1WXCB

Crystal structure of the copper-free streptomyces castaneoglobisporus tyrosinase complexed with a caddie protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
72
Chain Sequence
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 72
sequence length 83
ec nomenclature
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 1wxcB01
2ZMZB 2ZWDB 2ZWEB 3AWYB 2AHKB 2JV8A 1WX5B 2AHLB 2ZWGB 1WX2B 3AWTB 1WX4B 1WXCB 3AWZB 3AWWB 3AWXB 3AWUB 3AWSB 2ZMYB 2ZMXB 3AWVB 3AX0B 2ZWFB
chains in the Genus database with same CATH superfamily
4NBDA 1WW9A 2ZMZB 2ZWDB 2ZWEB 3AWYB 3VMGA 2AHKB 2DE7A 3VMHA 2JV8A 3GKQA 4NBHA 4NB8A 1Z03A 4NB9A 1WX5B 2AHLB 2ZWGB 1WX2B 3AWTB 3GCFA 4NBFA 1Z02A 1WX4B 1WXCB 4NBCA 3AWZB 3VMIA 3AWWB 4NBBA 3AWXB 3AWUB 3AWSB 2ZMXB 2ZMYB 1Z01A 4NBGA 4NBEA 3AWVB 2DE5A 3AX0B 4NBAA 2DE6A 2ZWFB
chains in the Genus database with same CATH topology
2ZMZB 2ZWDB 2ZWEB 3AWYB 2AHKB 2JV8A 1WX5B 2AHLB 2ZWGB 1WX2B 3AWTB 1WX4B 1WXCB 3AWZB 3AWWB 3AWXB 3AWUB 3AWSB 2ZMYB 2ZMXB 3AWVB 3AX0B 2ZWFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMZ B;  2ZWD B;  2ZWE B;  3AWY B;  2AHK B;  2JV8 A;  1WX5 B;  2AHL B;  2ZWG B;  1WX2 B;  3AWT B;  1WX4 B;  1WXC B;  3AWZ B;  3AWW B;  3AWX B;  3AWU B;  3AWS B;  2ZMY B;  2ZMX B;  3AWV B;  3AX0 B;  2ZWF B; 
#chains in the Genus database with same CATH topology
 4NBD A;  1WW9 A;  2ZMZ B;  2ZWD B;  2ZWE B;  3AWY B;  3VMG A;  2AHK B;  2DE7 A;  3VMH A;  2JV8 A;  3GKQ A;  4NBH A;  4NB8 A;  1Z03 A;  4NB9 A;  1WX5 B;  2AHL B;  2ZWG B;  1WX2 B;  3AWT B;  3GCF A;  4NBF A;  1Z02 A;  1WX4 B;  1WXC B;  4NBC A;  3AWZ B;  3VMI A;  3AWW B;  4NBB A;  3AWX B;  3AWU B;  3AWS B;  2ZMX B;  2ZMY B;  1Z01 A;  4NBG A;  4NBE A;  3AWV B;  2DE5 A;  3AX0 B;  4NBA A;  2DE6 A;  2ZWF B; 
#chains in the Genus database with same CATH homology
 2ZMZ B;  2ZWD B;  2ZWE B;  3AWY B;  2AHK B;  2JV8 A;  1WX5 B;  2AHL B;  2ZWG B;  1WX2 B;  3AWT B;  1WX4 B;  1WXC B;  3AWZ B;  3AWW B;  3AWX B;  3AWU B;  3AWS B;  2ZMY B;  2ZMX B;  3AWV B;  3AX0 B;  2ZWF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...