4K8WA

An arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
SAGDGVLYYRLTDRYHINDVVVYEVDNTLKVGRIAAQAGDEVSFTQEGGLLINGHPPEKEVPYLTYPHSSGPNFPYKVPTGTYFILNDYREERLDSRYYGALPINQIKGKISTLLRVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An arm-swapped dimer of the Streptococcus pyogenes pilin specific assembly factor SipA.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords LepA
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10502 Peptidase_S26 Signal peptidase, peptidase S26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 4k8wA00
1JHFA 2FJRA 1F39A 4K8WA 3BDNA 4NV4A 1JHEA 1AY9A 3S04A 1I4VA 3K2ZA 4ME8A 1KCAA 3JSOA 2FKDA 2HO0A 4N31A 1T7DA 3IIQA 1JHCA 1B12A 1JHHA 1KN9A 1UMUA 3JSPA 2HNFA
chains in the Genus database with same CATH superfamily
1JHFA 2FJRA 1F39A 4K8WA 3BDNA 4NV4A 1JHEA 1AY9A 3S04A 1I4VA 3K2ZA 4ME8A 1KCAA 3JSOA 2FKDA 2HO0A 4N31A 1T7DA 3IIQA 1JHCA 1B12A 1JHHA 1KN9A 1UMUA 3JSPA 2HNFA
chains in the Genus database with same CATH topology
1JHFA 2FJRA 1F39A 4K8WA 3BDNA 4NV4A 1JHEA 1AY9A 3S04A 1I4VA 3K2ZA 4ME8A 1KCAA 3JSOA 2FKDA 2HO0A 4N31A 1T7DA 3IIQA 1JHCA 1B12A 1JHHA 1KN9A 1UMUA 3JSPA 2HNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHF A;  2FJR A;  1F39 A;  4K8W A;  3BDN A;  4NV4 A;  1JHE A;  1AY9 A;  3S04 A;  1I4V A;  3K2Z A;  4ME8 A;  1KCA A;  3JSO A;  2FKD A;  2HO0 A;  4N31 A;  1T7D A;  3IIQ A;  1JHC A;  1B12 A;  1JHH A;  1KN9 A;  1UMU A;  3JSP A;  2HNF A; 
#chains in the Genus database with same CATH topology
 1JHF A;  2FJR A;  1F39 A;  4K8W A;  3BDN A;  4NV4 A;  1JHE A;  1AY9 A;  3S04 A;  1I4V A;  3K2Z A;  4ME8 A;  1KCA A;  3JSO A;  2FKD A;  2HO0 A;  4N31 A;  1T7D A;  3IIQ A;  1JHC A;  1B12 A;  1JHH A;  1KN9 A;  1UMU A;  3JSP A;  2HNF A; 
#chains in the Genus database with same CATH homology
 1JHF A;  2FJR A;  1F39 A;  4K8W A;  3BDN A;  4NV4 A;  1JHE A;  1AY9 A;  3S04 A;  1I4V A;  3K2Z A;  4ME8 A;  1KCA A;  3JSO A;  2FKD A;  2HO0 A;  4N31 A;  1T7D A;  3IIQ A;  1JHC A;  1B12 A;  1JHH A;  1KN9 A;  1UMU A;  3JSP A;  2HNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...