EWNA 2IJLA 1ZN2A 1Z1DA 2UUZA 2ZXIA 1HSJA 1X58A 4I98B 3GMEA 5K7HA 1XDSA 4HLXA 3OOPA 3S14J 1XN7A 4UUSB 4OWRB 3MD2A 1LFBA 4RB0A 1YW9A 4DBRA 1FTZA 4HDUA 1Y56A 3VFZA 1JT6A 3HTUA 4CA0A 3BCBA 5HVQC 1SC7A 4ENMA 2DPUA 3OYCA 4X6AJ 2N8GA 4WCGA 3OYLA 2ZC2A 2H6BA 2ZJQF 2Y0MA 2EK5A 4CCJA 5IYDJ 3OR2C 3EYIA 1DQUA 2PQ8A 2HGCA 1SD7A 3BR2A 4OOIA 1Z0XA 2QSFX 3QPHA 2R92J 1G2HA 5BS6A 2OZ6A 1SAUA 3E3VA 2FKDA 1HDPA 2DQRA 3RPUA 2KIUA 3RZDJ 5CLSA 1ETXA 2EZHA 1OLTA 2VASA 3TOBA 2DJIA 3ROUA 1MIJA 3DU5A 2LF8A 3V8JA 4B47A 3WTUC 1MNEA 4ASNA 2PJRB 2R7VA 1E3PA 1KONA 4N4NB 4G12A 1D1BA 4MFEA 3SZPA 2W00A 2EV5A 1JTYA 2PEXA 2W48A 1LDJA 1A5JA 2X6OA 4PJNA 3QYBA 2F5DA 4E7JA 4Q48A 3H1CA 5B3SH 4DBQA 4IRGA 1DUXC 2O9LA 4ZDOA 2PJPA 3FXUA 1O57A 2LBFA 3M1EA 5CVIA 2R7XA 4BNCA 1LVAA 1QGPA 2IXSA 2L7KA 4RAZA 3K70C 4BJ5C 1UZCA 2M30A 3R0AA 4XORA 2VBYA 4XIDA 5KVRA 3HGGA 3CJRB 3IUOA 3OSFA 2JWTA 4PK4A 2OTLI 4WXHA 4HNVA 1LB2A 3FXMA 4CCNA 4KN7X 4A3MJ 2XB0X 1R49A 3HRMA 4BKXA 3L09A 2QLZA 5ICCA 4LLGF 1MBKA 3N4MA 5EJCA 1ZR4A 3DLLF 2E1NA 1SFEA 3H5NA 4ZYAA 1SVMA 3JRAA 2NNNA 2EA4A 2ZJRF 1QNTA 3OYKA 3OYHA 4JBAA 1BJZA 2GZWA 1ON2A 4M74A 1AA7A 1A04A 3CMMA 3K2AA 2OPTA 3AG1H 1XCVA 1L0OC 4HW0A 5BQTA 1LPQA 1CGPA 3ZR8X 3F3XA 3QPTA 3IAS2 1OPCA 4RAFA 2ISZA 1E17A 1K4SA 5CKTA 1V3FA 1J9IA 1JUSA 2STTA 2XRNA 5D8KB 4DZJA 2Q2EA 1QHHD 1IXSB 2DFIA 3FIWA 3LSKA 3L2CA 4ME8A 4PJMA 3ZRGA 4E4HA 4XLPF 4B48A 2LH9A 3LSGA 1XMAA 2HVSA 5E1WA 1ZQ3P 1LFPA 2L7MP 5HNFA 3F72A 1IV6A 2VODA 2QKMB 4CCMA 4HOBA 2ZXHA 4AYBN 2H1LA 4QLCU 3L1PA 4FCYA 3KX2A 2EILH 4ZTJA 4PFPA 3C7JA 1VQ6I 3HRUA 1WH7A 2W4SA 1QZEA 2O3FA 5ED4A 1TNSA 2L3DA 4V2GA 5IYBJ 1T7DA 4BEHB 1BI2A 3ULQB 2VXZA 3D5RC 1REPC 3JRBA 2HZDA 2CFOA 1TQIA 1SFOJ 4IHYA 5ICFA 1TQMA 4F52A 4HX4A 4FTHA 4A3DJ 2CU7A 1SFXA 4Y4RA 4OIQF 2DOAA 2DOEA 3I55I 3FBNB 2HFHA 4C30A 1IUYA 3LWFA 3IKTA 1OYYA 4HV5A 2DTZA 2DN0A 1ETWA 1BA5A 1B12A 4G7ZF 3EUAA 2G7HA 2Y30A 5FB2A 4M9SA 3CCRI 2A6EF 1IGNA 1BBYA 2VJ4A 1IZ1A 1ZG3A 3A02A 4CCKA 4LMYA 2W25A 3FMSA 1ZYRF 3U1DA 4A3BJ 1VQ7I 4XKVA 3B73A 1TTYA 3ZMUA 2VPLA 4YELA 3LA7A 1MMSA 1IDYA 1H0MA 3CMYA 3K4CA 1P9QC 1ZH5A 1IRFA 5FLMJ 4NDLA 4U87A 1UCRA 3HUGA 5J40A 2DXIA 4KIGA 4A6DA 1G3TA 5FJ8J 2FD5A 5L3DA 1LDKB 1JGGA 5E20A 4RMNA 4MTDA 4YG2F 4HF0A 1JKOC 1MMGA 3KEQA 2XV4S 3BJ6A 2BY0A 3U1KA 3W3CA 2IA0A 3MMYB 2YSRA 5F27A 4B4CA 1JUPA 2QM3A 3JREA 4A2UA 5H6QA 3CZ6A 3TKYA 3BC8A 1T98A 3BG9A 4II2A 4B3XA 5IT9Z 5HDGA 1S5LC 5LLQA 4IL6C 1ZLJA 4IRIA 3HOVJ 2CQQA 5IT9K 1YJNI 5FLVA 5IY5H 1BIBA 3GF2A 4XN0A 5HS8A 4L5IA 3BTJA 3EDPA 5JFRA 9ANTA 2XKPA 4FHTA 3CCLI 6PAXA 2LDUA 3GO5A 3LQRA 4KNYA 2DW4A 3ASOH 4KUMA 3TL4X 3D5LA 4LLLA 2K9MA 1J5YA 2R7SA 4Y52J 3V42A 4CSWA 2DMQA 1Z3XA 4Y15A 3DF8A 4WXDA 4I2OA 3SHFA 2DQLA 4D7NA 1J7KA 4M9ZA 2CUFA 3SJMA 2OQGA 3HTSB 3WU1B 4AC0A 2PI0A 1MD0A 4ENJA 1KA8A 4N9IA 3FK7A 1OYWA 4IJAA 5EYRA 3QOEA 2GIVA 1MBEA 1U8RA 2LNBA 3SZTA 5IPAA 3TW7A 4DYRA 2O8XA 1MKMA 4NQWB 1HC8A 3F22A 2DK5A 5HDKA 4RLQA 2HXIA 4MQVA 4D5CA 2GWRA 3G1OA 5LD2C 3QU6A 3I4MJ 1UHSA 1X2MA 2FQ4A 4HF2A 1VQOI 5J47A 3OS0A 2JA5J 3CC7I 3K10A 5DCFA 3FXJA 4KN4X 3F8MA 2HKOA 4CDGA 1B1BA 2JRTA 2UZKA 1V4RA 3OS2A 2HOAA 5JLWA 4BXXJ 2Q2EB 3S1QJ 1Z6RA 5D5XB 1SD4A 2MLKA 4XLNF 1IJWC 3J80Z 3HOYJ 5L3FA 3IRRA 1U3EM 2DT5A 5GAGJ 2E2HJ 2JZYA 2PFBA 4BS9A 4K2EA 1FBSA 1W5TA 3J80K 2KL4A 4CYCA 2M5WA 5E3MA 1P2FA 4I6ZA 4EJOA 1OCTC 4DYQA 5DUIA 3WU2C 5EZHA 1P7JA 2ME6A 2Z33A 4HV6A 4IHTA 5JI6A 3I4NJ 5F0FA 1T6SA 3DPTA 3BQYA 1FOXA 1TNTA 3PQKA 2MC3A 3ABMH 3PUBA 3BR0A 5DTDA 3PO3J 1AOYA 1PYVA 2IS2A 1RR7A 4PCQA 2EINH 4A69C 5M5YJ 4LG3A 1K7AA 1WJBA 2DOFA 2DT6A 4DYCA 3VSLA 4E7HA 1FOKA 2YUSA 1QVTA 3GTPJ 3M1CA 1W4MA 3G1LA 2HDCA 3HHHA 1OCCH 4UY8I 1FTTA 2HNFA 4LG0B 3HOZJ 1SD5A 3G1MA 2WAQN 1YYVA 5ILVA 3PIOF 1R1VA 1XGMA 4E7KA 3HIFA 2IA2A 3RDIA 1K6OA 1VQ9I 4AVZA 4F92B 5J4VA 1OJLA 2X85A 2VUMJ 4HQEA 5DCMA 3D5SC 3I59A 1MSEC 2YR2A 4RM2A 1W1WE 5E1XA 1QPMA 2F5CA 3BJOA 2EFOA 3E5QA 2KP6A 4A3EJ 2CG4A 4A12A 1JI8A 3W6VA 1MJ9A 3HSFA 4HLYA 5LGTA 4IEJA 1HXDA 2Y75A 4P1WA 4CXFA 3RI4A 1CF7A 3J7YJ 2R7ZJ 3Q9VA 2P8TA 2CW7A 1S9HA 2CUZA 5IT3A 4JYKA 4UVCA 4DJAA 4D9JA 3HB9A 4G7HF 3J7AY 1EV7A 1TW2A 3OYNA 2WY7Q 2M4GA 2P0WA 3Q0VA 3T8RA 1FIPA 1OCRH 1XC5A 2LSOA 1RUOA 4G7OF 1DP3A 3SDGA 1MMNA 3KYDB 2AXTC 4PGGA 3SZGA 2EIKH 4IPAA 1K78A 3JAMZ 3FKIJ 3Q0UA 1Z67A 1FYLA 2EIMH 2X6YA 3ZP5A 4UV9A 3I71A 1TWAJ 3UR3C 2H8WA 4GDFA 2AXLA 1J2XA 2FNAA 2R4GA 3ZMSA 4RB3C 3R60A 4XONA 3B6CA 4R1HA 5LRSA 2XRLA 3GTJJ 1D0YA 3C1DA 2Z9OA 1R58A 2RDPA 3CF2A 2ZO4A 1FX7A 1RZ4A 3BDDA 2XB5A 4C3IJ 3RKWA 2K4BA 3GYHX 1D1AA 4Z6YA 1R5HA 2LFBA 4KMUX 4M9XA 3GTLJ 2QKLB 2EZIA 2HQRA 3IKVA 2H8RA 1FLIA 5JR3A 3EQLF 2L7FP 1MZBA 1ONVA 4EATA 3HOUJ 3BQZA 1TL8A 4CZZA 2D5VA 1VQNI 1XD7A 2JPCA 2FE3A 5EG0B 1IN4A 1BW6A 2K85A 4XR6A 3HC7A 2M8GX 3I0TA 3MQ0A 3TW6A 2FSWA 3WTTC 2HPIA 1B9MA 3BJAA 3HZJA 4OINF 4EVIA 1KU9A 2FJ1A 1F5TA 2XPUA 3C3WA 3H0GJ 2VXDA 2QEXI 2XUBA 4U7BA 2A5YB 3GX4X 2E35A 2WTEA 5F04A 3M7GA 3DKXA 1XG1A 1QA6A 1W0UA 4ZDPA 1O3TA 5FKMA 3TO9A 2O03A 2XSDC 2CH0A 1YHQI 4BJ6C 2HU9A 3MVPA 1UB9A 2V9KA 2CQNA 3WE3A 2IEKA 1SEUA 5FKLA 1LE8A 2M8EA 3BTCA 4BYYA 2C6YA 2NVQJ 3S1NJ 2ADUA 2IP2A 2DA4A 4AIKA 3HXLA 2XKOA 3EPZA 4XSXF 3TOAA 3A01B 4II3A 3GFJA 1OQYA 3CCSI 5L3BA 1P7IA 1FOWA 2V1XA 1XGSA 2WB1A 1HQCA 4RGSA 1NK2P 4M71A 1X2NA 4EV0A 3WG9A 3BCAA 3GWZA 3K1NA 1JHFA 2KPMA 3DWLE 1DU6A 2DFEA 2ISYA 3TQNA 1LJ9A 2Z16A 1XGNA 2KIQA 1HW1A 5BPDA 3I4PA 1HDDC 2LY9A 3WTWC 1XGOA 3FK6A 3OS1A 3W2WA 2FOWA 4U0VA 4AU7A 4DQ2A 2JA8J 2LC2A 4LIUA 5GAEJ 3E97A 3P9KA 4I76A 4C2MJ 1RETA 2BBYA 1B4AA 1UELB 2BVMA 1S29A 3P9CA 2G0EA 3VPRA 5DM7F 5EDNA 2FU4A 4IF4A 3FZVA 1A36A 3O8GA 3F21A 3FMRA 3BT9A 3IWFA 1DU0A 4KT5C 1WJDA 2E7WA 3CP8A 5ICEA 3NEUA 1A6IA 2LF7A 3CUOA 3DV8A 3P7NA 5E8GA 2Y2ZA 4KFCA 4BXFA 1WJAA 3BR5A 4LIVA 3DTEA 5HNHA 3K69A 4HSRA 1SFKA 4AIHA 1DGRM 5KAFC 3PSFA 2E1MB 4ON0A 2VQLA 3H9JA 1R6RA 3JSOA 5LGNA 2UXXA 3PNTA 4PUSA 3JSPA 1FNNA 1WFXA 2GA2A 1WRJA 4A3LJ 2A61A 1TT0A 3I59B 1VNDA 1QRYA 1U9NA 3QAHA 2V1NA 2DYSH 2Y0SA 4F93B 4RAYA 3ZN0A 3CD6I 1GVDA 3S1MJ 5FKKA 2BV6A 4PJJA 2QQ8A 2IPQX 3HM5A 2OU2A 1MDMA 3MAJA 4YFXF 2I8DA 3FKJA 1CF7B 4F55A 5CVRA 1T0FA 3ZQFA 1PJRA 3I56I 2F6CA 1Z7LA 1LEBA 4XLEA 2R7DA 2OQRA 3DXJF 1C0WA 1VZ0A 1RIOH 3DPLC 4XRSA 3ZQIA 1E3OC 1BI1A 1OISA 3RQIA 1IN6A 3C18A 4I0BA 4BDYA 3I64A 2GAUA 1TZLA 2RAEA 2EPFA 2FA5A 1JHCA 4XSZF 3RPQA 1Y0UA 1K78B 3F0CA 4DW6A 3KP7A 3KCCA 1LUJB 3DFGA 4HX8A 3H35A 2VLAA 3CCQI 3CCEI 4A0ZA 3AG4H 4C2TA 3R61A 2JA7J 1YX3A 2K9NA 3IP4B 2WAEA 4PJ0C 4W1UA 3JRCA 5GAHJ 5K1YA 1YTYA 2UV1A 4ZYHA 4YIFA 2VOOA 4ZYGA 1U5TA 3ZN1A 1XMXA 1IUFA 2MG4A 2E19A 2E1OA 2E36A 5JHFA 2V9VA 4XQFA 4O5VA 1HBXG 1FIAA 4C3JJ 5CYVA 1ETYA 1G3YA 1IW7F 1B59A 2ECBA 5ICGA 3ZGKA 2Z1DA 3OYGA 2OC6A 2VT2A 2XAHA 1GT0C 3HG9A 1B6AA 1K83J 2KZGA 3F8BA 1R4NB 3HEFA 4Y33A 1AWCA 4P9FA 2DMNA 4BACA 3R4KA 4RGRA 1LQ1A 2UXNA 1FSEA 3QQAA 3CDHA 4UHTA 2FBHA 1EJ9A 2AS5F 1S3JA 1XDUA 2GOMA 3DBHB 1Y1WJ 2M45A 2V4JC 1KCAA 2NOJB 1KU3A 5DS9A 2EFPA 4B1RA 1IO2A 3CLOA 4IX7A 2NVTJ 2JT1A 5H6RA 1YLFA 1YITI 1PP8F 3WTYC 1IXCA 2JA6J 4L9NA 2R7FA 3L9FA 3COAC 2CW0F 2R0QC 3FM5A 2QQAA 4IO9F 1WJEA 3S93A 2HPMA 2M9HA 5F6FA 3G3ZA 2HXOA 3PQJA 1U78A 2HO0A 2KIFA 1T33A 4Q5SF 1LE8B 3R6SA 4XNFA 4KIFA 1R9TJ 4RGUA 1JHHA 5B66C 3PNYA 3CJNA 2QGUA 3HBLA 3KEOA 3RTRA 1I1GA 2M7BA 1VQKI 2VBZA 2KT0A 5IP6A 1OCZH 2K02A 4JX4A 1ZREA 1ZRDA 1O7FA 3ABLH 3KP6A 3FX3A 2LP0A 4NC6A 1JXSA 2DK8A 1G6NA 3H5RA 4QPQA 4PFOA 2GXGA 3LL7A 2NAZA 4F3QA 3RZOJ 3TO7A 2F5VA 4ABZA 1R4MB 1LDDA 1FT9A 3CDLA 3Q3SA 5FFXA 2GM4A 3T1BA 1ZG1A 1BOBA 3RSNA 2RQPA 1VQ8I 1G3WA 2QENA 2CQ7A 2F4OB 5K5OA 1TT5B 1YE9A 2QBYA 2E2JJ 4L0YB 2FRHA 3VODA 1WKMA 2KLOA 4BGDA 5TISC 2HQAA 3QP5A 4W97A 2IRFG 4ENKA 1FPQA 1E2XA 3K4JA 1GVJA 1Q1HA 5KNLA 5J8FA 2V7FA 1D0ZA 4Y13A 3ZQLA 4N0BA 5FGMA 3V8KA 4PJLA 5C4JJ 2KHMA 4CCOA 1FZPB 3OL3A 2M3AA 1BR1A 2HR3A 2YX4A 4EM1A 1FEXA 4RB2C 2G7UA 4ESJA 4EJTA 2CSOA 2XAQA 4A0YA 4CICA 1AY9A 2EFNA 3EUHC 1K6YA 4BHBA 3GFMA 3SDBA 2QZ8A 2XF5A 1P92A 2RGVA 4MHGA 4A3CJ 3M4OJ 1MJAA 4EJVA 3HSRA 1MNDA 3NWSA 1V5EA 3KLOA 2MA3A 2JN6A 2B63J 1H9TA 3DU6A 3BTLA 4WX9A 2A6HF 5JLXA 3S3MA 1TC3C 2XASA 5F0HA 2E1CA 1YX5A 1XSXA 1D3YA 1GDTA 4OIOF 3BTIA 4J19A 4UB6C 1X1DA 5D8LB 2CUJA 2HVQA 2CS3A 2R7QA 3DEWA 4DIQA 3BR3A 2W82A 1W36C 1D0XA 2E1MC 1W0TA 2H1KA 1KYWA 2XF6A 3M8FA 1O3SA 3I5UA 1OKRA 2CV0A 4UVAA 1YJWI 2DDBA 3S16J 2A6TA 3HHGA 2VJIA 3O3KA 2VI6A 2YX7A 5HLIA 3BWGA 4HSTA 2P7VB 4MFDA 4BY7J 2VC1A 5CQGA 4NB5A 2K3FA 1GLNA 1V55H 2LG4A 5K7FA 2JVHA 2MABA 2VIXA 5L3GA 3CLQA 1YI2I 2OA4A 2KQRA 2QWWA 3PUFA 3JRGA 1G3SA 4P9UA 1JKRC 2QUFA 2XGCA 3D0SA 4Z2YA 2VQHA 2VQGA 3JTHA 3Q0WA 4RDUA 3T0YA 3OIOA 3ELKA 1VFCA 1NG6A 2PBIA 5LFAA 3WTSC 4V2FA 5F1JA 3A4CA 1ITYA 4C3HJ 4YIRX 3O6BB 3QU3A 2DCEA 3KYLA 2XAFA 1NH3A 4LOCA 1IN7A 5M3FJ 2M4KA 3P9IA 5D5VB 4RLFA 1I6XA 1WJ5A 3L7WA 1IC8A 3DEEA 3BR6A 3K70D 1I4VA 5IP9J 1SFUA 3MKZA 5D4SA 1M1EB 2L2OA 2RC4A 2ZJ2A 2F4MB 2FOKA 2OTJI 1S7OA 4BBSJ 4LFUA 2HKXA 3KLNA 2K5CA 2I10A 1K4TA 2DMUA 1E3HA 5HDNA 2GA1A 2W85A 4JOMA 3HGYA 2V9PA 4XLFA 3KETA 5CPRB 3WGGA 1QBJA 5M3MJ 2B9SA 2IW5A 1I39A 3GZ5A 4DGWB 2VBWA 3BY6A 3HPGA 2HYGD 1Z3YA 5A2QZ 1QVUA 4OIPF 1G8XA 2LBFB 2JJ7A 3WGHA 5HOOA 2X0LA 2MGQA 2Z99A 5A2QK 3Q5FA 2VN2A 1ZRFA 4N4OB 1IRGA 1PDNC 3KE2A 2R7WA 1QZZA 1SMYF 1EF4A 2R5ZA 3LSHA 2PX9A 2ECCA 4A0XA 5DD8A 3K4LA 4B43A 1J09A 2M87A 1USTA 2AO9A 1F1ZA 2BEOA 5B5EC 2CQKA 4UUVA 1BR4A 4OIRF 1UJ8A 1UHWA 2D2WA 3AAFA 3BG7A 3H3ZA 1FOYA 3LSIA 5DUKA 2A07F 4ZH4F 2V1UA 5BOXA 1OR7C 2FF4A 2R7OA 5D5UB 1O3QA 1S8NA 4G9YA 1WI9A 2ZBKA 2YU3A 4MLOA 3LSRA 2K40A 1MMDA 1G59A 2DFFA 3MCZA 1Y6IA 3K4KA 3P5JA 1UMQA 2KIMA 1F43A 2STWA 4HYEA 3GTMJ 1XX5A 4RBOA 2F2EA 2MC4A 1Z9CA 3SFIA 1X4OA 4M3DA 2BVLA 2X9DA 2BE5F 4XOPA 3QRFF 3G6EI 3RKXA 5E3LA 3W2AA 1JUMA 2LR8A 1V54H 3ZPLA 3PM1A 2L9NA 3C2GA 5F64A 2LOOA 1VF9A 4GXOA 2MFZA 3MWMA 3V7SA 1DPUA 4E7SA 2D1HA 1QQIA 5CVUA 2VOPA 3K4MA 2O6GE 3KFWX 4AD9A 1X3UA 1ZTRA 4ZTFA 1ON1A 4WK8F 3MZYA 2ZB9A 5B1BH 1MBHA 1MBJA 5J8CA 2VJ5A 2Y69H 2CW8A 2COBA 3PL8A 3S2WA 3WG7H 2RREA 3U9GA 5D4RA 5CQEA 1JJ8C 3OSGA 3BDNA 2NOGA 4FE4A 5K5RA 3M8EA 3RIRA 3OOUA 2JMWA 4M6YA 3HKZA 2P5KA 4NUBA 