3AWUB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 40 h
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awuB01
2ZMYB 3AWTB 3AWUB 1WX5B 2AHLB 1WX4B 2ZMZB 3AWZB 3AWVB 3AWSB 2ZWGB 2AHKB 3AX0B 2ZMXB 2ZWFB 1WX2B 3AWWB 3AWYB 2ZWEB 2ZWDB 2JV8A 3AWXB 1WXCB
chains in the Genus database with same CATH superfamily
2ZMYB 3AWTB 3AWUB 4NBDA 4NB8A 1WX5B 1WW9A 4NBHA 2AHLB 3GCFA 1WX4B 2ZMZB 3AWZB 3AWVB 2DE7A 3GKQA 4NB9A 3AWSB 1Z02A 4NBBA 2ZWGB 2AHKB 4NBAA 1Z03A 3VMGA 1Z01A 3AX0B 2DE5A 2ZMXB 2ZWFB 1WX2B 2DE6A 4NBEA 4NBFA 3AWWB 3AWYB 3VMHA 2ZWEB 3VMIA 2ZWDB 2JV8A 4NBGA 4NBCA 3AWXB 1WXCB
chains in the Genus database with same CATH topology
2ZMYB 3AWTB 3AWUB 1WX5B 2AHLB 1WX4B 2ZMZB 3AWZB 3AWVB 3AWSB 2ZWGB 2AHKB 3AX0B 2ZMXB 2ZWFB 1WX2B 3AWWB 3AWYB 2ZWEB 2ZWDB 2JV8A 3AWXB 1WXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMY B;  3AWT B;  3AWU B;  1WX5 B;  2AHL B;  1WX4 B;  2ZMZ B;  3AWZ B;  3AWV B;  3AWS B;  2ZWG B;  2AHK B;  3AX0 B;  2ZMX B;  2ZWF B;  1WX2 B;  3AWW B;  3AWY B;  2ZWE B;  2ZWD B;  2JV8 A;  3AWX B;  1WXC B; 
#chains in the Genus database with same CATH topology
 2ZMY B;  3AWT B;  3AWU B;  4NBD A;  4NB8 A;  1WX5 B;  1WW9 A;  4NBH A;  2AHL B;  3GCF A;  1WX4 B;  2ZMZ B;  3AWZ B;  3AWV B;  2DE7 A;  3GKQ A;  4NB9 A;  3AWS B;  1Z02 A;  4NBB A;  2ZWG B;  2AHK B;  4NBA A;  1Z03 A;  3VMG A;  1Z01 A;  3AX0 B;  2DE5 A;  2ZMX B;  2ZWF B;  1WX2 B;  2DE6 A;  4NBE A;  4NBF A;  3AWW B;  3AWY B;  3VMH A;  2ZWE B;  3VMI A;  2ZWD B;  2JV8 A;  4NBG A;  4NBC A;  3AWX B;  1WXC B; 
#chains in the Genus database with same CATH homology
 2ZMY B;  3AWT B;  3AWU B;  1WX5 B;  2AHL B;  1WX4 B;  2ZMZ B;  3AWZ B;  3AWV B;  3AWS B;  2ZWG B;  2AHK B;  3AX0 B;  2ZMX B;  2ZWF B;  1WX2 B;  3AWW B;  3AWY B;  2ZWE B;  2ZWD B;  2JV8 A;  3AWX B;  1WXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...