1WX4B

Crystal structure of the oxy-form of the copper-bound streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein prepared by the addition of dithiothreitol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
71
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 15
structure length 71
sequence length 82
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 1wx4B01
1WX2B 3AWXB 1WXCB 2ZWFB 2ZWDB 3AWVB 2ZWGB 2ZMXB 1WX5B 3AWZB 2ZMZB 2AHLB 3AWWB 3AWYB 2AHKB 3AWUB 3AWTB 2JV8A 3AX0B 1WX4B 2ZWEB 2ZMYB 3AWSB
chains in the Genus database with same CATH superfamily
2DE7A 1WX2B 3AWXB 3VMGA 1WXCB 1Z03A 2ZWFB 3GCFA 2ZWDB 1Z01A 3AWVB 2ZWGB 4NBBA 4NBGA 2ZMXB 1WX5B 3AWZB 2ZMZB 4NB9A 3VMIA 2AHLB 3AWWB 3AWYB 2AHKB 3AWUB 3GKQA 4NBFA 4NB8A 3AWTB 1Z02A 3VMHA 2DE5A 2JV8A 1WW9A 4NBEA 2DE6A 3AX0B 4NBCA 1WX4B 4NBDA 2ZWEB 4NBAA 4NBHA 2ZMYB 3AWSB
chains in the Genus database with same CATH topology
1WX2B 3AWXB 1WXCB 2ZWFB 2ZWDB 3AWVB 2ZWGB 2ZMXB 1WX5B 3AWZB 2ZMZB 2AHLB 3AWWB 3AWYB 2AHKB 3AWUB 3AWTB 2JV8A 3AX0B 1WX4B 2ZWEB 2ZMYB 3AWSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX2 B;  3AWX B;  1WXC B;  2ZWF B;  2ZWD B;  3AWV B;  2ZWG B;  2ZMX B;  1WX5 B;  3AWZ B;  2ZMZ B;  2AHL B;  3AWW B;  3AWY B;  2AHK B;  3AWU B;  3AWT B;  2JV8 A;  3AX0 B;  1WX4 B;  2ZWE B;  2ZMY B;  3AWS B; 
#chains in the Genus database with same CATH topology
 2DE7 A;  1WX2 B;  3AWX B;  3VMG A;  1WXC B;  1Z03 A;  2ZWF B;  3GCF A;  2ZWD B;  1Z01 A;  3AWV B;  2ZWG B;  4NBB A;  4NBG A;  2ZMX B;  1WX5 B;  3AWZ B;  2ZMZ B;  4NB9 A;  3VMI A;  2AHL B;  3AWW B;  3AWY B;  2AHK B;  3AWU B;  3GKQ A;  4NBF A;  4NB8 A;  3AWT B;  1Z02 A;  3VMH A;  2DE5 A;  2JV8 A;  1WW9 A;  4NBE A;  2DE6 A;  3AX0 B;  4NBC A;  1WX4 B;  4NBD A;  2ZWE B;  4NBA A;  4NBH A;  2ZMY B;  3AWS B; 
#chains in the Genus database with same CATH homology
 1WX2 B;  3AWX B;  1WXC B;  2ZWF B;  2ZWD B;  3AWV B;  2ZWG B;  2ZMX B;  1WX5 B;  3AWZ B;  2ZMZ B;  2AHL B;  3AWW B;  3AWY B;  2AHK B;  3AWU B;  3AWT B;  2JV8 A;  3AX0 B;  1WX4 B;  2ZWE B;  2ZMY B;  3AWS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...