3CC2I 2HZTA 4EJWA 2R5YA 2ELKA 2KRCA 3REOA 3LSPA 2ZSIB 2VONA 1ETKA 3S17J 3BLYA 4YRVA 3H3VK 3H92A 2IS4A 4FX0A 2OZUA 2GOXB 2K4JA 4RB1A 4EGYA 4K8WA 4I01A 3MKWB 1X1BA 2ID6A 2O7OA 2FQ3A 3KZIC 1O4XA 3CQZJ 1OYIA 2FXAA 2NVXJ 1BI3A 5BPIA 3FDYA 2DO7A 3FXLA 2EFQA 3OR1C 3D1NI 4FQGA 3UKGA 3K4BA 2ZMEA 1IRXA 4RAGA 3MEXA 1U9OA 3I9V2 1NK3P 5LHHA 1KYZA 2DBBA 2HQNA 5LRRA 1T0FC 1FWZA 3R0JA 4ZDLA 1S7EA 2DA1A 3WTXC 1APLC 2FMYA 3PFIA 2Z3YA 4LB6B 3E6MA 5D6EA 4KITB 1MJBA 1YOVB 3HUGB 2ESHA 3FHNA 2L9VA 5J1YA 4CUGA 1IF1A 1T95A 1AKHA 4AM3A 3H0DA 4BE1A 3F8FA 4ZYDA 4GRIA 4YIIA 2DTRA 2HWVA 2COMA 3IRQA 5HLHA 3IV5A 1X3WB 4XRFA 2BY1A 2MD0A 1CQTA 4LITA 5DM6F 4KT6A 5K7ZA 3A03A 4KICA 3G71I 5LHIA 3K1PA 1U5TC 4EMSA 2KJCA 4G6TB 4EJUA 2XAJA 4E7IA 4EEFG 3O8HA 1N25A 1HKSA 2TRTA 4LJZF 2HQ5A 3LFUA 5H20A 5HLTA 2FNPA 1K79A 1X1AA 4IKFA 1R36A 4HPQA 2KDOA 4BE0A 4BU2A 4U0WA 1ULYA 1GV5A 4M3EA 2H6CA 1X19A 2CGPA 2GLOA 1FP2A 4XRMA 3ZMVA 1H9GA 4B44A 4YFNF 4I99C 1XS9A 4Q4ZF 1FBQA 4PZJA 3JRFA 2OJED 2DA3A 2NS7A 5E3OA 1MMAA 5F0CA 4A6EA 2CQXA 1R00A 1MNMC 4IVNA 5FKOA 5J1RA 1I5ZA 2M0MA 1BOAA 4RM3A 4BY1J 3JRDA 4CGZA 4P96A 1I3QJ 4JQFA 2NS0A 2PLYA 1HW5A 1RNLA 1FYKA 4MTEA 2DYRH 2K9LA 4B09A 2IGOA 4WF2A 3CMAI 4IQJA 3WODF 1FY7A 2YS9A 4WWCA 2QSHX 1BN5A 4G6QA 1P4XA 5GP9A 3RYPA 1H88C 1U8BA 2NS8A 2RNGA 3ZQGA 2IVMA 2Y9YA 3F6VA 3OMYA 2CFXA 3OWTA 4CH7A 5TGTA 2DMPA 3E5UA 2PJRA 1JJ6C 3PFYA 2QYOA 4ITVA 3OYMA 4EM0B 1S6LA 4M72A 2IS1A 1QHGA 3IHUA 1D8KA 3KIOA 1YIJI 1X1PA 2KJBA 1YIOA 5EEGA 5TJJA 4IHVA 1DPRA 5FFZA 3J7AO 3L2RA 1I27A 2L9SA 4F91B 2BOLA 2QSGX 3HDDA 1LNWA 4I09A 3DBLB 4MIMA 5FRNA 4WXCA 1RR8C 4XK4A 3IIQA 4CYCB 3FXOA 1MW7A 1RC9A 2EH3A 2PMHA 4XICA 2LKXA 2ZNZA 4MEYF 2V6CA 2HI3A 4ZYEA 2HVRA 1HOMA 2A05A 2ZNYA 4DOZA 4L5EA 1B8IA 3PO2J 3DCFA 5E79C 4X1EA 4A3JJ 4N9HA 3AFHA 5GADJ 5JHUA 1MGTA 2O61A 1WVRA 2ETHA 2JA2A 4IOAF 2LLKA 4XM3A 2P6SA 3IH3A 4JX6A 1ZK8A 1J75A 2ID3A 2VKHA 2HNHA 4JX5A 1U2WA 1ETVA 1SAXA 4XKBA 2Y48A 4BQAA 1FMWA 3TP3A 2R5YB 1RKTA 2BW3A 1D5VA 2L7ZA 2M2EA 5LEKA 3HOTA 3GTQJ 3V8LA 1JTXA 4E7LA 2M0CA 3C2BA 2ZCWA 3ABTA 3L2UA 2B7EA 4FX4A 3KP4A 4GYGA 2NXNB 1Z7UA 3BP8A 3LFKA 5DCMB 3S3OA 2LD5A 2VPRA 3QOPA 3GW2A 3DPUA 3VYSB 5J4YA 1ZR2A 2RN7A 3RJPA 3LMMA 4ESBA 2HOTA 2VB6A 1ZAOA 2L9RA 3WU0A 5E18F 4O3MA 3VYRB 1KGSA 2ZMEB 2M34A 5FD6A 4ESFA 1ZGJA 3LSMA 1HF0A 1WQ2A 2WB1N 2GXBA 3E6BA 2IGKA 4U88A 4ZZLA 1HSTA 2LKSA 4AIDA 3OY9A 3K0LA 1MH4A 1EKEA 2XPVA 4BE2A 3DQVC 2HYFA 2KKOA 3ZQQA 2O8KA 3N97A 4D5FA 3EYYA 5DEQA 1TLHB 2W24A 2JVGA 2VQCA 1MBGA 3AKZA 1OMIA 5AIPA 2BHYA 2LY2A 1AKHB 1Y1VJ 2DODA 3NRVA 2JUCA 1I3AA 2FBIA 3CMEI 2F5FA 1BR2A 2MSYA 1Y8RB 3LSJA 2BY3A 3CJQB 4RGXA 2JUGA 1RRJA 1QPIA 5IYCJ 3OL4A 2BZTA 1DGWY 1KQ0A 2EQRA 2MD5A 2XAGA 3BR1A 3PSIA 2EBIA 3NARA 3J81Z 5J6XA 4JP0A 2LRDA 3KYCB 2R3SA 4PDKA 3V7CA 1XB4A 4CCLA 1IG7A 1IDZA 4XOTA 3J81K 2CO5A 2CYYA 1LVKA 1ETQA 5L3CA 3B02A 2DPDA 2H09A 4HNUA 2EJRA 3OIQA 2RV8A 3WE2A 4UV8A 2XDVA 1G4DA 2UWMA 3MFKA 2E5NA 1TWCJ 3L2VA 1ZKGA 4D1QA 3MZHA 1ZGWA 3K4NA 5E3NA 4ZJZA 3TDZC 1VTNC 2NVYJ 2Y31A 1PVEA 2JSCA 3TO6A 3CF5F 5GTIC 1R22A 2Y0SN 4V19K 1TWGJ 2ZJPF 3SEQA 4XBFA 3I54A 1B72A 4CYDA 1LEAA 3HPHA 1KQ8A 3CCMI 1EA3A 1WPKA 2L01A 1T08B 2O0YA 3H9QA 1U6GA 2F4IA 3WHBA 2W7NA 4S0HB 4FETA 1QZYA 5EGOA 2EB7A 3GZNB 1FMVA 4UB8C 2DU9A 3J7ZI 1W7PD 2ZFWA 4HRIA 3K9TA 2X1EA 3HL2A 1WWXA 2JK3A 2O5RA 2Y9ZA 2ZKZA 3SYTA 1O7LA 1A31A 1O3RA 4BDZA 2NRAC 5ILUA 3LA3A 2VKVA 3OYEA 3F6OA 1WH5A 2J5OA 3GXOA 4GCVA 1KZHA 3RYRA 5D5WB 3H9GA 3PNVA 2CMPA 2ESNA 4AYBA 4CO8A 1YS7A 3ESWB 3LAJA 1WHUA 1TP4A 3FXRA 1X4PA 1USSA 4D0PA 1WGXA 1EH8A 2HTSA 4FT8A 2YPRA 3CUQA 5ERIA 5EEAA 1RUNA 2RQQA 1IRZA 3E0JB 3C2HA 1RPWA 3ECHA 3GFIA 1FJLA 3QPLA 1IN8A 1BJAA 1W7PA 3S2DJ 3U21A 1B8IB 3KP5A 2MYSA 4KIBA 4B8XA 5KHDA 2ELJA 3ISPA 1IV8A 5M5XJ 4HQMA 3ZOBA 3GUDA 2M1BA 3KP2A 3QYEA 5FLXZ 4LD5A 4NQWA 1ODDA 3ZXSA 4MNUA 1I50J 2HYJA 4PSXA 1UHMA 2EV6A 3CCUI 2XIGA 5FLXK 2BW3B 5FD5A 4BL0B 4I02A 3DTKA 3S2HJ 4H0EA 1YW7A 2WC2A 2E71A 1XSVA 4YEJA 2VKDA 2VBXA 5EEHA 3TP0A 4S05A 2OV7A 1UMUA 5DYMA 1MBFA 3IH2A 1JGSA 2EZKA 3WTZA 4A3KJ 2P6TA 4OU0A 1GHCA 3SEZA 3S1RJ 2K86A 2ZXWH 4L5JA 5F1RA 1Y0NA 1MDMB 1BM9A 4D7MA 5CVJA 2MW8A 3HRTA 3NAUA 2L4AA 3BZKA 4LK1F 1R1UA 2AQFA 2W84A 2HOEA 2LREA 3I53A 4TV7A 1T38A 1T39A 1OCOH 4NBQA 2XROA 4AUXA 3ONQA 4C2UA 3E1SA 5AIQA 1YFHA 2Q1ZB 3DLAA 4ANJA 3GBGA 1JT0A 2A68F 1WJFA 3L00A 4GO1A 2FBKA 2L4MA 2AQEA 3F8CA 4L9TA 4GFBA 3EUKL 1QU3A 4BUPA 1IXRC 3S32A 4XLCA 1R7JA 3VDXA 2DA2A 2KRHA 4HF1A 4DZPA 3E6DA 1YO5C 4LG0A 4LB5A 4KDPA 1D5YA 2EV0A 1POGA 2EZLA 5BNGA 3AG3H 2FMLA 3GEZA 3V7RA 1OFCX 4BBRJ 1U5TB 3B6AA 3GVAA 2NVUB 4BHPA 2ZMEC 4IRHA 3K2ZA 4L9JA 5DDGA 1GXQA 2LYCA 2W1OA 3HYIA 3H3UA 5EF6A 5FO5A 2EIJH 1YW8A 3ZMTA 3WTVC 5C3EJ 2DA5A 1H89C 1R1TA 4Y17A 2EA2A 1X1CA 2QQBA 2B0LA 3FMQA 4EGZA 3AL0B 4M3GA 1STZA 2H27A 2F5EA 3HOXJ 3JW4A 3FBIB 4XKCA 2KISA 1SVOA 3GZ6A 3JTGA 1Z91A 3MN2A 4XL9A 3E5XA 3OIPA 2L5QA 2XSJC 4AIJA 3QODA 3A0HC 3ZMDA 2OCCH 1FYMA 1ENHA 1OCPA 3SFZA 2F48A 2P5LC 1Z21A 1QO0D 1B72B 1S7AA 3ZQCA 3JRHA 3W6KB 1DP7P 3GTKJ 1AHDP 4BQOA 2K7LA 4IXAA 5EGOB 1PUFA 2FJRA 2PG4A 3M07A 3VWBA 5M5WJ 1ACIA 5GTHC 2HEOA 5KK1A 4X0GA 1SMTA 2KRFA 1KQ9A 3U2RA 2DA6A 2X1DA 3GTGJ 1BC8C 3F9KA 3GLXA 4QWQA 3FHZA 3QWLA 3E6CC 1T8IA 2MLGA 2HTJA 5JVTA 2WY8Q 2OBPA 2X1CA 4LK0F 3QYFA 2A3SA 3VOEA 1XTAA 4DNCA 3MKLA 3IC7A 3BG6A 4HDVA 3CCVI 1Y39A 2ELHA 1YS6A 4BXUA 3BZ6A 3CESA 3ECOA 4CHUA 1Z6TA 5L3EA 1PUEE 5EG0A 4G6DA 3KPHA 3CUQB 3FF5A 5CJ9A 1GV2A 2LKPA 1R71A 2FEZA 3VEPA 1NHAA 3OYDA 4KJZA 2XGEA 3ZQ7A 1WCMJ 4C9YA 4A3IJ 2LVSA
chains in the Genus database with same CATH topology
4JK1X 3IL2A 2VE9A 1B9NA 2QBYB 1W7PB 2P7CB 2DI3A 3LA2A 2XGXA 1ZG5A 4F7ZA 4LGWA 2G9WA 3K1MA 3ZMZA 4I0AA 5BMZA 4UVBA 1ZARA 4HX7A 4M6XA 2P5VA 1BIAA 4OMZA 1P6RA 2QQ9A 3OV8A 3VB2A 1HKQA 4I7HA 2Z5UA 3F23A 3KZYA 3RKYA 4MQ9F 3EUHA 4AWXB 3DEUA 2W57A 1FC3A 4M73A 5AONA 4R8HA 5DD4A 3QP6A 3CO6C 1F9NA 1FP1D 1HW2A 3ML6A 2Q8KA 1TW3A 2RKHA 3BPXA 3LAPA 1XCBA 4HBLA 5LBQA 2IA1A 1KU7A 2IT0A 1W5SA 4HZFA 4U0YA 2OD5A 2D45A 2BYVE 4S04A 5D6FA 4NHJA 4A5NA 2GQQA 4KMFA 1IN5A 2MH9A 1PP7U 1F4KA 4O6JA 4L18B 4HAMA 2L02A 4HA8A 1JHEA 4G8XA 4BHCA 1KN9A 1KU2A 1GXPA 2XHKA 2HS5A 4P55A 2MBFA 2JTVA 3SXYA 4NV4A 1I1SA 2Q0OA 4U7DA 1T2KA 1R5GA 3T5XA 3CTAA 3JAMK 3ERED 3WGIA 2PMUA 3HRSA 1UFMA 1P4AA 3V4GA 5HS7A 1BC7C 2PN6A 5E8IA 1D8JA 1XSDA 2VE8A 4AVPA 3FWEA 3BPVA 1IAWA 4Q47A 2L54A 1WSUA 1SD6A 2XVCA 3NQOA 3GFLA 3O2PE 3FXQA 3LSTA 1P4WA 4L0ZB 3TDUC 1TBXA 2A69F 1ZRCA 2DLLA 1FSHA 2MH2A 3BROA 3M9AA 1Z05A 2WWYA 4RS8A 4OMYA 2DAOA 2RVCA 4BH9A 2NYXA 3Q9SA 1TQPA 1ZGAA 4IHSA 1XMKA 2EFWA 4GYIA 4MGRA 3DKWA 1L3LA 1OR7A 5HLGA 2D1VA 4N31A 2CWEA 2V79A 2WV0A 5HS9A 3EETA 4PGHA 3CUQC 2ACJA 4BAYA 2JPBA 4GGGA 4KYWA 4MEXF 3SQNA 2J5PA 2X4HA 4ETSA 3KZZA 5ILSA 4EM2A 3W6JB 3CO7C 3S04A 2K27A 4UNOA 5LGUA 4R79A 3LQQA 1ZHFA 1EH7A 1J0RA 4L9VA 1F39A 3KP3A 1FBUA 4UXNA 2OAZA 5DV5A 4YFKF 5LHGA 5LEJA 1JE8A 2RNJA 5K5QA 4G94A 1J59A 2ZXJA 4E70A 2E7XA 5CVVA 1RI7A 5E1ZB 4ZZDA 1HKTA 2V1DA 3DP7A 4ENNA 3I58A 3HSEA 1YQAA 2VT3A 1EH6A 2NNYA 1DDNA 2P4WA 2TDXA 3HOSA 4LLNA 5TRDA 3F8NA 1R23A 4A5MA 3BOQA 4P5OA 1YG2A 1ZLKA 2BGCA 2VC0A 3IWZA 4EQQA 2H94A 3ABUA 3G73A 4KA4A 2QVOA 3FM3A 3TGNA 3T8TA 5E17F 1BI0A 2EWNA 2IJLA 1ZN2A 1Z1DA 4I98B 1HSJA 1XDSA 4HLXA 3OOPA 1XN7A 4RB0A 1YW9A 4HDUA 3VFZA 3HTUA 5HVQC 2DPUA 4ENMA 4WCGA 2H6BA 2Y0MA 2EK5A 3EYIA 2PQ8A 2HGCA 1SD7A 4OOIA 3QPHA 5BS6A 2OZ6A 3E3VA 2FKDA 2DQRA 3RPUA 2KIUA 5CLSA 3TOBA 3ROUA 2LF8A 3V8JA 3WTUC 4ASNA 3SZPA 2EV5A 2PEXA 1LDJA 2F5DA 4Q48A 4IRGA 1DUXC 2PJPA 3FXUA 1O57A 3M1EA 5CVIA 4BNCA 1LVAA 1QGPA 4RAZA 2M30A 3R0AA 2VBYA 5KVRA 4WXHA 1LB2A 4KN7X 3HRMA 3L09A 2QLZA 5ICCA 4LLGF 3N4MA 2E1NA 1SFEA 2NNNA 2EA4A 1QNTA 4JBAA 2GZWA 1ON2A 4M74A 1A04A 1XCVA 1L0OC 4HW0A 5BQTA 1CGPA 3F3XA 3QPTA 1OPCA 2ISZA 1E17A 1V3FA 1J9IA 2STTA 2XRNA 5D8KB 2Q2EA 2DFIA 1IXSB 4ME8A 3L2CA 4XLPF 1XMAA 5E1WA 3F72A 2VODA 4HOBA 4QLCU 3C7JA 3HRUA 2O3FA 5ED4A 1TNSA 2L3DA 1T7DA 1BI2A 3ULQB 2VXZA 1REPC 1TQIA 5ICFA 1TQMA 4HX4A 1SFXA 4OIQF 2HFHA 1IUYA 3LWFA 3IKTA 1OYYA 4HV5A 1B12A 4G7ZF 2G7HA 5FB2A 4M9SA 2A6EF 1BBYA 1IZ1A 1ZG3A 4LMYA 2W25A 3FMSA 1ZYRF 3U1DA 3B73A 1TTYA 3ZMUA 3LA7A 1H0MA 1ZH5A 1IRFA 1UCRA 3HUGA 4KIGA 4A6DA 1G3TA 5L3DA 1LDKB 5E20A 4MTDA 4YG2F 4HF0A 3KEQA 2XV4S 3BJ6A 2IA0A 2YSRA 2QM3A 4A2UA 5H6QA 3TKYA 1T98A 5IT9Z 5HDGA 5LLQA 1ZLJA 4IRIA 5IT9K 1BIBA 3GF2A 5HS8A 4L5IA 3EDPA 5JFRA 2XKPA 4FHTA 6PAXA 2LDUA 3GO5A 3LQRA 4KNYA 2DW4A 4KUMA 3D5LA 4LLLA 1J5YA 4Y15A 3DF8A 4WXDA 4I2OA 3SHFA 2DQLA 1J7KA 4M9ZA 2OQGA 3HTSB 3WU1B 2PI0A 1MD0A 4ENJA 1KA8A 4N9IA 1OYWA 4IJAA 2GIVA 1U8RA 2LNBA 3SZTA 2O8XA 1MKMA 3F22A 2DK5A 5HDKA 4MQVA 2GWRA 3QU6A 4HF2A 5DCFA 4KN4X 3F8MA 2HKOA 4CDGA 1B1BA 2JRTA 2UZKA 1V4RA 1Z6RA 5D5XB 1SD4A 2MLKA 4XLNF 3J80Z 5L3FA 3IRRA 1U3EM 2DT5A 2JZYA 2PFBA 4K2EA 1FBSA 1W5TA 3J80K 2M5WA 1P2FA 4EJOA 5DUIA 2Z33A 4HV6A 4IHTA 5JI6A 1T6SA 3DPTA 1TNTA 3PQKA 2MC3A 1AOYA 4PCQA 1K7AA 1FOKA 1W4MA 2HDCA 3HHHA 2HNFA 4LG0B 1SD5A 1YYVA 5ILVA 1R1VA 1XGMA 3HIFA 2IA2A 3RDIA 1K6OA 4HQEA 5DCMA 3I59A 2YR2A 5E1XA 1QPMA 2F5CA 3BJOA 2EFOA 3E5QA 2CG4A 4A12A 1MJ9A 3HSFA 4HLYA 5LGTA 1HXDA 2Y75A 4CXFA 3RI4A 1CF7A 3Q9VA 2P8TA 5IT3A 4UVCA 4G7HF 1EV7A 1TW2A 3T8RA 2LSOA 1RUOA 4G7OF 4PGGA 4IPAA 1K78A 3JAMZ 1FYLA 3ZP5A 4UV9A 3I71A 2AXLA 1J2XA 2FNAA 4RB3C 3ZMSA 3R60A 4R1HA 5LRSA 3C1DA 2Z9OA 1R58A 2RDPA 2ZO4A 1FX7A 1RZ4A 3BDDA 3RKWA 2K4BA 3GYHX 1R5HA 4M9XA 4KMUX 2HQRA 3IKVA 1FLIA 5JR3A 3EQLF 1MZBA 1ONVA 4CZZA 1XD7A 2JPCA 2FE3A 1IN4A 3I0TA 3WTTC 3MQ0A 2FSWA 1B9MA 3BJAA 4OINF 4EVIA 1KU9A 1F5TA 3C3WA 2XUBA 4U7BA 2A5YB 3GX4X 2WTEA 3M7GA 1O3TA 3TO9A 2O03A 1UB9A 3WE3A 2M8EA 4BYYA 2C6YA 2ADUA 2IP2A 4AIKA 2XKOA 4XSXF 3TOAA 3GFJA 5L3BA 2V1XA 1XGSA 1HQCA 4RGSA 4M71A 4EV0A 3WG9A 3GWZA 3K1NA 1JHFA 2ISYA 3TQNA 1LJ9A 1XGNA 1HW1A 5BPDA 3I4PA 3WTWC 1XGOA 4U0VA 4DQ2A 3E97A 3P9KA 2BBYA 1B4AA 1S29A 3P9CA 2FU4A 4IF4A 3FZVA 3F21A 3FMRA 3IWFA 4KT5C 2E7WA 5ICEA 3NEUA 2LF7A 3CUOA 3DV8A 3P7NA 4KFCA 5E8GA 3K69A 4AIHA 4ON0A 3JSOA 5LGNA 2UXXA 3JSPA 1FNNA 2GA2A 1WRJA 2A61A 3I59B 3QAHA 4RAYA 3ZN0A 2BV6A 2IPQX 2OU2A 1MDMA 