2ZMYB

Crystal structure of the met2-form of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking in cupric sulfate solution for 80 hours
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title X-Ray Snapshots of a Hydroxylation Mechanism of Tyrosinase
rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zmyB01
2ZWGB 3AWYB 1WXCB 3AWWB 3AWZB 3AWXB 2JV8A 2ZMYB 3AWTB 3AWSB 3AWUB 2ZWDB 3AWVB 1WX5B 1WX4B 2AHKB 2ZWFB 3AX0B 1WX2B 2ZWEB 2ZMXB 2ZMZB 2AHLB
chains in the Genus database with same CATH superfamily
4NBBA 2DE7A 2ZWGB 3AWYB 1WXCB 3AWWB 1Z03A 3AWZB 1Z01A 3AWXB 4NBDA 2JV8A 2ZMYB 4NBAA 4NBCA 3AWTB 3AWSB 4NBEA 3AWUB 4NB8A 3VMHA 2ZWDB 2DE5A 1Z02A 1WX5B 2DE6A 3AWVB 1WX4B 2AHKB 4NBGA 2ZWFB 3AX0B 4NBHA 4NBFA 1WX2B 2ZWEB 2ZMXB 3GKQA 3VMIA 3VMGA 1WW9A 4NB9A 2ZMZB 2AHLB 3GCFA
chains in the Genus database with same CATH topology
2ZWGB 3AWYB 1WXCB 3AWWB 3AWZB 3AWXB 2JV8A 2ZMYB 3AWTB 3AWSB 3AWUB 2ZWDB 3AWVB 1WX5B 1WX4B 2AHKB 2ZWFB 3AX0B 1WX2B 2ZWEB 2ZMXB 2ZMZB 2AHLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWG B;  3AWY B;  1WXC B;  3AWW B;  3AWZ B;  3AWX B;  2JV8 A;  2ZMY B;  3AWT B;  3AWS B;  3AWU B;  2ZWD B;  3AWV B;  1WX5 B;  1WX4 B;  2AHK B;  2ZWF B;  3AX0 B;  1WX2 B;  2ZWE B;  2ZMX B;  2ZMZ B;  2AHL B; 
#chains in the Genus database with same CATH topology
 4NBB A;  2DE7 A;  2ZWG B;  3AWY B;  1WXC B;  3AWW B;  1Z03 A;  3AWZ B;  1Z01 A;  3AWX B;  4NBD A;  2JV8 A;  2ZMY B;  4NBA A;  4NBC A;  3AWT B;  3AWS B;  4NBE A;  3AWU B;  4NB8 A;  3VMH A;  2ZWD B;  2DE5 A;  1Z02 A;  1WX5 B;  2DE6 A;  3AWV B;  1WX4 B;  2AHK B;  4NBG A;  2ZWF B;  3AX0 B;  4NBH A;  4NBF A;  1WX2 B;  2ZWE B;  2ZMX B;  3GKQ A;  3VMI A;  3VMG A;  1WW9 A;  4NB9 A;  2ZMZ B;  2AHL B;  3GCF A; 
#chains in the Genus database with same CATH homology
 2ZWG B;  3AWY B;  1WXC B;  3AWW B;  3AWZ B;  3AWX B;  2JV8 A;  2ZMY B;  3AWT B;  3AWS B;  3AWU B;  2ZWD B;  3AWV B;  1WX5 B;  1WX4 B;  2AHK B;  2ZWF B;  3AX0 B;  1WX2 B;  2ZWE B;  2ZMX B;  2ZMZ B;  2AHL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...