3AWXB

Crystal structure of streptomyces tyrosinase in a complex with caddie h82q mutant soaked in a cu(ii)-containing solution for 80 hr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
72
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLQVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 72
sequence length 83
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awxB01
1WX2B 2ZMXB 1WXCB 2AHKB 3AWXB 2AHLB 2ZWGB 2ZMYB 3AX0B 1WX5B 3AWTB 3AWYB 3AWSB 2JV8A 2ZWFB 2ZWEB 3AWUB 2ZMZB 3AWWB 3AWVB 3AWZB 2ZWDB 1WX4B
chains in the Genus database with same CATH superfamily
3VMGA 1WX2B 2ZMXB 1WW9A 3VMHA 4NBDA 1WXCB 2AHKB 3AWXB 1Z03A 3VMIA 2AHLB 4NBFA 4NBBA 4NBEA 2ZWGB 2ZMYB 3AX0B 1WX5B 4NBGA 3AWTB 4NB8A 3AWYB 3AWSB 2DE6A 2JV8A 2ZWFB 2ZWEB 3AWUB 4NB9A 2DE7A 1Z02A 2ZMZB 2DE5A 4NBHA 3AWWB 3AWVB 4NBCA 1Z01A 3AWZB 2ZWDB 3GCFA 4NBAA 1WX4B 3GKQA
chains in the Genus database with same CATH topology
1WX2B 2ZMXB 1WXCB 2AHKB 3AWXB 2AHLB 2ZWGB 2ZMYB 3AX0B 1WX5B 3AWTB 3AWYB 3AWSB 2JV8A 2ZWFB 2ZWEB 3AWUB 2ZMZB 3AWWB 3AWVB 3AWZB 2ZWDB 1WX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX2 B;  2ZMX B;  1WXC B;  2AHK B;  3AWX B;  2AHL B;  2ZWG B;  2ZMY B;  3AX0 B;  1WX5 B;  3AWT B;  3AWY B;  3AWS B;  2JV8 A;  2ZWF B;  2ZWE B;  3AWU B;  2ZMZ B;  3AWW B;  3AWV B;  3AWZ B;  2ZWD B;  1WX4 B; 
#chains in the Genus database with same CATH topology
 3VMG A;  1WX2 B;  2ZMX B;  1WW9 A;  3VMH A;  4NBD A;  1WXC B;  2AHK B;  3AWX B;  1Z03 A;  3VMI A;  2AHL B;  4NBF A;  4NBB A;  4NBE A;  2ZWG B;  2ZMY B;  3AX0 B;  1WX5 B;  4NBG A;  3AWT B;  4NB8 A;  3AWY B;  3AWS B;  2DE6 A;  2JV8 A;  2ZWF B;  2ZWE B;  3AWU B;  4NB9 A;  2DE7 A;  1Z02 A;  2ZMZ B;  2DE5 A;  4NBH A;  3AWW B;  3AWV B;  4NBC A;  1Z01 A;  3AWZ B;  2ZWD B;  3GCF A;  4NBA A;  1WX4 B;  3GKQ A; 
#chains in the Genus database with same CATH homology
 1WX2 B;  2ZMX B;  1WXC B;  2AHK B;  3AWX B;  2AHL B;  2ZWG B;  2ZMY B;  3AX0 B;  1WX5 B;  3AWT B;  3AWY B;  3AWS B;  2JV8 A;  2ZWF B;  2ZWE B;  3AWU B;  2ZMZ B;  3AWW B;  3AWV B;  3AWZ B;  2ZWD B;  1WX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...