3MAJA 4YFXF 1CF7B 5CVRA 1T0FA 1LEBA 2R7DA 2OQRA 3DXJF 1C0WA 1RIOH 3DPLC 1BI1A 1IN6A 3C18A 4I0BA 3I64A 2GAUA 2FA5A 1JHCA 4XSZF 3RPQA 1Y0UA 1K78B 3KP7A 3KCCA 3DFGA 4HX8A 4A0ZA 3R61A 5K1YA 1YTYA 4ZYHA 4YIFA 2VOOA 4ZYGA 1U5TA 3ZN1A 2V9VA 4O5VA 1HBXG 5CYVA 1G3YA 1IW7F 1B59A 5ICGA 2VT2A 2XAHA 1B6AA 3F8BA 1AWCA 4P9FA 3R4KA 4RGRA 1LQ1A 2UXNA 1FSEA 3CDHA 4UHTA 2FBHA 2AS5F 1S3JA 1XDUA 2M45A 1KCAA 1KU3A 2EFPA 3CLOA 2JT1A 5H6RA 1YLFA 1PP8F 3WTYC 1IXCA 4L9NA 2R7FA 3L9FA 3COAC 2CW0F 3FM5A 2QQAA 5F6FA 3G3ZA 3PQJA 1U78A 2HO0A 2KIFA 4Q5SF 3R6SA 4KIFA 4RGUA 1JHHA 3CJNA 3KEOA 3RTRA 1I1GA 2VBZA 2K02A 1ZREA 1ZRDA 1O7FA 3KP6A 3FX3A 1JXSA 2DK8A 1G6NA 2GXGA 2NAZA 3TO7A 1LDDA 1FT9A 5FFXA 3T1BA 1ZG1A 2RQPA 1G3WA 2QENA 5K5OA 2QBYA 4L0YB 2FRHA 3VODA 1WKMA 3QP5A 2IRFG 4ENKA 1FPQA 1E2XA 1GVJA 1Q1HA 5J8FA 4Y13A 4N0BA 5FGMA 3V8KA 1FZPB 2HR3A 2YX4A 4EM1A 4RB2C 2G7UA 4ESJA 4EJTA 2CSOA 2XAQA 4A0YA 4CICA 1AY9A 2EFNA 4BHBA 3GFMA 2QZ8A 1P92A 2RGVA 4MHGA 1MJAA 4EJVA 3HSRA 3KLOA 2MA3A 1H9TA 4WX9A 2A6HF 2XASA 2E1CA 1XSXA 1D3YA 4OIOF 5D8LB 1KYWA 1O3SA 3M8FA 3I5UA 1OKRA 4UVAA 3HHGA 3O3KA 2YX7A 5HLIA 3BWGA 2P7VB 2VC1A 4NB5A 5L3GA 2OA4A 2QWWA 1G3SA 4P9UA 2QUFA 3D0SA 4Z2YA 3JTHA 3T0YA 3ELKA 2PBIA 3WTSC 3O6BB 3QU3A 2XAFA 1IN7A 3P9IA 5D5VB 1I6XA 3L7WA 1I4VA 1SFUA 5D4SA 2RC4A 2ZJ2A 2FOKA 1S7OA 4LFUA 2HKXA 3KLNA 5HDNA 2GA1A 2W85A 1QBJA 3KETA 3WGGA 2IW5A 3GZ5A 2VBWA 3BY6A 2HYGD 5A2QZ 4OIPF 3WGHA 5HOOA 2X0LA 2Z99A 5A2QK 3Q5FA 2VN2A 1ZRFA 1IRGA 1PDNC 3KE2A 1QZZA 1SMYF 4A0XA 5DD8A 2M87A 1USTA 1F1ZA 2BEOA 2CQKA 4UUVA 4OIRF 1UHWA 2D2WA 3AAFA 3H3ZA 5DUKA 2A07F 4ZH4F 2V1UA 5BOXA 2FF4A 5D5UB 1O3QA 1S8NA 4G9YA 1WI9A 2ZBKA 2YU3A 3MCZA 2KIMA 2STWA 4HYEA 2F2EA 1Z9CA 2BE5F 3QRFF 3RKXA 3ZPLA 5F64A 4GXOA 3MWMA 3V7SA 1DPUA 2D1HA 1QQIA 5CVUA 2VOPA 2O6GE 3KFWX 4AD9A 1X3UA 1ON1A 4WK8F 3MZYA 5J8CA 3S2WA 5D4RA 3U9GA 3BDNA 5K5RA 3M8EA 3RIRA 4M6YA 2P5KA 2HZTA 4EJWA 3REOA 2VONA 3H92A 4FX0A 2OZUA 2K4JA 4RB1A 4EGYA 4K8WA 4I01A 2FQ3A 1OYIA 2FXAA 1BI3A 5BPIA 2DO7A 2EFQA 2ZMEA 3MEXA 5LHHA 1KYZA 2DBBA 2HQNA 5LRRA 1FWZA 3R0JA 3WTXC 2FMYA 3PFIA 2Z3YA 4LB6B 3E6MA 5D6EA 1MJBA 2ESHA 1IF1A 3F8FA 4ZYDA 4YIIA 2DTRA 2HWVA 2COMA 3IRQA 5HLHA 4XRFA 4KICA 5LHIA 3K1PA 1U5TC 4EMSA 2KJCA 4EJUA 2XAJA 4LJZF 1HKSA 5H20A 2FNPA 1K79A 1R36A 4U0WA 1ULYA 2H6CA 2CGPA 1FP2A 3ZMVA 1H9GA 4YFNF 4Q4ZF 1FBQA 4PZJA 4A6EA 1R00A 4IVNA 1I5ZA 1BOAA 4CGZA 4P96A 4JQFA 2NS0A 2PLYA 1HW5A 1RNLA 1FYKA 4MTEA 4B09A 4WF2A 3WODF 1FY7A 4WWCA 1BN5A 4G6QA 1P4XA 3RYPA 2IVMA 3F6VA 2CFXA 3E5UA 2QYOA 4EM0B 1S6LA 4M72A 3IHUA 1D8KA 2KJBA 1YIOA 5EEGA 5TJJA 1DPRA 5FFZA 3J7AO 1I27A 1LNWA 4I09A 4WXCA 3IIQA 2PMHA 2ZNZA 4MEYF 2V6CA 4ZYEA 2ZNYA 4N9HA 5JHUA 1MGTA 2O61A 2ETHA 2P6SA 1J75A 1U2WA 1SAXA 2Y48A 4BQAA 1D5VA 5LEKA 3HOTA 3V8LA 2ZCWA 3ABTA 4FX4A 3KP4A 4GYGA 3BP8A 1Z7UA 3LFKA 5DCMB 3QOPA 3GW2A 2RN7A 3RJPA 4ESBA 1ZAOA 3WU0A 5E18F 4O3MA 1KGSA 2ZMEB 5FD6A 4ESFA 1ZGJA 1WQ2A 2GXBA 3E6BA 4U88A 4ZZLA 1HSTA 3K0LA 3DQVC 2HYFA 2KKOA 3N97A 3EYYA 5DEQA 1TLHB 2W24A 1OMIA 5AIPA 3NRVA 2FBIA 2F5FA 4RGXA 1KQ0A 2MD5A 2XAGA 3J81Z 5J6XA 2R3SA 4PDKA 3V7CA 1XB4A 3J81K 2CO5A 2CYYA 5L3CA 3B02A 2DPDA 2H09A 2EJRA 2RV8A 3WE2A 4UV8A 1G4DA 2UWMA 3MFKA 3MZHA 3TDZC 1VTNC 2JSCA 3TO6A 1R22A 4XBFA 3I54A 4CYDA 1LEAA 1KQ8A 2L01A 2O0YA 1U6GA 1QZYA 2EB7A 2DU9A 1W7PD 2ZFWA 3K9TA 1WWXA 2ZKZA 1O7LA 1O3RA 2NRAC 5ILUA 3LA3A 3F6OA 4GCVA 2J5OA 3GXOA 3RYRA 5D5WB 2ESNA 4CO8A 1YS7A 3LAJA 3FXRA 4D0PA 1USSA 1EH8A 2HTSA 4FT8A 2YPRA 3CUQA 5ERIA 1RUNA 3ECHA 3GFIA 1IN8A 1BJAA 1W7PA 3KP5A 4KIBA 4B8XA 3ISPA 4HQMA 3GUDA 2M1BA 3KP2A 5FLXZ 4LD5A 4NQWA 1ODDA 4MNUA 1UHMA 2EV6A 2XIGA 5FLXK 5FD5A 4I02A 4H0EA 1YW7A 2WC2A 1XSVA 2VBXA 5EEHA 4S05A 1UMUA 5DYMA 1JGSA 3WTZA 2P6TA 4OU0A 1GHCA 2K86A 4L5JA 5F1RA 1MDMB 1BM9A 5CVJA 3HRTA 2L4AA 4LK1F 1R1UA 2W84A 2HOEA 3I53A 4TV7A 1T38A 1T39A 2XROA 5AIQA 1YFHA 2A68F 3L00A 4GO1A 2FBKA 2L4MA 3F8CA 4L9TA 1IXRC 1R7JA 4HF1A 3E6DA 1YO5C 4LG0A 4LB5A 4KDPA 2EV0A 2FMLA 3GEZA 3V7RA 1U5TB 3GVAA 4BHPA 4IRHA 3K2ZA 4L9JA 5DDGA 1GXQA 3HYIA 3H3UA 5FO5A 3ZMTA 1YW8A 3WTVC 1R1TA 4Y17A 2EA2A 2QQBA 2B0LA 3FMQA 4EGZA 1STZA 2H27A 2F5EA 3JW4A 3GZ6A 3JTGA 1Z91A 3E5XA 4AIJA 3ZMDA 1FYMA 3SFZA 2P5LC 1QO0D 1S7AA 3W6KB 1DP7P 2K7LA 4IXAA 2FJRA 2PG4A 2HEOA 5KK1A 1SMTA 2KRFA 1KQ9A 3U2RA 1BC8C 3GLXA 4QWQA 3FHZA 3E6CC 2MLGA 2HTJA 5JVTA 2OBPA 4LK0F 2A3SA 3VOEA 4DNCA 3IC7A 4HDVA 2ELHA 1YS6A 4BXUA 3BZ6A 3ECOA 4CHUA 1Z6TA 5L3EA 1PUEE 4G6DA 3CUQB 3FF5A 5CJ9A 2LKPA 2FEZA 3VEPA 1NHAA 3ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 X;  3IL2 A;  2VE9 A;  1B9N A;  2QBY B;  1W7P B;  2P7C B;  2DI3 A;  3LA2 A;  2XGX A;  1ZG5 A;  4F7Z A;  4LGW A;  2G9W A;  3K1M A;  3ZMZ A;  4I0A A;  5BMZ A;  4UVB A;  1ZAR A;  4HX7 A;  4M6X A;  2P5V A;  1BIA A;  4OMZ A;  1P6R A;  2QQ9 A;  3OV8 A;  3VB2 A;  1HKQ A;  4I7H A;  2Z5U A;  3F23 A;  3KZY A;  3RKY A;  4MQ9 F;  3EUH A;  4AWX B;  3DEU A;  2W57 A;  1FC3 A;  4M73 A;  5AON A;  4R8H A;  5DD4 A;  3QP6 A;  3CO6 C;  1F9N A;  1FP1 D;  1HW2 A;  3ML6 A;  2Q8K A;  1TW3 A;  2RKH A;  3BPX A;  3LAP A;  1XCB A;  4HBL A;  5LBQ A;  2IA1 A;  1KU7 A;  2IT0 A;  1W5S A;  4HZF A;  4U0Y A;  2OD5 A;  2D45 A;  2BYV E;  4S04 A;  5D6F A;  4NHJ A;  4A5N A;  2GQQ A;  4KMF A;  1IN5 A;  2MH9 A;  1PP7 U;  1F4K A;  4O6J A;  4L18 B;  4HAM A;  2L02 A;  4HA8 A;  1JHE A;  4G8X A;  4BHC A;  1KN9 A;  1KU2 A;  1GXP A;  2XHK A;  2HS5 A;  4P55 A;  2MBF A;  2JTV A;  3SXY A;  4NV4 A;  1I1S A;  2Q0O A;  4U7D A;  1T2K A;  1R5G A;  3T5X A;  3CTA A;  3JAM K;  3ERE D;  3WGI A;  2PMU A;  3HRS A;  1UFM A;  1P4A A;  3V4G A;  5HS7 A;  1BC7 C;  2PN6 A;  5E8I A;  1D8J A;  1XSD A;  2VE8 A;  4AVP A;  3FWE A;  3BPV A;  1IAW A;  4Q47 A;  2L54 A;  1WSU A;  1SD6 A;  2XVC A;  3NQO A;  3GFL A;  3O2P E;  3FXQ A;  3LST A;  1P4W A;  4L0Z B;  3TDU C;  1TBX A;  2A69 F;  1ZRC A;  2DLL A;  1FSH A;  2MH2 A;  3BRO A;  3M9A A;  1Z05 A;  2WWY A;  4RS8 A;  4OMY A;  2DAO A;  2RVC A;  4BH9 A;  2NYX A;  3Q9S A;  1TQP A;  1ZGA A;  4IHS A;  1XMK A;  2EFW A;  4GYI A;  4MGR A;  3DKW A;  1L3L A;  1OR7 A;  5HLG A;  2D1V A;  4N31 A;  2CWE A;  2V79 A;  2WV0 A;  5HS9 A;  3EET A;  4PGH A;  3CUQ C;  2ACJ A;  4BAY A;  2JPB A;  4GGG A;  4KYW A;  4MEX F;  3SQN A;  2J5P A;  2X4H A;  4ETS A;  3KZZ A;  5ILS A;  4EM2 A;  3W6J B;  3CO7 C;  3S04 A;  2K27 A;  4UNO A;  5LGU A;  4R79 A;  3LQQ A;  1ZHF A;  1EH7 A;  1J0R A;  4L9V A;  1F39 A;  3KP3 A;  1FBU A;  4UXN A;  2OAZ A;  5DV5 A;  4YFK F;  5LHG A;  5LEJ A;  1JE8 A;  2RNJ A;  5K5Q A;  4G94 A;  1J59 A;  2ZXJ A;  4E70 A;  2E7X A;  5CVV A;  1RI7 A;  5E1Z B;  4ZZD A;  1HKT A;  2V1D A;  3DP7 A;  4ENN A;  3I58 A;  3HSE A;  1YQA A;  2VT3 A;  1EH6 A;  2NNY A;  1DDN A;  2P4W A;  2TDX A;  3HOS A;  4LLN A;  5TRD A;  3F8N A;  1R23 A;  4A5M A;  3BOQ A;  4P5O A;  1YG2 A;  1ZLK A;  2BGC A;  2VC0 A;  3IWZ A;  4EQQ A;  2H94 A;  3ABU A;  3G73 A;  4KA4 A;  2QVO A;  3FM3 A;  3TGN A;  3T8T A;  5E17 F;  1BI0 A;  2EWN A;  2IJL A;  1ZN2 A;  1Z1D A;  4I98 B;  1HSJ A;  1XDS A;  4HLX A;  3OOP A;  1XN7 A;  4RB0 A;  1YW9 A;  4HDU A;  3VFZ A;  3HTU A;  5HVQ C;  2DPU A;  4ENM A;  4WCG A;  2H6B A;  2Y0M A;  2EK5 A;  3EYI A;  2PQ8 A;  2HGC A;  1SD7 A;  4OOI A;  3QPH A;  5BS6 A;  2OZ6 A;  3E3V A;  2FKD A;  2DQR A;  3RPU A;  2KIU A;  5CLS A;  3TOB A;  3ROU A;  2LF8 A;  3V8J A;  3WTU C;  4ASN A;  3SZP A;  2EV5 A;  2PEX A;  1LDJ A;  2F5D A;  4Q48 A;  4IRG A;  1DUX C;  2PJP A;  3FXU A;  1O57 A;  3M1E A;  5CVI A;  4BNC A;  1LVA A;  1QGP A;  4RAZ A;  2M30 A;  3R0A A;  2VBY A;  5KVR A;  4WXH A;  1LB2 A;  4KN7 X;  3HRM A;  3L09 A;  2QLZ A;  5ICC A;  4LLG F;  3N4M A;  2E1N A;  1SFE A;  2NNN A;  2EA4 A;  1QNT A;  4JBA A;  2GZW A;  1ON2 A;  4M74 A;  1A04 A;  1XCV A;  1L0O C;  4HW0 A;  5BQT A;  1CGP A;  3F3X A;  3QPT A;  1OPC A;  2ISZ A;  1E17 A;  1V3F A;  1J9I A;  2STT A;  2XRN A;  5D8K B;  2Q2E A;  2DFI A;  1IXS B;  4ME8 A;  3L2C A;  4XLP F;  1XMA A;  5E1W A;  3F72 A;  2VOD A;  4HOB A;  4QLC U;  3C7J A;  3HRU A;  2O3F A;  5ED4 A;  1TNS A;  2L3D A;  1T7D A;  1BI2 A;  3ULQ B;  2VXZ A;  1REP C;  1TQI A;  5ICF A;  1TQM A;  4HX4 A;  1SFX A;  4OIQ F;  2HFH A;  1IUY A;  3LWF A;  3IKT A;  1OYY A;  4HV5 A;  1B12 A;  4G7Z F;  2G7H A;  5FB2 A;  4M9S A;  2A6E F;  1BBY A;  1IZ1 A;  1ZG3 A;  4LMY A;  2W25 A;  3FMS A;  1ZYR F;  3U1D A;  3B73 A;  1TTY A;  3ZMU A;  3LA7 A;  1H0M A;  1ZH5 A;  1IRF A;  1UCR A;  3HUG A;  4KIG A;  4A6D A;  1G3T A;  5L3D A;  1LDK B;  5E20 A;  4MTD A;  4YG2 F;  4HF0 A;  3KEQ A;  2XV4 S;  3BJ6 A;  2IA0 A;  2YSR A;  2QM3 A;  4A2U A;  5H6Q A;  3TKY A;  1T98 A;  5IT9 Z;  5HDG A;  5LLQ A;  1ZLJ A;  4IRI A;  5IT9 K;  1BIB A;  3GF2 A;  5HS8 A;  4L5I A;  3EDP A;  5JFR A;  2XKP A;  4FHT A;  6PAX A;  2LDU A;  3GO5 A;  3LQR A;  4KNY A;  2DW4 A;  4KUM A;  3D5L A;  4LLL A;  1J5Y A;  4Y15 A;  3DF8 A;  4WXD A;  4I2O A;  3SHF A;  2DQL A;  1J7K A;  4M9Z A;  2OQG A;  3HTS B;  3WU1 B;  2PI0 A;  1MD0 A;  4ENJ A;  1KA8 A;  4N9I A;  1OYW A;  4IJA A;  2GIV A;  1U8R A;  2LNB A;  3SZT A;  2O8X A;  1MKM A;  3F22 A;  2DK5 A;  5HDK A;  4MQV A;  2GWR A;  3QU6 A;  4HF2 A;  5DCF A;  4KN4 X;  3F8M A;  2HKO A;  4CDG A;  1B1B A;  2JRT A;  2UZK A;  1V4R A;  1Z6R A;  5D5X B;  1SD4 A;  2MLK A;  4XLN F;  3J80 Z;  5L3F A;  3IRR A;  1U3E M;  2DT5 A;  2JZY A;  2PFB A;  4K2E A;  1FBS A;  1W5T A;  3J80 K;  2M5W A;  1P2F A;  4EJO A;  5DUI A;  2Z33 A;  4HV6 A;  4IHT A;  5JI6 A;  1T6S A;  3DPT A;  1TNT A;  3PQK A;  2MC3 A;  1AOY A;  4PCQ A;  1K7A A;  1FOK A;  1W4M A;  2HDC A;  3HHH A;  2HNF A;  4LG0 B;  1SD5 A;  1YYV A;  5ILV A;  1R1V A;  1XGM A;  3HIF A;  2IA2 A;  3RDI A;  1K6O A;  4HQE A;  5DCM A;  3I59 A;  2YR2 A;  5E1X A;  1QPM A;  2F5C A;  3BJO A;  2EFO A;  3E5Q A;  2CG4 A;  4A12 A;  1MJ9 A;  3HSF A;  4HLY A;  5LGT A;  1HXD A;  2Y75 A;  4CXF A;  3RI4 A;  1CF7 A;  3Q9V A;  2P8T A;  5IT3 A;  4UVC A;  4G7H F;  1EV7 A;  1TW2 A;  3T8R A;  2LSO A;  1RUO A;  4G7O F;  4PGG A;  4IPA A;  1K78 A;  3JAM Z;  1FYL A;  3ZP5 A;  4UV9 A;  3I71 A;  2AXL A;  1J2X A;  