The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
91
|
sequence length |
313
|
structure length |
313
|
Chain Sequence |
MAELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNSLKVTQANVSNVLSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQNAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADRVYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQKMKPEKNPFKGLSTDRKMDEVS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Rotavirus protein involved in genome replication and packaging exhibits a HIT-like fold.
pubmed doi rcsb |
molecule tags |
Viral protein
|
source organism |
Simian 11 rotavirus (serotype 3 / strain sa11-ramig)
|
molecule keywords |
Rotavirus-NSP2
|
total genus |
91
|
structure length |
313
|
sequence length |
313
|
ec nomenclature | |
pdb deposition date | 2002-03-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02509 | Rota_NS35 | Rotavirus non-structural protein 35 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | HIT family, subunit A | Rotavirus NSP2 fragment, C-terminal domain | ||
Alpha Beta | Alpha-Beta Complex | Rotavirus NSP2 fragment, N-terminal domain | Rotavirus NSP2 fragment, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1L9V A; 2GU0 A; 2R7P A; 2R7J A; 2R7C A; 2R8F A; 4G0A A; 4G0J A; #chains in the Genus database with same CATH topology 1L9V A; 2Q4H A; 4FIT A; 3OJ7 A; 1GUP A; 4I5V A; 3O1C A; 3SPD A; 5ED3 A; 3SP4 A; 1GUQ A; 1XML A; 2Q4L A; 4ZGL A; 3O1Z A; 3QGZ A; 2H39 A; 2LJW A; 3LB5 A; 5I2E A; 4G0A A; 5EMT A; 4NDI A; 5BV3 A; 5IPE A; 4QEB A; 4EGU A; 1RZY A; 4YKL B; 3BL9 A; 4EQH A; 2GU0 A; 5I2F A; 5ED6 A; 4NK0 A; 4NDF A; 1ZWJ A; 4QDE A; 1KPC A; 2R7P A; 3TW2 A; 3OMF A; 1AV5 A; 2EO4 A; 3FIT A; 4NDG A; 3IMI A; 1ST0 A; 4QDV A; 3O1X A; 2POF A; 1EMS A; 3N1T A; 5CS2 A; 4EQG A; 4G0J A; 1KPE A; 3OHE A; 2R7C A; 5IN3 A; 3ANO A; 5IPD A; 1HXQ A; 3WO5 A; 1KPA A; 5IPC A; 5FIT A; 3BLA A; 3O0M A; 3L7X A; 4XBA A; 4NDH A; 3P0T A; 4RHN A; 3R6F A; 4INC A; 2FHI A; 4EQE A; 1KPB A; 3BL7 A; 4ZKL A; 1XMM A; 2R7J A; 4NJZ A; 4ZKV A; 3SPL A; 5RHN A; 4NJX A; 1HXP A; 1Y23 A; 4I5T A; 4I5W A; 3N1S A; 2OIK A; 1ST4 A; 1Z84 A; 4INI A; 4NJY A; 1KPF A; 2R8F A; 5IPB A; 6FIT A; 2FIT A; 3RHN A; 3SZQ A; 6RHN A; 1VLR A; 3I24 A; 3NRD A; 3KSV A; 1FHI A; 1FIT A; 3I4S A; 3OXK A; #chains in the Genus database with same CATH homology 1L9V A; 2GU0 A; 2R7P A; 2R7J A; 2R7C A; 2R8F A; 4G0A A; 4G0J A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...