2AHKB

Crystal structure of the met-form of the copper-bound streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
72
Chain Sequence
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINASE
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 15
structure length 72
sequence length 83
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2ahkB01
2ZWDB 3AWYB 3AX0B 3AWWB 1WXCB 3AWVB 3AWZB 1WX5B 2ZMYB 3AWSB 2AHKB 1WX2B 3AWTB 3AWXB 2JV8A 2ZWEB 1WX4B 2ZMZB 3AWUB 2ZWFB 2ZWGB 2AHLB 2ZMXB
chains in the Genus database with same CATH superfamily
2ZWDB 3AWYB 3AX0B 4NBBA 3AWWB 4NBHA 4NBDA 4NB8A 1WXCB 3AWVB 3AWZB 3GKQA 1Z02A 1WX5B 2ZMYB 3AWSB 4NBEA 2DE7A 2DE5A 3GCFA 2AHKB 1WX2B 2DE6A 3AWTB 4NB9A 3VMIA 3AWXB 4NBCA 1WW9A 3VMHA 2JV8A 4NBFA 2ZWEB 1WX4B 1Z01A 2ZMZB 3AWUB 2ZWFB 3VMGA 1Z03A 4NBAA 4NBGA 2ZWGB 2AHLB 2ZMXB
chains in the Genus database with same CATH topology
2ZWDB 3AWYB 3AX0B 3AWWB 1WXCB 3AWVB 3AWZB 1WX5B 2ZMYB 3AWSB 2AHKB 1WX2B 3AWTB 3AWXB 2JV8A 2ZWEB 1WX4B 2ZMZB 3AWUB 2ZWFB 2ZWGB 2AHLB 2ZMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWD B;  3AWY B;  3AX0 B;  3AWW B;  1WXC B;  3AWV B;  3AWZ B;  1WX5 B;  2ZMY B;  3AWS B;  2AHK B;  1WX2 B;  3AWT B;  3AWX B;  2JV8 A;  2ZWE B;  1WX4 B;  2ZMZ B;  3AWU B;  2ZWF B;  2ZWG B;  2AHL B;  2ZMX B; 
#chains in the Genus database with same CATH topology
 2ZWD B;  3AWY B;  3AX0 B;  4NBB A;  3AWW B;  4NBH A;  4NBD A;  4NB8 A;  1WXC B;  3AWV B;  3AWZ B;  3GKQ A;  1Z02 A;  1WX5 B;  2ZMY B;  3AWS B;  4NBE A;  2DE7 A;  2DE5 A;  3GCF A;  2AHK B;  1WX2 B;  2DE6 A;  3AWT B;  4NB9 A;  3VMI A;  3AWX B;  4NBC A;  1WW9 A;  3VMH A;  2JV8 A;  4NBF A;  2ZWE B;  1WX4 B;  1Z01 A;  2ZMZ B;  3AWU B;  2ZWF B;  3VMG A;  1Z03 A;  4NBA A;  4NBG A;  2ZWG B;  2AHL B;  2ZMX B; 
#chains in the Genus database with same CATH homology
 2ZWD B;  3AWY B;  3AX0 B;  3AWW B;  1WXC B;  3AWV B;  3AWZ B;  1WX5 B;  2ZMY B;  3AWS B;  2AHK B;  1WX2 B;  3AWT B;  3AWX B;  2JV8 A;  2ZWE B;  1WX4 B;  2ZMZ B;  3AWU B;  2ZWF B;  2ZWG B;  2AHL B;  2ZMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...