2FNA A;  4RB3 C;  3ZMS A;  3R60 A;  4R1H A;  5LRS A;  3C1D A;  2Z9O A;  1R58 A;  2RDP A;  2ZO4 A;  1FX7 A;  1RZ4 A;  3BDD A;  3RKW A;  2K4B A;  3GYH X;  1R5H A;  4M9X A;  4KMU X;  2HQR A;  3IKV A;  1FLI A;  5JR3 A;  3EQL F;  1MZB A;  1ONV A;  4CZZ A;  1XD7 A;  2JPC A;  2FE3 A;  1IN4 A;  3I0T A;  3WTT C;  3MQ0 A;  2FSW A;  1B9M A;  3BJA A;  4OIN F;  4EVI A;  1KU9 A;  1F5T A;  3C3W A;  2XUB A;  4U7B A;  2A5Y B;  3GX4 X;  2WTE A;  3M7G A;  1O3T A;  3TO9 A;  2O03 A;  1UB9 A;  3WE3 A;  2M8E A;  4BYY A;  2C6Y A;  2ADU A;  2IP2 A;  4AIK A;  2XKO A;  4XSX F;  3TOA A;  3GFJ A;  5L3B A;  2V1X A;  1XGS A;  1HQC A;  4RGS A;  4M71 A;  4EV0 A;  3WG9 A;  3GWZ A;  3K1N A;  1JHF A;  2ISY A;  3TQN A;  1LJ9 A;  1XGN A;  1HW1 A;  5BPD A;  3I4P A;  3WTW C;  1XGO A;  4U0V A;  4DQ2 A;  3E97 A;  3P9K A;  2BBY A;  1B4A A;  1S29 A;  3P9C A;  2FU4 A;  4IF4 A;  3FZV A;  3F21 A;  3FMR A;  3IWF A;  4KT5 C;  2E7W A;  5ICE A;  3NEU A;  2LF7 A;  3CUO A;  3DV8 A;  3P7N A;  4KFC A;  5E8G A;  3K69 A;  4AIH A;  4ON0 A;  3JSO A;  5LGN A;  2UXX A;  3JSP A;  1FNN A;  2GA2 A;  1WRJ A;  2A61 A;  3I59 B;  3QAH A;  4RAY A;  3ZN0 A;  2BV6 A;  2IPQ X;  2OU2 A;  1MDM A;  3MAJ A;  4YFX F;  1CF7 B;  5CVR A;  1T0F A;  1LEB A;  2R7D A;  2OQR A;  3DXJ F;  1C0W A;  1RIO H;  3DPL C;  1BI1 A;  1IN6 A;  3C18 A;  4I0B A;  3I64 A;  2GAU A;  2FA5 A;  1JHC A;  4XSZ F;  3RPQ A;  1Y0U A;  1K78 B;  3KP7 A;  3KCC A;  3DFG A;  4HX8 A;  4A0Z A;  3R61 A;  5K1Y A;  1YTY A;  4ZYH A;  4YIF A;  2VOO A;  4ZYG A;  1U5T A;  3ZN1 A;  2V9V A;  4O5V A;  1HBX G;  5CYV A;  1G3Y A;  1IW7 F;  1B59 A;  5ICG A;  2VT2 A;  2XAH A;  1B6A A;  3F8B A;  1AWC A;  4P9F A;  3R4K A;  4RGR A;  1LQ1 A;  2UXN A;  1FSE A;  3CDH A;  4UHT A;  2FBH A;  2AS5 F;  1S3J A;  1XDU A;  2M45 A;  1KCA A;  1KU3 A;  2EFP A;  3CLO A;  2JT1 A;  5H6R A;  1YLF A;  1PP8 F;  3WTY C;  1IXC A;  4L9N A;  2R7F A;  3L9F A;  3COA C;  2CW0 F;  3FM5 A;  2QQA A;  5F6F A;  3G3Z A;  3PQJ A;  1U78 A;  2HO0 A;  2KIF A;  4Q5S F;  3R6S A;  4KIF A;  4RGU A;  1JHH A;  3CJN A;  3KEO A;  3RTR A;  1I1G A;  2VBZ A;  2K02 A;  1ZRE A;  1ZRD A;  1O7F A;  3KP6 A;  3FX3 A;  1JXS A;  2DK8 A;  1G6N A;  2GXG A;  2NAZ A;  3TO7 A;  1LDD A;  1FT9 A;  5FFX A;  3T1B A;  1ZG1 A;  2RQP A;  1G3W A;  2QEN A;  5K5O A;  2QBY A;  4L0Y B;  2FRH A;  3VOD A;  1WKM A;  3QP5 A;  2IRF G;  4ENK A;  1FPQ A;  1E2X A;  1GVJ A;  1Q1H A;  5J8F A;  4Y13 A;  4N0B A;  5FGM A;  3V8K A;  1FZP B;  2HR3 A;  2YX4 A;  4EM1 A;  4RB2 C;  2G7U A;  4ESJ A;  4EJT A;  2CSO A;  2XAQ A;  4A0Y A;  4CIC A;  1AY9 A;  2EFN A;  4BHB A;  3GFM A;  2QZ8 A;  1P92 A;  2RGV A;  4MHG A;  1MJA A;  4EJV A;  3HSR A;  3KLO A;  2MA3 A;  1H9T A;  4WX9 A;  2A6H F;  2XAS A;  2E1C A;  1XSX A;  1D3Y A;  4OIO F;  5D8L B;  1KYW A;  1O3S A;  3M8F A;  3I5U A;  1OKR A;  4UVA A;  3HHG A;  3O3K A;  2YX7 A;  5HLI A;  3BWG A;  2P7V B;  2VC1 A;  4NB5 A;  5L3G A;  2OA4 A;  2QWW A;  1G3S A;  4P9U A;  2QUF A;  3D0S A;  4Z2Y A;  3JTH A;  3T0Y A;  3ELK A;  2PBI A;  3WTS C;  3O6B B;  3QU3 A;  2XAF A;  1IN7 A;  3P9I A;  5D5V B;  1I6X A;  3L7W A;  1I4V A;  1SFU A;  5D4S A;  2RC4 A;  2ZJ2 A;  2FOK A;  1S7O A;  4LFU A;  2HKX A;  3KLN A;  5HDN A;  2GA1 A;  2W85 A;  1QBJ A;  3KET A;  3WGG A;  2IW5 A;  3GZ5 A;  2VBW A;  3BY6 A;  2HYG D;  5A2Q Z;  4OIP F;  3WGH A;  5HOO A;  2X0L A;  2Z99 A;  5A2Q K;  3Q5F A;  2VN2 A;  1ZRF A;  1IRG A;  1PDN C;  3KE2 A;  1QZZ A;  1SMY F;  4A0X A;  5DD8 A;  2M87 A;  1UST A;  1F1Z A;  2BEO A;  2CQK A;  4UUV A;  4OIR F;  1UHW A;  2D2W A;  3AAF A;  3H3Z A;  5DUK A;  2A07 F;  4ZH4 F;  2V1U A;  5BOX A;  2FF4 A;  5D5U B;  1O3Q A;  1S8N A;  4G9Y A;  1WI9 A;  2ZBK A;  2YU3 A;  3MCZ A;  2KIM A;  2STW A;  4HYE A;  2F2E A;  1Z9C A;  2BE5 F;  3QRF F;  3RKX A;  3ZPL A;  5F64 A;  4GXO A;  3MWM A;  3V7S A;  1DPU A;  2D1H A;  1QQI A;  5CVU A;  2VOP A;  2O6G E;  3KFW X;  4AD9 A;  1X3U A;  1ON1 A;  4WK8 F;  3MZY A;  5J8C A;  3S2W A;  5D4R A;  3U9G A;  3BDN A;  5K5R A;  3M8E A;  3RIR A;  4M6Y A;  2P5K A;  2HZT A;  4EJW A;  3REO A;  2VON A;  3H92 A;  4FX0 A;  2OZU A;  2K4J A;  4RB1 A;  4EGY A;  4K8W A;  4I01 A;  2FQ3 A;  1OYI A;  2FXA A;  1BI3 A;  5BPI A;  2DO7 A;  2EFQ A;  2ZME A;  3MEX A;  5LHH A;  1KYZ A;  2DBB A;  2HQN A;  5LRR A;  1FWZ A;  3R0J A;  3WTX C;  2FMY A;  3PFI A;  2Z3Y A;  4LB6 B;  3E6M A;  5D6E A;  1MJB A;  2ESH A;  1IF1 A;  3F8F A;  4ZYD A;  4YII A;  2DTR A;  2HWV A;  2COM A;  3IRQ A;  5HLH A;  4XRF A;  4KIC A;  5LHI A;  3K1P A;  1U5T C;  4EMS A;  2KJC A;  4EJU A;  2XAJ A;  4LJZ F;  1HKS A;  5H20 A;  2FNP A;  1K79 A;  1R36 A;  4U0W A;  1ULY A;  2H6C A;  2CGP A;  1FP2 A;  3ZMV A;  1H9G A;  4YFN F;  4Q4Z F;  1FBQ A;  4PZJ A;  4A6E A;  1R00 A;  4IVN A;  1I5Z A;  1BOA A;  4CGZ A;  4P96 A;  4JQF A;  2NS0 A;  2PLY A;  1HW5 A;  1RNL A;  1FYK A;  4MTE A;  4B09 A;  4WF2 A;  3WOD F;  1FY7 A;  4WWC A;  1BN5 A;  4G6Q A;  1P4X A;  3RYP A;  2IVM A;  3F6V A;  2CFX A;  3E5U A;  2QYO A;  4EM0 B;  1S6L A;  4M72 A;  3IHU A;  1D8K A;  2KJB A;  1YIO A;  5EEG A;  5TJJ A;  1DPR A;  5FFZ A;  3J7A O;  1I27 A;  1LNW A;  4I09 A;  4WXC A;  3IIQ A;  2PMH A;  2ZNZ A;  4MEY F;  2V6C A;  4ZYE A;  2ZNY A;  4N9H A;  5JHU A;  1MGT A;  2O61 A;  2ETH A;  2P6S A;  1J75 A;  1U2W A;  1SAX A;  2Y48 A;  4BQA A;  1D5V A;  5LEK A;  3HOT A;  3V8L A;  2ZCW A;  3ABT A;  4FX4 A;  3KP4 A;  4GYG A;  3BP8 A;  1Z7U A;  3LFK A;  5DCM B;  3QOP A;  3GW2 A;  2RN7 A;  3RJP A;  4ESB A;  1ZAO A;  3WU0 A;  5E18 F;  4O3M A;  1KGS A;  2ZME B;  5FD6 A;  4ESF A;  1ZGJ A;  1WQ2 A;  2GXB A;  3E6B A;  4U88 A;  4ZZL A;  1HST A;  3K0L A;  3DQV C;  2HYF A;  2KKO A;  3N97 A;  3EYY A;  5DEQ A;  1TLH B;  2W24 A;  1OMI A;  5AIP A;  3NRV A;  2FBI A;  2F5F A;  4RGX A;  1KQ0 A;  2MD5 A;  2XAG A;  3J81 Z;  5J6X A;  2R3S A;  4PDK A;  3V7C A;  1XB4 A;  3J81 K;  2CO5 A;  2CYY A;  5L3C A;  3B02 A;  2DPD A;  2H09 A;  2EJR A;  2RV8 A;  3WE2 A;  4UV8 A;  1G4D A;  2UWM A;  3MFK A;  3MZH A;  3TDZ C;  1VTN C;  2JSC A;  3TO6 A;  1R22 A;  4XBF A;  3I54 A;  4CYD A;  1LEA A;  1KQ8 A;  2L01 A;  2O0Y A;  1U6G A;  1QZY A;  2EB7 A;  2DU9 A;  1W7P D;  2ZFW A;  3K9T A;  1WWX A;  2ZKZ A;  1O7L A;  1O3R A;  2NRA C;  5ILU A;  3LA3 A;  3F6O A;  4GCV A;  2J5O A;  3GXO A;  3RYR A;  5D5W B;  2ESN A;  4CO8 A;  1YS7 A;  3LAJ A;  3FXR A;  4D0P A;  1USS A;  1EH8 A;  2HTS A;  4FT8 A;  2YPR A;  3CUQ A;  5ERI A;  1RUN A;  3ECH A;  3GFI A;  1IN8 A;  1BJA A;  1W7P A;  3KP5 A;  4KIB A;  4B8X A;  3ISP A;  4HQM A;  3GUD A;  2M1B A;  3KP2 A;  5FLX Z;  4LD5 A;  4NQW A;  1ODD A;  4MNU A;  1UHM A;  2EV6 A;  2XIG A;  5FLX K;  5FD5 A;  4I02 A;  4H0E A;  1YW7 A;  2WC2 A;  1XSV A;  2VBX A;  5EEH A;  4S05 A;  1UMU A;  5DYM A;  1JGS A;  3WTZ A;  2P6T A;  4OU0 A;  1GHC A;  2K86 A;  4L5J A;  5F1R A;  1MDM B;  1BM9 A;  5CVJ A;  3HRT A;  2L4A A;  4LK1 F;  1R1U A;  2W84 A;  2HOE A;  3I53 A;  4TV7 A;  1T38 A;  1T39 A;  2XRO A;  5AIQ A;  1YFH A;  2A68 F;  3L00 A;  4GO1 A;  2FBK A;  2L4M A;  3F8C A;  4L9T A;  1IXR C;  1R7J A;  4HF1 A;  3E6D A;  1YO5 C;  4LG0 A;  4LB5 A;  4KDP A;  2EV0 A;  2FML A;  3GEZ A;  3V7R A;  1U5T B;  3GVA A;  4BHP A;  4IRH A;  3K2Z A;  4L9J A;  5DDG A;  1GXQ A;  3HYI A;  3H3U A;  5FO5 A;  3ZMT A;  1YW8 A;  3WTV C;  1R1T A;  4Y17 A;  2EA2 A;  2QQB A;  2B0L A;  3FMQ A;  4EGZ A;  1STZ A;  2H27 A;  2F5E A;  3JW4 A;  3GZ6 A;  3JTG A;  1Z91 A;  3E5X A;  4AIJ A;  3ZMD A;  1FYM A;  3SFZ A;  2P5L C;  1QO0 D;  1S7A A;  3W6K B;  1DP7 P;  2K7L A;  4IXA A;  2FJR A;  2PG4 A;  2HEO A;  5KK1 A;  1SMT A;  2KRF A;  1KQ9 A;  3U2R A;  1BC8 C;  3GLX A;  4QWQ A;  3FHZ A;  3E6C C;  2MLG A;  2HTJ A;  5JVT A;  2OBP A;  4LK0 F;  2A3S A;  3VOE A;  4DNC A;  3IC7 A;  4HDV A;  2ELH A;  1YS6 A;  4BXU A;  3BZ6 A;  3ECO A;  4CHU A;  1Z6T A;  5L3E A;  1PUE E;  4G6D A;  3CUQ B;  3FF5 A;  5CJ9 A;  2LKP A;  2FEZ A;  3VEP A;  1NHA A;  3ZQ7 A; 
#chains in the Genus database with same CATH topology
 4JK1 X;  3L2W A;  3IL2 A;  2VE9 A;  1B9N A;  2QBY B;  3MKY B;  1SVL A;  3RCO A;  3W2V A;  3WHC A;  2WAQ A;  1W7P B;  2IGN A;  3LOC A;  3OYB A;  3TBI A;  2P7C B;  2DJN A;  3A1Y A;  2DI3 A;  3LA2 A;  2XGX A;  3HJE A;  4IOC F;  1ZG5 A;  4HG2 A;  4F7Z A;  4LGW A;  2G9W A;  3K1M A;  3ZMZ A;  4I0A A;  3DBR B;  1GUU A;  4QTR A;  5BMZ A;  4UVB A;  4HNT A;  4IZZ A;  2R7R A;  1ZAR A;  2OCE A;  2VKE A;  1A6Q A;  3A01 A;  2ICW G;  4HX7 A;  5FKN A;  4KIS A;  4M6X A;  2P5V A;  1BIA A;  4QSH A;  3RKQ A;  4OMZ A;  4MO7 A;  1P6R A;  2KDZ A;  3GLL A;  2QQ9 A;  3OV8 A;  5IP7 J;  2KFD A;  3VB2 A;  1HKQ A;  3CDI A;  4I7H A;  2HOS A;  1W36 D;  2Z5U A;  3F23 A;  3NWT A;  4H4K C;  2DDA A;  3KZY A;  3RKY A;  1F36 A;  4MQ9 F;  3ERM A;  3X2Q H;  3EUH A;  4AWX B;  3DEU A;  1E0E A;  2W57 A;  1FC3 A;  4M73 A;  5AON A;  4R8H A;  5DD4 A;  3BG3 A;  3N05 A;  2LTP A;  3GTO J;  3QP6 A;  3CO6 C;  1F9N A;  5B1A H;  1Y8Q B;  3VYU B;  1FP1 D;  1HW2 A;  2WAF A;  3ML6 A;  2Q8K A;  4XLH A;  2BY2 A;  1TW3 A;  2PMZ A;  2RKH A;  3BPX A;  3LAP A;  3JRI A;  1XCB A;  4HBL A;  5LBQ A;  2IA1 A;  1KU7 A;  4Y3O A;  2QF7 A;  2IT0 A;  1W5S A;  2XAU A;  3GCM A;  1N77 A;  1ORK A;  4HZF A;  4RA2 A;  2IAI A;  4U0Y A;  3BZC A;  2OD5 A;  2D45 A;  2BYV E;  4S04 A;  4IHW A;  5D6F A;  4NHJ A;  4A5N A;  2GQQ A;  2YU9 J;  4KMF A;  1V5G A;  2V26 A;  1IN5 A;  2MH9 A;  1N75 A;  3UNG C;  1D1C A;  1YRN A;  1PP7 U;  5IOY A;  5HOD A;  3HOW J;  1F4K A;  1Q1V A;  2K3P A;  4O6J A;  4L18 B;  2LK2 A;  4HAM A;  2CV2 A;  2BXY A;  4BJT A;  2L02 A;  2P81 A;  4HA8 A;  4FAS D;  2X6W A;  3TMO A;  1JHE A;  4G8X A;  1NTC A;  2XF7 A;  3CC4 I;  1MSF C;  2QCO A;  3ASN H;  4BHC A;  4J00 A;  1KN9 A;  1LFU P;  3A2K A;  2LY1 A;  2ME0 A;  1KU2 A;  1MH3 A;  1JKQ C;  1GXP A;  2XHK A;  3MZ8 A;  2HS5 A;  4P55 A;  4BQQ A;  2MBF A;  1HCR A;  2CRG A;  4NC7 A;  4IHX A;  2GXA A;  1JKP C;  2JTV A;  3SXY A;  4NV4 A;  3A0B C;  1VQM I;  1BW5 A;  1I1S A;  2Q0O A;  2XGD A;  4PSW A;  4U7D A;  3IAM 2;  1T2K A;  1R5G A;  3T5X A;  