2ZMXB

Crystal structure of the met1-form of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus obtained by soaking in cupric sulfate solution for 36 hours
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
77
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title Crystallographic Evidence That the Dinuclear Copper Center of Tyrosinase Is Flexible during Catalysis
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 77
sequence length 83
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zmxB01
3AWWB 1WXCB 1WX2B 2ZMZB 2ZWFB 3AWZB 2ZWEB 3AWTB 2JV8A 2ZMYB 3AX0B 2ZWDB 3AWSB 1WX5B 2ZWGB 2AHKB 3AWXB 3AWYB 2AHLB 3AWUB 2ZMXB 3AWVB 1WX4B
chains in the Genus database with same CATH superfamily
3AWWB 1WXCB 1WX2B 2ZMZB 2ZWFB 3GCFA 3AWZB 4NB9A 2ZWEB 3AWTB 4NBFA 2JV8A 1Z02A 2DE5A 2ZMYB 3AX0B 4NBAA 2DE7A 4NBBA 3VMHA 2ZWDB 3AWSB 3GKQA 2DE6A 4NB8A 1WX5B 1Z03A 3VMGA 2ZWGB 4NBEA 4NBGA 1WW9A 3VMIA 2AHKB 3AWXB 4NBDA 3AWYB 2AHLB 3AWUB 1Z01A 2ZMXB 3AWVB 1WX4B 4NBHA 4NBCA
chains in the Genus database with same CATH topology
3AWWB 1WXCB 1WX2B 2ZMZB 2ZWFB 3AWZB 2ZWEB 3AWTB 2JV8A 2ZMYB 3AX0B 2ZWDB 3AWSB 1WX5B 2ZWGB 2AHKB 3AWXB 3AWYB 2AHLB 3AWUB 2ZMXB 3AWVB 1WX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWW B;  1WXC B;  1WX2 B;  2ZMZ B;  2ZWF B;  3AWZ B;  2ZWE B;  3AWT B;  2JV8 A;  2ZMY B;  3AX0 B;  2ZWD B;  3AWS B;  1WX5 B;  2ZWG B;  2AHK B;  3AWX B;  3AWY B;  2AHL B;  3AWU B;  2ZMX B;  3AWV B;  1WX4 B; 
#chains in the Genus database with same CATH topology
 3AWW B;  1WXC B;  1WX2 B;  2ZMZ B;  2ZWF B;  3GCF A;  3AWZ B;  4NB9 A;  2ZWE B;  3AWT B;  4NBF A;  2JV8 A;  1Z02 A;  2DE5 A;  2ZMY B;  3AX0 B;  4NBA A;  2DE7 A;  4NBB A;  3VMH A;  2ZWD B;  3AWS B;  3GKQ A;  2DE6 A;  4NB8 A;  1WX5 B;  1Z03 A;  3VMG A;  2ZWG B;  4NBE A;  4NBG A;  1WW9 A;  3VMI A;  2AHK B;  3AWX B;  4NBD A;  3AWY B;  2AHL B;  3AWU B;  1Z01 A;  2ZMX B;  3AWV B;  1WX4 B;  4NBH A;  4NBC A; 
#chains in the Genus database with same CATH homology
 3AWW B;  1WXC B;  1WX2 B;  2ZMZ B;  2ZWF B;  3AWZ B;  2ZWE B;  3AWT B;  2JV8 A;  2ZMY B;  3AX0 B;  2ZWD B;  3AWS B;  1WX5 B;  2ZWG B;  2AHK B;  3AWX B;  3AWY B;  2AHL B;  3AWU B;  2ZMX B;  3AWV B;  1WX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...