1WX4B

Crystal structure of the oxy-form of the copper-bound streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein prepared by the addition of dithiothreitol
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
71
Chain Sequence
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/metal transport
molecule keywords tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
total genus 15
structure length 71
sequence length 82
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 1wx4B01
3AWZB 1WX5B 2ZMYB 2AHKB 3AWWB 3AX0B 2JV8A 2ZWDB 1WX2B 1WXCB 2ZWEB 2AHLB 3AWYB 2ZWGB 3AWTB 3AWUB 2ZMXB 3AWVB 2ZMZB 1WX4B 3AWSB 3AWXB 2ZWFB
chains in the Genus database with same CATH superfamily
4NBDA 2DE7A 1WW9A 3AWZB 4NBCA 1WX5B 2DE5A 2ZMYB 2AHKB 3VMGA 3AWWB 3AX0B 2DE6A 2JV8A 2ZWDB 4NBHA 4NBAA 1WX2B 4NB8A 3VMIA 1WXCB 2ZWEB 4NBGA 1Z02A 4NBFA 1Z03A 2AHLB 3AWYB 2ZWGB 1Z01A 3AWTB 3GCFA 4NB9A 4NBBA 3VMHA 3AWUB 4NBEA 2ZMXB 3AWVB 2ZMZB 3GKQA 1WX4B 3AWSB 3AWXB 2ZWFB
chains in the Genus database with same CATH topology
3AWZB 1WX5B 2ZMYB 2AHKB 3AWWB 3AX0B 2JV8A 2ZWDB 1WX2B 1WXCB 2ZWEB 2AHLB 3AWYB 2ZWGB 3AWTB 3AWUB 2ZMXB 3AWVB 2ZMZB 1WX4B 3AWSB 3AWXB 2ZWFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWZ B;  1WX5 B;  2ZMY B;  2AHK B;  3AWW B;  3AX0 B;  2JV8 A;  2ZWD B;  1WX2 B;  1WXC B;  2ZWE B;  2AHL B;  3AWY B;  2ZWG B;  3AWT B;  3AWU B;  2ZMX B;  3AWV B;  2ZMZ B;  1WX4 B;  3AWS B;  3AWX B;  2ZWF B; 
#chains in the Genus database with same CATH topology
 4NBD A;  2DE7 A;  1WW9 A;  3AWZ B;  4NBC A;  1WX5 B;  2DE5 A;  2ZMY B;  2AHK B;  3VMG A;  3AWW B;  3AX0 B;  2DE6 A;  2JV8 A;  2ZWD B;  4NBH A;  4NBA A;  1WX2 B;  4NB8 A;  3VMI A;  1WXC B;  2ZWE B;  4NBG A;  1Z02 A;  4NBF A;  1Z03 A;  2AHL B;  3AWY B;  2ZWG B;  1Z01 A;  3AWT B;  3GCF A;  4NB9 A;  4NBB A;  3VMH A;  3AWU B;  4NBE A;  2ZMX B;  3AWV B;  2ZMZ B;  3GKQ A;  1WX4 B;  3AWS B;  3AWX B;  2ZWF B; 
#chains in the Genus database with same CATH homology
 3AWZ B;  1WX5 B;  2ZMY B;  2AHK B;  3AWW B;  3AX0 B;  2JV8 A;  2ZWD B;  1WX2 B;  1WXC B;  2ZWE B;  2AHL B;  3AWY B;  2ZWG B;  3AWT B;  3AWU B;  2ZMX B;  3AWV B;  2ZMZ B;  1WX4 B;  3AWS B;  3AWX B;  2ZWF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...