2IGM A;  2DMT A;  3IH4 A;  3CTA A;  1AU7 A;  3JAM K;  3ERE D;  1PUF B;  3HKZ N;  3WGI A;  2KMU A;  2PMU A;  2R7U A;  3HRS A;  1UFM A;  1P4A A;  2X6X A;  5F08 A;  4IQ4 A;  3LNQ A;  3V4G A;  5C44 J;  2XPW A;  5HS7 A;  1SAN A;  1BC7 C;  2PN6 A;  5E8I A;  4XLA A;  1T56 A;  2PMZ N;  3TED A;  3AL0 C;  4M3B A;  4UUS A;  4CZC A;  1X3Z B;  3S3N A;  1D8J A;  4NC8 A;  1XSD A;  3PIP F;  2VE8 A;  2WV1 A;  4AVP A;  3FWE A;  2HDD A;  3CCJ I;  3BPV A;  1ETO A;  2QA4 I;  1IAW A;  4Q47 A;  2HDW A;  3DTI A;  3S8P A;  2L54 A;  3RQ4 A;  1WJC A;  2CUE A;  2L0K A;  1WSU A;  1SD6 A;  2R5Z B;  2CJJ A;  4BQN A;  2XVC A;  3CJT B;  2E34 A;  2IBD A;  3NQO A;  2K9S A;  1UAA A;  3GFL A;  2M7A A;  2OUM A;  3S15 J;  3O2P E;  2GIZ A;  3FXQ A;  2XC7 A;  3LST A;  1P4W A;  1K61 A;  4L0Z B;  3TDU C;  1TBX A;  2A69 F;  4XRS G;  1Z77 A;  2AHQ A;  1ZRC A;  2VL8 A;  2DLL A;  1RKW A;  2WBM A;  1FSH A;  2MH2 A;  2TCT A;  3BRO A;  5KCM A;  3AG2 H;  3L2Q A;  3M9A A;  1Z05 A;  2WWY A;  4RS8 A;  4OMY A;  3JR9 A;  4FIS A;  2DAO A;  1WZ2 A;  2RVC A;  3ZQH A;  4BH9 A;  2NYX A;  3Q9S A;  1TWF J;  1TQP A;  1ZGA A;  3BG5 A;  4IHS A;  1I6H J;  3I3L A;  1XMK A;  2EFW A;  4GYI A;  4MGR A;  3FXK A;  3M3Y J;  1UG0 A;  2R7T A;  4OAZ A;  3DKW A;  4ZC3 A;  4E7Z A;  1L3L A;  3FIS A;  1OR7 A;  3JCU C;  3G4S I;  5HLG A;  2X51 A;  2DT7 B;  2I5U A;  2D1V A;  4N31 A;  2A5W A;  2CWE A;  2V79 A;  4XMY A;  2WV0 A;  1VQ5 I;  5HS9 A;  3EET A;  2K9Q A;  4PGH A;  3CUQ C;  2IS6 A;  3G2B A;  1W5C C;  2ACJ A;  4BAY A;  2E60 A;  2JPB A;  3CP2 A;  4GGG A;  1HLV A;  4KYW A;  5C4X J;  4MEX F;  5FRO A;  2E5Z A;  3PJR A;  3SQN A;  2J5P A;  4XN3 A;  2X4H A;  4ETS A;  5H2F C;  4XKW A;  3KZZ A;  3E7L A;  5ILS A;  4B3A A;  4QPO A;  2R93 J;  4EM2 A;  1ZEL A;  3W6J B;  3CO7 C;  2FX0 A;  1XPX A;  1BL0 A;  3S04 A;  2K27 A;  4NNJ A;  4UNO A;  5LGU A;  4R79 A;  4A3F J;  1VQL I;  1N78 A;  5KAI C;  3LQQ A;  2CV1 A;  1ZHF A;  5J1U A;  2JSP A;  1EH7 A;  1TWH J;  4M3F A;  3QPS A;  1J0R A;  2BXZ A;  4L9V A;  1F39 A;  1V5F A;  3KP3 A;  1FBU A;  3H36 A;  4A93 J;  2WA0 A;  2JQ7 A;  4UXN A;  2JRM A;  3DKY A;  2OAZ A;  1LKX A;  5DV5 A;  4YFK F;  5LHG A;  4A3G J;  5LEJ A;  5GPC A;  1JE8 A;  1VQ4 I;  2RNJ A;  5K5Q A;  2KZV A;  4G94 A;  1ERD A;  1J59 A;  2ZXJ A;  1VQP I;  2GBY A;  3OYF A;  3OYA A;  2ZSH B;  4E70 A;  5FRM A;  2E7X A;  1VI0 A;  1R5I D;  5CVV A;  4HEA 2;  1RI7 A;  5E1Z B;  1NG7 A;  4ZZD A;  3VSK A;  5GPA A;  1HKT A;  1S72 I;  5EZG A;  4Y7N J;  1YRN B;  2V1D A;  3DP7 A;  2ZFU A;  3I58 A;  4ENN A;  2E2I J;  4FE7 A;  3HSE A;  1YQA A;  2BHZ A;  2VT3 A;  1EH6 A;  1HA8 A;  4UUT A;  1WI3 A;  2NNY A;  1DDN A;  3ABK H;  1U0J A;  3ZCO A;  2DA7 A;  2P4W A;  5JVG F;  2V6E A;  1UG2 A;  2TDX A;  3HOS A;  4LLN A;  2LMD A;  4BEH A;  3KEY A;  4J01 A;  1H8A C;  5TRD A;  3F8N A;  1R23 A;  5IOZ A;  2X48 A;  2OF7 A;  4A5M A;  4M6V A;  3BOQ A;  4P5O A;  2FUG 2;  3H5A A;  1A35 A;  1YG2 A;  2DFH A;  3K6G A;  1ZLK A;  3OYI A;  2BGC A;  2VC0 A;  2WAD A;  3K7A J;  3VYT B;  3OYJ A;  3IWZ A;  4EQQ A;  4OAY A;  2H94 A;  5J3L A;  3RPU D;  3ABU A;  3G73 A;  1RES A;  3CCY A;  4KA4 A;  2QVO A;  3FM3 A;  2VJJ A;  3TGN A;  3T8T A;  3M8J A;  4E6K G;  1YJ9 I;  4QIW N;  5E17 F;  1BI0 A;  2Z2S B;  2EWN A;  2IJL A;  1ZN2 A;  1Z1D A;  2UUZ A;  2ZXI A;  1HSJ A;  1X58 A;  4I98 B;  3GME A;  5K7H A;  1XDS A;  4HLX A;  3OOP A;  3S14 J;  1XN7 A;  4UUS B;  4OWR B;  3MD2 A;  1LFB A;  4RB0 A;  1YW9 A;  4DBR A;  1FTZ A;  4HDU A;  1Y56 A;  3VFZ A;  1JT6 A;  3HTU A;  4CA0 A;  3BCB A;  5HVQ C;  1SC7 A;  4ENM A;  2DPU A;  3OYC A;  4X6A J;  2N8G A;  4WCG A;  3OYL A;  2ZC2 A;  2H6B A;  2ZJQ F;  2Y0M A;  2EK5 A;  4CCJ A;  5IYD J;  3OR2 C;  3EYI A;  1DQU A;  2PQ8 A;  2HGC A;  1SD7 A;  3BR2 A;  4OOI A;  1Z0X A;  2QSF X;  3QPH A;  2R92 J;  1G2H A;  5BS6 A;  2OZ6 A;  1SAU A;  3E3V A;  2FKD A;  1HDP A;  2DQR A;  3RPU A;  2KIU A;  3RZD J;  5CLS A;  1ETX A;  2EZH A;  1OLT A;  2VAS A;  3TOB A;  2DJI A;  3ROU A;  1MIJ A;  3DU5 A;  2LF8 A;  3V8J A;  4B47 A;  3WTU C;  1MNE A;  4ASN A;  2PJR B;  2R7V A;  1E3P A;  1KON A;  4N4N B;  4G12 A;  1D1B A;  4MFE A;  3SZP A;  2W00 A;  2EV5 A;  1JTY A;  2PEX A;  2W48 A;  1LDJ A;  1A5J A;  2X6O A;  4PJN A;  3QYB A;  2F5D A;  4E7J A;  4Q48 A;  3H1C A;  5B3S H;  4DBQ A;  4IRG A;  1DUX C;  2O9L A;  4ZDO A;  2PJP A;  3FXU A;  1O57 A;  2LBF A;  3M1E A;  5CVI A;  2R7X A;  4BNC A;  1LVA A;  1QGP A;  2IXS A;  2L7K A;  4RAZ A;  3K70 C;  4BJ5 C;  1UZC A;  2M30 A;  3R0A A;  4XOR A;  2VBY A;  4XID A;  5KVR A;  3HGG A;  3CJR B;  3IUO A;  3OSF A;  2JWT A;  4PK4 A;  2OTL I;  4WXH A;  4HNV A;  1LB2 A;  3FXM A;  4CCN A;  4KN7 X;  4A3M J;  2XB0 X;  1R49 A;  3HRM A;  4BKX A;  3L09 A;  2QLZ A;  5ICC A;  4LLG F;  1MBK A;  3N4M A;  5EJC A;  1ZR4 A;  3DLL F;  2E1N A;  1SFE A;  3H5N A;  4ZYA A;  1SVM A;  3JRA A;  2NNN A;  2EA4 A;  2ZJR F;  1QNT A;  3OYK A;  3OYH A;  4JBA A;  1BJZ A;  2GZW A;  1ON2 A;  4M74 A;  1AA7 A;  1A04 A;  3CMM A;  3K2A A;  2OPT A;  3AG1 H;  1XCV A;  1L0O C;  4HW0 A;  5BQT A;  1LPQ A;  1CGP A;  3ZR8 X;  3F3X A;  3QPT A;  3IAS 2;  1OPC A;  4RAF A;  2ISZ A;  1E17 A;  1K4S A;  5CKT A;  1V3F A;  1J9I A;  1JUS A;  2STT A;  2XRN A;  5D8K B;  4DZJ A;  2Q2E A;  1QHH D;  1IXS B;  2DFI A;  3FIW A;  3LSK A;  3L2C A;  4ME8 A;  4PJM A;  3ZRG A;  4E4H A;  4XLP F;  4B48 A;  2LH9 A;  3LSG A;  1XMA A;  2HVS A;  5E1W A;  1ZQ3 P;  1LFP A;  2L7M P;  5HNF A;  3F72 A;  1IV6 A;  2VOD A;  2QKM B;  4CCM A;  4HOB A;  2ZXH A;  4AYB N;  2H1L A;  4QLC U;  3L1P A;  4FCY A;  3KX2 A;  2EIL H;  4ZTJ A;  4PFP A;  3C7J A;  1VQ6 I;  3HRU A;  1WH7 A;  2W4S A;  1QZE A;  2O3F A;  5ED4 A;  1TNS A;  2L3D A;  4V2G A;  5IYB J;  1T7D A;  4BEH B;  1BI2 A;  3ULQ B;  2VXZ A;  3D5R C;  1REP C;  3JRB A;  2HZD A;  2CFO A;  1TQI A;  1SFO J;  4IHY A;  5ICF A;  1TQM A;  4F52 A;  4HX4 A;  4FTH A;  4A3D J;  2CU7 A;  1SFX A;  4Y4R A;  4OIQ F;  2DOA A;  2DOE A;  3I55 I;  3FBN B;  2HFH A;  4C30 A;  1IUY A;  3LWF A;  3IKT A;  1OYY A;  4HV5 A;  2DTZ A;  2DN0 A;  1ETW A;  1BA5 A;  1B12 A;  4G7Z F;  3EUA A;  2G7H A;  2Y30 A;  5FB2 A;  4M9S A;  3CCR I;  2A6E F;  1IGN A;  1BBY A;  2VJ4 A;  1IZ1 A;  1ZG3 A;  3A02 A;  4CCK A;  4LMY A;  2W25 A;  3FMS A;  1ZYR F;  3U1D A;  4A3B J;  1VQ7 I;  4XKV A;  3B73 A;  1TTY A;  3ZMU A;  2VPL A;  4YEL A;  3LA7 A;  1MMS A;  1IDY A;  1H0M A;  3CMY A;  3K4C A;  1P9Q C;  1ZH5 A;  1IRF A;  5FLM J;  4NDL A;  4U87 A;  1UCR A;  3HUG A;  5J40 A;  2DXI A;  4KIG A;  4A6D A;  1G3T A;  5FJ8 J;  2FD5 A;  5L3D A;  1LDK B;  1JGG A;  5E20 A;  4RMN A;  4MTD A;  4YG2 F;  4HF0 A;  1JKO C;  1MMG A;  3KEQ A;  2XV4 S;  3BJ6 A;  2BY0 A;  3U1K A;  3W3C A;  2IA0 A;  3MMY B;  2YSR A;  5F27 A;  4B4C A;  1JUP A;  2QM3 A;  3JRE A;  4A2U A;  5H6Q A;  3CZ6 A;  3TKY A;  3BC8 A;  1T98 A;  3BG9 A;  4II2 A;  4B3X A;  5IT9 Z;  5HDG A;  1S5L C;  5LLQ A;  4IL6 C;  1ZLJ A;  4IRI A;  3HOV J;  2CQQ A;  5IT9 K;  1YJN I;  5FLV A;  5IY5 H;  1BIB A;  3GF2 A;  4XN0 A;  5HS8 A;  4L5I A;  3BTJ A;  3EDP A;  5JFR A;  9ANT A;  2XKP A;  4FHT A;  3CCL I;  6PAX A;  2LDU A;  3GO5 A;  3LQR A;  4KNY A;  2DW4 A;  3ASO H;  4KUM A;  3TL4 X;  3D5L A;  4LLL A;  2K9M A;  1J5Y A;  2R7S A;  4Y52 J;  3V42 A;  4CSW A;  2DMQ A;  1Z3X A;  4Y15 A;  3DF8 A;  4WXD A;  4I2O A;  3SHF A;  2DQL A;  4D7N A;  1J7K A;  4M9Z A;  2CUF A;  3SJM A;  2OQG A;  3HTS B;  3WU1 B;  4AC0 A;  2PI0 A;  1MD0 A;  4ENJ A;  1KA8 A;  4N9I A;  3FK7 A;  1OYW A;  4IJA A;  5EYR A;  3QOE A;  2GIV A;  1MBE A;  1U8R A;  2LNB A;  3SZT A;  5IPA A;  3TW7 A;  4DYR A;  2O8X A;  1MKM A;  4NQW B;  1HC8 A;  3F22 A;  2DK5 A;  5HDK A;  4RLQ A;  2HXI A;  4MQV A;  4D5C A;  2GWR A;  3G1O A;  5LD2 C;  3QU6 A;  3I4M J;  1UHS A;  1X2M A;  2FQ4 A;  4HF2 A;  1VQO I;  5J47 A;  3OS0 A;  2JA5 J;  3CC7 I;  3K10 A;  5DCF A;  3FXJ A;  4KN4 X;  3F8M A;  2HKO A;  4CDG A;  1B1B A;  2JRT A;  2UZK A;  1V4R A;  3OS2 A;  2HOA A;  5JLW A;  4BXX J;  2Q2E B;  3S1Q J;  1Z6R A;  5D5X B;  1SD4 A;  2MLK A;  4XLN F;  1IJW C;  3J80 Z;  3HOY J;  5L3F A;  3IRR A;  1U3E M;  2DT5 A;  5GAG J;  2E2H J;  2JZY A;  2PFB A;  4BS9 A;  4K2E A;  1FBS A;  1W5T A;  3J80 K;  2KL4 A;  4CYC A;  2M5W A;  5E3M A;  1P2F A;  4I6Z A;  4EJO A;  1OCT C;  4DYQ A;  5DUI A;  3WU2 C;  5EZH A;  1P7J A;  2ME6 A;  2Z33 A;  4HV6 A;  4IHT A;  5JI6 A;  3I4N J;  5F0F A;  1T6S A;  3DPT A;  3BQY A;  1FOX A;  1TNT A;  3PQK A;  2MC3 A;  3ABM H;  3PUB A;  3BR0 A;  5DTD A;  3PO3 J;  1AOY A;  1PYV A;  2IS2 A;  1RR7 A;  4PCQ A;  2EIN H;  4A69 C;  5M5Y J;  4LG3 A;  1K7A A;  1WJB A;  2DOF A;  2DT6 A;  4DYC A;  3VSL A;  4E7H A;  1FOK A;  2YUS A;  1QVT A;  3GTP J;  3M1C A;  1W4M A;  3G1L A;  2HDC A;  3HHH A;  1OCC H;  4UY8 I;  1FTT A;  2HNF A;  4LG0 B;  3HOZ J;  1SD5 A;  3G1M A;  2WAQ N;  1YYV A;  5ILV A;  3PIO F;  1R1V A;  1XGM A;  4E7K A;  3HIF A;  2IA2 A;  3RDI A;  1K6O A;  1VQ9 I;  4AVZ A;  4F92 B;  5J4V A;  1OJL A;  2X85 A;  2VUM J;  4HQE A;  5DCM A;  3D5S C;  3I59 A;  1MSE C;  2YR2 A;  4RM2 A;  1W1W E;  5E1X A;  1QPM A;  2F5C A;  3BJO A;  2EFO A;  3E5Q A;  2KP6 A;  4A3E J;  2CG4 A;  4A12 A;  1JI8 A;  3W6V A;  1MJ9 A;  3HSF A;  4HLY A;  5LGT A;  4IEJ A;  1HXD A;  2Y75 A;  4P1W A;  4CXF A;  3RI4 A;  1CF7 A;  3J7Y J;  2R7Z J;  3Q9V A;  2P8T A;  2CW7 A;  1S9H A;  2CUZ A;  5IT3 A;  4JYK A;  4UVC A;  4DJA A;  4D9J A;  3HB9 A;  4G7H F;  3J7A Y;  1EV7 A;  1TW2 A;  3OYN A;  2WY7 Q;  2M4G A;  2P0W A;  3Q0V A;  3T8R A;  1FIP A;  1OCR H;  1XC5 A;  2LSO A;  1RUO A;  4G7O F;  1DP3 A;  3SDG A;  1MMN A;  3KYD B;  2AXT C;  4PGG A;  3SZG A;  2EIK H;  4IPA A;  1K78 A;  3JAM Z;  3FKI J;  3Q0U A;  1Z67 A;  1FYL A;  2EIM H;  2X6Y A;  3ZP5 A;  4UV9 A;  3I71 A;  1TWA J;  3UR3 C;  2H8W A;  4GDF A;  2AXL A;  1J2X A;  2FNA A;  2R4G A;  3ZMS A;  4RB3 C;  3R60 A;  4XON A;  3B6C A;  4R1H A;  5LRS A;  2XRL A;  3GTJ J;  1D0Y A;  3C1D A;  2Z9O A;  1R58 A;  2RDP A;  3CF2 A;  2ZO4 A;  1FX7 A;  1RZ4 A;  3BDD A;  2XB5 A;  4C3I J;  3RKW A;  