2AHKB

Crystal structure of the met-form of the copper-bound streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
72
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINASE
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 15
structure length 72
sequence length 83
ec nomenclature
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2ahkB01
1WXCB 1WX5B 2ZMYB 2ZWFB 1WX2B 3AWUB 2ZWDB 2ZWGB 3AWXB 2AHKB 2JV8A 1WX4B 2ZMXB 3AWZB 3AWWB 3AWYB 3AX0B 3AWVB 3AWTB 3AWSB 2ZMZB 2ZWEB 2AHLB
chains in the Genus database with same CATH superfamily
4NBFA 1WXCB 1Z03A 1Z01A 1WW9A 4NBDA 1WX5B 2ZMYB 3VMGA 4NBGA 1Z02A 2ZWFB 1WX2B 4NBHA 3AWUB 4NB8A 2DE5A 2ZWDB 2ZWGB 3AWXB 2AHKB 4NBAA 2JV8A 4NBEA 1WX4B 2ZMXB 3AWZB 3GCFA 3AWWB 3AWYB 3AX0B 3GKQA 3AWVB 3VMHA 4NB9A 4NBBA 4NBCA 2DE6A 2DE7A 3AWTB 3AWSB 3VMIA 2ZMZB 2ZWEB 2AHLB
chains in the Genus database with same CATH topology
1WXCB 1WX5B 2ZMYB 2ZWFB 1WX2B 3AWUB 2ZWDB 2ZWGB 3AWXB 2AHKB 2JV8A 1WX4B 2ZMXB 3AWZB 3AWWB 3AWYB 3AX0B 3AWVB 3AWTB 3AWSB 2ZMZB 2ZWEB 2AHLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXC B;  1WX5 B;  2ZMY B;  2ZWF B;  1WX2 B;  3AWU B;  2ZWD B;  2ZWG B;  3AWX B;  2AHK B;  2JV8 A;  1WX4 B;  2ZMX B;  3AWZ B;  3AWW B;  3AWY B;  3AX0 B;  3AWV B;  3AWT B;  3AWS B;  2ZMZ B;  2ZWE B;  2AHL B; 
#chains in the Genus database with same CATH topology
 4NBF A;  1WXC B;  1Z03 A;  1Z01 A;  1WW9 A;  4NBD A;  1WX5 B;  2ZMY B;  3VMG A;  4NBG A;  1Z02 A;  2ZWF B;  1WX2 B;  4NBH A;  3AWU B;  4NB8 A;  2DE5 A;  2ZWD B;  2ZWG B;  3AWX B;  2AHK B;  4NBA A;  2JV8 A;  4NBE A;  1WX4 B;  2ZMX B;  3AWZ B;  3GCF A;  3AWW B;  3AWY B;  3AX0 B;  3GKQ A;  3AWV B;  3VMH A;  4NB9 A;  4NBB A;  4NBC A;  2DE6 A;  2DE7 A;  3AWT B;  3AWS B;  3VMI A;  2ZMZ B;  2ZWE B;  2AHL B; 
#chains in the Genus database with same CATH homology
 1WXC B;  1WX5 B;  2ZMY B;  2ZWF B;  1WX2 B;  3AWU B;  2ZWD B;  2ZWG B;  3AWX B;  2AHK B;  2JV8 A;  1WX4 B;  2ZMX B;  3AWZ B;  3AWW B;  3AWY B;  3AX0 B;  3AWV B;  3AWT B;  3AWS B;  2ZMZ B;  2ZWE B;  2AHL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...