2K4B A;  3GYH X;  1D1A A;  4Z6Y A;  1R5H A;  2LFB A;  4KMU X;  4M9X A;  3GTL J;  2QKL B;  2EZI A;  2HQR A;  3IKV A;  2H8R A;  1FLI A;  5JR3 A;  3EQL F;  2L7F P;  1MZB A;  1ONV A;  4EAT A;  3HOU J;  3BQZ A;  1TL8 A;  4CZZ A;  2D5V A;  1VQN I;  1XD7 A;  2JPC A;  2FE3 A;  5EG0 B;  1IN4 A;  1BW6 A;  2K85 A;  4XR6 A;  3HC7 A;  2M8G X;  3I0T A;  3MQ0 A;  3TW6 A;  2FSW A;  3WTT C;  2HPI A;  1B9M A;  3BJA A;  3HZJ A;  4OIN F;  4EVI A;  1KU9 A;  2FJ1 A;  1F5T A;  2XPU A;  3C3W A;  3H0G J;  2VXD A;  2QEX I;  2XUB A;  4U7B A;  2A5Y B;  3GX4 X;  2E35 A;  2WTE A;  5F04 A;  3M7G A;  3DKX A;  1XG1 A;  1QA6 A;  1W0U A;  4ZDP A;  1O3T A;  5FKM A;  3TO9 A;  2O03 A;  2XSD C;  2CH0 A;  1YHQ I;  4BJ6 C;  2HU9 A;  3MVP A;  1UB9 A;  2V9K A;  2CQN A;  3WE3 A;  2IEK A;  1SEU A;  5FKL A;  1LE8 A;  2M8E A;  3BTC A;  4BYY A;  2C6Y A;  2NVQ J;  3S1N J;  2ADU A;  2IP2 A;  2DA4 A;  4AIK A;  3HXL A;  2XKO A;  3EPZ A;  4XSX F;  3TOA A;  3A01 B;  4II3 A;  3GFJ A;  1OQY A;  3CCS I;  5L3B A;  1P7I A;  1FOW A;  2V1X A;  1XGS A;  2WB1 A;  1HQC A;  4RGS A;  1NK2 P;  4M71 A;  1X2N A;  4EV0 A;  3WG9 A;  3BCA A;  3GWZ A;  3K1N A;  1JHF A;  2KPM A;  3DWL E;  1DU6 A;  2DFE A;  2ISY A;  3TQN A;  1LJ9 A;  2Z16 A;  1XGN A;  2KIQ A;  1HW1 A;  5BPD A;  3I4P A;  1HDD C;  2LY9 A;  3WTW C;  1XGO A;  3FK6 A;  3OS1 A;  3W2W A;  2FOW A;  4U0V A;  4AU7 A;  4DQ2 A;  2JA8 J;  2LC2 A;  4LIU A;  5GAE J;  3E97 A;  3P9K A;  4I76 A;  4C2M J;  1RET A;  2BBY A;  1B4A A;  1UEL B;  2BVM A;  1S29 A;  3P9C A;  2G0E A;  3VPR A;  5DM7 F;  5EDN A;  2FU4 A;  4IF4 A;  3FZV A;  1A36 A;  3O8G A;  3F21 A;  3FMR A;  3BT9 A;  3IWF A;  1DU0 A;  4KT5 C;  1WJD A;  2E7W A;  3CP8 A;  5ICE A;  3NEU A;  1A6I A;  2LF7 A;  3CUO A;  3DV8 A;  3P7N A;  5E8G A;  2Y2Z A;  4KFC A;  4BXF A;  1WJA A;  3BR5 A;  4LIV A;  3DTE A;  5HNH A;  3K69 A;  4HSR A;  1SFK A;  4AIH A;  1DGR M;  5KAF C;  3PSF A;  2E1M B;  4ON0 A;  2VQL A;  3H9J A;  1R6R A;  3JSO A;  5LGN A;  2UXX A;  3PNT A;  4PUS A;  3JSP A;  1FNN A;  1WFX A;  2GA2 A;  1WRJ A;  4A3L J;  2A61 A;  1TT0 A;  3I59 B;  1VND A;  1QRY A;  1U9N A;  3QAH A;  2V1N A;  2DYS H;  2Y0S A;  4F93 B;  4RAY A;  3ZN0 A;  3CD6 I;  1GVD A;  3S1M J;  5FKK A;  2BV6 A;  4PJJ A;  2QQ8 A;  2IPQ X;  3HM5 A;  2OU2 A;  1MDM A;  3MAJ A;  4YFX F;  2I8D A;  3FKJ A;  1CF7 B;  4F55 A;  5CVR A;  1T0F A;  3ZQF A;  1PJR A;  3I56 I;  2F6C A;  1Z7L A;  1LEB A;  4XLE A;  2R7D A;  2OQR A;  3DXJ F;  1C0W A;  1VZ0 A;  1RIO H;  3DPL C;  4XRS A;  3ZQI A;  1E3O C;  1BI1 A;  1OIS A;  3RQI A;  1IN6 A;  3C18 A;  4I0B A;  4BDY A;  3I64 A;  2GAU A;  1TZL A;  2RAE A;  2EPF A;  2FA5 A;  1JHC A;  4XSZ F;  3RPQ A;  1Y0U A;  1K78 B;  3F0C A;  4DW6 A;  3KP7 A;  3KCC A;  1LUJ B;  3DFG A;  4HX8 A;  3H35 A;  2VLA A;  3CCQ I;  3CCE I;  4A0Z A;  3AG4 H;  4C2T A;  3R61 A;  2JA7 J;  1YX3 A;  2K9N A;  3IP4 B;  2WAE A;  4PJ0 C;  4W1U A;  3JRC A;  5GAH J;  5K1Y A;  1YTY A;  2UV1 A;  4ZYH A;  4YIF A;  2VOO A;  4ZYG A;  1U5T A;  3ZN1 A;  1XMX A;  1IUF A;  2MG4 A;  2E19 A;  2E1O A;  2E36 A;  5JHF A;  2V9V A;  4XQF A;  4O5V A;  1HBX G;  1FIA A;  4C3J J;  5CYV A;  1ETY A;  1G3Y A;  1IW7 F;  1B59 A;  2ECB A;  5ICG A;  3ZGK A;  2Z1D A;  3OYG A;  2OC6 A;  2VT2 A;  2XAH A;  1GT0 C;  3HG9 A;  1B6A A;  1K83 J;  2KZG A;  3F8B A;  1R4N B;  3HEF A;  4Y33 A;  1AWC A;  4P9F A;  2DMN A;  4BAC A;  3R4K A;  4RGR A;  1LQ1 A;  2UXN A;  1FSE A;  3QQA A;  3CDH A;  4UHT A;  2FBH A;  1EJ9 A;  2AS5 F;  1S3J A;  1XDU A;  2GOM A;  3DBH B;  1Y1W J;  2M45 A;  2V4J C;  1KCA A;  2NOJ B;  1KU3 A;  5DS9 A;  2EFP A;  4B1R A;  1IO2 A;  3CLO A;  4IX7 A;  2NVT J;  2JT1 A;  5H6R A;  1YLF A;  1YIT I;  1PP8 F;  3WTY C;  1IXC A;  2JA6 J;  4L9N A;  2R7F A;  3L9F A;  3COA C;  2CW0 F;  2R0Q C;  3FM5 A;  2QQA A;  4IO9 F;  1WJE A;  3S93 A;  2HPM A;  2M9H A;  5F6F A;  3G3Z A;  2HXO A;  3PQJ A;  1U78 A;  2HO0 A;  2KIF A;  1T33 A;  4Q5S F;  1LE8 B;  3R6S A;  4XNF A;  4KIF A;  1R9T J;  4RGU A;  1JHH A;  5B66 C;  3PNY A;  3CJN A;  2QGU A;  3HBL A;  3KEO A;  3RTR A;  1I1G A;  2M7B A;  1VQK I;  2VBZ A;  2KT0 A;  5IP6 A;  1OCZ H;  2K02 A;  4JX4 A;  1ZRE A;  1ZRD A;  1O7F A;  3ABL H;  3KP6 A;  3FX3 A;  2LP0 A;  4NC6 A;  1JXS A;  2DK8 A;  1G6N A;  3H5R A;  4QPQ A;  4PFO A;  2GXG A;  3LL7 A;  2NAZ A;  4F3Q A;  3RZO J;  3TO7 A;  2F5V A;  4ABZ A;  1R4M B;  1LDD A;  1FT9 A;  3CDL A;  3Q3S A;  5FFX A;  2GM4 A;  3T1B A;  1ZG1 A;  1BOB A;  3RSN A;  2RQP A;  1VQ8 I;  1G3W A;  2QEN A;  2CQ7 A;  2F4O B;  5K5O A;  1TT5 B;  1YE9 A;  2QBY A;  2E2J J;  4L0Y B;  2FRH A;  3VOD A;  1WKM A;  2KLO A;  4BGD A;  5TIS C;  2HQA A;  3QP5 A;  4W97 A;  2IRF G;  4ENK A;  1FPQ A;  1E2X A;  3K4J A;  1GVJ A;  1Q1H A;  5KNL A;  5J8F A;  2V7F A;  1D0Z A;  4Y13 A;  3ZQL A;  4N0B A;  5FGM A;  3V8K A;  4PJL A;  5C4J J;  2KHM A;  4CCO A;  1FZP B;  3OL3 A;  2M3A A;  1BR1 A;  2HR3 A;  2YX4 A;  4EM1 A;  1FEX A;  4RB2 C;  2G7U A;  4ESJ A;  4EJT A;  2CSO A;  2XAQ A;  4A0Y A;  4CIC A;  1AY9 A;  2EFN A;  3EUH C;  1K6Y A;  4BHB A;  3GFM A;  3SDB A;  2QZ8 A;  2XF5 A;  1P92 A;  2RGV A;  4MHG A;  4A3C J;  3M4O J;  1MJA A;  4EJV A;  3HSR A;  1MND A;  3NWS A;  1V5E A;  3KLO A;  2MA3 A;  2JN6 A;  2B63 J;  1H9T A;  3DU6 A;  3BTL A;  4WX9 A;  2A6H F;  5JLX A;  3S3M A;  1TC3 C;  2XAS A;  5F0H A;  2E1C A;  1YX5 A;  1XSX A;  1D3Y A;  1GDT A;  4OIO F;  3BTI A;  4J19 A;  4UB6 C;  1X1D A;  5D8L B;  2CUJ A;  2HVQ A;  2CS3 A;  2R7Q A;  3DEW A;  4DIQ A;  3BR3 A;  2W82 A;  1W36 C;  1D0X A;  2E1M C;  1W0T A;  2H1K A;  1KYW A;  2XF6 A;  3M8F A;  1O3S A;  3I5U A;  1OKR A;  2CV0 A;  4UVA A;  1YJW I;  2DDB A;  3S16 J;  2A6T A;  3HHG A;  2VJI A;  3O3K A;  2VI6 A;  2YX7 A;  5HLI A;  3BWG A;  4HST A;  2P7V B;  4MFD A;  4BY7 J;  2VC1 A;  5CQG A;  4NB5 A;  2K3F A;  1GLN A;  1V55 H;  2LG4 A;  5K7F A;  2JVH A;  2MAB A;  2VIX A;  5L3G A;  3CLQ A;  1YI2 I;  2OA4 A;  2KQR A;  2QWW A;  3PUF A;  3JRG A;  1G3S A;  4P9U A;  1JKR C;  2QUF A;  2XGC A;  3D0S A;  4Z2Y A;  2VQH A;  2VQG A;  3JTH A;  3Q0W A;  4RDU A;  3T0Y A;  3OIO A;  3ELK A;  1VFC A;  1NG6 A;  2PBI A;  5LFA A;  3WTS C;  4V2F A;  5F1J A;  3A4C A;  1ITY A;  4C3H J;  4YIR X;  3O6B B;  3QU3 A;  2DCE A;  3KYL A;  2XAF A;  1NH3 A;  4LOC A;  1IN7 A;  5M3F J;  2M4K A;  3P9I A;  5D5V B;  4RLF A;  1I6X A;  1WJ5 A;  3L7W A;  1IC8 A;  3DEE A;  3BR6 A;  3K70 D;  1I4V A;  5IP9 J;  1SFU A;  3MKZ A;  5D4S A;  1M1E B;  2L2O A;  2RC4 A;  2ZJ2 A;  2F4M B;  2FOK A;  2OTJ I;  1S7O A;  4BBS J;  4LFU A;  2HKX A;  3KLN A;  2K5C A;  2I10 A;  1K4T A;  2DMU A;  1E3H A;  5HDN A;  2GA1 A;  2W85 A;  4JOM A;  3HGY A;  2V9P A;  4XLF A;  3KET A;  5CPR B;  3WGG A;  1QBJ A;  5M3M J;  2B9S A;  2IW5 A;  1I39 A;  3GZ5 A;  4DGW B;  2VBW A;  3BY6 A;  3HPG A;  2HYG D;  1Z3Y A;  5A2Q Z;  1QVU A;  4OIP F;  1G8X A;  2LBF B;  2JJ7 A;  3WGH A;  5HOO A;  2X0L A;  2MGQ A;  2Z99 A;  5A2Q K;  3Q5F A;  2VN2 A;  1ZRF A;  4N4O B;  1IRG A;  1PDN C;  3KE2 A;  2R7W A;  1QZZ A;  1SMY F;  1EF4 A;  2R5Z A;  3LSH A;  2PX9 A;  2ECC A;  4A0X A;  5DD8 A;  3K4L A;  4B43 A;  1J09 A;  2M87 A;  1UST A;  2AO9 A;  1F1Z A;  2BEO A;  5B5E C;  2CQK A;  4UUV A;  1BR4 A;  4OIR F;  1UJ8 A;  1UHW A;  2D2W A;  3AAF A;  3BG7 A;  3H3Z A;  1FOY A;  3LSI A;  5DUK A;  2A07 F;  4ZH4 F;  2V1U A;  5BOX A;  1OR7 C;  2FF4 A;  2R7O A;  5D5U B;  1O3Q A;  1S8N A;  4G9Y A;  1WI9 A;  2ZBK A;  2YU3 A;  4MLO A;  3LSR A;  2K40 A;  1MMD A;  1G59 A;  2DFF A;  3MCZ A;  1Y6I A;  3K4K A;  3P5J A;  1UMQ A;  2KIM A;  1F43 A;  2STW A;  4HYE A;  3GTM J;  1XX5 A;  4RBO A;  2F2E A;  2MC4 A;  1Z9C A;  3SFI A;  1X4O A;  4M3D A;  2BVL A;  2X9D A;  2BE5 F;  4XOP A;  3QRF F;  3G6E I;  3RKX A;  5E3L A;  3W2A A;  1JUM A;  2LR8 A;  1V54 H;  3ZPL A;  3PM1 A;  2L9N A;  3C2G A;  5F64 A;  2LOO A;  1VF9 A;  4GXO A;  2MFZ A;  3MWM A;  3V7S A;  1DPU A;  4E7S A;  2D1H A;  1QQI A;  5CVU A;  2VOP A;  3K4M A;  2O6G E;  3KFW X;  4AD9 A;  1X3U A;  1ZTR A;  4ZTF A;  1ON1 A;  4WK8 F;  3MZY A;  2ZB9 A;  5B1B H;  1MBH A;  1MBJ A;  5J8C A;  2VJ5 A;  2Y69 H;  2CW8 A;  2COB A;  3PL8 A;  3S2W A;  3WG7 H;  2RRE A;  3U9G A;  5D4R A;  5CQE A;  1JJ8 C;  3OSG A;  3BDN A;  2NOG A;  4FE4 A;  5K5R A;  3M8E A;  3RIR A;  3OOU A;  2JMW A;  4M6Y A;  3HKZ A;  2P5K A;  4NUB A;  3CC2 I;  2HZT A;  4EJW A;  2R5Y A;  2ELK A;  2KRC A;  3REO A;  3LSP A;  2ZSI B;  2VON A;  1ETK A;  3S17 J;  3BLY A;  4YRV A;  3H3V K;  3H92 A;  2IS4 A;  4FX0 A;  2OZU A;  2GOX B;  2K4J A;  4RB1 A;  4EGY A;  4K8W A;  4I01 A;  3MKW B;  1X1B A;  2ID6 A;  2O7O A;  2FQ3 A;  3KZI C;  1O4X A;  3CQZ J;  1OYI A;  2FXA A;  2NVX J;  1BI3 A;  5BPI A;  3FDY A;  2DO7 A;  3FXL A;  2EFQ A;  3OR1 C;  3D1N I;  4FQG A;  3UKG A;  3K4B A;  2ZME A;  1IRX A;  4RAG A;  3MEX A;  1U9O A;  3I9V 2;  1NK3 P;  5LHH A;  1KYZ A;  2DBB A;  2HQN A;  5LRR A;  1T0F C;  1FWZ A;  3R0J A;  4ZDL A;  1S7E A;  2DA1 A;  3WTX C;  1APL C;  2FMY A;  3PFI A;  2Z3Y A;  4LB6 B;  3E6M A;  5D6E A;  4KIT B;  1MJB A;  1YOV B;  3HUG B;  2ESH A;  3FHN A;  2L9V A;  5J1Y A;  4CUG A;  1IF1 A;  1T95 A;  1AKH A;  4AM3 A;  3H0D A;  4BE1 A;  3F8F A;  4ZYD A;  4GRI A;  4YII A;  2DTR A;  2HWV A;  2COM A;  3IRQ A;  5HLH A;  3IV5 A;  1X3W B;  4XRF A;  2BY1 A;  2MD0 A;  1CQT A;  4LIT A;  5DM6 F;  4KT6 A;  5K7Z A;  3A03 A;  4KIC A;  3G71 I;  5LHI A;  3K1P A;  1U5T C;  4EMS A;  2KJC A;  4G6T B;  4EJU A;  2XAJ A;  4E7I A;  4EEF G;  3O8H A;  1N25 A;  1HKS A;  2TRT A;  4LJZ F;  2HQ5 A;  3LFU A;  5H20 A;  5HLT A;  2FNP A;  1K79 A;  1X1A A;  4IKF A;  1R36 A;  4HPQ A;  2KDO A;  4BE0 A;  4BU2 A;  4U0W A;  1ULY A;  1GV5 A;  4M3E A;  2H6C A;  1X19 A;  2CGP A;  2GLO A;  1FP2 A;  4XRM A;  3ZMV A;  1H9G A;  4B44 A;  4YFN F;  4I99 C;  1XS9 A;  4Q4Z F;  1FBQ A;  4PZJ A;  3JRF A;  2OJE D;  2DA3 A;  2NS7 A;  5E3O A;  1MMA A;  5F0C A;  4A6E A;  2CQX A;  1R00 A;  1MNM C;  4IVN A;  5FKO A;  5J1R A;  1I5Z A;  2M0M A;  1BOA A;  4RM3 A;  4BY1 J;  3JRD A;  4CGZ A;  4P96 A;  1I3Q J;  4JQF A;  2NS0 A;  2PLY A;  1HW5 A;  1RNL A;  1FYK A;  4MTE A;  2DYR H;  2K9L A;  4B09 A;  2IGO A;  4WF2 A;  3CMA I;  4IQJ A;  3WOD F;  1FY7 A;  2YS9 A;  4WWC A;  2QSH X;  1BN5 A;  4G6Q A;  1P4X A;  5GP9 A;  3RYP A;  1H88 C;  1U8B A;  2NS8 A;  2RNG A;  3ZQG A;  2IVM A;  2Y9Y A;  3F6V A;  3OMY A;  2CFX A;  3OWT A;  4CH7 A;  5TGT A;  2DMP A;  3E5U A;  2PJR A;  1JJ6 C;  3PFY A;  2QYO A;  4ITV A;  3OYM A;  4EM0 B;  1S6L A;  4M72 A;  2IS1 A;  1QHG A;  3IHU A;  1D8K A;  3KIO A;  1YIJ I;  1X1P A;  2KJB A;  1YIO A;  5EEG A;  5TJJ A;  4IHV A;  1DPR A;  5FFZ A;  3J7A O;  3L2R A;  1I27 A;  2L9S A;  4F91 B;  2BOL A;  2QSG X;  3HDD A;  1LNW A;  4I09 A;  3DBL B;  4MIM A;  5FRN A;  4WXC A;  1RR8 C;  4XK4 A;  3IIQ A;  4CYC B;  3FXO A;  1MW7 A;  1RC9 A;  2EH3 A;  2PMH A;  4XIC A;  2LKX A;  2ZNZ A;  4MEY F;  2V6C A;  2HI3 A;  4ZYE A;  2HVR A;  1HOM A;  2A05 A;  2ZNY A;  4DOZ A;  4L5E A;  1B8I A;  3PO2 J;  3DCF A;  5E79 C;  4X1E A;  4A3J J;  4N9H A;  3AFH A;  5GAD J;  5JHU A;  1MGT A;  2O61 A;  1WVR A;  2ETH A;  2JA2 A;  4IOA F;  2LLK A;  4XM3 A;  2P6S A;  3IH3 A;  4JX6 A;  1ZK8 A;  1J75 A;  2ID3 A;  2VKH A;  2HNH A;  4JX5 A;  1U2W A;  1ETV A;  1SAX A;  4XKB A;  2Y48 A;  4BQA A;  1FMW A;  3TP3 A;  2R5Y B;  1RKT A;  2BW3 A;  1D5V A;  2L7Z A;  2M2E A;  5LEK A;  3HOT A;  3GTQ J;  3V8L A;  1JTX A;  4E7L A;  2M0C A;  3C2B A;  2ZCW A;  3ABT A;  3L2U A;  2B7E A;  4FX4 A;  3KP4 A;  4GYG A;  2NXN B;  1Z7U A;  3BP8 A;  3LFK A;  5DCM B;  3S3O A;  2LD5 A;  2VPR A;  3QOP A;  3GW2 A;  3DPU A;  3VYS B;  5J4Y A;  1ZR2 A;  2RN7 A;  3RJP A;  3LMM A;  4ESB A;  2HOT A;  2VB6 A;  1ZAO A;  2L9R A;  3WU0 A;  5E18 F;  4O3M A;  3VYR B;  1KGS A;  2ZME B;  2M34 A;  5FD6 A;  4ESF A;  1ZGJ A;  3LSM A;  1HF0 A;  1WQ2 A;  2WB1 N;  2GXB A;  3E6B A;  2IGK A;  4U88 A;  4ZZL A;  1HST A;  2LKS A;  4AID A;  3OY9 A;  3K0L A;  1MH4 A;  1EKE A;  2XPV A;  4BE2 A;  3DQV C;  2HYF A;  2KKO A;  3ZQQ A;  2O8K A;  3N97 A;  4D5F A;  3EYY A;  5DEQ A;  1TLH B;  2W24 A;  2JVG A;  2VQC A;  1MBG A;  3AKZ A;  1OMI A;  5AIP A;  2BHY A;  2LY2 A;  1AKH B;  1Y1V J;  2DOD A;  3NRV A;  2JUC A;  1I3A A;  2FBI A;  3CME I;  2F5F A;  1BR2 A;  2MSY A;  1Y8R B;  3LSJ A;  2BY3 A;  3CJQ B;  4RGX A;  2JUG A;  1RRJ A;  1QPI A;  5IYC J;  3OL4 A;  2BZT A;  1DGW Y;  1KQ0 A;  2EQR A;  2MD5 A;  2XAG A;  3BR1 A;  3PSI A;  2EBI A;  3NAR A;  3J81 Z;  5J6X A;  4JP0 A;  2LRD A;  3KYC B;  2R3S A;  4PDK A;  3V7C A;  1XB4 A;  4CCL A;  1IG7 A;  1IDZ A;  4XOT A;  3J81 K;  2CO5 A;  2CYY A;  1LVK A;  1ETQ A;  5L3C A;  3B02 A;  2DPD A;  2H09 A;  4HNU A;  2EJR A;  3OIQ A;  2RV8 A;  3WE2 A;  4UV8 A;  2XDV A;  1G4D A;  2UWM A;  3MFK A;  2E5N A;  1TWC J;  3L2V A;  1ZKG A;  4D1Q A;  3MZH A;  1ZGW A;  3K4N A;  5E3N A;  4ZJZ A;  3TDZ C;  1VTN C;  2NVY J;  2Y31 A;  1PVE A;  2JSC A;  3TO6 A;  3CF5 F;  5GTI C;  1R22 A;  2Y0S N;  4V19 K;  1TWG J;  2ZJP F;  3SEQ A;  4XBF A;  3I54 A;  1B72 A;  4CYD A;  1LEA A;  3HPH A;  1KQ8 A;  3CCM I;  1EA3 A;  1WPK A;  2L01 A;  1T08 B;  2O0Y A;  3H9Q A;  1U6G A;  2F4I A;  3WHB A;  2W7N A;  4S0H B;  4FET A;  1QZY A;  5EGO A;  2EB7 A;  3GZN B;  1FMV A;  4UB8 C;  2DU9 A;  3J7Z I;  1W7P D;  2ZFW A;  4HRI A;  3K9T A;  2X1E A;  3HL2 A;  1WWX A;  2JK3 A;  2O5R A;  2Y9Z A;  2ZKZ A;  3SYT A;  1O7L A;  1A31 A;  1O3R A;  4BDZ A;  2NRA C;  5ILU A;  3LA3 A;  2VKV A;  3OYE A;  3F6O A;  1WH5 A;  2J5O A;  3GXO A;  4GCV A;  1KZH A;  3RYR A;  5D5W B;  3H9G A;  3PNV A;  2CMP A;  2ESN A;  4AYB A;  4CO8 A;  1YS7 A;  3ESW B;  3LAJ A;  1WHU A;  1TP4 A;  3FXR A;  1X4P A;  1USS A;  4D0P A;  1WGX A;  1EH8 A;  2HTS A;  4FT8 A;  2YPR A;  3CUQ A;  5ERI A;  5EEA A;  1RUN A;  2RQQ A;  1IRZ A;  3E0J B;  3C2H A;  1RPW A;  3ECH A;  3GFI A;  1FJL A;  3QPL A;  1IN8 A;  1BJA A;  1W7P A;  3S2D J;  3U21 A;  1B8I B;  3KP5 A;  2MYS A;  4KIB A;  4B8X A;  5KHD A;  2ELJ A;  3ISP A;  1IV8 A;  5M5X J;  4HQM A;  3ZOB A;  3GUD A;  2M1B A;  3KP2 A;  3QYE A;  5FLX Z;  4LD5 A;  4NQW A;  1ODD A;  3ZXS A;  4MNU A;  1I50 J;  2HYJ A;  4PSX A;  1UHM A;  2EV6 A;  3CCU I;  2XIG A;  5FLX K;  2BW3 B;  5FD5 A;  4BL0 B;  4I02 A;  3DTK A;  3S2H J;  4H0E A;  1YW7 A;  2WC2 A;  2E71 A;  1XSV A;  4YEJ A;  2VKD A;  2VBX A;  5EEH A;  3TP0 A;  4S05 A;  2OV7 A;  1UMU A;  5DYM A;  1MBF A;  3IH2 A;  1JGS A;  2EZK A;  3WTZ A;  4A3K J;  2P6T A;  4OU0 A;  1GHC A;  3SEZ A;  3S1R J;  2K86 A;  2ZXW H;  4L5J A;  5F1R A;  1Y0N A;  1MDM B;  1BM9 A;  4D7M A;  5CVJ A;  2MW8 A;  3HRT A;  3NAU A;  2L4A A;  3BZK A;  4LK1 F;  1R1U A;  2AQF A;  2W84 A;  2HOE A;  2LRE A;  3I53 A;  4TV7 A;  1T38 A;  1T39 A;  1OCO H;  4NBQ A;  2XRO A;  4AUX A;  3ONQ A;  4C2U A;  3E1S A;  5AIQ A;  1YFH A;  2Q1Z B;  3DLA A;  4ANJ A;  3GBG A;  1JT0 A;  2A68 F;  1WJF A;  3L00 A;  4GO1 A;  2FBK A;  2L4M A;  2AQE A;  3F8C A;  4L9T A;  4GFB A;  3EUK L;  1QU3 A;  4BUP A;  1IXR C;  3S32 A;  4XLC A;  1R7J A;  3VDX A;  2DA2 A;  2KRH A;  4HF1 A;  4DZP A;  3E6D A;  1YO5 C;  4LG0 A;  4LB5 A;  4KDP A;  1D5Y A;  2EV0 A;  1POG A;  2EZL A;  5BNG A;  3AG3 H;  2FML A;  3GEZ A;  3V7R A;  1OFC X;  4BBR J;  1U5T B;  3B6A A;  3GVA A;  2NVU B;  4BHP A;  2ZME C;  4IRH A;  3K2Z A;  4L9J A;  5DDG A;  1GXQ A;  2LYC A;  2W1O A;  3HYI A;  3H3U A;  5EF6 A;  5FO5 A;  2EIJ H;  1YW8 A;  3ZMT A;  3WTV C;  5C3E J;  2DA5 A;  1H89 C;  1R1T A;  4Y17 A;  2EA2 A;  1X1C A;  2QQB A;  2B0L A;  3FMQ A;  4EGZ A;  3AL0 B;  4M3G A;  1STZ A;  2H27 A;  2F5E A;  3HOX J;  3JW4 A;  3FBI B;  4XKC A;  2KIS A;  1SVO A;  3GZ6 A;  3JTG A;  1Z91 A;  3MN2 A;  4XL9 A;  3E5X A;  3OIP A;  2L5Q A;  2XSJ C;  4AIJ A;  3QOD A;  3A0H C;  3ZMD A;  2OCC H;  1FYM A;  1ENH A;  1OCP A;  3SFZ A;  2F48 A;  2P5L C;  1Z21 A;  1QO0 D;  1B72 B;  1S7A A;  3ZQC A;  3JRH A;  3W6K B;  1DP7 P;  3GTK J;  1AHD P;  4BQO A;  2K7L A;  4IXA A;  5EGO B;  1PUF A;  2FJR A;  2PG4 A;  3M07 A;  3VWB A;  5M5W J;  1ACI A;  5GTH C;  2HEO A;  5KK1 A;  4X0G A;  1SMT A;  2KRF A;  1KQ9 A;  3U2R A;  2DA6 A;  2X1D A;  3GTG J;  1BC8 C;  3F9K A;  3GLX A;  4QWQ A;  3FHZ A;  3QWL A;  3E6C C;  1T8I A;  2MLG A;  2HTJ A;  5JVT A;  2WY8 Q;  2OBP A;  2X1C A;  4LK0 F;  3QYF A;  2A3S A;  3VOE A;  1XTA A;  4DNC A;  3MKL A;  3IC7 A;  3BG6 A;  4HDV A;  3CCV I;  1Y39 A;  2ELH A;  1YS6 A;  4BXU A;  3BZ6 A;  3CES A;  3ECO A;  4CHU A;  1Z6T A;  5L3E A;  1PUE E;  5EG0 A;  4G6D A;  3KPH A;  3CUQ B;  3FF5 A;  5CJ9 A;  1GV2 A;  2LKP A;  1R71 A;  2FEZ A;  3VEP A;  1NHA A;  3OYD A;  4KJZ A;  2XGE A;  3ZQ7 A;  1WCM J;  4C9Y A;  4A3I J;  2LVS A; 
#chains in the Genus database with same CATH homology
 4JK1 X;  3IL2 A;  2VE9 A;  1B9N A;  2QBY B;  1W7P B;  2P7C B;  2DI3 A;  3LA2 A;  2XGX A;  1ZG5 A;  4F7Z A;  4LGW A;  2G9W A;  3K1M A;  3ZMZ A;  4I0A A;  5BMZ A;  4UVB A;  1ZAR A;  4HX7 A;  4M6X A;  2P5V A;  1BIA A;  4OMZ A;  1P6R A;  2QQ9 A;  3OV8 A;  3VB2 A;  1HKQ A;  4I7H A;  2Z5U A;  3F23 A;  3KZY A;  3RKY A;  4MQ9 F;  3EUH A;  4AWX B;  3DEU A;  2W57 A;  1FC3 A;  4M73 A;  5AON A;  4R8H A;  5DD4 A;  3QP6 A;  3CO6 C;  1F9N A;  1FP1 D;  1HW2 A;  3ML6 A;  2Q8K A;  1TW3 A;  2RKH A;  3BPX A;  3LAP A;  1XCB A;  4HBL A;  5LBQ A;  2IA1 A;  1KU7 A;  2IT0 A;  1W5S A;  4HZF A;  4U0Y A;  2OD5 A;  2D45 A;  2BYV E;  4S04 A;  5D6F A;  4NHJ A;  4A5N A;  2GQQ A;  4KMF A;  1IN5 A;  2MH9 A;  1PP7 U;  1F4K A;  4O6J A;  4L18 B;  4HAM A;  2L02 A;  4HA8 A;  1JHE A;  4G8X A;  4BHC A;  1KN9 A;  1KU2 A;  1GXP A;  2XHK A;  2HS5 A;  4P55 A;  2MBF A;  2JTV A;  3SXY A;  4NV4 A;  1I1S A;  2Q0O A;  4U7D A;  1T2K A;  1R5G A;  3T5X A;  3CTA A;  3JAM K;  3ERE D;  3WGI A;  2PMU A;  3HRS A;  1UFM A;  1P4A A;  3V4G A;  5HS7 A;  1BC7 C;  2PN6 A;  5E8I A;  1D8J A;  1XSD A;  2VE8 A;  4AVP A;  3FWE A;  3BPV A;  1IAW A;  4Q47 A;  2L54 A;  1WSU A;  1SD6 A;  2XVC A;  3NQO A;  3GFL A;  3O2P E;  3FXQ A;  3LST A;  1P4W A;  4L0Z B;  3TDU C;  1TBX A;  2A69 F;  1ZRC A;  2DLL A;  1FSH A;  2MH2 A;  3BRO A;  3M9A A;  1Z05 A;  2WWY A;  4RS8 A;  4OMY A;  2DAO A;  2RVC A;  4BH9 A;  2NYX A;  3Q9S A;  1TQP A;  1ZGA A;  4IHS A;  1XMK A;  2EFW A;  4GYI A;  4MGR A;  3DKW A;  1L3L A;  1OR7 A;  5HLG A;  2D1V A;  4N31 A;  2CWE A;  2V79 A;  2WV0 A;  5HS9 A;  3EET A;  4PGH A;  3CUQ C;  2ACJ A;  4BAY A;  2JPB A;  4GGG A;  4KYW A;  4MEX F;  3SQN A;  2J5P A;  2X4H A;  4ETS A;  3KZZ A;  5ILS A;  4EM2 A;  3W6J B;  3CO7 C;  3S04 A;  2K27 A;  4UNO A;  5LGU A;  4R79 A;  3LQQ A;  1ZHF A;  1EH7 A;  1J0R A;  4L9V A;  1F39 A;  3KP3 A;  1FBU A;  4UXN A;  2OAZ A;  5DV5 A;  4YFK F;  5LHG A;  5LEJ A;  1JE8 A;  2RNJ A;  5K5Q A;  4G94 A;  1J59 A;  2ZXJ A;  4E70 A;  2E7X A;  5CVV A;  1RI7 A;  5E1Z B;  4ZZD A;  1HKT A;  2V1D A;  3DP7 A;  4ENN A;  3I58 A;  3HSE A;  1YQA A;  2VT3 A;  1EH6 A;  2NNY A;  1DDN A;  2P4W A;  2TDX A;  3HOS A;  4LLN A;  5TRD A;  3F8N A;  1R23 A;  4A5M A;  3BOQ A;  4P5O A;  1YG2 A;  1ZLK A;  2BGC A;  2VC0 A;  3IWZ A;  4EQQ A;  2H94 A;  3ABU A;  3G73 A;  4KA4 A;  2QVO A;  3FM3 A;  3TGN A;  3T8T A;  5E17 F;  1BI0 A;  2EWN A;  2IJL A;  1ZN2 A;  1Z1D A;  4I98 B;  1HSJ A;  1XDS A;  4HLX A;  3OOP A;  1XN7 A;  4RB0 A;  1YW9 A;  4HDU A;  3VFZ A;  3HTU A;  5HVQ C;  2DPU A;  4ENM A;  4WCG A;  2H6B A;  2Y0M A;  2EK5 A;  3EYI A;  2PQ8 A;  2HGC A;  1SD7 A;  4OOI A;  3QPH A;  5BS6 A;  2OZ6 A;  3E3V A;  2FKD A;  2DQR A;  3RPU A;  2KIU A;  5CLS A;  3TOB A;  3ROU A;  2LF8 A;  3V8J A;  3WTU C;  4ASN A;  3SZP A;  2EV5 A;  2PEX A;  1LDJ A;  2F5D A;  4Q48 A;  4IRG A;  1DUX C;  2PJP A;  3FXU A;  1O57 A;  3M1E A;  5CVI A;  4BNC A;  1LVA A;  1QGP A;  4RAZ A;  2M30 A;  3R0A A;  2VBY A;  5KVR A;  4WXH A;  1LB2 A;  4KN7 X;  3HRM A;  3L09 A;  2QLZ A;  5ICC A;  4LLG F;  3N4M A;  2E1N A;  1SFE A;  2NNN A;  2EA4 A;  1QNT A;  4JBA A;  2GZW A;  1ON2 A;  4M74 A;  1A04 A;  1XCV A;  1L0O C;  4HW0 A;  5BQT A;  1CGP A;  3F3X A;  3QPT A;  1OPC A;  2ISZ A;  1E17 A;  1V3F A;  1J9I A;  2STT A;  2XRN A;  5D8K B;  2Q2E A;  2DFI A;  1IXS B;  4ME8 A;  3L2C A;  4XLP F;  1XMA A;  5E1W A;  3F72 A;  2VOD A;  4HOB A;  4QLC U;  3C7J A;  3HRU A;  2O3F A;  5ED4 A;  1TNS A;  2L3D A;  1T7D A;  1BI2 A;  3ULQ B;  2VXZ A;  1REP C;  1TQI A;  5ICF A;  1TQM A;  4HX4 A;  1SFX A;  4OIQ F;  2HFH A;  1IUY A;  3LWF A;  3IKT A;  1OYY A;  4HV5 A;  1B12 A;  4G7Z F;  2G7H A;  5FB2 A;  4M9S A;  2A6E F;  1BBY A;  1IZ1 A;  1ZG3 A;  4LMY A;  2W25 A;  3FMS A;  1ZYR F;  3U1D A;  3B73 A;  1TTY A;  3ZMU A;  3LA7 A;  1H0M A;  1ZH5 A;  1IRF A;  1UCR A;  3HUG A;  4KIG A;  4A6D A;  1G3T A;  5L3D A;  1LDK B;  5E20 A;  4MTD A;  4YG2 F;  4HF0 A;  3KEQ A;  2XV4 S;  3BJ6 A;  2IA0 A;  2YSR A;  2QM3 A;  4A2U A;  5H6Q A;  3TKY A;  1T98 A;  5IT9 Z;  5HDG A;  5LLQ A;  1ZLJ A;  4IRI A;  5IT9 K;  1BIB A;  3GF2 A;  5HS8 A;  4L5I A;  3EDP A;  5JFR A;  2XKP A;  4FHT A;  6PAX A;  2LDU A;  3GO5 A;  3LQR A;  4KNY A;  2DW4 A;  4KUM A;  3D5L A;  4LLL A;  1J5Y A;  4Y15 A;  3DF8 A;  4WXD A;  4I2O A;  3SHF A;  2DQL A;  1J7K A;  4M9Z A;  2OQG A;  3HTS B;  3WU1 B;  2PI0 A;  1MD0 A;  4ENJ A;  1KA8 A;  4N9I A;  1OYW A;  4IJA A;  2GIV A;  1U8R A;  2LNB A;  3SZT A;  2O8X A;  1MKM A;  3F22 A;  2DK5 A;  5HDK A;  4MQV A;  2GWR A;  3QU6 A;  4HF2 A;  5DCF A;  4KN4 X;  3F8M A;  2HKO A;  4CDG A;  1B1B A;  2JRT A;  2UZK A;  1V4R A;  1Z6R A;  5D5X B;  1SD4 A;  2MLK A;  4XLN F;  3J80 Z;  5L3F A;  3IRR A;  1U3E M;  2DT5 A;  2JZY A;  2PFB A;  4K2E A;  1FBS A;  1W5T A;  3J80 K;  2M5W A;  1P2F A;  4EJO A;  5DUI A;  2Z33 A;  4HV6 A;  4IHT A;  5JI6 A;  1T6S A;  3DPT A;  1TNT A;  3PQK A;  2MC3 A;  1AOY A;  4PCQ A;  1K7A A;  1FOK A;  1W4M A;  2HDC A;  3HHH A;  2HNF A;  4LG0 B;  1SD5 A;  1YYV A;  5ILV A;  1R1V A;  1XGM A;  3HIF A;  2IA2 A;  3RDI A;  1K6O A;  4HQE A;  5DCM A;  3I59 A;  2YR2 A;  5E1X A;  1QPM A;  2F5C A;  3BJO A;  2EFO A;  3E5Q A;  2CG4 A;  4A12 A;  1MJ9 A;  3HSF A;  4HLY A;  5LGT A;  1HXD A;  2Y75 A;  4CXF A;  3RI4 A;  1CF7 A;  3Q9V A;  2P8T A;  5IT3 A;  4UVC A;  4G7H F;  1EV7 A;  1TW2 A;  3T8R A;  2LSO A;  1RUO A;  4G7O F;  4PGG A;  4IPA A;  1K78 A;  3JAM Z;  1FYL A;  3ZP5 A;  4UV9 A;  3I71 A;  2AXL A;  1J2X A;  2FNA A;  4RB3 C;  3ZMS A;  3R60 A;  4R1H A;  5LRS A;  3C1D A;  2Z9O A;  1R58 A;  2RDP A;  2ZO4 A;  1FX7 A;  1RZ4 A;  3BDD A;  3RKW A;  2K4B A;  3GYH X;  1R5H A;  4M9X A;  4KMU X;  2HQR A;  3IKV A;  1FLI A;  5JR3 A;  3EQL F;  1MZB A;  1ONV A;  4CZZ A;  1XD7 A;  2JPC A;  2FE3 A;  1IN4 A;  3I0T A;  3WTT C;  3MQ0 A;  2FSW A;  1B9M A;  3BJA A;  4OIN F;  4EVI A;  1KU9 A;  1F5T A;  3C3W A;  2XUB A;  4U7B A;  2A5Y B;  3GX4 X;  2WTE A;  3M7G A;  1O3T A;  3TO9 A;  2O03 A;  1UB9 A;  3WE3 A;  2M8E A;  4BYY A;  2C6Y A;  2ADU A;  2IP2 A;  4AIK A;  2XKO A;  4XSX F;  3TOA A;  3GFJ A;  5L3B A;  2V1X A;  1XGS A;  1HQC A;  4RGS A;  4M71 A;  4EV0 A;  3WG9 A;  3GWZ A;  3K1N A;  1JHF A;  2ISY A;  3TQN A;  1LJ9 A;  1XGN A;  1HW1 A;  5BPD A;  3I4P A;  3WTW C;  1XGO A;  4U0V A;  4DQ2 A;  3E97 A;  3P9K A;  2BBY A;  1B4A A;  1S29 A;  3P9C A;  2FU4 A;  4IF4 A;  3FZV A;  3F21 A;  3FMR A;  3IWF A;  4KT5 C;  2E7W A;  5ICE A;  3NEU A;  2LF7 A;  3CUO A;  3DV8 A;  3P7N A;  4KFC A;  5E8G A;  3K69 A;  4AIH A;  4ON0 A;  3JSO A;  5LGN A;  2UXX A;  3JSP A;  1FNN A;  2GA2 A;  1WRJ A;  2A61 A;  3I59 B;  3QAH A;  4RAY A;  3ZN0 A;  2BV6 A;  2IPQ X;  2OU2 A;  1MDM A;  3MAJ A;  4YFX F;  1CF7 B;  5CVR A;  1T0F A;  1LEB A;  2R7D A;  2OQR A;  3DXJ F;  1C0W A;  1RIO H;  3DPL C;  1BI1 A;  1IN6 A;  3C18 A;  4I0B A;  3I64 A;  2GAU A;  2FA5 A;  1JHC A;  4XSZ F;  3RPQ A;  1Y0U A;  1K78 B;  3KP7 A;  3KCC A;  3DFG A;  4HX8 A;  4A0Z A;  3R61 A;  5K1Y A;  1YTY A;  4ZYH A;  4YIF A;  2VOO A;  4ZYG A;  1U5T A;  3ZN1 A;  2V9V A;  4O5V A;  1HBX G;  5CYV A;  1G3Y A;  1IW7 F;  1B59 A;  5ICG A;  2VT2 A;  2XAH A;  1B6A A;  3F8B A;  1AWC A;  4P9F A;  3R4K A;  4RGR A;  1LQ1 A;  2UXN A;  1FSE A;  3CDH A;  4UHT A;  2FBH A;  2AS5 F;  1S3J A;  1XDU A;  2M45 A;  1KCA A;  1KU3 A;  2EFP A;  3CLO A;  2JT1 A;  5H6R A;  1YLF A;  1PP8 F;  3WTY C;  1IXC A;  4L9N A;  2R7F A;  3L9F A;  3COA C;  2CW0 F;  3FM5 A;  2QQA A;  5F6F A;  3G3Z A;  3PQJ A;  1U78 A;  2HO0 A;  2KIF A;  4Q5S F;  3R6S A;  4KIF A;  4RGU A;  1JHH A;  3CJN A;  3KEO A;  3RTR A;  1I1G A;  2VBZ A;  2K02 A;  1ZRE A;  1ZRD A;  1O7F A;  3KP6 A;  3FX3 A;  1JXS A;  2DK8 A;  1G6N A;  2GXG A;  2NAZ A;  3TO7 A;  1LDD A;  1FT9 A;  5FFX A;  3T1B A;  1ZG1 A;  2RQP A;  1G3W A;  2QEN A;  5K5O A;  2QBY A;  4L0Y B;  2FRH A;  3VOD A;  1WKM A;  3QP5 A;  2IRF G;  4ENK A;  1FPQ A;  1E2X A;  1GVJ A;  1Q1H A;  5J8F A;  4Y13 A;  4N0B A;  5FGM A;  3V8K A;  1FZP B;  2HR3 A;  2YX4 A;  4EM1 A;  4RB2 C;  2G7U A;  4ESJ A;  4EJT A;  2CSO A;  2XAQ A;  4A0Y A;  4CIC A;  1AY9 A;  2EFN A;  4BHB A;  3GFM A;  2QZ8 A;  1P92 A;  2RGV A;  4MHG A;  1MJA A;  4EJV A;  3HSR A;  3KLO A;  2MA3 A;  1H9T A;  4WX9 A;  2A6H F;  2XAS A;  2E1C A;  1XSX A;  1D3Y A;  4OIO F;  5D8L B;  1KYW A;  1O3S A;  3M8F A;  3I5U A;  1OKR A;  4UVA A;  3HHG A;  3O3K A;  2YX7 A;  5HLI A;  3BWG A;  2P7V B;  2VC1 A;  4NB5 A;  5L3G A;  2OA4 A;  2QWW A;  1G3S A;  4P9U A;  2QUF A;  3D0S A;  4Z2Y A;  3JTH A;  3T0Y A;  3ELK A;  2PBI A;  3WTS C;  3O6B B;  3QU3 A;  2XAF A;  1IN7 A;  3P9I A;  5D5V B;  1I6X A;  3L7W A;  1I4V A;  1SFU A;  5D4S A;  2RC4 A;  2ZJ2 A;  2FOK A;  1S7O A;  4LFU A;  2HKX A;  3KLN A;  5HDN A;  2GA1 A;  2W85 A;  1QBJ A;  3KET A;  3WGG A;  2IW5 A;  3GZ5 A;  2VBW A;  3BY6 A;  2HYG D;  5A2Q Z;  4OIP F;  3WGH A;  5HOO A;  2X0L A;  2Z99 A;  5A2Q K;  3Q5F A;  2VN2 A;  1ZRF A;  1IRG A;  1PDN C;  3KE2 A;  1QZZ A;  1SMY F;  4A0X A;  5DD8 A;  2M87 A;  1UST A;  1F1Z A;  2BEO A;  2CQK A;  4UUV A;  4OIR F;  1UHW A;  2D2W A;  3AAF A;  3H3Z A;  5DUK A;  2A07 F;  4ZH4 F;  2V1U A;  5BOX A;  2FF4 A;  5D5U B;  1O3Q A;  1S8N A;  4G9Y A;  1WI9 A;  2ZBK A;  2YU3 A;  3MCZ A;  2KIM A;  2STW A;  4HYE A;  2F2E A;  1Z9C A;  2BE5 F;  3QRF F;  3RKX A;  3ZPL A;  5F64 A;  4GXO A;  3MWM A;  3V7S A;  1DPU A;  2D1H A;  1QQI A;  5CVU A;  2VOP A;  2O6G E;  3KFW X;  4AD9 A;  1X3U A;  1ON1 A;  4WK8 F;  3MZY A;  5J8C A;  3S2W A;  5D4R A;  3U9G A;  3BDN A;  5K5R A;  3M8E A;  3RIR A;  4M6Y A;  2P5K A;  2HZT A;  4EJW A;  3REO A;  2VON A;  3H92 A;  4FX0 A;  2OZU A;  2K4J A;  4RB1 A;  4EGY A;  4K8W A;  4I01 A;  2FQ3 A;  1OYI A;  2FXA A;  1BI3 A;  5BPI A;  2DO7 A;  2EFQ A;  2ZME A;  3MEX A;  5LHH A;  1KYZ A;  2DBB A;  2HQN A;  5LRR A;  1FWZ A;  3R0J A;  3WTX C;  2FMY A;  3PFI A;  2Z3Y A;  4LB6 B;  3E6M A;  5D6E A;  1MJB A;  2ESH A;  1IF1 A;  3F8F A;  4ZYD A;  4YII A;  2DTR A;  2HWV A;  2COM A;  3IRQ A;  5HLH A;  4XRF A;  4KIC A;  5LHI A;  3K1P A;  1U5T C;  4EMS A;  2KJC A;  4EJU A;  2XAJ A;  4LJZ F;  1HKS A;  5H20 A;  2FNP A;  1K79 A;  1R36 A;  4U0W A;  1ULY A;  2H6C A;  2CGP A;  1FP2 A;  3ZMV A;  1H9G A;  4YFN F;  4Q4Z F;  1FBQ A;  4PZJ A;  4A6E A;  1R00 A;  4IVN A;  1I5Z A;  1BOA A;  4CGZ A;  4P96 A;  4JQF A;  2NS0 A;  2PLY A;  1HW5 A;  1RNL A;  1FYK A;  4MTE A;  4B09 A;  4WF2 A;  3WOD F;  1FY7 A;  4WWC A;  1BN5 A;  4G6Q A;  1P4X A;  3RYP A;  2IVM A;  3F6V A;  2CFX A;  3E5U A;  2QYO A;  4EM0 B;  1S6L A;  4M72 A;  3IHU A;  1D8K A;  2KJB A;  1YIO A;  5EEG A;  5TJJ A;  1DPR A;  5FFZ A;  3J7A O;  1I27 A;  1LNW A;  4I09 A;  4WXC A;  3IIQ A;  2PMH A;  2ZNZ A;  4MEY F;  2V6C A;  4ZYE A;  2ZNY A;  4N9H A;  5JHU A;  1MGT A;  2O61 A;  2ETH A;  2P6S A;  1J75 A;  1U2W A;  1SAX A;  2Y48 A;  4BQA A;  1D5V A;  5LEK A;  3HOT A;  3V8L A;  2ZCW A;  3ABT A;  4FX4 A;  3KP4 A;  4GYG A;  3BP8 A;  1Z7U A;  3LFK A;  5DCM B;  3QOP A;  3GW2 A;  2RN7 A;  3RJP A;  4ESB A;  1ZAO A;  3WU0 A;  5E18 F;  4O3M A;  1KGS A;  2ZME B;  5FD6 A;  4ESF A;  1ZGJ A;  1WQ2 A;  2GXB A;  3E6B A;  4U88 A;  4ZZL A;  1HST A;  3K0L A;  3DQV C;  2HYF A;  2KKO A;  3N97 A;  3EYY A;  5DEQ A;  1TLH B;  2W24 A;  1OMI A;  5AIP A;  3NRV A;  2FBI A;  2F5F A;  4RGX A;  1KQ0 A;  2MD5 A;  2XAG A;  3J81 Z;  5J6X A;  2R3S A;  4PDK A;  3V7C A;  1XB4 A;  3J81 K;  2CO5 A;  2CYY A;  5L3C A;  3B02 A;  2DPD A;  2H09 A;  2EJR A;  2RV8 A;  3WE2 A;  4UV8 A;  1G4D A;  2UWM A;  3MFK A;  3MZH A;  3TDZ C;  1VTN C;  2JSC A;  3TO6 A;  1R22 A;  4XBF A;  3I54 A;  4CYD A;  1LEA A;  1KQ8 A;  2L01 A;  2O0Y A;  1U6G A;  1QZY A;  2EB7 A;  2DU9 A;  1W7P D;  2ZFW A;  3K9T A;  1WWX A;  2ZKZ A;  1O7L A;  1O3R A;  2NRA C;  5ILU A;  3LA3 A;  3F6O A;  4GCV A;  2J5O A;  3GXO A;  3RYR A;  5D5W B;  2ESN A;  4CO8 A;  1YS7 A;  3LAJ A;  3FXR A;  4D0P A;  1USS A;  1EH8 A;  2HTS A;  4FT8 A;  2YPR A;  3CUQ A;  5ERI A;  1RUN A;  3ECH A;  3GFI A;  1IN8 A;  1BJA A;  1W7P A;  3KP5 A;  4KIB A;  4B8X A;  3ISP A;  4HQM A;  3GUD A;  2M1B A;  3KP2 A;  5FLX Z;  4LD5 A;  4NQW A;  1ODD A;  4MNU A;  1UHM A;  2EV6 A;  2XIG A;  5FLX K;  5FD5 A;  4I02 A;  4H0E A;  1YW7 A;  2WC2 A;  1XSV A;  2VBX A;  5EEH A;  4S05 A;  1UMU A;  5DYM A;  1JGS A;  3WTZ A;  2P6T A;  4OU0 A;  1GHC A;  2K86 A;  4L5J A;  5F1R A;  1MDM B;  1BM9 A;  5CVJ A;  3HRT A;  2L4A A;  4LK1 F;  1R1U A;  2W84 A;  2HOE A;  3I53 A;  4TV7 A;  1T38 A;  1T39 A;  2XRO A;  5AIQ A;  1YFH A;  2A68 F;  3L00 A;  4GO1 A;  2FBK A;  2L4M A;  3F8C A;  4L9T A;  1IXR C;  1R7J A;  4HF1 A;  3E6D A;  1YO5 C;  4LG0 A;  4LB5 A;  4KDP A;  2EV0 A;  2FML A;  3GEZ A;  3V7R A;  1U5T B;  3GVA A;  4BHP A;  4IRH A;  3K2Z A;  4L9J A;  5DDG A;  1GXQ A;  3HYI A;  3H3U A;  5FO5 A;  3ZMT A;  1YW8 A;  3WTV C;  1R1T A;  4Y17 A;  2EA2 A;  2QQB A;  2B0L A;  3FMQ A;  4EGZ A;  1STZ A;  2H27 A;  2F5E A;  3JW4 A;  3GZ6 A;  3JTG A;  1Z91 A;  3E5X A;  4AIJ A;  3ZMD A;  1FYM A;  3SFZ A;  2P5L C;  1QO0 D;  1S7A A;  3W6K B;  1DP7 P;  2K7L A;  4IXA A;  2FJR A;  2PG4 A;  2HEO A;  5KK1 A;  1SMT A;  2KRF A;  1KQ9 A;  3U2R A;  1BC8 C;  3GLX A;  4QWQ A;  3FHZ A;  3E6C C;  2MLG A;  2HTJ A;  5JVT A;  2OBP A;  4LK0 F;  2A3S A;  3VOE A;  4DNC A;  3IC7 A;  4HDV A;  2ELH A;  1YS6 A;  4BXU A;  3BZ6 A;  3ECO A;  4CHU A;  1Z6T A;  5L3E A;  1PUE E;  4G6D A;  3CUQ B;  3FF5 A;  5CJ9 A;  2LKP A;  2FEZ A;  3VEP A;  1NHA A;  3ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...